3VYXA

Structural insights into risc assembly facilitated by dsrna binding domains of human rna helicase (dhx9)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
95
structure length
95
Chain Sequence
NAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent RNA helicase A
publication title Structural insights into RISC assembly facilitated by dsRNA-binding domains of human RNA helicase A (DHX9)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
total genus 24
structure length 95
sequence length 95
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3vyxA00
2UXCE 1N36E 1I94E 4LFBE 1XNRE 2UU9E 4LF7E 2DB2A 4DV0E 3J7Yp 1T4NA 1DI2A 4YHHE 4DKKA 1FKAE 2LJHA 4X62E 2L2MA 5BR8E 4NXNE 4AQYE 4DV5E 4LF9E 2YT4A 4B3TE 2UXDE 1QU6A 4X65E 1EKZA 4DR7E 1N34E 3LLHA 4DV2E 4OOGC 4LF6E 1STUA 2B7VA 2L33A 4DUZE 3OTOE 4DR2E 1XNQE 1HNZE 1J5EE 4X66E 3T1HE 2LTRA 2IHR1 2N3GA 4GKKE 3C4TA 1WHQA 1N33E 1YZ9A 1WHNA 3ADJA 1IBKE 4JI1E 4NXME 1T4OA 2UUCE 1PKPA 4GKJE 4DR5E 1O0WA 2UUBE 1FJGE 1RQ0A 3ADGA 2ZM6E 4JI3E 4B3SE 3ADLA 3C4BA 4DV1E 4JI6E 4LF8E 2LTSA 2HHHE 4DUYE 4B3RE 2L3JA 2DIXA 2MDRA 5LMUE 1UHZA 3VYYA 1YYOA 4DV6E 4DR1E 2F4VE 2RTXA 2B3TB 3ADIA 1X49A 1RC7A 4M2ZA 1ZBTA 2UUAE 5IWAE 4LFAE 4DR4E 4JYAE 2JY9A 1HR0E 2LBSB 2UXBE 3T1YE 4JI5E 4DV3E 4DR6E 2NUFA 1J26A 2NA2A 1GQEA 4JI8E 4JI2E 4LF4E 2RSMA 4LF5E 1UILA 4OX9E 4JV5E 1HNXE 2L2KB 4B3ME 2L3CA 3P1XA 4M30A 2VQFE 2RS7A 1HNWE 4X64E 1YYWA 1XMQE 4DV4E 1YYKA 2EZ6A 2CPNA 2N3HA 2RS6A 4YY3E 2L2NA 4DR3E 1IBLE 2LRSA 2KHXA 2E5LE 2LUPB 4DV7E 2NUGA 1X48A 4KHPE 4JI0E 2NUEA 4JI4E 1N32E 1T4LB 4WFTA 4LFCE 4X8WA 4WYQB 2LUQA 5CFFE 3VYXA 2VQEE 5LMNE 1IBME 4K0KE 2DMYA 2JVAA 2B7TA 1XMOE 4JI7E 3HTXA 1X47A
chains in the Genus database with same CATH superfamily
3JAMC 4ZYHA 1I94E 2GHFA 2YTFA 2EQ3A 4DV0E 3HQ1A 2H36X 3DJWA 3MHHC 4X62E 3JU0A 2ENAA 2EWLA 1TN9A 4NXNE 2YRMA 2MKNA 1EKZA 1X6FA 2M7QA 2VF1A 2ADRA 2ENHA 4HEIA 4OOGC 1STUA 2B7VA 2L33A 4R03A 2BB8A 3OTOE 2EM6A 2JOXA 2J7JA 4M0VA 4X66E 3T1HE 2LTRA 1A1FA 2EPNA 4GKKE 2EE8A 5A2QC 1UN6B 4JI1E 1MGTA 2EMWA 1T38A 2HJJA 3BGHA 3THNA 1FJGE 2YZTA 1NEIA 2A25A 4I8OA 2DGCA 4JI3E 4B3SE 4BC9A 1A1IA 1YUIA 1WJPA 5IXMB 2MKDA 2WBSA 1G2FC 2L3JA 4WX9A 1YYOA 4DV6E 1DQ3A 1MEYC 2CT1A 2R1FA 4L8NA 2EMCA 2F8BA 4F54A 1X6EA 2EOOA 5T6JA 1PDAA 5IWAE 4R2PA 2JY9A 5A6JA 2EMLA 3T1YE 2V89A 2M4IA 2NUFA 2EN3A 2EN1A 4P78A 2HC5A 1UILA 2E72A 4OX9E 3KZZA 3AUZA 3FIGA 4X64E 2EPZA 1YYWA 3HPSA 2N8XA 4NZVA 2LV2A 2CPNA 2BBGA 3IWDA 2DRPA 2WCC3 2EMFA 2E5LE 2RSIA 4R2CA 2DMIA 4KHPE 5DNYA 2NUEA 2EPLX 5IT9C 3TQMA 2LJUA 5IV8B 3RMPA 2VQEE 3UK3C 3C6MA 3HTXA 1TF6A 2EMHA 5AE1A 2UXCE 5F3WA 4LFBE 5KL4A 2M9AA 2HGHA 4LF7E 2KONA 5KL7A 2EOXA 1BBOA 3EPLA 4DKKA 2LCEA 2LJHA 2NABA 2YSPA 5BR8E 1A1JA 4WXDA 2JWOA 4DV5E 1EH8A 5TSEA 2UXDE 4B3TE 1QU6A 4X65E 3KWRA 3EPKA 3QG5C 1SR9A 4R2DA 2EMGA 2EOFA 2YRKA 4DUZE 4DR2E 4F6MA 1HNZE 4BMJA 2N3GA 2EORA 2MC6A 1WHQA 1N33E 3J81C 4FK5C 1WHNA 3JTZA 2E1MA 1T4OA 5A6BA 2MDGA 3F6GA 4GKJE 2JP9A 2EN7A 1AH5A 2VRDA 3EQ1A 2DSYA 4Q28A 4Q35B 2WBUA 3ADGA 2EMZA 1ZU1A 3ADLA 2EPCA 3L00A 2EN8A 4LF8E 2V83A 2CSHA 2EPAA 4ZYEA 1WXRA 4B3RE 2DIXA 3BBGA 2MDRA 1UHZA 5LMUE 1ZAAC 2YWQA 1NCSA 1GTKA 2RTXA 2V87A 2I13A 2YTOA 3ADIA 1X49A 2EJ4A 1RC7A 2YPNA 4IS1C 3J7AG 2B9DA 1B69A 1A1KA 2EOQA 4JI5E 4F2JC 4ZYGA 2EM3A 4LF4E 2V88A 2EMXA 4MLQA 1IQSA 2L2KB 2YU8A 2L3CA 4B3ME 2EPXA 2JYAA 2EOMA 2EMBA 3IWBA 1PJTA 1KJKA 5LLQA 2K4VA 2L6MA 4LU9A 5KL6A 4X9JA 1XMQE 1GZ6A 2YTEA 4DV4E 2RS6A 1ZR9A 2L2NA 4DR3E 5FLXC 4DV7E 2FV4B 2NUGA 4GZNC 4BS9A 3EPHA 4JI0E 4JI4E 2DLQA 4WFTA 2GLIA 2RPCA 4LFCE 4TUIA 5A69A 2LUQA 2G7HA 5CFFE 1X6HA 1YFHA 1JK1A 2YTJA 1UBDC 2JOBA 4R2AA 2EPKX 4P7DA 4ZYDA 4NHRA 1IBME 2DMYA 3J80C 2JVAA 4WSGA 1N36E 2WZOA 2EQ1A 2EMAA 2EMIA 2EM8A 2EQ0A 4R8OA 4J8ZA 2DB2A 2EPPA 4DMIA 3J7Yp 1DI2A 1FKAE 2YTGA 1BB8A 4R2SA 2EPRA 2L2MA 4AQYE 3KZYA 2V8QB 4LF9E 3MSWA 2YT4A 1A1GA 2EN6A 2YTIA 2VE7C 4M9VC 3LLHA 3MHSC 4RHBB 4MLVA 2L92A 1IMUA 1J5EE 2JXPA 2EN2A 2EM5A 2IHR1 2GPIA 1YZ9A 1IBKE 1TF3A 4IJDA 2EOHA 4DR5E 1O0WA 1N3GA 2EM9A 4O24A 5KL2A 1L4SA 2PRTA 2ZM6E 2CTDA 2EPUA 2M1SA 2HHHE 1BBGA 2DLKA 5AASA 1QNTA 2MC5A 3VYYA 2Q8UA 3K6QA 2F4VE 2L8TA 5A6BD 1DGCA 3BF2A 2YRHA 1ZBTA 1ZBQA 4HTGA 4F9BB 4F9AB 1A1HA 3LMLA 2EOZA 4DV3E 2EOIA 1J26A 4WXCA 1A1LA 4JI8E 3F6HA 1EH7A 5A6AA 1WRJA 3ZOQB 5LL6R 4BBYA 2VQFE 2RS7A 1T39A 1YPNA 2LO3A 3OMLA 2EZ6A 4YY3E 1IBLE 2LRSA 2EMKA 2KHXA 3BIDA 5A6KA 1Z1BA 2EN4A 2EMYA 2D9HA 1X3CA 1LLMC 1T4LB 4WYQB 1RMDA 3AV0A 2YTQA 5ADZA 1KYQA 2ENCA 4K0KE 1JK2A 3H09A 4BHBA 1G2DC 4WSPA 2B7TA 2ODRC 4JI7E 1X5WA 2RQLA 1X47A 2LT7A 1YSAC 1XNRE 2UU9E 3THOB 2K7IA 5AC4A 2EOEA 1T4NA 4YHHE 4R2QA 2JR1A 2LVHA 3M99B 5KL5A 1SFEA 2EM7A 2I9IA 5AC5A 2YTNA 2R76A 4O5GA 4DR7E 1N34E 4DV2E 4LF6E 3HPZA 1XNQE 3VHTB 2EOJA 4L5NC 2EP3A 1PJSA 4BCAA 3C4TA 4KWYA 5AE3A 3EPJA 2LE2A 2YU5A 3ADJA 2EL6A 4NXME 4R2RA 2UUCE 1PKPA 1IQOA 2UUBE 1PJQA 1F2IG 1RQ0A 4LTYA 2YTDA 2V86A 3C4BA 4DV1E 4JI6E 2LTSA 4DUYE 4DR1E 2FGGA 4KZSA 2V85A 2YSOA 2B3TB 4R2EA 2EOYA 4M2ZA 2ELYA 2YTPA 2UUAE 4LFAE 4DR4E 4JYAE 1HR0E 2EPMX 2LBSB 2UXBE 4O43A 4DR6E 4WPYA 4RH8A 2WBTA 2NA2A 1GQEA 2LMZA 4JI2E 2RSMA 4LF5E 4JV5E 3C6KA 3DF6A 1HNXE 2JPAA 3P1XA 4M30A 3ECRA 5AE2A 1HNWE 2EL4A 4TUGA 1AAYA 3HXLA 2EL5A 2ODRD 3IWCA 4BC7A 1P47A 1YYKA 3VK6A 4BHCA 2N3HA 4F6NA 4F9CB 2LUPB 1X48A 2ELZA 2EM4A 2FTXB 4GEQB 1N32E 1YUJA 4X8WA 2EPOA 4N4RB 3VYXA 2EM0A 5KL3A 5LMNE 2EOSA 1XMOE 4O4KA 1EH6A 2EM2A 2KOUA
chains in the Genus database with same CATH topology
5AE1A 3JAMC 2UXCE 5F3WA 1N36E 1I94E 4LFBE 1XNRE 2UU9E 2WZOA 4LF7E 2KONA 4R8OA 4J8ZA 2DB2A 4DMIA 3J7Yp 1T4NA 2H36X 3DJWA 3HQ1A 4DKKA 4YHHE 4DV0E 1FKAE 2LJHA 4X62E 3JU0A 2JR1A 2L2MA 5BR8E 2EWLA 4NXNE 4AQYE 2JWOA 4DV5E 2V8QB 4LF9E 3MSWA 2YT4A 4B3TE 2UXDE 1QU6A 4X65E 3KWRA 2VE7C 1EKZA 2M7QA 1SR9A 2VF1A 4DR7E 1N34E 3LLHA 4DV2E 4OOGC 4LF6E 1STUA 2B7VA 3HPZA 2L33A 4R03A 2L92A 4DUZE 3OTOE 4DR2E 1XNQE 2JOXA 1HNZE 4BMJA 4L5NC 1J5EE 4M0VA 4X66E 3T1HE 2LTRA 2IHR1 2N3GA 4BCAA 4GKKE 3C4TA 2MC6A 1WHQA 1N33E 5A2QC 3J81C 5AE3A 1YZ9A 1WHNA 2LE2A 3ADJA 1IBKE 4JI1E 3JTZA 4NXME 2E1MA 1T4OA 2UUCE 1PKPA 3F6GA 4GKJE 4DR5E 1O0WA 2UUBE 1FJGE 2DSYA 2YZTA 4Q28A 4I8OA 1RQ0A 3ADGA 4LTYA 2ZM6E 4JI3E 4B3SE 4BC9A 3ADLA 2V86A 3C4BA 4DV1E 4JI6E 4LF8E 2LTSA 2M1SA 2V83A 2HHHE 4DUYE 5AASA 1WXRA 4B3RE 2DIXA 2L3JA 2MC5A 2MDRA 1UHZA 5LMUE 3VYYA 1YYOA 4DV6E 1DQ3A 4DR1E 2FGGA 3K6QA 4KZSA 2F4VE 2RTXA 2V85A 2B3TB 2L8TA 2V87A 2F8BA 4L8NA 3ADIA 1X49A 4F54A 1RC7A 4M2ZA 3J7AG 1ZBTA 1ZBQA 5T6JA 2B9DA 5IWAE 2UUAE 4LFAE 4DR4E 4JYAE 2JY9A 4F9BB 1HR0E 4F9AB 2LBSB 2UXBE 3T1YE 4JI5E 3LMLA 2V89A 4DV3E 2M4IA 4DR6E 2NUFA 1DI2A 4WPYA 1J26A 2NA2A 1GQEA 2LMZA 3F6HA 4P78A 4JI8E 2V88A 4JI2E 4LF4E 2RSMA 4LF5E 1UILA 4OX9E 3ZOQB 3DF6A 1HNXE 4JV5E 5LL6R 2L2KB 2L3CA 3AUZA 3P1XA 4M30A 4BBYA 2VQFE 4B3ME 2RS7A 5AE2A 1HNWE 4TUGA 3FIGA 3HXLA 3IWBA 4X64E 1YYWA 2ODRD 2K4VA 2L6MA 3IWCA 3HPSA 4LU9A 4BC7A 3OMLA 1XMQE 1GZ6A 3VK6A 4DV4E 1YYKA 2CPNA 2N3HA 2RS6A 3IWDA 4YY3E 2EZ6A 4F9CB 2L2NA 4DR3E 1IBLE 2LRSA 2KHXA 2E5LE 2LUPB 5FLXC 4DV7E 2FV4B 2NUGA 1X48A 4BS9A 2FTXB 4GEQB 5DNYA 4JI0E 2NUEA 4KHPE 4JI4E 1N32E 5IT9C 1T4LB 4WFTA 4LFCE 4TUIA 4X8WA 4WYQB 3RMPA 2LUQA 2G7HA 5CFFE 3VYXA 3AV0A 2VQEE 2JOBA 5ADZA 4P7DA 5LMNE 1IBME 4K0KE 2DMYA 3H09A 3J80C 4WSPA 2JVAA 2B7TA 2ODRC 1XMOE 4JI7E 3HTXA 1X47A 2KOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC E;  1N36 E;  1I94 E;  4LFB E;  1XNR E;  2UU9 E;  4LF7 E;  2DB2 A;  4DV0 E;  3J7Y p;  1T4N A;  1DI2 A;  4YHH E;  4DKK A;  1FKA E;  2LJH A;  4X62 E;  2L2M A;  5BR8 E;  4NXN E;  4AQY E;  4DV5 E;  4LF9 E;  2YT4 A;  4B3T E;  2UXD E;  1QU6 A;  4X65 E;  1EKZ A;  4DR7 E;  1N34 E;  3LLH A;  4DV2 E;  4OOG C;  4LF6 E;  1STU A;  2B7V A;  2L33 A;  4DUZ E;  3OTO E;  4DR2 E;  1XNQ E;  1HNZ E;  1J5E E;  4X66 E;  3T1H E;  2LTR A;  2IHR 1;  2N3G A;  4GKK E;  3C4T A;  1WHQ A;  1N33 E;  1YZ9 A;  1WHN A;  3ADJ A;  1IBK E;  4JI1 E;  4NXM E;  1T4O A;  2UUC E;  1PKP A;  4GKJ E;  4DR5 E;  1O0W A;  2UUB E;  1FJG E;  1RQ0 A;  3ADG A;  2ZM6 E;  4JI3 E;  4B3S E;  3ADL A;  3C4B A;  4DV1 E;  4JI6 E;  4LF8 E;  2LTS A;  2HHH E;  4DUY E;  4B3R E;  2L3J A;  2DIX A;  2MDR A;  5LMU E;  1UHZ A;  3VYY A;  1YYO A;  4DV6 E;  4DR1 E;  2F4V E;  2RTX A;  2B3T B;  3ADI A;  1X49 A;  1RC7 A;  4M2Z A;  1ZBT A;  2UUA E;  5IWA E;  4LFA E;  4DR4 E;  4JYA E;  2JY9 A;  1HR0 E;  2LBS B;  2UXB E;  3T1Y E;  4JI5 E;  4DV3 E;  4DR6 E;  2NUF A;  1J26 A;  2NA2 A;  1GQE A;  4JI8 E;  4JI2 E;  4LF4 E;  2RSM A;  4LF5 E;  1UIL A;  4OX9 E;  4JV5 E;  1HNX E;  2L2K B;  4B3M E;  2L3C A;  3P1X A;  4M30 A;  2VQF E;  2RS7 A;  1HNW E;  4X64 E;  1YYW A;  1XMQ E;  4DV4 E;  1YYK A;  2EZ6 A;  2CPN A;  2N3H A;  2RS6 A;  4YY3 E;  2L2N A;  4DR3 E;  1IBL E;  2LRS A;  2KHX A;  2E5L E;  2LUP B;  4DV7 E;  2NUG A;  1X48 A;  4KHP E;  4JI0 E;  2NUE A;  4JI4 E;  1N32 E;  1T4L B;  4WFT A;  4LFC E;  4X8W A;  4WYQ B;  2LUQ A;  5CFF E;  3VYX A;  2VQE E;  5LMN E;  1IBM E;  4K0K E;  2DMY A;  2JVA A;  2B7T A;  1XMO E;  4JI7 E;  3HTX A;  1X47 A; 
#chains in the Genus database with same CATH topology
 3JAM C;  4ZYH A;  1I94 E;  2GHF A;  2YTF A;  2EQ3 A;  4DV0 E;  3HQ1 A;  2H36 X;  3DJW A;  3MHH C;  4X62 E;  3JU0 A;  2ENA A;  2EWL A;  1TN9 A;  4NXN E;  2YRM A;  2MKN A;  1EKZ A;  1X6F A;  2M7Q A;  2VF1 A;  2ADR A;  2ENH A;  4HEI A;  4OOG C;  1STU A;  2B7V A;  2L33 A;  4R03 A;  2BB8 A;  3OTO E;  2EM6 A;  2JOX A;  2J7J A;  4M0V A;  4X66 E;  3T1H E;  2LTR A;  1A1F A;  2EPN A;  4GKK E;  2EE8 A;  5A2Q C;  1UN6 B;  4JI1 E;  1MGT A;  2EMW A;  1T38 A;  2HJJ A;  3BGH A;  3THN A;  1FJG E;  2YZT A;  1NEI A;  2A25 A;  4I8O A;  2DGC A;  4JI3 E;  4B3S E;  4BC9 A;  1A1I A;  1YUI A;  1WJP A;  5IXM B;  2MKD A;  2WBS A;  1G2F C;  2L3J A;  4WX9 A;  1YYO A;  4DV6 E;  1DQ3 A;  1MEY C;  2CT1 A;  2R1F A;  4L8N A;  2EMC A;  2F8B A;  4F54 A;  1X6E A;  2EOO A;  5T6J A;  1PDA A;  5IWA E;  4R2P A;  2JY9 A;  5A6J A;  2EML A;  3T1Y E;  2V89 A;  2M4I A;  2NUF A;  2EN3 A;  2EN1 A;  4P78 A;  2HC5 A;  1UIL A;  2E72 A;  4OX9 E;  3KZZ A;  3AUZ A;  3FIG A;  4X64 E;  2EPZ A;  1YYW A;  3HPS A;  2N8X A;  4NZV A;  2LV2 A;  2CPN A;  2BBG A;  3IWD A;  2DRP A;  2WCC 3;  2EMF A;  2E5L E;  2RSI A;  4R2C A;  2DMI A;  4KHP E;  5DNY A;  2NUE A;  2EPL X;  5IT9 C;  3TQM A;  2LJU A;  5IV8 B;  3RMP A;  2VQE E;  3UK3 C;  3C6M A;  3HTX A;  1TF6 A;  2EMH A;  5AE1 A;  2UXC E;  5F3W A;  4LFB E;  5KL4 A;  2M9A A;  2HGH A;  4LF7 E;  2KON A;  5KL7 A;  2EOX A;  1BBO A;  3EPL A;  4DKK A;  2LCE A;  2LJH A;  2NAB A;  2YSP A;  5BR8 E;  1A1J A;  4WXD A;  2JWO A;  4DV5 E;  1EH8 A;  5TSE A;  2UXD E;  4B3T E;  1QU6 A;  4X65 E;  3KWR A;  3EPK A;  3QG5 C;  1SR9 A;  4R2D A;  2EMG A;  2EOF A;  2YRK A;  4DUZ E;  4DR2 E;  4F6M A;  1HNZ E;  4BMJ A;  2N3G A;  2EOR A;  2MC6 A;  1WHQ A;  1N33 E;  3J81 C;  4FK5 C;  1WHN A;  3JTZ A;  2E1M A;  1T4O A;  5A6B A;  2MDG A;  3F6G A;  4GKJ E;  2JP9 A;  2EN7 A;  1AH5 A;  2VRD A;  3EQ1 A;  2DSY A;  4Q28 A;  4Q35 B;  2WBU A;  3ADG A;  2EMZ A;  1ZU1 A;  3ADL A;  2EPC A;  3L00 A;  2EN8 A;  4LF8 E;  2V83 A;  2CSH A;  2EPA A;  4ZYE A;  1WXR A;  4B3R E;  2DIX A;  3BBG A;  2MDR A;  1UHZ A;  5LMU E;  1ZAA C;  2YWQ A;  1NCS A;  1GTK A;  2RTX A;  2V87 A;  2I13 A;  2YTO A;  3ADI A;  1X49 A;  2EJ4 A;  1RC7 A;  2YPN A;  4IS1 C;  3J7A G;  2B9D A;  1B69 A;  1A1K A;  2EOQ A;  4JI5 E;  4F2J C;  4ZYG A;  2EM3 A;  4LF4 E;  2V88 A;  2EMX A;  4MLQ A;  1IQS A;  2L2K B;  2YU8 A;  2L3C A;  4B3M E;  2EPX A;  2JYA A;  2EOM A;  2EMB A;  3IWB A;  1PJT A;  1KJK A;  5LLQ A;  2K4V A;  2L6M A;  4LU9 A;  5KL6 A;  4X9J A;  1XMQ E;  1GZ6 A;  2YTE A;  4DV4 E;  2RS6 A;  1ZR9 A;  2L2N A;  4DR3 E;  5FLX C;  4DV7 E;  2FV4 B;  2NUG A;  4GZN C;  4BS9 A;  3EPH A;  4JI0 E;  4JI4 E;  2DLQ A;  4WFT A;  2GLI A;  2RPC A;  4LFC E;  4TUI A;  5A69 A;  2LUQ A;  2G7H A;  5CFF E;  1X6H A;  1YFH A;  1JK1 A;  2YTJ A;  1UBD C;  2JOB A;  4R2A A;  2EPK X;  4P7D A;  4ZYD A;  4NHR A;  1IBM E;  2DMY A;  3J80 C;  2JVA A;  4WSG A;  1N36 E;  2WZO A;  2EQ1 A;  2EMA A;  2EMI A;  2EM8 A;  2EQ0 A;  4R8O A;  4J8Z A;  2DB2 A;  2EPP A;  4DMI A;  3J7Y p;  1DI2 A;  1FKA E;  2YTG A;  1BB8 A;  4R2S A;  2EPR A;  2L2M A;  4AQY E;  3KZY A;  2V8Q B;  4LF9 E;  3MSW A;  2YT4 A;  1A1G A;  2EN6 A;  2YTI A;  2VE7 C;  4M9V C;  3LLH A;  3MHS C;  4RHB B;  4MLV A;  2L92 A;  1IMU A;  1J5E E;  2JXP A;  2EN2 A;  2EM5 A;  2IHR 1;  2GPI A;  1YZ9 A;  1IBK E;  1TF3 A;  4IJD A;  2EOH A;  4DR5 E;  1O0W A;  1N3G A;  2EM9 A;  4O24 A;  5KL2 A;  1L4S A;  2PRT A;  2ZM6 E;  2CTD A;  2EPU A;  2M1S A;  2HHH E;  1BBG A;  2DLK A;  5AAS A;  1QNT A;  2MC5 A;  3VYY A;  2Q8U A;  3K6Q A;  2F4V E;  2L8T A;  5A6B D;  1DGC A;  3BF2 A;  2YRH A;  1ZBT A;  1ZBQ A;  4HTG A;  4F9B B;  4F9A B;  1A1H A;  3LML A;  2EOZ A;  4DV3 E;  2EOI A;  1J26 A;  4WXC A;  1A1L A;  4JI8 E;  3F6H A;  1EH7 A;  5A6A A;  1WRJ A;  3ZOQ B;  5LL6 R;  4BBY A;  2VQF E;  2RS7 A;  1T39 A;  1YPN A;  2LO3 A;  3OML A;  2EZ6 A;  4YY3 E;  1IBL E;  2LRS A;  2EMK A;  2KHX A;  3BID A;  5A6K A;  1Z1B A;  2EN4 A;  2EMY A;  2D9H A;  1X3C A;  1LLM C;  1T4L B;  4WYQ B;  1RMD A;  3AV0 A;  2YTQ A;  5ADZ A;  1KYQ A;  2ENC A;  4K0K E;  1JK2 A;  3H09 A;  4BHB A;  1G2D C;  4WSP A;  2B7T A;  2ODR C;  4JI7 E;  1X5W A;  2RQL A;  1X47 A;  2LT7 A;  1YSA C;  1XNR E;  2UU9 E;  3THO B;  2K7I A;  5AC4 A;  2EOE A;  1T4N A;  4YHH E;  4R2Q A;  2JR1 A;  2LVH A;  3M99 B;  5KL5 A;  1SFE A;  2EM7 A;  2I9I A;  5AC5 A;  2YTN A;  2R76 A;  4O5G A;  4DR7 E;  1N34 E;  4DV2 E;  4LF6 E;  3HPZ A;  1XNQ E;  3VHT B;  2EOJ A;  4L5N C;  2EP3 A;  1PJS A;  4BCA A;  3C4T A;  4KWY A;  5AE3 A;  3EPJ A;  2LE2 A;  2YU5 A;  3ADJ A;  2EL6 A;  4NXM E;  4R2R A;  2UUC E;  1PKP A;  1IQO A;  2UUB E;  1PJQ A;  1F2I G;  1RQ0 A;  4LTY A;  2YTD A;  2V86 A;  3C4B A;  4DV1 E;  4JI6 E;  2LTS A;  4DUY E;  4DR1 E;  2FGG A;  4KZS A;  2V85 A;  2YSO A;  2B3T B;  4R2E A;  2EOY A;  4M2Z A;  2ELY A;  2YTP A;  2UUA E;  4LFA E;  4DR4 E;  4JYA E;  1HR0 E;  2EPM X;  2LBS B;  2UXB E;  4O43 A;  4DR6 E;  4WPY A;  4RH8 A;  2WBT A;  2NA2 A;  1GQE A;  2LMZ A;  4JI2 E;  2RSM A;  4LF5 E;  4JV5 E;  3C6K A;  3DF6 A;  1HNX E;  2JPA A;  3P1X A;  4M30 A;  3ECR A;  5AE2 A;  1HNW E;  2EL4 A;  4TUG A;  1AAY A;  3HXL A;  2EL5 A;  2ODR D;  3IWC A;  4BC7 A;  1P47 A;  1YYK A;  3VK6 A;  4BHC A;  2N3H A;  4F6N A;  4F9C B;  2LUP B;  1X48 A;  2ELZ A;  2EM4 A;  2FTX B;  4GEQ B;  1N32 E;  1YUJ A;  4X8W A;  2EPO A;  4N4R B;  3VYX A;  2EM0 A;  5KL3 A;  5LMN E;  2EOS A;  1XMO E;  4O4K A;  1EH6 A;  2EM2 A;  2KOU A; 
#chains in the Genus database with same CATH homology
 5AE1 A;  3JAM C;  2UXC E;  5F3W A;  1N36 E;  1I94 E;  4LFB E;  1XNR E;  2UU9 E;  2WZO A;  4LF7 E;  2KON A;  4R8O A;  4J8Z A;  2DB2 A;  4DMI A;  3J7Y p;  1T4N A;  2H36 X;  3DJW A;  3HQ1 A;  4DKK A;  4YHH E;  4DV0 E;  1FKA E;  2LJH A;  4X62 E;  3JU0 A;  2JR1 A;  2L2M A;  5BR8 E;  2EWL A;  4NXN E;  4AQY E;  2JWO A;  4DV5 E;  2V8Q B;  4LF9 E;  3MSW A;  2YT4 A;  4B3T E;  2UXD E;  1QU6 A;  4X65 E;  3KWR A;  2VE7 C;  1EKZ A;  2M7Q A;  1SR9 A;  2VF1 A;  4DR7 E;  1N34 E;  3LLH A;  4DV2 E;  4OOG C;  4LF6 E;  1STU A;  2B7V A;  3HPZ A;  2L33 A;  4R03 A;  2L92 A;  4DUZ E;  3OTO E;  4DR2 E;  1XNQ E;  2JOX A;  1HNZ E;  4BMJ A;  4L5N C;  1J5E E;  4M0V A;  4X66 E;  3T1H E;  2LTR A;  2IHR 1;  2N3G A;  4BCA A;  4GKK E;  3C4T A;  2MC6 A;  1WHQ A;  1N33 E;  5A2Q C;  3J81 C;  5AE3 A;  1YZ9 A;  1WHN A;  2LE2 A;  3ADJ A;  1IBK E;  4JI1 E;  3JTZ A;  4NXM E;  2E1M A;  1T4O A;  2UUC E;  1PKP A;  3F6G A;  4GKJ E;  4DR5 E;  1O0W A;  2UUB E;  1FJG E;  2DSY A;  2YZT A;  4Q28 A;  4I8O A;  1RQ0 A;  3ADG A;  4LTY A;  2ZM6 E;  4JI3 E;  4B3S E;  4BC9 A;  3ADL A;  2V86 A;  3C4B A;  4DV1 E;  4JI6 E;  4LF8 E;  2LTS A;  2M1S A;  2V83 A;  2HHH E;  4DUY E;  5AAS A;  1WXR A;  4B3R E;  2DIX A;  2L3J A;  2MC5 A;  2MDR A;  1UHZ A;  5LMU E;  3VYY A;  1YYO A;  4DV6 E;  1DQ3 A;  4DR1 E;  2FGG A;  3K6Q A;  4KZS A;  2F4V E;  2RTX A;  2V85 A;  2B3T B;  2L8T A;  2V87 A;  2F8B A;  4L8N A;  3ADI A;  1X49 A;  4F54 A;  1RC7 A;  4M2Z A;  3J7A G;  1ZBT A;  1ZBQ A;  5T6J A;  2B9D A;  5IWA E;  2UUA E;  4LFA E;  4DR4 E;  4JYA E;  2JY9 A;  4F9B B;  1HR0 E;  4F9A B;  2LBS B;  2UXB E;  3T1Y E;  4JI5 E;  3LML A;  2V89 A;  4DV3 E;  2M4I A;  4DR6 E;  2NUF A;  1DI2 A;  4WPY A;  1J26 A;  2NA2 A;  1GQE A;  2LMZ A;  3F6H A;  4P78 A;  4JI8 E;  2V88 A;  4JI2 E;  4LF4 E;  2RSM A;  4LF5 E;  1UIL A;  4OX9 E;  3ZOQ B;  3DF6 A;  1HNX E;  4JV5 E;  5LL6 R;  2L2K B;  2L3C A;  3AUZ A;  3P1X A;  4M30 A;  4BBY A;  2VQF E;  4B3M E;  2RS7 A;  5AE2 A;  1HNW E;  4TUG A;  3FIG A;  3HXL A;  3IWB A;  4X64 E;  1YYW A;  2ODR D;  2K4V A;  2L6M A;  3IWC A;  3HPS A;  4LU9 A;  4BC7 A;  3OML A;  1XMQ E;  1GZ6 A;  3VK6 A;  4DV4 E;  1YYK A;  2CPN A;  2N3H A;  2RS6 A;  3IWD A;  4YY3 E;  2EZ6 A;  4F9C B;  2L2N A;  4DR3 E;  1IBL E;  2LRS A;  2KHX A;  2E5L E;  2LUP B;  5FLX C;  4DV7 E;  2FV4 B;  2NUG A;  1X48 A;  4BS9 A;  2FTX B;  4GEQ B;  5DNY A;  4JI0 E;  2NUE A;  4KHP E;  4JI4 E;  1N32 E;  5IT9 C;  1T4L B;  4WFT A;  4LFC E;  4TUI A;  4X8W A;  4WYQ B;  3RMP A;  2LUQ A;  2G7H A;  5CFF E;  3VYX A;  3AV0 A;  2VQE E;  2JOB A;  5ADZ A;  4P7D A;  5LMN E;  1IBM E;  4K0K E;  2DMY A;  3H09 A;  3J80 C;  4WSP A;  2JVA A;  2B7T A;  2ODR C;  1XMO E;  4JI7 E;  3HTX A;  1X47 A;  2KOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...