3VYXA

Structural insights into risc assembly facilitated by dsrna binding domains of human rna helicase (dhx9)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
95
structure length
95
Chain Sequence
b'NAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent RNA helicase A
publication title Structural insights into RISC assembly facilitated by dsRNA-binding domains of human RNA helicase A (DHX9)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
total genus 24
structure length 95
sequence length 95
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3vyxA00
4JI5E 4K0KE 2LJHA 5BR8E 2UUBE 4X65E 1XMOE 4LF5E 4GKKE 4AQYE 2F4VE 2DMYA 4JI7E 1X49A 1X47A 5LMUE 1HNWE 2VQEE 2UUAE 4LFBE 1GQEA 5LMNE 1HNZE 1J26A 2LTSA 2L33A 2RS6A 4DR5E 2NUEA 4GKJE 3OTOE 3VYXA 2ZM6E 2UXCE 2NUFA 4JV5E 2L2KB 2UUCE 2KHXA 1IBME 4B3ME 1WHNA 4JI3E 3P1XA 2NUGA 4WFTA 1FKAE 3VYYA 4LFAE 1XNRE 4DV2E 1UHZA 1RQ0A 1T4NA 2RSMA 1J5EE 1IBLE 4JI0E 1RC7A 1HNXE 2L2MA 2L2NA 4YHHE 1EKZA 1T4LB 4X8WA 4OOGC 4B3SE 2E5LE 4X62E 3T1YE 3ADLA 4X66E 4JYAE 4LF7E 2UXBE 2LUQA 2DIXA 4NXNE 4DUYE 1N32E 1N34E 4DV0E 4DV6E 3ADGA 1DI2A 2DB2A 1YYKA 1X48A 1T4OA 2RS7A 2UXDE 2B7VA 1ZBTA 1XNQE 4DR2E 1WHQA 3C4TA 4WYQB 1HR0E 3ADJA 2B7TA 4NXME 2LTRA 2MDRA 4DV4E 3HTXA 4DKKA 5IWAE 4DV5E 4M2ZA 4LF9E 4DR4E 2B3TB 4OX9E 2L3CA 2N3GA 4DUZE 2CPNA 1O0WA 4DR3E 1IBKE 2N3HA 1PKPA 2UU9E 3C4BA 1YYWA 4M30A 3J7Yp 5CFFE 4DR7E 4DV3E 4YY3E 3LLHA 2L3JA 1N33E 1UILA 1FJGE 4KHPE 1YYOA 2LRSA 3T1HE 2IHR1 2NA2A 2LBSB 2EZ6A 3ADIA 4B3RE 2YT4A 4DR6E 4DV7E 1YZ9A 4DR1E 4JI6E 2LUPB 1XMQE 4JI4E 1I94E 4X64E 4JI8E 4LF8E 2RTXA 4DV1E 4B3TE 4JI1E 2VQFE 2JY9A 4LFCE 4LF6E 1QU6A 1STUA 2JVAA 1N36E 2HHHE 4LF4E 4JI2E
chains in the Genus database with same CATH superfamily
5ADZA 2GPIA 1A1KA 4M0VA 2ENAA 1X47A 5LMUE 2K4VA 2DLKA 2N8XA 2EN8A 3MHHC 4GZNC 2HC5A 4Q35B 5LMNE 4HTGA 1TN9A 2LTSA 2EMAA 4O43A 1X3CA 2EL5A 2YU8A 1JK1A 2EJ4A 2EL6A 2YTDA 2VE7C 2UUCE 2KHXA 2ODRC 4BHBA 1MGTA 5AE3A 2NUGA 4P78A 4BCAA 2EOXA 5KL3A 3VYYA 1RQ0A 1A1GA 5A6AA 2YSOA 3F6HA 5IXMB 4IS1C 3VHTB 4X8WA 2EOEA 4B3SE 5T6JA 4TUGA 1IQOA 4JYAE 2UXBE 2LUQA 4O4KA 2JR1A 2EMFA 1N32E 2EM2A 2ELYA 2G7HA 2WZOA 3ADGA 2EOFA 1X48A 4BC9A 1EH6A 1WHQA 3KZZA 3H09A 3ADJA 2B7TA 2EM8A 1NEIA 1JK2A 2HGHA 2EPAA 5AE2A 2K7IA 4HEIA 3KWRA 2B9DA 2DSYA 2EN7A 4DUZE 1RMDA 5A6KA 1A1HA 4BMJA 2EPUA 4R2AA 4M30A 2JPAA 3J7Yp 5CFFE 3J81C 4N4RB 4YY3E 3LLHA 2L3JA 2KOUA 1UILA 3QG5C 5KL2A 4GEQB 2ENCA 2FTXB 3T1HE 2M9AA 4Q28A 4R2EA 2EZ6A 4F9AB 3C6KA 2V83A 1NCSA 4NZVA 3L00A 2EOJA 4O24A 4DR1E 2EMXA 5AC5A 2LJUA 2YTNA 3TQMA 2EMBA 4NHRA 2VQFE 2JY9A 5A6BA 3MHSC 2JVAA 1N36E 2HHHE 4LF4E 5KL5A 4JI5E 2EOMA 1YFHA 5BR8E 2UUBE 4AQYE 2F4VE 4WPYA 4R2PA 4WX9A 2ENHA 3MSWA 2EM0A 4DMIA 2EL4A 2UUAE 3EPHA 2L6MA 1PJQA 2KONA 1A1LA 2WBSA 1HNZE 5IV8B 4M9VC 5FLXC 4DR5E 2NUEA 3ECRA 2BB8A 4WSPA 2UXCE 2EOSA 2NUFA 4R03A 2L2KB 4F2JC 2EPZA 4B3ME 2EN2A 3RMPA 1N3GA 4BS9A 2DLQA 2EPMX 3K6QA 4BBYA 1Z1BA 2EN4A 5KL4A 4LFAE 1XNRE 1UHZA 2EM7A 5AE1A 3JAMC 2YWQA 1IBLE 3KZYA 2EM3A 2L2NA 1EKZA 4R2QA 1T4LB 2EN6A 4OOGC 4MLVA 4R2RA 3T1YE 4TUIA 2CT1A 2DIXA 2EQ1A 2M4IA 1N34E 4DV6E 3BBGA 4F9CB 3IWBA 1DGCA 3J7AG 3HPZA 4ZYEA 2B7VA 4DR2E 3C4TA 2EM9A 3JTZA 1GTKA 2MC5A 2LTRA 4DV4E 2YTQA 3HTXA 4DKKA 5IWAE 4RH8A 4OX9E 5A6JA 1EH7A 2MDGA 2YTPA 1PKPA 3ZOQB 2UU9E 3EQ1A 1YYWA 2PRTA 1UN6B 1BBOA 1DQ3A 2EE8A 3UK3C 2I9IA 4DV3E 3DJWA 3IWCA 4KHPE 2YTEA 2LRSA 4MLQA 2IHR1 2YT4A 4F6MA 1IMUA 5KL7A 4DV7E 4F54A 2LUPB 1XMQE 1I94E 4L5NC 1A1IA 2CSHA 1X6EA 2V89A 3J80C 2E72A 1KJKA 4DV1E 2EQ3A 2EPKX 2MC6A 3THNA 2JYAA 2ADRA 2YU5A 2EN1A 2H36X 4ZYHA 4K0KE 5TSEA 2LJHA 1XMOE 2LMZA 1PJTA 2LT7A 2DMYA 1PDAA 2JOXA 2EMIA 3OMLA 4ZYDA 1HNWE 2YPNA 1GQEA 2GLIA 4LU9A 2EOIA 2EPXA 2L33A 1F2IG 2RS6A 2EOOA 5KL6A 4GKJE 4LTYA 2I13A 2EMLA 2ZM6E 4JV5E 3M99B 5DNYA 4FK5C 2EMZA 1QNTA 2V85A 3P1XA 4WXDA 2EOZA 1LLMC 2L92A 2VRDA 2DRPA 4ZYGA 1FKAE 2EM5A 1T4NA 4BHCA 1TF6A 2RSMA 1ZU1A 5IT9C 3HXLA 1AH5A 1MEYC 2M7QA 4JI0E 3EPJA 3EPKA 1X6HA 2YSPA 4P7DA 1TF3A 1YUIA 2V8QB 4X66E 3F6GA 2EPNA 2JXPA 2LV2A 4BC7A 1WXRA 4DUYE 2LVHA 5A2QC 1YYKA 1T4OA 2UXDE 1ZBTA 1XNQE 4WYQB 1HR0E 4NXME 4DV5E 4LF9E 2A25A 4WSGA 2N3GA 2R1FA 2MKNA 2WCC3 1O0WA 2WBUA 2N3HA 2EMWA 2CTDA 1KYQA 2EQ0A 4KWYA 2L8TA 4L8NA 5AC4A 2EOQA 1SFEA 2EOYA 1T38A 2V88A 2BBGA 1FJGE 3BF2A 2HJJA 2LE2A 1YYOA 4B3RE 3ADIA 1BB8A 2EMCA 2EPPA 4R2CA 4DR6E 2DGCA 2EMYA 2EN3A 5A69A 3HQ1A 2EMGA 4JI4E 4X64E 2YTGA 1EH8A 1YSAC 2R76A 2EORA 5F3WA 2EWLA 4J8ZA 1P47A 4B3TE 2D9HA 4LFCE 4LF6E 1QU6A 1X6FA 2YTFA 4IJDA 1PJSA 4JI2E 2WBTA 5LL6R 2JOBA 1ZAAC 3DF6A 4X65E 4LF5E 4GKKE 1YPNA 2FV4B 2FGGA 4JI7E 2YRMA 1X49A 2YRKA 2LCEA 2VQEE 3IWDA 1G2FC 2EM6A 2EM4A 4LFBE 2E1MA 1J26A 3AUZA 4RHBB 4I8OA 2DMIA 1AAYA 2EPCA 3EPLA 3OTOE 3VYXA 2GHFA 2YZTA 1IBME 1ZR9A 1WHNA 2EPRA 4JI3E 2YTJA 3FIGA 4X9JA 4WFTA 2Q8UA 2EMHA 1G2DC 1UBDC 4DV2E 1L4SA 3AV0A 1J5EE 1RC7A 1GZ6A 4R2DA 1HNXE 2L2MA 2RSIA 4R8OA 2EOHA 2ODRD 3THOB 4YHHE 2JP9A 1ZBQA 2JWOA 2E5LE 1SR9A 4X62E 1T39A 1WRJA 1A1FA 3ADLA 4LF7E 4R2SA 4NXNE 3HPSA 4DV0E 2MKDA 2V87A 3VK6A 2DB2A 1DI2A 2RS7A 2V86A 2NABA 3JU0A 4KZSA 2M1SA 2VF1A 4F9BB 2YTOA 5LLQA 2MDRA 4M2ZA 4DR4E 2B3TB 2L3CA 1IQSA 2CPNA 4DR3E 1IBKE 3BIDA 4WXCA 3BGHA 4F6NA 3C4BA 4O5GA 3LMLA 2YTIA 1A1JA 4DR7E 1BBGA 1N33E 2EPLX 2EPOA 1X5WA 2F8BA 2NA2A 2LBSB 2YRHA 3C6MA 1YZ9A 5A6BD 2RQLA 4JI6E 4JI8E 4LF8E 2LO3A 2RTXA 1YUJA 5AASA 1WJPA 4JI1E 2ELZA 2EP3A 1STUA 1B69A 2J7JA 2RPCA 2EMKA
chains in the Genus database with same CATH topology
4JI5E 5LL6R 4K0KE 2JOBA 2LJHA 5BR8E 2UUBE 3DF6A 4X65E 1XMOE 4LF5E 4GKKE 2FV4B 2LMZA 4WPYA 5ADZA 2DMYA 4AQYE 2F4VE 2JOXA 2FGGA 3OMLA 4M0VA 4JI7E 1X49A 1X47A 3MSWA 5LMUE 1HNWE 4DMIA 2VQEE 3IWDA 2UUAE 2K4VA 2L6MA 4LFBE 2KONA 1GQEA 1YYKA 2E1MA 4LU9A 5LMNE 1HNZE 3AUZA 1J26A 2LTSA 4I8OA 2L33A 2RS6A 5FLXC 4DR5E 2NUEA 4GKJE 4LTYA 3OTOE 3VYXA 4WSPA 2ZM6E 2NUFA 5DNYA 4JV5E 2UXCE 4R03A 2L2KB 2VE7C 2YZTA 2UUCE 2KHXA 2ODRC 1IBME 5AE3A 1WHNA 2V85A 3RMPA 3P1XA 4B3ME 4JI3E 4BS9A 2NUGA 4P78A 4BCAA 3K6QA 4BBYA 3FIGA 2L92A 4WFTA 1FKAE 3VYYA 4LFAE 1XNRE 4DV2E 1UHZA 5AE1A 1RQ0A 1T4NA 2RSMA 3AV0A 3JAMC 5IT9C 3HXLA 2M7QA 1J5EE 1IBLE 4JI0E 3F6HA 1RC7A 1GZ6A 1HNXE 2L2MA 2L2NA 4R8OA 4YHHE 2ODRD 1T4LB 4X8WA 1EKZA 4OOGC 4B3SE 1ZBQA 2JWOA 5T6JA 1SR9A 4X62E 2E5LE 4P7DA 4TUGA 3T1YE 2V8QB 3ADLA 4X66E 4TUIA 4LF7E 4JYAE 2LUQA 3F6GA 2UXBE 2JR1A 2DIXA 4BC7A 1WXRA 4NXNE 2M4IA 3HPSA 4DUYE 1N32E 5A2QC 4DV0E 4DV6E 2G7HA 2V87A 2WZOA 2DB2A 3ADGA 3VK6A 1X48A 1T4OA 2RS7A 2V86A 3IWBA 3HPZA 3JU0A 4F9CB 3J7AG 2UXDE 4KZSA 2B7VA 2M1SA 1ZBTA 2VF1A 4F9BB 4BC9A 1XNQE 4DR2E 1WHQA 3C4TA 4WYQB 1HR0E 3H09A 3JTZA 2MC5A 3ADJA 2B7TA 4NXME 2LTRA 2MDRA 4DV4E 3HTXA 4DKKA 5AE2A 5IWAE 4DV5E 4LF9E 4M2ZA 4DR4E 2B3TB 2B9DA 3KWRA 2L3CA 4OX9E 2DSYA 2N3GA 1DI2A 4DUZE 2CPNA 1N34E 1O0WA 4DR3E 1IBKE 2N3HA 4BMJA 1PKPA 3ZOQB 2UU9E 3C4BA 1YYWA 4M30A 2L8TA 1DQ3A 3LMLA 4L8NA 3J7Yp 5CFFE 3J81C 4DR7E 4DV3E 4YY3E 3LLHA 2L3JA 2V88A 2KOUA 1UILA 1N33E 1FJGE 3DJWA 3IWCA 4GEQB 4KHPE 2F8BA 2LE2A 1YYOA 2FTXB 2LRSA 3T1HE 2IHR1 2NA2A 4Q28A 2LBSB 2EZ6A 3ADIA 4B3RE 4F9AB 2YT4A 4DR6E 2V83A 4DV7E 3HQ1A 1YZ9A 4DR1E 4JI6E 4F54A 2LUPB 1XMQE 4JI4E 1I94E 4L5NC 4X64E 2V89A 4JI8E 3J80C 4LF8E 2RTXA 4DV1E 2EWLA 5F3WA 2MC6A 4J8ZA 5AASA 4B3TE 4JI1E 2VQFE 2JY9A 4LFCE 4LF6E 1QU6A 1STUA 2H36X 2JVAA 1N36E 2HHHE 4LF4E 4JI2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 E;  4K0K E;  2LJH A;  5BR8 E;  2UUB E;  4X65 E;  1XMO E;  4LF5 E;  4GKK E;  4AQY E;  2F4V E;  2DMY A;  4JI7 E;  1X49 A;  1X47 A;  5LMU E;  1HNW E;  2VQE E;  2UUA E;  4LFB E;  1GQE A;  5LMN E;  1HNZ E;  1J26 A;  2LTS A;  2L33 A;  2RS6 A;  4DR5 E;  2NUE A;  4GKJ E;  3OTO E;  3VYX A;  2ZM6 E;  2UXC E;  2NUF A;  4JV5 E;  2L2K B;  2UUC E;  2KHX A;  1IBM E;  4B3M E;  1WHN A;  4JI3 E;  3P1X A;  2NUG A;  4WFT A;  1FKA E;  3VYY A;  4LFA E;  1XNR E;  4DV2 E;  1UHZ A;  1RQ0 A;  1T4N A;  2RSM A;  1J5E E;  1IBL E;  4JI0 E;  1RC7 A;  1HNX E;  2L2M A;  2L2N A;  4YHH E;  1EKZ A;  1T4L B;  4X8W A;  4OOG C;  4B3S E;  2E5L E;  4X62 E;  3T1Y E;  3ADL A;  4X66 E;  4JYA E;  4LF7 E;  2UXB E;  2LUQ A;  2DIX A;  4NXN E;  4DUY E;  1N32 E;  1N34 E;  4DV0 E;  4DV6 E;  3ADG A;  1DI2 A;  2DB2 A;  1YYK A;  1X48 A;  1T4O A;  2RS7 A;  2UXD E;  2B7V A;  1ZBT A;  1XNQ E;  4DR2 E;  1WHQ A;  3C4T A;  4WYQ B;  1HR0 E;  3ADJ A;  2B7T A;  4NXM E;  2LTR A;  2MDR A;  4DV4 E;  3HTX A;  4DKK A;  5IWA E;  4DV5 E;  4M2Z A;  4LF9 E;  4DR4 E;  2B3T B;  4OX9 E;  2L3C A;  2N3G A;  4DUZ E;  2CPN A;  1O0W A;  4DR3 E;  1IBK E;  2N3H A;  1PKP A;  2UU9 E;  3C4B A;  1YYW A;  4M30 A;  3J7Y p;  5CFF E;  4DR7 E;  4DV3 E;  4YY3 E;  3LLH A;  2L3J A;  1N33 E;  1UIL A;  1FJG E;  4KHP E;  1YYO A;  2LRS A;  3T1H E;  2IHR 1;  2NA2 A;  2LBS B;  2EZ6 A;  3ADI A;  4B3R E;  2YT4 A;  4DR6 E;  4DV7 E;  1YZ9 A;  4DR1 E;  4JI6 E;  2LUP B;  1XMQ E;  4JI4 E;  1I94 E;  4X64 E;  4JI8 E;  4LF8 E;  2RTX A;  4DV1 E;  4B3T E;  4JI1 E;  2VQF E;  2JY9 A;  4LFC E;  4LF6 E;  1QU6 A;  1STU A;  2JVA A;  1N36 E;  2HHH E;  4LF4 E;  4JI2 E; 
#chains in the Genus database with same CATH topology
 5ADZ A;  2GPI A;  1A1K A;  4M0V A;  2ENA A;  1X47 A;  5LMU E;  2K4V A;  2DLK A;  2N8X A;  2EN8 A;  3MHH C;  4GZN C;  2HC5 A;  4Q35 B;  5LMN E;  4HTG A;  1TN9 A;  2LTS A;  2EMA A;  4O43 A;  1X3C A;  2EL5 A;  2YU8 A;  1JK1 A;  2EJ4 A;  2EL6 A;  2YTD A;  2VE7 C;  2UUC E;  2KHX A;  2ODR C;  4BHB A;  1MGT A;  5AE3 A;  2NUG A;  4P78 A;  4BCA A;  2EOX A;  5KL3 A;  3VYY A;  1RQ0 A;  1A1G A;  5A6A A;  2YSO A;  3F6H A;  5IXM B;  4IS1 C;  3VHT B;  4X8W A;  2EOE A;  4B3S E;  5T6J A;  4TUG A;  1IQO A;  4JYA E;  2UXB E;  2LUQ A;  4O4K A;  2JR1 A;  2EMF A;  1N32 E;  2EM2 A;  2ELY A;  2G7H A;  2WZO A;  3ADG A;  2EOF A;  1X48 A;  4BC9 A;  1EH6 A;  1WHQ A;  3KZZ A;  3H09 A;  3ADJ A;  2B7T A;  2EM8 A;  1NEI A;  1JK2 A;  2HGH A;  2EPA A;  5AE2 A;  2K7I A;  4HEI A;  3KWR A;  2B9D A;  2DSY A;  2EN7 A;  4DUZ E;  1RMD A;  5A6K A;  1A1H A;  4BMJ A;  2EPU A;  4R2A A;  4M30 A;  2JPA A;  3J7Y p;  5CFF E;  3J81 C;  4N4R B;  4YY3 E;  3LLH A;  2L3J A;  2KOU A;  1UIL A;  3QG5 C;  5KL2 A;  4GEQ B;  2ENC A;  2FTX B;  3T1H E;  2M9A A;  4Q28 A;  4R2E A;  2EZ6 A;  4F9A B;  3C6K A;  2V83 A;  1NCS A;  4NZV A;  3L00 A;  2EOJ A;  4O24 A;  4DR1 E;  2EMX A;  5AC5 A;  2LJU A;  2YTN A;  3TQM A;  2EMB A;  4NHR A;  2VQF E;  2JY9 A;  5A6B A;  3MHS C;  2JVA A;  1N36 E;  2HHH E;  4LF4 E;  5KL5 A;  4JI5 E;  2EOM A;  1YFH A;  5BR8 E;  2UUB E;  4AQY E;  2F4V E;  4WPY A;  4R2P A;  4WX9 A;  2ENH A;  3MSW A;  2EM0 A;  4DMI A;  2EL4 A;  2UUA E;  3EPH A;  2L6M A;  1PJQ A;  2KON A;  1A1L A;  2WBS A;  1HNZ E;  5IV8 B;  4M9V C;  5FLX C;  4DR5 E;  2NUE A;  3ECR A;  2BB8 A;  4WSP A;  2UXC E;  2EOS A;  2NUF A;  4R03 A;  2L2K B;  4F2J C;  2EPZ A;  4B3M E;  2EN2 A;  3RMP A;  1N3G A;  4BS9 A;  2DLQ A;  2EPM X;  3K6Q A;  4BBY A;  1Z1B A;  2EN4 A;  5KL4 A;  4LFA E;  1XNR E;  1UHZ A;  2EM7 A;  5AE1 A;  3JAM C;  2YWQ A;  1IBL E;  3KZY A;  2EM3 A;  2L2N A;  1EKZ A;  4R2Q A;  1T4L B;  2EN6 A;  4OOG C;  4MLV A;  4R2R A;  3T1Y E;  4TUI A;  2CT1 A;  2DIX A;  2EQ1 A;  2M4I A;  1N34 E;  4DV6 E;  3BBG A;  4F9C B;  3IWB A;  1DGC A;  3J7A G;  3HPZ A;  4ZYE A;  2B7V A;  4DR2 E;  3C4T A;  2EM9 A;  3JTZ A;  1GTK A;  2MC5 A;  2LTR A;  4DV4 E;  2YTQ A;  3HTX A;  4DKK A;  5IWA E;  4RH8 A;  4OX9 E;  5A6J A;  1EH7 A;  2MDG A;  2YTP A;  1PKP A;  3ZOQ B;  2UU9 E;  3EQ1 A;  1YYW A;  2PRT A;  1UN6 B;  1BBO A;  1DQ3 A;  2EE8 A;  3UK3 C;  2I9I A;  4DV3 E;  3DJW A;  3IWC A;  4KHP E;  2YTE A;  2LRS A;  4MLQ A;  2IHR 1;  2YT4 A;  4F6M A;  1IMU A;  5KL7 A;  4DV7 E;  4F54 A;  2LUP B;  1XMQ E;  1I94 E;  4L5N C;  1A1I A;  2CSH A;  1X6E A;  2V89 A;  3J80 C;  2E72 A;  1KJK A;  4DV1 E;  2EQ3 A;  2EPK X;  2MC6 A;  3THN A;  2JYA A;  2ADR A;  2YU5 A;  2EN1 A;  2H36 X;  4ZYH A;  4K0K E;  5TSE A;  2LJH A;  1XMO E;  2LMZ A;  1PJT A;  2LT7 A;  2DMY A;  1PDA A;  2JOX A;  2EMI A;  3OML A;  4ZYD A;  1HNW E;  2YPN A;  1GQE A;  2GLI A;  4LU9 A;  2EOI A;  2EPX A;  2L33 A;  1F2I G;  2RS6 A;  2EOO A;  5KL6 A;  4GKJ E;  4LTY A;  2I13 A;  2EML A;  2ZM6 E;  4JV5 E;  3M99 B;  5DNY A;  4FK5 C;  2EMZ A;  1QNT A;  2V85 A;  3P1X A;  4WXD A;  2EOZ A;  1LLM C;  2L92 A;  2VRD A;  2DRP A;  4ZYG A;  1FKA E;  2EM5 A;  1T4N A;  4BHC A;  1TF6 A;  2RSM A;  1ZU1 A;  5IT9 C;  3HXL A;  1AH5 A;  1MEY C;  2M7Q A;  4JI0 E;  3EPJ A;  3EPK A;  1X6H A;  2YSP A;  4P7D A;  1TF3 A;  1YUI A;  2V8Q B;  4X66 E;  3F6G A;  2EPN A;  2JXP A;  2LV2 A;  4BC7 A;  1WXR A;  4DUY E;  2LVH A;  5A2Q C;  1YYK A;  1T4O A;  2UXD E;  1ZBT A;  1XNQ E;  4WYQ B;  1HR0 E;  4NXM E;  4DV5 E;  4LF9 E;  2A25 A;  4WSG A;  2N3G A;  2R1F A;  2MKN A;  2WCC 3;  1O0W A;  2WBU A;  2N3H A;  2EMW A;  2CTD A;  1KYQ A;  2EQ0 A;  4KWY A;  2L8T A;  4L8N A;  5AC4 A;  2EOQ A;  1SFE A;  2EOY A;  1T38 A;  2V88 A;  2BBG A;  1FJG E;  3BF2 A;  2HJJ A;  2LE2 A;  1YYO A;  4B3R E;  3ADI A;  1BB8 A;  2EMC A;  2EPP A;  4R2C A;  4DR6 E;  2DGC A;  2EMY A;  2EN3 A;  5A69 A;  3HQ1 A;  2EMG A;  4JI4 E;  4X64 E;  2YTG A;  1EH8 A;  1YSA C;  2R76 A;  2EOR A;  5F3W A;  2EWL A;  4J8Z A;  1P47 A;  4B3T E;  2D9H A;  4LFC E;  4LF6 E;  1QU6 A;  1X6F A;  2YTF A;  4IJD A;  1PJS A;  4JI2 E;  2WBT A;  5LL6 R;  2JOB A;  1ZAA C;  3DF6 A;  4X65 E;  4LF5 E;  4GKK E;  1YPN A;  2FV4 B;  2FGG A;  4JI7 E;  2YRM A;  1X49 A;  2YRK A;  2LCE A;  2VQE E;  3IWD A;  1G2F C;  2EM6 A;  2EM4 A;  4LFB E;  2E1M A;  1J26 A;  3AUZ A;  4RHB B;  4I8O A;  2DMI A;  1AAY A;  2EPC A;  3EPL A;  3OTO E;  3VYX A;  2GHF A;  2YZT A;  1IBM E;  1ZR9 A;  1WHN A;  2EPR A;  4JI3 E;  2YTJ A;  3FIG A;  4X9J A;  4WFT A;  2Q8U A;  2EMH A;  1G2D C;  1UBD C;  4DV2 E;  1L4S A;  3AV0 A;  1J5E E;  1RC7 A;  1GZ6 A;  4R2D A;  1HNX E;  2L2M A;  2RSI A;  4R8O A;  2EOH A;  2ODR D;  3THO B;  4YHH E;  2JP9 A;  1ZBQ A;  2JWO A;  2E5L E;  1SR9 A;  4X62 E;  1T39 A;  1WRJ A;  1A1F A;  3ADL A;  4LF7 E;  4R2S A;  4NXN E;  3HPS A;  4DV0 E;  2MKD A;  2V87 A;  3VK6 A;  2DB2 A;  1DI2 A;  2RS7 A;  2V86 A;  2NAB A;  3JU0 A;  4KZS A;  2M1S A;  2VF1 A;  4F9B B;  2YTO A;  5LLQ A;  2MDR A;  4M2Z A;  4DR4 E;  2B3T B;  2L3C A;  1IQS A;  2CPN A;  4DR3 E;  1IBK E;  3BID A;  4WXC A;  3BGH A;  4F6N A;  3C4B A;  4O5G A;  3LML A;  2YTI A;  1A1J A;  4DR7 E;  1BBG A;  1N33 E;  2EPL X;  2EPO A;  1X5W A;  2F8B A;  2NA2 A;  2LBS B;  2YRH A;  3C6M A;  1YZ9 A;  5A6B D;  2RQL A;  4JI6 E;  4JI8 E;  4LF8 E;  2LO3 A;  2RTX A;  1YUJ A;  5AAS A;  1WJP A;  4JI1 E;  2ELZ A;  2EP3 A;  1STU A;  1B69 A;  2J7J A;  2RPC A;  2EMK A; 
#chains in the Genus database with same CATH homology
 4JI5 E;  5LL6 R;  4K0K E;  2JOB A;  2LJH A;  5BR8 E;  2UUB E;  3DF6 A;  4X65 E;  1XMO E;  4LF5 E;  4GKK E;  2FV4 B;  2LMZ A;  4WPY A;  5ADZ A;  2DMY A;  4AQY E;  2F4V E;  2JOX A;  2FGG A;  3OML A;  4M0V A;  4JI7 E;  1X49 A;  1X47 A;  3MSW A;  5LMU E;  1HNW E;  4DMI A;  2VQE E;  3IWD A;  2UUA E;  2K4V A;  2L6M A;  4LFB E;  2KON A;  1GQE A;  1YYK A;  2E1M A;  4LU9 A;  5LMN E;  1HNZ E;  3AUZ A;  1J26 A;  2LTS A;  4I8O A;  2L33 A;  2RS6 A;  5FLX C;  4DR5 E;  2NUE A;  4GKJ E;  4LTY A;  3OTO E;  3VYX A;  4WSP A;  2ZM6 E;  2NUF A;  5DNY A;  4JV5 E;  2UXC E;  4R03 A;  2L2K B;  2VE7 C;  2YZT A;  2UUC E;  2KHX A;  2ODR C;  1IBM E;  5AE3 A;  1WHN A;  2V85 A;  3RMP A;  3P1X A;  4B3M E;  4JI3 E;  4BS9 A;  2NUG A;  4P78 A;  4BCA A;  3K6Q A;  4BBY A;  3FIG A;  2L92 A;  4WFT A;  1FKA E;  3VYY A;  4LFA E;  1XNR E;  4DV2 E;  1UHZ A;  5AE1 A;  1RQ0 A;  1T4N A;  2RSM A;  3AV0 A;  3JAM C;  5IT9 C;  3HXL A;  2M7Q A;  1J5E E;  1IBL E;  4JI0 E;  3F6H A;  1RC7 A;  1GZ6 A;  1HNX E;  2L2M A;  2L2N A;  4R8O A;  4YHH E;  2ODR D;  1T4L B;  4X8W A;  1EKZ A;  4OOG C;  4B3S E;  1ZBQ A;  2JWO A;  5T6J A;  1SR9 A;  4X62 E;  2E5L E;  4P7D A;  4TUG A;  3T1Y E;  2V8Q B;  3ADL A;  4X66 E;  4TUI A;  4LF7 E;  4JYA E;  2LUQ A;  3F6G A;  2UXB E;  2JR1 A;  2DIX A;  4BC7 A;  1WXR A;  4NXN E;  2M4I A;  3HPS A;  4DUY E;  1N32 E;  5A2Q C;  4DV0 E;  4DV6 E;  2G7H A;  2V87 A;  2WZO A;  2DB2 A;  3ADG A;  3VK6 A;  1X48 A;  1T4O A;  2RS7 A;  2V86 A;  3IWB A;  3HPZ A;  3JU0 A;  4F9C B;  3J7A G;  2UXD E;  4KZS A;  2B7V A;  2M1S A;  1ZBT A;  2VF1 A;  4F9B B;  4BC9 A;  1XNQ E;  4DR2 E;  1WHQ A;  3C4T A;  4WYQ B;  1HR0 E;  3H09 A;  3JTZ A;  2MC5 A;  3ADJ A;  2B7T A;  4NXM E;  2LTR A;  2MDR A;  4DV4 E;  3HTX A;  4DKK A;  5AE2 A;  5IWA E;  4DV5 E;  4LF9 E;  4M2Z A;  4DR4 E;  2B3T B;  2B9D A;  3KWR A;  2L3C A;  4OX9 E;  2DSY A;  2N3G A;  1DI2 A;  4DUZ E;  2CPN A;  1N34 E;  1O0W A;  4DR3 E;  1IBK E;  2N3H A;  4BMJ A;  1PKP A;  3ZOQ B;  2UU9 E;  3C4B A;  1YYW A;  4M30 A;  2L8T A;  1DQ3 A;  3LML A;  4L8N A;  3J7Y p;  5CFF E;  3J81 C;  4DR7 E;  4DV3 E;  4YY3 E;  3LLH A;  2L3J A;  2V88 A;  2KOU A;  1UIL A;  1N33 E;  1FJG E;  3DJW A;  3IWC A;  4GEQ B;  4KHP E;  2F8B A;  2LE2 A;  1YYO A;  2FTX B;  2LRS A;  3T1H E;  2IHR 1;  2NA2 A;  4Q28 A;  2LBS B;  2EZ6 A;  3ADI A;  4B3R E;  4F9A B;  2YT4 A;  4DR6 E;  2V83 A;  4DV7 E;  3HQ1 A;  1YZ9 A;  4DR1 E;  4JI6 E;  4F54 A;  2LUP B;  1XMQ E;  4JI4 E;  1I94 E;  4L5N C;  4X64 E;  2V89 A;  4JI8 E;  3J80 C;  4LF8 E;  2RTX A;  4DV1 E;  2EWL A;  5F3W A;  2MC6 A;  4J8Z A;  5AAS A;  4B3T E;  4JI1 E;  2VQF E;  2JY9 A;  4LFC E;  4LF6 E;  1QU6 A;  1STU A;  2H36 X;  2JVA A;  1N36 E;  2HHH E;  4LF4 E;  4JI2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...