3VYXA

Structural insights into risc assembly facilitated by dsrna binding domains of human rna helicase (dhx9)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
95
structure length
95
Chain Sequence
NAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into RISC assembly facilitated by dsRNA-binding domains of human RNA helicase A (DHX9)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
molecule keywords ATP-dependent RNA helicase A
total genus 24
structure length 95
sequence length 95
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3vyxA00
1FKAE 2NA2A 2UUBE 2VQEE 4LF6E 3ADGA 4OX9E 5BR8E 4DR6E 1J26A 1N33E 4YHHE 4X65E 1T4LB 4WFTA 2RS7A 1N34E 4DUZE 4M2ZA 4JI2E 2IHR1 3VYXA 1N36E 2N3HA 4WYQB 4X62E 1HNZE 1XNQE 4KHPE 2ZM6E 4JI5E 1T4NA 1PKPA 4LF9E 4JV5E 1YYWA 2LBSB 1ZBTA 2LJHA 1HNXE 1YZ9A 2NUGA 1HNWE 2HHHE 3ADLA 4JI7E 4NXNE 4DR4E 2RTXA 2KHXA 4NXME 4DR3E 2L3JA 4B3TE 4DV2E 1WHQA 2L3CA 2JY9A 2LUQA 4DKKA 4DUYE 3C4BA 4B3SE 4LFCE 2NUFA 2UUAE 4DV3E 4JYAE 4LF7E 4AQYE 2LUPB 3C4TA 1X49A 4DV6E 4DV0E 2EZ6A 4DV7E 2NUEA 1YYOA 1IBLE 4DR2E 1UILA 4LFAE 2E5LE 4GKKE 4DV1E 1X47A 2L2KB 1HR0E 2DB2A 2UU9E 4JI6E 4X66E 1FJGE 2MDRA 4DR5E 2DIXA 3ADJA 1WHNA 2F4VE 4X8WA 3T1YE 4B3RE 4LF5E 4DV5E 4YY3E 2UXDE 5LMNE 4JI3E 5IWAE 4M30A 5CFFE 2JVAA 2LTRA 2RSMA 3J7Yp 2L33A 4K0KE 3ADIA 3HTXA 1STUA 1XMOE 1GQEA 1RQ0A 1XMQE 1UHZA 3T1HE 1YYKA 4GKJE 2UXCE 3P1XA 4JI8E 3LLHA 2CPNA 2B7VA 1O0WA 2LRSA 1RC7A 4JI4E 4LF8E 1DI2A 2RS6A 4DV4E 4DR1E 2YT4A 3OTOE 2L2NA 1J5EE 1IBME 4JI0E 1I94E 4LF4E 2UUCE 1XNRE 2UXBE 2B3TB 4JI1E 2N3GA 1IBKE 2B7TA 2DMYA 4LFBE 1N32E 2VQFE 4X64E 4DR7E 3VYYA 1EKZA 1X48A 2L2MA 4B3ME 2LTSA 4OOGC 1QU6A 1T4OA 5LMUE
chains in the Genus database with same CATH superfamily
1FKAE 2HGHA 4LF6E 1J26A 5BR8E 2N8XA 2EMXA 3FIGA 4WFTA 2HJJA 4M2ZA 4JI2E 4WYQB 1X6EA 2EOXA 4JI5E 2WCC3 1PKPA 5DNYA 2YTQA 2ELZA 2V8QB 4O24A 3RMPA 4JV5E 1HNXE 1YZ9A 4BC9A 2EM5A 1A1JA 1B69A 4N4RB 4NXNE 2MC5A 2EM4A 2KHXA 3HPSA 2L3JA 4DV2E 5AC5A 2EMBA 3F6GA 4B3SE 4LFCE 2LT7A 4BHBA 2UUAE 2EOFA 2L8TA 2LJUA 4AQYE 1G2DC 2EMYA 1EH6A 5KL5A 2F8BA 2YZTA 1X6FA 4WX9A 1A1KA 2EZ6A 4L5NC 1YYOA 1IBLE 5KL4A 1X47A 3EPKA 4ZYDA 4R2SA 2EPRA 3QG5C 4DR5E 2LV2A 2DIXA 1WHNA 2JP9A 2A25A 4X8WA 4ZYHA 2LMZA 5A69A 1ZBQA 3F6HA 4YY3E 4R2PA 4JI3E 4M0VA 1A1IA 2CSHA 1JK1A 1RMDA 1ZU1A 2EMIA 2EPLX 2RSMA 2LO3A 3J7Yp 4K0KE 2DLKA 2VE7C 3HXLA 3HTXA 1XMOE 1GQEA 1UHZA 2L92A 5IV8B 4GKJE 3BBGA 1TF6A 2YRKA 4BC7A 1BBOA 4LF8E 1DI2A 2RS6A 2DLQA 2MC6A 2UUCE 4FK5C 4BBYA 1YPNA 2YTJA 2EOOA 2WZOA 3VHTB 2YTPA 2VQFE 4X64E 2EOEA 2EPZA 1EKZA 4R2AA 4Q28A 1YSAC 1X3CA 1QU6A 1T4OA 4NHRA 4NXME 2RQLA 2VQEE 4R2CA 4P78A 1T39A 3KZYA 3IWBA 5AASA 2RS7A 4DUZE 1G2FC 2V88A 2EJ4A 4DMIA 1F2IG 1WRJA 1X6HA 3DF6A 1N36E 2N3HA 1XNQE 4J8ZA 2M9AA 2LCEA 3THOB 2EL6A 4ZYGA 2ZM6E 2EPOA 3L00A 1YUIA 5KL2A 2GHFA 4TUGA 3J7AG 5A2QC 1PDAA 2V85A 4I8OA 3HQ1A 2EMGA 1HNWE 4WSPA 1TF3A 4JI7E 2YU5A 2FV4B 2CTDA 1SFEA 4DKKA 3KWRA 1BB8A 2EM2A 2YRHA 2ELYA 2EQ3A 1X49A 4DV0E 2Q8UA 3K6QA 3BIDA 2EPMX 1X5WA 4KWYA 1NCSA 4LFAE 4F6MA 2WBUA 3TQMA 2L2KB 1SR9A 2EMWA 2MDRA 3ADJA 1A1FA 1N3GA 2V89A 4ZYEA 4B3RE 5ADZA 2EOSA 4DV5E 2I9IA 5LMNE 2H36X 4O43A 4M30A 5CFFE 1PJQA 2EPKX 2LTRA 2V83A 2YTNA 5FLXC 4X9JA 4F54A 5A6AA 2EPNA 4R2QA 3T1HE 4TUIA 1YYKA 4RH8A 4BMJA 2EOQA 4JI8E 3EPHA 2B7VA 4JI4E 2EN1A 1MEYC 1AH5A 4GZNC 4DR1E 2DGCA 4F9BB 4LF4E 2E72A 4WPYA 2B3TB 4WXCA 2EORA 2JWOA 1A1GA 4Q35B 4NZVA 1WJPA 1N32E 3VYYA 4KZSA 5AE1A 2L2MA 4B3ME 2EMLA 4OOGC 4O5GA 4MLVA 2NA2A 2YTDA 2EMKA 4OX9E 4R8OA 3JAMC 2KONA 4YHHE 4F9AB 1MGTA 4X65E 2EM6A 1LLMC 4IS1C 2YTEA 1T4LB 2CT1A 5IT9C 2M7QA 4R03A 2IHR1 3VYXA 2DSYA 5T6JA 4X62E 1BBGA 4KHPE 2I13A 2B9DA 3AUZA 2EE8A 5KL3A 2DMIA 4BHCA 4LF9E 2GLIA 1YYWA 2J7JA 2LBSB 1ZBTA 1T38A 2LJHA 4RHBB 4DR4E 2EM7A 2ENHA 4DR3E 2L3CA 3ECRA 5A6BD 3M99B 2EN8A 5A6KA 3H09A 2D9HA 4DV3E 2L6MA 2EPPA 2WBSA 4LF7E 2LUPB 3C4TA 4MLQA 5KL7A 2RSIA 2EN4A 2JR1A 4WSGA 4DV7E 2NUEA 2EOIA 2EMHA 5A6BA 2ENAA 1UILA 2E5LE 5LLQA 4GKKE 4DV1E 2FTXB 1PJSA 3JU0A 4L8NA 1HR0E 2DB2A 3VK6A 2YTOA 3IWCA 5AE2A 2KOUA 4R2EA 2RPCA 3THNA 3KZZA 1DGCA 3T1YE 1QNTA 2ADRA 4LF5E 1IQSA 2EOHA 1WXRA 2EPAA 5TSEA 2EMCA 2FGGA 2EQ1A 2EOYA 4LU9A 2L33A 2WBTA 4R2DA 2YSPA 3ADIA 2EOJA 1GTKA 2YTGA 2JXPA 3LMLA 3ZOQB 1RQ0A 1XMQE 4P7DA 2UXCE 3P1XA 3LLHA 2EN2A 2EN7A 1O0WA 1RC7A 2YSOA 4HEIA 2YT4A 2L2NA 1IBME 5A6JA 1I94E 1XNRE 4JI1E 1IBKE 2BB8A 1KYQA 2YTIA 2ODRC 2YTFA 3MSWA 4DR7E 2G7HA 1GZ6A 1IMUA 5AC4A 3MHHC 1P47A 2EL4A 2UUBE 2EL5A 2HC5A 4DR6E 3ADGA 2YWQA 3IWDA 3OMLA 4M9VC 1N33E 2LE2A 5LL6R 3J80C 1N34E 2ODRD 2DRPA 3EPLA 4O4KA 5KL6A 1HNZE 5AE3A 4LTYA 1IQOA 1A1HA 1KJKA 2LVHA 2YU8A 1T4NA 2MKNA 2EWLA 2V87A 1EH8A 2EQ0A 5F3WA 2ENCA 2NUGA 3BGHA 2HHHE 2EPUA 3ADLA 2RTXA 3MHSC 2M1SA 4B3TE 2EMAA 1WHQA 1A1LA 2JY9A 2VRDA 2LUQA 2EM0A 4DUYE 3C4BA 1UN6B 4BS9A 2R76A 2JPAA 2NUFA 2YRMA 4JYAE 2JYAA 3C6MA 1TN9A 4DV6E 2EPCA 2EP3A 1L4SA 2MDGA 4DR2E 1JK2A 1UBDC 2E1MA 4R2RA 1ZR9A 2V86A 3HPZA 2K4VA 2UU9E 4JI6E 4X66E 1FJGE 2EM8A 2F4VE 3J81C 3UK3C 2EMZA 1ZAAC 4HTGA 2UXDE 2VF1A 2EOZA 5IWAE 3EPJA 2NABA 2JVAA 4WXDA 2EM9A 2EN6A 1Z1BA 3DJWA 3JTZA 2PRTA 1STUA 2EOMA 5IXMB 1AAYA 1DQ3A 2CPNA 2LRSA 1YFHA 2BBGA 1YUJA 2EM3A 4F2JC 4DV4E 4GEQB 3OTOE 1J5EE 4JI0E 2K7IA 4BCAA 4F9CB 1NEIA 2UXBE 3BF2A 2GPIA 4IJDA 2N3GA 3C6KA 1EH7A 2B7TA 2DMYA 4F6NA 1PJTA 2EN3A 4LFBE 3AV0A 2MKDA 1X48A 2JOXA 2EMFA 2M4IA 2EPXA 2LTSA 2R1FA 2JOBA 3EQ1A 5LMUE 2YPNA
chains in the Genus database with same CATH topology
1FKAE 2NA2A 2UUBE 2VQEE 4LF6E 3ADGA 4R8OA 5BR8E 3IWDA 3JAMC 4OX9E 4DR6E 1J26A 2KONA 3OMLA 1N33E 4P78A 4YHHE 4F9AB 2LE2A 4X65E 5LL6R 3FIGA 3IWBA 1T4LB 3J80C 4WFTA 5AASA 2RS7A 1N34E 4DUZE 2V88A 2ODRD 4DMIA 4JV5E 4M2ZA 4JI2E 5IT9C 2M7QA 4R03A 3DF6A 2IHR1 3VYXA 2DSYA 1N36E 2N3HA 4WYQB 5T6JA 4J8ZA 4X62E 1HNZE 1XNQE 4KHPE 5AE3A 2ZM6E 4LTYA 4JI5E 2B9DA 3AUZA 1T4NA 4TUGA 1PKPA 3J7AG 5DNYA 3RMPA 2V8QB 2EWLA 4LF9E 1YYWA 5A2QC 2LBSB 2V87A 1ZBTA 2V85A 4I8OA 3HQ1A 2LJHA 5F3WA 1HNXE 1YZ9A 4BC9A 2HHHE 2NUGA 4WSPA 1HNWE 3ADLA 4JI7E 4NXNE 4DR4E 2MC5A 2RTXA 2KHXA 4NXME 2FV4B 3HPSA 4DR3E 2M1SA 2L3JA 4B3TE 4DV2E 1WHQA 2L3CA 2JY9A 2LUQA 3F6GA 4DKKA 4DUYE 3KWRA 3C4BA 4B3SE 4LFCE 4BS9A 3H09A 2NUFA 2UUAE 4DV3E 2L6MA 2L8TA 4JYAE 4LF7E 4AQYE 2LUPB 3C4TA 1X49A 4DV6E 4DV0E 2F8BA 3K6QA 2YZTA 2JR1A 2EZ6A 4DV7E 2NUEA 4L5NC 1YYOA 1IBLE 4DR2E 1UILA 4LFAE 2E5LE 4GKKE 2E1MA 4DV1E 2V86A 3HPZA 2FTXB 1X47A 3JU0A 4L8NA 2L2KB 2K4VA 2DB2A 3VK6A 1HR0E 2UU9E 4JI6E 3IWCA 5AE2A 2KOUA 4X66E 1FJGE 1SR9A 2MDRA 4DR5E 2DIXA 3ADJA 1WHNA 2F4VE 4X8WA 2LMZA 2V89A 3T1YE 3J81C 4B3RE 5ADZA 1ZBQA 3F6HA 4LF5E 4DV5E 4YY3E 2UXDE 2VF1A 5LMNE 1WXRA 2H36X 5IWAE 4JI3E 4M30A 4M0VA 5CFFE 2JVAA 2FGGA 2LTRA 2RSMA 4LU9A 3J7Yp 2L33A 2V83A 4K0KE 3DJWA 2VE7C 3HXLA 3ADIA 3JTZA 5FLXC 3HTXA 4F54A 1STUA 1XMOE 3LMLA 1GQEA 3ZOQB 1RQ0A 1XMQE 1UHZA 4P7DA 4TUIA 2L92A 4BMJA 3T1HE 1YYKA 4GKJE 2UXCE 1DQ3A 3P1XA 4JI8E 3LLHA 2B7VA 2CPNA 1O0WA 2LRSA 4BC7A 1RC7A 4JI4E 4LF8E 1DI2A 2RS6A 4DV4E 2MC6A 1T4OA 2YT4A 4GEQB 4F9BB 2L2NA 3OTOE 4DR1E 1J5EE 4BCAA 1I94E 4F9CB 1IBME 2UUCE 4JI0E 4LF4E 1XNRE 2UXBE 4WPYA 4BBYA 2B3TB 4JI1E 2N3GA 1IBKE 2JWOA 2B7TA 2DMYA 2WZOA 4LFBE 2ODRC 3AV0A 3MSWA 4X64E 2VQFE 1N32E 2G7HA 4DR7E 3VYYA 1EKZA 1X48A 1GZ6A 2JOXA 4KZSA 5AE1A 2L2MA 4Q28A 4B3ME 2M4IA 2LTSA 4OOGC 1QU6A 2JOBA 5LMUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKA E;  2NA2 A;  2UUB E;  2VQE E;  4LF6 E;  3ADG A;  4OX9 E;  5BR8 E;  4DR6 E;  1J26 A;  1N33 E;  4YHH E;  4X65 E;  1T4L B;  4WFT A;  2RS7 A;  1N34 E;  4DUZ E;  4M2Z A;  4JI2 E;  2IHR 1;  3VYX A;  1N36 E;  2N3H A;  4WYQ B;  4X62 E;  1HNZ E;  1XNQ E;  4KHP E;  2ZM6 E;  4JI5 E;  1T4N A;  1PKP A;  4LF9 E;  4JV5 E;  1YYW A;  2LBS B;  1ZBT A;  2LJH A;  1HNX E;  1YZ9 A;  2NUG A;  1HNW E;  2HHH E;  3ADL A;  4JI7 E;  4NXN E;  4DR4 E;  2RTX A;  2KHX A;  4NXM E;  4DR3 E;  2L3J A;  4B3T E;  4DV2 E;  1WHQ A;  2L3C A;  2JY9 A;  2LUQ A;  4DKK A;  4DUY E;  3C4B A;  4B3S E;  4LFC E;  2NUF A;  2UUA E;  4DV3 E;  4JYA E;  4LF7 E;  4AQY E;  2LUP B;  3C4T A;  1X49 A;  4DV6 E;  4DV0 E;  2EZ6 A;  4DV7 E;  2NUE A;  1YYO A;  1IBL E;  4DR2 E;  1UIL A;  4LFA E;  2E5L E;  4GKK E;  4DV1 E;  1X47 A;  2L2K B;  1HR0 E;  2DB2 A;  2UU9 E;  4JI6 E;  4X66 E;  1FJG E;  2MDR A;  4DR5 E;  2DIX A;  3ADJ A;  1WHN A;  2F4V E;  4X8W A;  3T1Y E;  4B3R E;  4LF5 E;  4DV5 E;  4YY3 E;  2UXD E;  5LMN E;  4JI3 E;  5IWA E;  4M30 A;  5CFF E;  2JVA A;  2LTR A;  2RSM A;  3J7Y p;  2L33 A;  4K0K E;  3ADI A;  3HTX A;  1STU A;  1XMO E;  1GQE A;  1RQ0 A;  1XMQ E;  1UHZ A;  3T1H E;  1YYK A;  4GKJ E;  2UXC E;  3P1X A;  4JI8 E;  3LLH A;  2CPN A;  2B7V A;  1O0W A;  2LRS A;  1RC7 A;  4JI4 E;  4LF8 E;  1DI2 A;  2RS6 A;  4DV4 E;  4DR1 E;  2YT4 A;  3OTO E;  2L2N A;  1J5E E;  1IBM E;  4JI0 E;  1I94 E;  4LF4 E;  2UUC E;  1XNR E;  2UXB E;  2B3T B;  4JI1 E;  2N3G A;  1IBK E;  2B7T A;  2DMY A;  4LFB E;  1N32 E;  2VQF E;  4X64 E;  4DR7 E;  3VYY A;  1EKZ A;  1X48 A;  2L2M A;  4B3M E;  2LTS A;  4OOG C;  1QU6 A;  1T4O A;  5LMU E; 
#chains in the Genus database with same CATH topology
 1FKA E;  2HGH A;  4LF6 E;  1J26 A;  5BR8 E;  2N8X A;  2EMX A;  3FIG A;  4WFT A;  2HJJ A;  4M2Z A;  4JI2 E;  4WYQ B;  1X6E A;  2EOX A;  4JI5 E;  2WCC 3;  1PKP A;  5DNY A;  2YTQ A;  2ELZ A;  2V8Q B;  4O24 A;  3RMP A;  4JV5 E;  1HNX E;  1YZ9 A;  4BC9 A;  2EM5 A;  1A1J A;  1B69 A;  4N4R B;  4NXN E;  2MC5 A;  2EM4 A;  2KHX A;  3HPS A;  2L3J A;  4DV2 E;  5AC5 A;  2EMB A;  3F6G A;  4B3S E;  4LFC E;  2LT7 A;  4BHB A;  2UUA E;  2EOF A;  2L8T A;  2LJU A;  4AQY E;  1G2D C;  2EMY A;  1EH6 A;  5KL5 A;  2F8B A;  2YZT A;  1X6F A;  4WX9 A;  1A1K A;  2EZ6 A;  4L5N C;  1YYO A;  1IBL E;  5KL4 A;  1X47 A;  3EPK A;  4ZYD A;  4R2S A;  2EPR A;  3QG5 C;  4DR5 E;  2LV2 A;  2DIX A;  1WHN A;  2JP9 A;  2A25 A;  4X8W A;  4ZYH A;  2LMZ A;  5A69 A;  1ZBQ A;  3F6H A;  4YY3 E;  4R2P A;  4JI3 E;  4M0V A;  1A1I A;  2CSH A;  1JK1 A;  1RMD A;  1ZU1 A;  2EMI A;  2EPL X;  2RSM A;  2LO3 A;  3J7Y p;  4K0K E;  2DLK A;  2VE7 C;  3HXL A;  3HTX A;  1XMO E;  1GQE A;  1UHZ A;  2L92 A;  5IV8 B;  4GKJ E;  3BBG A;  1TF6 A;  2YRK A;  4BC7 A;  1BBO A;  4LF8 E;  1DI2 A;  2RS6 A;  2DLQ A;  2MC6 A;  2UUC E;  4FK5 C;  4BBY A;  1YPN A;  2YTJ A;  2EOO A;  2WZO A;  3VHT B;  2YTP A;  2VQF E;  4X64 E;  2EOE A;  2EPZ A;  1EKZ A;  4R2A A;  4Q28 A;  1YSA C;  1X3C A;  1QU6 A;  1T4O A;  4NHR A;  4NXM E;  2RQL A;  2VQE E;  4R2C A;  4P78 A;  1T39 A;  3KZY A;  3IWB A;  5AAS A;  2RS7 A;  4DUZ E;  1G2F C;  2V88 A;  2EJ4 A;  4DMI A;  1F2I G;  1WRJ A;  1X6H A;  3DF6 A;  1N36 E;  2N3H A;  1XNQ E;  4J8Z A;  2M9A A;  2LCE A;  3THO B;  2EL6 A;  4ZYG A;  2ZM6 E;  2EPO A;  3L00 A;  1YUI A;  5KL2 A;  2GHF A;  4TUG A;  3J7A G;  5A2Q C;  1PDA A;  2V85 A;  4I8O A;  3HQ1 A;  2EMG A;  1HNW E;  4WSP A;  1TF3 A;  4JI7 E;  2YU5 A;  2FV4 B;  2CTD A;  1SFE A;  4DKK A;  3KWR A;  1BB8 A;  2EM2 A;  2YRH A;  2ELY A;  2EQ3 A;  1X49 A;  4DV0 E;  2Q8U A;  3K6Q A;  3BID A;  2EPM X;  1X5W A;  4KWY A;  1NCS A;  4LFA E;  4F6M A;  2WBU A;  3TQM A;  2L2K B;  1SR9 A;  2EMW A;  2MDR A;  3ADJ A;  1A1F A;  1N3G A;  2V89 A;  4ZYE A;  4B3R E;  5ADZ A;  2EOS A;  4DV5 E;  2I9I A;  5LMN E;  2H36 X;  4O43 A;  4M30 A;  5CFF E;  1PJQ A;  2EPK X;  2LTR A;  2V83 A;  2YTN A;  5FLX C;  4X9J A;  4F54 A;  5A6A A;  2EPN A;  4R2Q A;  3T1H E;  4TUI A;  1YYK A;  4RH8 A;  4BMJ A;  2EOQ A;  4JI8 E;  3EPH A;  2B7V A;  4JI4 E;  2EN1 A;  1MEY C;  1AH5 A;  4GZN C;  4DR1 E;  2DGC A;  4F9B B;  4LF4 E;  2E72 A;  4WPY A;  2B3T B;  4WXC A;  2EOR A;  2JWO A;  1A1G A;  4Q35 B;  4NZV A;  1WJP A;  1N32 E;  3VYY A;  4KZS A;  5AE1 A;  2L2M A;  4B3M E;  2EML A;  4OOG C;  4O5G A;  4MLV A;  2NA2 A;  2YTD A;  2EMK A;  4OX9 E;  4R8O A;  3JAM C;  2KON A;  4YHH E;  4F9A B;  1MGT A;  4X65 E;  2EM6 A;  1LLM C;  4IS1 C;  2YTE A;  1T4L B;  2CT1 A;  5IT9 C;  2M7Q A;  4R03 A;  2IHR 1;  3VYX A;  2DSY A;  5T6J A;  4X62 E;  1BBG A;  4KHP E;  2I13 A;  2B9D A;  3AUZ A;  2EE8 A;  5KL3 A;  2DMI A;  4BHC A;  4LF9 E;  2GLI A;  1YYW A;  2J7J A;  2LBS B;  1ZBT A;  1T38 A;  2LJH A;  4RHB B;  4DR4 E;  2EM7 A;  2ENH A;  4DR3 E;  2L3C A;  3ECR A;  5A6B D;  3M99 B;  2EN8 A;  5A6K A;  3H09 A;  2D9H A;  4DV3 E;  2L6M A;  2EPP A;  2WBS A;  4LF7 E;  2LUP B;  3C4T A;  4MLQ A;  5KL7 A;  2RSI A;  2EN4 A;  2JR1 A;  4WSG A;  4DV7 E;  2NUE A;  2EOI A;  2EMH A;  5A6B A;  2ENA A;  1UIL A;  2E5L E;  5LLQ A;  4GKK E;  4DV1 E;  2FTX B;  1PJS A;  3JU0 A;  4L8N A;  1HR0 E;  2DB2 A;  3VK6 A;  2YTO A;  3IWC A;  5AE2 A;  2KOU A;  4R2E A;  2RPC A;  3THN A;  3KZZ A;  1DGC A;  3T1Y E;  1QNT A;  2ADR A;  4LF5 E;  1IQS A;  2EOH A;  1WXR A;  2EPA A;  5TSE A;  2EMC A;  2FGG A;  2EQ1 A;  2EOY A;  4LU9 A;  2L33 A;  2WBT A;  4R2D A;  2YSP A;  3ADI A;  2EOJ A;  1GTK A;  2YTG A;  2JXP A;  3LML A;  3ZOQ B;  1RQ0 A;  1XMQ E;  4P7D A;  2UXC E;  3P1X A;  3LLH A;  2EN2 A;  2EN7 A;  1O0W A;  1RC7 A;  2YSO A;  4HEI A;  2YT4 A;  2L2N A;  1IBM E;  5A6J A;  1I94 E;  1XNR E;  4JI1 E;  1IBK E;  2BB8 A;  1KYQ A;  2YTI A;  2ODR C;  2YTF A;  3MSW A;  4DR7 E;  2G7H A;  1GZ6 A;  1IMU A;  5AC4 A;  3MHH C;  1P47 A;  2EL4 A;  2UUB E;  2EL5 A;  2HC5 A;  4DR6 E;  3ADG A;  2YWQ A;  3IWD A;  3OML A;  4M9V C;  1N33 E;  2LE2 A;  5LL6 R;  3J80 C;  1N34 E;  2ODR D;  2DRP A;  3EPL A;  4O4K A;  5KL6 A;  1HNZ E;  5AE3 A;  4LTY A;  1IQO A;  1A1H A;  1KJK A;  2LVH A;  2YU8 A;  1T4N A;  2MKN A;  2EWL A;  2V87 A;  1EH8 A;  2EQ0 A;  5F3W A;  2ENC A;  2NUG A;  3BGH A;  2HHH E;  2EPU A;  3ADL A;  2RTX A;  3MHS C;  2M1S A;  4B3T E;  2EMA A;  1WHQ A;  1A1L A;  2JY9 A;  2VRD A;  2LUQ A;  2EM0 A;  4DUY E;  3C4B A;  1UN6 B;  4BS9 A;  2R76 A;  2JPA A;  2NUF A;  2YRM A;  4JYA E;  2JYA A;  3C6M A;  1TN9 A;  4DV6 E;  2EPC A;  2EP3 A;  1L4S A;  2MDG A;  4DR2 E;  1JK2 A;  1UBD C;  2E1M A;  4R2R A;  1ZR9 A;  2V86 A;  3HPZ A;  2K4V A;  2UU9 E;  4JI6 E;  4X66 E;  1FJG E;  2EM8 A;  2F4V E;  3J81 C;  3UK3 C;  2EMZ A;  1ZAA C;  4HTG A;  2UXD E;  2VF1 A;  2EOZ A;  5IWA E;  3EPJ A;  2NAB A;  2JVA A;  4WXD A;  2EM9 A;  2EN6 A;  1Z1B A;  3DJW A;  3JTZ A;  2PRT A;  1STU A;  2EOM A;  5IXM B;  1AAY A;  1DQ3 A;  2CPN A;  2LRS A;  1YFH A;  2BBG A;  1YUJ A;  2EM3 A;  4F2J C;  4DV4 E;  4GEQ B;  3OTO E;  1J5E E;  4JI0 E;  2K7I A;  4BCA A;  4F9C B;  1NEI A;  2UXB E;  3BF2 A;  2GPI A;  4IJD A;  2N3G A;  3C6K A;  1EH7 A;  2B7T A;  2DMY A;  4F6N A;  1PJT A;  2EN3 A;  4LFB E;  3AV0 A;  2MKD A;  1X48 A;  2JOX A;  2EMF A;  2M4I A;  2EPX A;  2LTS A;  2R1F A;  2JOB A;  3EQ1 A;  5LMU E;  2YPN A; 
#chains in the Genus database with same CATH homology
 1FKA E;  2NA2 A;  2UUB E;  2VQE E;  4LF6 E;  3ADG A;  4R8O A;  5BR8 E;  3IWD A;  3JAM C;  4OX9 E;  4DR6 E;  1J26 A;  2KON A;  3OML A;  1N33 E;  4P78 A;  4YHH E;  4F9A B;  2LE2 A;  4X65 E;  5LL6 R;  3FIG A;  3IWB A;  1T4L B;  3J80 C;  4WFT A;  5AAS A;  2RS7 A;  1N34 E;  4DUZ E;  2V88 A;  2ODR D;  4DMI A;  4JV5 E;  4M2Z A;  4JI2 E;  5IT9 C;  2M7Q A;  4R03 A;  3DF6 A;  2IHR 1;  3VYX A;  2DSY A;  1N36 E;  2N3H A;  4WYQ B;  5T6J A;  4J8Z A;  4X62 E;  1HNZ E;  1XNQ E;  4KHP E;  5AE3 A;  2ZM6 E;  4LTY A;  4JI5 E;  2B9D A;  3AUZ A;  1T4N A;  4TUG A;  1PKP A;  3J7A G;  5DNY A;  3RMP A;  2V8Q B;  2EWL A;  4LF9 E;  1YYW A;  5A2Q C;  2LBS B;  2V87 A;  1ZBT A;  2V85 A;  4I8O A;  3HQ1 A;  2LJH A;  5F3W A;  1HNX E;  1YZ9 A;  4BC9 A;  2HHH E;  2NUG A;  4WSP A;  1HNW E;  3ADL A;  4JI7 E;  4NXN E;  4DR4 E;  2MC5 A;  2RTX A;  2KHX A;  4NXM E;  2FV4 B;  3HPS A;  4DR3 E;  2M1S A;  2L3J A;  4B3T E;  4DV2 E;  1WHQ A;  2L3C A;  2JY9 A;  2LUQ A;  3F6G A;  4DKK A;  4DUY E;  3KWR A;  3C4B A;  4B3S E;  4LFC E;  4BS9 A;  3H09 A;  2NUF A;  2UUA E;  4DV3 E;  2L6M A;  2L8T A;  4JYA E;  4LF7 E;  4AQY E;  2LUP B;  3C4T A;  1X49 A;  4DV6 E;  4DV0 E;  2F8B A;  3K6Q A;  2YZT A;  2JR1 A;  2EZ6 A;  4DV7 E;  2NUE A;  4L5N C;  1YYO A;  1IBL E;  4DR2 E;  1UIL A;  4LFA E;  2E5L E;  4GKK E;  2E1M A;  4DV1 E;  2V86 A;  3HPZ A;  2FTX B;  1X47 A;  3JU0 A;  4L8N A;  2L2K B;  2K4V A;  2DB2 A;  3VK6 A;  1HR0 E;  2UU9 E;  4JI6 E;  3IWC A;  5AE2 A;  2KOU A;  4X66 E;  1FJG E;  1SR9 A;  2MDR A;  4DR5 E;  2DIX A;  3ADJ A;  1WHN A;  2F4V E;  4X8W A;  2LMZ A;  2V89 A;  3T1Y E;  3J81 C;  4B3R E;  5ADZ A;  1ZBQ A;  3F6H A;  4LF5 E;  4DV5 E;  4YY3 E;  2UXD E;  2VF1 A;  5LMN E;  1WXR A;  2H36 X;  5IWA E;  4JI3 E;  4M30 A;  4M0V A;  5CFF E;  2JVA A;  2FGG A;  2LTR A;  2RSM A;  4LU9 A;  3J7Y p;  2L33 A;  2V83 A;  4K0K E;  3DJW A;  2VE7 C;  3HXL A;  3ADI A;  3JTZ A;  5FLX C;  3HTX A;  4F54 A;  1STU A;  1XMO E;  3LML A;  1GQE A;  3ZOQ B;  1RQ0 A;  1XMQ E;  1UHZ A;  4P7D A;  4TUI A;  2L92 A;  4BMJ A;  3T1H E;  1YYK A;  4GKJ E;  2UXC E;  1DQ3 A;  3P1X A;  4JI8 E;  3LLH A;  2B7V A;  2CPN A;  1O0W A;  2LRS A;  4BC7 A;  1RC7 A;  4JI4 E;  4LF8 E;  1DI2 A;  2RS6 A;  4DV4 E;  2MC6 A;  1T4O A;  2YT4 A;  4GEQ B;  4F9B B;  2L2N A;  3OTO E;  4DR1 E;  1J5E E;  4BCA A;  1I94 E;  4F9C B;  1IBM E;  2UUC E;  4JI0 E;  4LF4 E;  1XNR E;  2UXB E;  4WPY A;  4BBY A;  2B3T B;  4JI1 E;  2N3G A;  1IBK E;  2JWO A;  2B7T A;  2DMY A;  2WZO A;  4LFB E;  2ODR C;  3AV0 A;  3MSW A;  4X64 E;  2VQF E;  1N32 E;  2G7H A;  4DR7 E;  3VYY A;  1EKZ A;  1X48 A;  1GZ6 A;  2JOX A;  4KZS A;  5AE1 A;  2L2M A;  4Q28 A;  4B3M E;  2M4I A;  2LTS A;  4OOG C;  1QU6 A;  2JOB A;  5LMU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...