3VYXA

Structural insights into risc assembly facilitated by dsrna binding domains of human rna helicase (dhx9)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
95
structure length
95
Chain Sequence
NAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent RNA helicase A
publication title Structural insights into RISC assembly facilitated by dsRNA-binding domains of human RNA helicase A (DHX9)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
total genus 24
structure length 95
sequence length 95
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3vyxA00
5LMNE 3T1YE 2ZM6E 4YHHE 2RS7A 3VYXA 4LF5E 4DUZE 2JY9A 1YYOA 2DB2A 2L2NA 2LUPB 2UUCE 2N3HA 1STUA 1IBKE 4X64E 4JI1E 1I94E 1HNWE 3LLHA 4DR6E 4GKJE 3VYYA 3C4TA 3OTOE 4WFTA 4DUYE 4NXME 2RS6A 3ADJA 2B7TA 4WYQB 2L33A 2N3GA 4JI8E 2NUEA 1O0WA 4X65E 1RC7A 4JI6E 1DI2A 2UXBE 2JVAA 4LF9E 4DV0E 3ADLA 1N33E 3ADIA 2EZ6A 2IHR1 4DR3E 1EKZA 5LMUE 4DV5E 2E5LE 1N36E 4LF6E 4KHPE 2B7VA 2YT4A 4DV3E 4DV7E 4X8WA 2L2KB 1HR0E 4DR4E 4DR7E 1IBLE 4DV2E 1WHQA 2LTRA 1YYWA 4DV4E 1RQ0A 1GQEA 2NA2A 4X66E 1T4LB 4JI7E 2LJHA 4JI0E 2VQEE 4AQYE 2LTSA 1XMQE 4X62E 2L3CA 1T4OA 3P1XA 1N32E 4JI5E 3ADGA 4M30A 2MDRA 4B3SE 4DKKA 4B3RE 2LBSB 3HTXA 2UUAE 2B3TB 2NUGA 4M2ZA 1ZBTA 3C4BA 4LF7E 4DR1E 4DR2E 1X48A 1XNQE 1PKPA 4YY3E 3J7Yp 1HNXE 4LFAE 4DV1E 1T4NA 2LUQA 2KHXA 2RSMA 1YZ9A 1X49A 4JV5E 4GKKE 4LFBE 4NXNE 2UXDE 1HNZE 4B3ME 1IBME 4JYAE 1J26A 3T1HE 2F4VE 5BR8E 4K0KE 1UHZA 2VQFE 1YYKA 2UXCE 2L3JA 1N34E 1UILA 2NUFA 4LF4E 2L2MA 4LF8E 4DR5E 1J5EE 1FKAE 2CPNA 1WHNA 4B3TE 4JI3E 2DMYA 2LRSA 2RTXA 2DIXA 1XNRE 1XMOE 1X47A 5CFFE 2UUBE 4LFCE 1FJGE 1QU6A 4OOGC 4DV6E 4JI4E 2HHHE 4OX9E 4JI2E 5IWAE 2UU9E
chains in the Genus database with same CATH superfamily
2A25A 1T39A 2RS7A 3VYXA 4LF5E 2YRMA 2V8QB 2L2NA 2LUPB 3ECRA 5KL6A 2EL6A 2EM7A 2EQ3A 1IBKE 4X64E 1A1HA 4IJDA 4BCAA 2M4IA 4WXDA 2YPNA 5IT9C 2HC5A 5LLQA 4DR6E 3ZOQB 2EOIA 3C4TA 2I9IA 4NXME 5ADZA 2EMZA 5A2QC 1ZBQA 2YWQA 4WYQB 1ZR9A 2N3GA 2NUEA 2EPCA 5A6AA 3L00A 1DI2A 2VE7C 1N33E 3KWRA 1WXRA 4DR3E 3H09A 1YPNA 2YU5A 1KYQA 2E5LE 2YRHA 2MC6A 2YT4A 4DV3E 4DV7E 4X8WA 5TSEA 4DR4E 3JTZA 4BC7A 3BIDA 1ZAAC 3BGHA 1JK1A 2EOOA 1DQ3A 1WHQA 2EL4A 2LTRA 4O24A 4DV4E 2NA2A 1GQEA 1T4LB 2LJHA 4JI0E 2EPNA 4AQYE 2V87A 2L8TA 2L3CA 1A1IA 2EMGA 1MGTA 1T4OA 3P1XA 2LJUA 2PRTA 4JI5E 3ADGA 1N32E 4M30A 2E72A 2JR1A 4L8NA 1AH5A 2BBGA 2EM9A 4DR1E 2KONA 1UBDC 4LTYA 4R2PA 2EQ0A 4YY3E 1BBGA 1HNXE 1YUJA 4LFAE 2EN4A 1T38A 2EN2A 4I8OA 2JOXA 2KHXA 2R1FA 1YUIA 2DGCA 4JV5E 4GKKE 4MLVA 1NEIA 2YU8A 2FTXB 2F4VE 3K6QA 2VQFE 1MEYC 4F6NA 4F9BB 1N34E 2E1MA 1UILA 2NUFA 4WSPA 2L2MA 4IS1C 3IWDA 1TN9A 5A6JA 2EOEA 2EOQA 2DIXA 2YZTA 1XMOE 5A6KA 2EP3A 4DV6E 1SFEA 4OX9E 2DLQA 5KL2A 2ZM6E 1A1JA 4DUZE 2DB2A 2HGHA 3OMLA 5AE3A 3DJWA 2MC5A 1A1GA 3C6MA 4Q35B 2UUCE 2N8XA 2MKNA 1STUA 1AAYA 4M9VC 1I94E 1HNWE 2JPAA 4P78A 2CSHA 4R2CA 3LLHA 4GKJE 3OTOE 4DUYE 2EPUA 2RS6A 3ADJA 3JU0A 3HXLA 4J8ZA 5KL4A 2ENHA 2B7TA 2L33A 2BB8A 4JI8E 1TF3A 2EMLA 3HPZA 3THNA 5KL7A 2UXBE 2EN3A 2JVAA 2EM6A 4LF9E 1GTKA 2EZ6A 2EPRA 2ENAA 3IWCA 3VHTB 4LU9A 1A1FA 1EKZA 2EOXA 5LMUE 2EPOA 1N36E 2V83A 4LF6E 2YTJA 4WXCA 3THOB 2EOSA 2EL5A 1PJTA 2EOJA 4ZYDA 1YYWA 1P47A 2ODRC 4HTGA 3F6GA 4BMJA 3J81C 2VQEE 3EPKA 3KZZA 5AE2A 2GPIA 1BBOA 4F2JC 2FGGA 2EOFA 2LBSB 3HTXA 2UUAE 2M1SA 2V85A 1B69A 1ZBTA 3MHSC 2EMCA 2EM5A 2JXPA 4DR2E 2EPAA 3LMLA 1XNQE 2YTPA 5AASA 4DV1E 1X6FA 4F9AB 1T4NA 4R2EA 1IMUA 4ZYEA 2EN8A 3RMPA 2EQ1A 4NXNE 4O4KA 2UXDE 3HPSA 4DMIA 1HNZE 4B3ME 2H36X 4JYAE 1J26A 2M9AA 4L5NC 1YYKA 2EPKX 2L3JA 1X5WA 3JAMC 2NABA 4BHBA 2LE2A 4LF4E 5T6JA 5A6BA 1ZU1A 4BS9A 1FKAE 2EM0A 2EPLX 2B9DA 2KOUA 2JWOA 1PDAA 1QNTA 4HEIA 4LFCE 3QG5C 1FJGE 2J7JA 4ZYHA 4JI2E 1EH6A 2ENCA 4WPYA 2EPXA 5LMNE 4YHHE 2L6MA 3MSWA 2JY9A 1YYOA 2EWLA 2EMAA 4BBYA 2EN6A 2EOMA 4R2DA 2EE8A 2V86A 4NZVA 2LVHA 5IXMB 1A1KA 4P7DA 3EPLA 5KL5A 2Q8UA 2WBSA 2CT1A 2EORA 4FK5C 3VYYA 2G7HA 3BF2A 2YSPA 2V88A 4R2RA 1O0WA 4X65E 4WX9A 3KZYA 4MLQA 1X6EA 1RC7A 4JI6E 4DV0E 1EH7A 2R76A 3ADLA 4ZYGA 2LV2A 1BB8A 4DV5E 1WRJA 5AE1A 1G2DC 3IWBA 1KJKA 2DMIA 4WSGA 2EOHA 1HR0E 2D9HA 2LCEA 1IBLE 1IQOA 2VRDA 1EH8A 2ELYA 4NHRA 2YTNA 1IQSA 4X66E 2EPZA 4JI7E 2LTSA 2EMXA 2WBUA 2EOZA 4F6MA 2JYAA 1UN6B 2GHFA 2EPPA 2FV4B 3AV0A 2B3TB 4N4RB 4M2ZA 1TF6A 2EMBA 2K4VA 2JOBA 1YFHA 4GZNC 3J7Yp 2EM2A 4X9JA 4RHBB 2M7QA 3VK6A 3F6HA 2EOYA 1YZ9A 3J80C 5A6BD 4R8OA 2GLIA 4R2SA 2WCC3 2F8BA 2WZOA 3T1HE 4K0KE 1L4SA 1UHZA 4KWYA 2EN1A 5AC4A 2UXCE 4LF8E 2EMIA 2EPMX 1J5EE 3UK3C 1WHNA 4B3TE 1LLMC 4JI3E 2LRSA 2DRPA 2HJJA 3C6KA 1GZ6A 4JI4E 3M99B 2HHHE 1SR9A 2V89A 5IWAE 5KL3A 2UU9E 2YRKA 3T1YE 2LO3A 1X3CA 2DLKA 5AC5A 1RMDA 2EJ4A 2YTOA 4F54A 4O5GA 2N3HA 1N3GA 4Q28A 2L92A 2YTEA 3J7AG 4JI1E 4R2QA 5IV8B 1JK2A 1PJQA 4WFTA 1Z1BA 2EMYA 2EN7A 5FLXC 2YSOA 5LL6R 1F2IG 3ADIA 3FIGA 3BBGA 2RQLA 2IHR1 4O43A 3EPJA 2DSYA 2YTGA 2CTDA 4TUGA 4R2AA 1YSAC 2I13A 4KHPE 2B7VA 2L2KB 3EPHA 4DR7E 4DV2E 2YTDA 1RQ0A 2EM8A 1XMQE 1PJSA 4X62E 2YTQA 2ODRD 2MDRA 1A1LA 3MHHC 4B3SE 3DF6A 4DKKA 4B3RE 2EMFA 5DNYA 2NUGA 3C4BA 2JP9A 4LF7E 2YTIA 2VF1A 1X48A 1PKPA 4BC9A 3AUZA 1NCSA 2LMZA 2LUQA 2RPCA 2MKDA 2RSMA 4R03A 1X49A 1X6HA 4LFBE 4F9CB 2ADRA 1IBME 5F3WA 2EMWA 1DGCA 1G2FC 2YTFA 4GEQB 5BR8E 2WBTA 2K7IA 4M0VA 4BHCA 4TUIA 5A69A 2EM4A 4KZSA 3TQMA 4DR5E 3HQ1A 2CPNA 1WJPA 2RTXA 2DMYA 2ELZA 1XNRE 2MDGA 2EMHA 2RSIA 1X47A 5CFFE 2LT7A 2UUBE 1QU6A 3EQ1A 4OOGC 4RH8A 2EM3A 2EMKA
chains in the Genus database with same CATH topology
5LMNE 3T1YE 2ZM6E 4YHHE 2RS7A 2L6MA 4LF5E 3MSWA 4DUZE 3VYXA 2JY9A 1YYOA 2DB2A 2EWLA 2V8QB 4BBYA 3OMLA 5AE3A 2L2NA 3DJWA 2V86A 2LUPB 2MC5A 4F54A 2UUCE 2N3HA 4Q28A 2L92A 3J7AG 1STUA 1IBKE 4P7DA 4X64E 4JI1E 4BCAA 1I94E 1HNWE 2M4IA 4P78A 5IT9C 3LLHA 4DR6E 4GKJE 3ZOQB 3VYYA 3C4TA 3OTOE 4WFTA 2G7HA 4DUYE 4NXME 2RS6A 3ADJA 3JU0A 3HXLA 4J8ZA 5ADZA 5A2QC 1ZBQA 2B7TA 2UXDE 4WYQB 2L33A 2V88A 2N3GA 4JI8E 2NUEA 1O0WA 4X65E 5FLXC 1RC7A 3HPZA 4JI6E 1DI2A 2UXBE 2JVAA 5LL6R 4LF9E 4DV0E 2VE7C 3ADLA 1N33E 3ADIA 2EZ6A 3KWRA 3FIGA 1WXRA 2IHR1 2DSYA 4DR3E 3IWCA 3H09A 4LU9A 1EKZA 5LMUE 4DV5E 2E5LE 5AE1A 4TUGA 2V83A 1N36E 4LF6E 3IWBA 4KHPE 2MC6A 2B7VA 2YT4A 4DV3E 4DV7E 4X8WA 2L2KB 1HR0E 4DR4E 3JTZA 4BC7A 4DR7E 1IBLE 4DV2E 1DQ3A 1WHQA 2LTRA 1YYWA 2ODRC 4DV4E 1RQ0A 1GQEA 2NA2A 4X66E 3F6GA 1T4LB 4JI7E 2LJHA 4BMJA 4JI0E 3J81C 2VQEE 4AQYE 2LTSA 2V87A 2L8TA 1XMQE 4X62E 2L3CA 1T4OA 3P1XA 5AE2A 4JI5E 2ODRD 3ADGA 1N32E 4M30A 2MDRA 2FGGA 2JR1A 2FV4B 3DF6A 4DKKA 4B3SE 4B3RE 2LBSB 3HTXA 2UUAE 3AV0A 4L8NA 2B3TB 5DNYA 2NUGA 2M1SA 2V85A 4M2ZA 1ZBTA 3C4BA 4LF7E 2K4VA 2JOBA 4DR1E 2KONA 1X48A 2VF1A 3LMLA 4DR2E 4LTYA 1XNQE 5AASA 1PKPA 4YY3E 4BC9A 3J7Yp 1HNXE 4LFAE 4DV1E 3AUZA 2M7QA 3VK6A 4F9AB 1T4NA 2LMZA 3F6HA 2LUQA 2JOXA 2KHXA 2RSMA 4I8OA 1X49A 4R03A 3RMPA 1YZ9A 4F9CB 4NXNE 4LFBE 4GKKE 4JV5E 3J80C 3HPSA 4DMIA 1HNZE 4B3ME 2H36X 1IBME 4R8OA 5F3WA 4JYAE 1J26A 2FTXB 4GEQB 2F8BA 2WZOA 3T1HE 2F4VE 5BR8E 3K6QA 4K0KE 1UHZA 4L5NC 2VQFE 1YYKA 2UXCE 2L3JA 1N34E 4F9BB 3JAMC 2E1MA 1UILA 4M0VA 2LE2A 4WSPA 2NUFA 4LF4E 4TUIA 5T6JA 2L2MA 4LF8E 3IWDA 4KZSA 4DR5E 4BS9A 3HQ1A 1J5EE 1FKAE 2CPNA 1WHNA 4B3TE 4JI3E 2DMYA 2LRSA 2RTXA 2B9DA 2DIXA 2JWOA 2KOUA 2YZTA 1XMOE 1XNRE 1X47A 5CFFE 2UUBE 4LFCE 1FJGE 1QU6A 1GZ6A 4OOGC 4DV6E 4JI4E 2HHHE 4OX9E 1SR9A 4JI2E 2V89A 5IWAE 2UU9E 4WPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN E;  3T1Y E;  2ZM6 E;  4YHH E;  2RS7 A;  3VYX A;  4LF5 E;  4DUZ E;  2JY9 A;  1YYO A;  2DB2 A;  2L2N A;  2LUP B;  2UUC E;  2N3H A;  1STU A;  1IBK E;  4X64 E;  4JI1 E;  1I94 E;  1HNW E;  3LLH A;  4DR6 E;  4GKJ E;  3VYY A;  3C4T A;  3OTO E;  4WFT A;  4DUY E;  4NXM E;  2RS6 A;  3ADJ A;  2B7T A;  4WYQ B;  2L33 A;  2N3G A;  4JI8 E;  2NUE A;  1O0W A;  4X65 E;  1RC7 A;  4JI6 E;  1DI2 A;  2UXB E;  2JVA A;  4LF9 E;  4DV0 E;  3ADL A;  1N33 E;  3ADI A;  2EZ6 A;  2IHR 1;  4DR3 E;  1EKZ A;  5LMU E;  4DV5 E;  2E5L E;  1N36 E;  4LF6 E;  4KHP E;  2B7V A;  2YT4 A;  4DV3 E;  4DV7 E;  4X8W A;  2L2K B;  1HR0 E;  4DR4 E;  4DR7 E;  1IBL E;  4DV2 E;  1WHQ A;  2LTR A;  1YYW A;  4DV4 E;  1RQ0 A;  1GQE A;  2NA2 A;  4X66 E;  1T4L B;  4JI7 E;  2LJH A;  4JI0 E;  2VQE E;  4AQY E;  2LTS A;  1XMQ E;  4X62 E;  2L3C A;  1T4O A;  3P1X A;  1N32 E;  4JI5 E;  3ADG A;  4M30 A;  2MDR A;  4B3S E;  4DKK A;  4B3R E;  2LBS B;  3HTX A;  2UUA E;  2B3T B;  2NUG A;  4M2Z A;  1ZBT A;  3C4B A;  4LF7 E;  4DR1 E;  4DR2 E;  1X48 A;  1XNQ E;  1PKP A;  4YY3 E;  3J7Y p;  1HNX E;  4LFA E;  4DV1 E;  1T4N A;  2LUQ A;  2KHX A;  2RSM A;  1YZ9 A;  1X49 A;  4JV5 E;  4GKK E;  4LFB E;  4NXN E;  2UXD E;  1HNZ E;  4B3M E;  1IBM E;  4JYA E;  1J26 A;  3T1H E;  2F4V E;  5BR8 E;  4K0K E;  1UHZ A;  2VQF E;  1YYK A;  2UXC E;  2L3J A;  1N34 E;  1UIL A;  2NUF A;  4LF4 E;  2L2M A;  4LF8 E;  4DR5 E;  1J5E E;  1FKA E;  2CPN A;  1WHN A;  4B3T E;  4JI3 E;  2DMY A;  2LRS A;  2RTX A;  2DIX A;  1XNR E;  1XMO E;  1X47 A;  5CFF E;  2UUB E;  4LFC E;  1FJG E;  1QU6 A;  4OOG C;  4DV6 E;  4JI4 E;  2HHH E;  4OX9 E;  4JI2 E;  5IWA E;  2UU9 E; 
#chains in the Genus database with same CATH topology
 2A25 A;  1T39 A;  2RS7 A;  3VYX A;  4LF5 E;  2YRM A;  2V8Q B;  2L2N A;  2LUP B;  3ECR A;  5KL6 A;  2EL6 A;  2EM7 A;  2EQ3 A;  1IBK E;  4X64 E;  1A1H A;  4IJD A;  4BCA A;  2M4I A;  4WXD A;  2YPN A;  5IT9 C;  2HC5 A;  5LLQ A;  4DR6 E;  3ZOQ B;  2EOI A;  3C4T A;  2I9I A;  4NXM E;  5ADZ A;  2EMZ A;  5A2Q C;  1ZBQ A;  2YWQ A;  4WYQ B;  1ZR9 A;  2N3G A;  2NUE A;  2EPC A;  5A6A A;  3L00 A;  1DI2 A;  2VE7 C;  1N33 E;  3KWR A;  1WXR A;  4DR3 E;  3H09 A;  1YPN A;  2YU5 A;  1KYQ A;  2E5L E;  2YRH A;  2MC6 A;  2YT4 A;  4DV3 E;  4DV7 E;  4X8W A;  5TSE A;  4DR4 E;  3JTZ A;  4BC7 A;  3BID A;  1ZAA C;  3BGH A;  1JK1 A;  2EOO A;  1DQ3 A;  1WHQ A;  2EL4 A;  2LTR A;  4O24 A;  4DV4 E;  2NA2 A;  1GQE A;  1T4L B;  2LJH A;  4JI0 E;  2EPN A;  4AQY E;  2V87 A;  2L8T A;  2L3C A;  1A1I A;  2EMG A;  1MGT A;  1T4O A;  3P1X A;  2LJU A;  2PRT A;  4JI5 E;  3ADG A;  1N32 E;  4M30 A;  2E72 A;  2JR1 A;  4L8N A;  1AH5 A;  2BBG A;  2EM9 A;  4DR1 E;  2KON A;  1UBD C;  4LTY A;  4R2P A;  2EQ0 A;  4YY3 E;  1BBG A;  1HNX E;  1YUJ A;  4LFA E;  2EN4 A;  1T38 A;  2EN2 A;  4I8O A;  2JOX A;  2KHX A;  2R1F A;  1YUI A;  2DGC A;  4JV5 E;  4GKK E;  4MLV A;  1NEI A;  2YU8 A;  2FTX B;  2F4V E;  3K6Q A;  2VQF E;  1MEY C;  4F6N A;  4F9B B;  1N34 E;  2E1M A;  1UIL A;  2NUF A;  4WSP A;  2L2M A;  4IS1 C;  3IWD A;  1TN9 A;  5A6J A;  2EOE A;  2EOQ A;  2DIX A;  2YZT A;  1XMO E;  5A6K A;  2EP3 A;  4DV6 E;  1SFE A;  4OX9 E;  2DLQ A;  5KL2 A;  2ZM6 E;  1A1J A;  4DUZ E;  2DB2 A;  2HGH A;  3OML A;  5AE3 A;  3DJW A;  2MC5 A;  1A1G A;  3C6M A;  4Q35 B;  2UUC E;  2N8X A;  2MKN A;  1STU A;  1AAY A;  4M9V C;  1I94 E;  1HNW E;  2JPA A;  4P78 A;  2CSH A;  4R2C A;  3LLH A;  4GKJ E;  3OTO E;  4DUY E;  2EPU A;  2RS6 A;  3ADJ A;  3JU0 A;  3HXL A;  4J8Z A;  5KL4 A;  2ENH A;  2B7T A;  2L33 A;  2BB8 A;  4JI8 E;  1TF3 A;  2EML A;  3HPZ A;  3THN A;  5KL7 A;  2UXB E;  2EN3 A;  2JVA A;  2EM6 A;  4LF9 E;  1GTK A;  2EZ6 A;  2EPR A;  2ENA A;  3IWC A;  3VHT B;  4LU9 A;  1A1F A;  1EKZ A;  2EOX A;  5LMU E;  2EPO A;  1N36 E;  2V83 A;  4LF6 E;  2YTJ A;  4WXC A;  3THO B;  2EOS A;  2EL5 A;  1PJT A;  2EOJ A;  4ZYD A;  1YYW A;  1P47 A;  2ODR C;  4HTG A;  3F6G A;  4BMJ A;  3J81 C;  2VQE E;  3EPK A;  3KZZ A;  5AE2 A;  2GPI A;  1BBO A;  4F2J C;  2FGG A;  2EOF A;  2LBS B;  3HTX A;  2UUA E;  2M1S A;  2V85 A;  1B69 A;  1ZBT A;  3MHS C;  2EMC A;  2EM5 A;  2JXP A;  4DR2 E;  2EPA A;  3LML A;  1XNQ E;  2YTP A;  5AAS A;  4DV1 E;  1X6F A;  4F9A B;  1T4N A;  4R2E A;  1IMU A;  4ZYE A;  2EN8 A;  3RMP A;  2EQ1 A;  4NXN E;  4O4K A;  2UXD E;  3HPS A;  4DMI A;  1HNZ E;  4B3M E;  2H36 X;  4JYA E;  1J26 A;  2M9A A;  4L5N C;  1YYK A;  2EPK X;  2L3J A;  1X5W A;  3JAM C;  2NAB A;  4BHB A;  2LE2 A;  4LF4 E;  5T6J A;  5A6B A;  1ZU1 A;  4BS9 A;  1FKA E;  2EM0 A;  2EPL X;  2B9D A;  2KOU A;  2JWO A;  1PDA A;  1QNT A;  4HEI A;  4LFC E;  3QG5 C;  1FJG E;  2J7J A;  4ZYH A;  4JI2 E;  1EH6 A;  2ENC A;  4WPY A;  2EPX A;  5LMN E;  4YHH E;  2L6M A;  3MSW A;  2JY9 A;  1YYO A;  2EWL A;  2EMA A;  4BBY A;  2EN6 A;  2EOM A;  4R2D A;  2EE8 A;  2V86 A;  4NZV A;  2LVH A;  5IXM B;  1A1K A;  4P7D A;  3EPL A;  5KL5 A;  2Q8U A;  2WBS A;  2CT1 A;  2EOR A;  4FK5 C;  3VYY A;  2G7H A;  3BF2 A;  2YSP A;  2V88 A;  4R2R A;  1O0W A;  4X65 E;  4WX9 A;  3KZY A;  4MLQ A;  1X6E A;  1RC7 A;  4JI6 E;  4DV0 E;  1EH7 A;  2R76 A;  3ADL A;  4ZYG A;  2LV2 A;  1BB8 A;  4DV5 E;  1WRJ A;  5AE1 A;  1G2D C;  3IWB A;  1KJK A;  2DMI A;  4WSG A;  2EOH A;  1HR0 E;  2D9H A;  2LCE A;  1IBL E;  1IQO A;  2VRD A;  1EH8 A;  2ELY A;  4NHR A;  2YTN A;  1IQS A;  4X66 E;  2EPZ A;  4JI7 E;  2LTS A;  2EMX A;  2WBU A;  2EOZ A;  4F6M A;  2JYA A;  1UN6 B;  2GHF A;  2EPP A;  2FV4 B;  3AV0 A;  2B3T B;  4N4R B;  4M2Z A;  1TF6 A;  2EMB A;  2K4V A;  2JOB A;  1YFH A;  4GZN C;  3J7Y p;  2EM2 A;  4X9J A;  4RHB B;  2M7Q A;  3VK6 A;  3F6H A;  2EOY A;  1YZ9 A;  3J80 C;  5A6B D;  4R8O A;  2GLI A;  4R2S A;  2WCC 3;  2F8B A;  2WZO A;  3T1H E;  4K0K E;  1L4S A;  1UHZ A;  4KWY A;  2EN1 A;  5AC4 A;  2UXC E;  4LF8 E;  2EMI A;  2EPM X;  1J5E E;  3UK3 C;  1WHN A;  4B3T E;  1LLM C;  4JI3 E;  2LRS A;  2DRP A;  2HJJ A;  3C6K A;  1GZ6 A;  4JI4 E;  3M99 B;  2HHH E;  1SR9 A;  2V89 A;  5IWA E;  5KL3 A;  2UU9 E;  2YRK A;  3T1Y E;  2LO3 A;  1X3C A;  2DLK A;  5AC5 A;  1RMD A;  2EJ4 A;  2YTO A;  4F54 A;  4O5G A;  2N3H A;  1N3G A;  4Q28 A;  2L92 A;  2YTE A;  3J7A G;  4JI1 E;  4R2Q A;  5IV8 B;  1JK2 A;  1PJQ A;  4WFT A;  1Z1B A;  2EMY A;  2EN7 A;  5FLX C;  2YSO A;  5LL6 R;  1F2I G;  3ADI A;  3FIG A;  3BBG A;  2RQL A;  2IHR 1;  4O43 A;  3EPJ A;  2DSY A;  2YTG A;  2CTD A;  4TUG A;  4R2A A;  1YSA C;  2I13 A;  4KHP E;  2B7V A;  2L2K B;  3EPH A;  4DR7 E;  4DV2 E;  2YTD A;  1RQ0 A;  2EM8 A;  1XMQ E;  1PJS A;  4X62 E;  2YTQ A;  2ODR D;  2MDR A;  1A1L A;  3MHH C;  4B3S E;  3DF6 A;  4DKK A;  4B3R E;  2EMF A;  5DNY A;  2NUG A;  3C4B A;  2JP9 A;  4LF7 E;  2YTI A;  2VF1 A;  1X48 A;  1PKP A;  4BC9 A;  3AUZ A;  1NCS A;  2LMZ A;  2LUQ A;  2RPC A;  2MKD A;  2RSM A;  4R03 A;  1X49 A;  1X6H A;  4LFB E;  4F9C B;  2ADR A;  1IBM E;  5F3W A;  2EMW A;  1DGC A;  1G2F C;  2YTF A;  4GEQ B;  5BR8 E;  2WBT A;  2K7I A;  4M0V A;  4BHC A;  4TUI A;  5A69 A;  2EM4 A;  4KZS A;  3TQM A;  4DR5 E;  3HQ1 A;  2CPN A;  1WJP A;  2RTX A;  2DMY A;  2ELZ A;  1XNR E;  2MDG A;  2EMH A;  2RSI A;  1X47 A;  5CFF E;  2LT7 A;  2UUB E;  1QU6 A;  3EQ1 A;  4OOG C;  4RH8 A;  2EM3 A;  2EMK A; 
#chains in the Genus database with same CATH homology
 5LMN E;  3T1Y E;  2ZM6 E;  4YHH E;  2RS7 A;  2L6M A;  4LF5 E;  3MSW A;  4DUZ E;  3VYX A;  2JY9 A;  1YYO A;  2DB2 A;  2EWL A;  2V8Q B;  4BBY A;  3OML A;  5AE3 A;  2L2N A;  3DJW A;  2V86 A;  2LUP B;  2MC5 A;  4F54 A;  2UUC E;  2N3H A;  4Q28 A;  2L92 A;  3J7A G;  1STU A;  1IBK E;  4P7D A;  4X64 E;  4JI1 E;  4BCA A;  1I94 E;  1HNW E;  2M4I A;  4P78 A;  5IT9 C;  3LLH A;  4DR6 E;  4GKJ E;  3ZOQ B;  3VYY A;  3C4T A;  3OTO E;  4WFT A;  2G7H A;  4DUY E;  4NXM E;  2RS6 A;  3ADJ A;  3JU0 A;  3HXL A;  4J8Z A;  5ADZ A;  5A2Q C;  1ZBQ A;  2B7T A;  2UXD E;  4WYQ B;  2L33 A;  2V88 A;  2N3G A;  4JI8 E;  2NUE A;  1O0W A;  4X65 E;  5FLX C;  1RC7 A;  3HPZ A;  4JI6 E;  1DI2 A;  2UXB E;  2JVA A;  5LL6 R;  4LF9 E;  4DV0 E;  2VE7 C;  3ADL A;  1N33 E;  3ADI A;  2EZ6 A;  3KWR A;  3FIG A;  1WXR A;  2IHR 1;  2DSY A;  4DR3 E;  3IWC A;  3H09 A;  4LU9 A;  1EKZ A;  5LMU E;  4DV5 E;  2E5L E;  5AE1 A;  4TUG A;  2V83 A;  1N36 E;  4LF6 E;  3IWB A;  4KHP E;  2MC6 A;  2B7V A;  2YT4 A;  4DV3 E;  4DV7 E;  4X8W A;  2L2K B;  1HR0 E;  4DR4 E;  3JTZ A;  4BC7 A;  4DR7 E;  1IBL E;  4DV2 E;  1DQ3 A;  1WHQ A;  2LTR A;  1YYW A;  2ODR C;  4DV4 E;  1RQ0 A;  1GQE A;  2NA2 A;  4X66 E;  3F6G A;  1T4L B;  4JI7 E;  2LJH A;  4BMJ A;  4JI0 E;  3J81 C;  2VQE E;  4AQY E;  2LTS A;  2V87 A;  2L8T A;  1XMQ E;  4X62 E;  2L3C A;  1T4O A;  3P1X A;  5AE2 A;  4JI5 E;  2ODR D;  3ADG A;  1N32 E;  4M30 A;  2MDR A;  2FGG A;  2JR1 A;  2FV4 B;  3DF6 A;  4DKK A;  4B3S E;  4B3R E;  2LBS B;  3HTX A;  2UUA E;  3AV0 A;  4L8N A;  2B3T B;  5DNY A;  2NUG A;  2M1S A;  2V85 A;  4M2Z A;  1ZBT A;  3C4B A;  4LF7 E;  2K4V A;  2JOB A;  4DR1 E;  2KON A;  1X48 A;  2VF1 A;  3LML A;  4DR2 E;  4LTY A;  1XNQ E;  5AAS A;  1PKP A;  4YY3 E;  4BC9 A;  3J7Y p;  1HNX E;  4LFA E;  4DV1 E;  3AUZ A;  2M7Q A;  3VK6 A;  4F9A B;  1T4N A;  2LMZ A;  3F6H A;  2LUQ A;  2JOX A;  2KHX A;  2RSM A;  4I8O A;  1X49 A;  4R03 A;  3RMP A;  1YZ9 A;  4F9C B;  4NXN E;  4LFB E;  4GKK E;  4JV5 E;  3J80 C;  3HPS A;  4DMI A;  1HNZ E;  4B3M E;  2H36 X;  1IBM E;  4R8O A;  5F3W A;  4JYA E;  1J26 A;  2FTX B;  4GEQ B;  2F8B A;  2WZO A;  3T1H E;  2F4V E;  5BR8 E;  3K6Q A;  4K0K E;  1UHZ A;  4L5N C;  2VQF E;  1YYK A;  2UXC E;  2L3J A;  1N34 E;  4F9B B;  3JAM C;  2E1M A;  1UIL A;  4M0V A;  2LE2 A;  4WSP A;  2NUF A;  4LF4 E;  4TUI A;  5T6J A;  2L2M A;  4LF8 E;  3IWD A;  4KZS A;  4DR5 E;  4BS9 A;  3HQ1 A;  1J5E E;  1FKA E;  2CPN A;  1WHN A;  4B3T E;  4JI3 E;  2DMY A;  2LRS A;  2RTX A;  2B9D A;  2DIX A;  2JWO A;  2KOU A;  2YZT A;  1XMO E;  1XNR E;  1X47 A;  5CFF E;  2UUB E;  4LFC E;  1FJG E;  1QU6 A;  1GZ6 A;  4OOG C;  4DV6 E;  4JI4 E;  2HHH E;  4OX9 E;  1SR9 A;  4JI2 E;  2V89 A;  5IWA E;  2UU9 E;  4WPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...