3VYXA

Structural insights into risc assembly facilitated by dsrna binding domains of human rna helicase (dhx9)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
95
structure length
95
Chain Sequence
NAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into RISC assembly facilitated by dsRNA-binding domains of human RNA helicase A (DHX9)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
molecule keywords ATP-dependent RNA helicase A
total genus 24
structure length 95
sequence length 95
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3vyxA00
4DR2E 1T4NA 4DR1E 1I94E 4B3TE 1XMOE 4JI5E 2LBSB 2VQFE 4M2ZA 4DR7E 1WHNA 2L2MA 5LMUE 1EKZA 2ZM6E 4LF5E 1N34E 3P1XA 4K0KE 4AQYE 4JI0E 1N36E 1T4OA 4LFAE 2LRSA 2EZ6A 2UUAE 2UXCE 3VYXA 1FKAE 2UXDE 1IBKE 1J26A 1YYOA 4DV4E 2NUGA 1XNRE 4DUZE 4WFTA 3OTOE 2LTSA 1FJGE 2RS6A 2DMYA 5LMNE 2NUFA 4DR5E 1YZ9A 4DV0E 2HHHE 2MDRA 4DUYE 1X48A 2DB2A 1UHZA 1O0WA 2B7TA 4DV1E 2CPNA 2N3HA 1XNQE 1RQ0A 5CFFE 4B3ME 3J7Yp 2L3CA 4DV7E 2L3JA 5IWAE 2IHR1 4WYQB 1ZBTA 2UU9E 1RC7A 2NA2A 4X8WA 1YYKA 4X64E 2NUEA 4LF7E 2UUCE 4LF4E 4X66E 1T4LB 4OX9E 4JI1E 1YYWA 3HTXA 2KHXA 4X65E 2RSMA 2E5LE 2F4VE 1IBME 4DKKA 2VQEE 4X62E 4B3SE 4JYAE 4M30A 4KHPE 1HR0E 2L33A 4JI8E 2LUQA 4DV2E 4NXME 4YY3E 1X49A 4LF8E 1HNWE 1DI2A 1N33E 4JI3E 4LFCE 4GKKE 4JV5E 2B3TB 3LLHA 4DV6E 1X47A 4LF9E 2YT4A 1IBLE 4B3RE 3C4TA 4DV5E 2L2NA 2UXBE 3VYYA 2L2KB 1HNXE 5BR8E 4DR3E 1HNZE 2UUBE 2DIXA 3T1HE 3ADLA 2RTXA 4GKJE 2LTRA 4DR6E 2LUPB 3ADJA 2JY9A 4JI7E 4NXNE 4LFBE 4JI4E 3ADGA 3C4BA 1WHQA 1J5EE 4OOGC 4DV3E 4JI2E 1XMQE 4JI6E 1N32E 2LJHA 2RS7A 3T1YE 3ADIA 2B7VA 1GQEA 2N3GA 4LF6E 1QU6A 4DR4E 1STUA 1UILA 4YHHE 2JVAA 1PKPA
chains in the Genus database with same CATH superfamily
4NHRA 4BMJA 1WRJA 2ENHA 4NZVA 4IJDA 3LMLA 1N34E 2EMCA 2MKDA 5A2QC 4AQYE 4K0KE 2EPNA 2EN3A 4LFAE 1WJPA 2RQLA 2V83A 2EZ6A 2UUAE 2I13A 1YFHA 3EPLA 1J26A 2EPZA 1NCSA 5LMNE 2ELZA 4DR5E 2MDRA 3RMPA 1ZBQA 2JWOA 2EMXA 2VRDA 2LJUA 5FLXC 2EMGA 1YSAC 2CPNA 1XNQE 1EH8A 2B9DA 2DLQA 1L4SA 2UU9E 2CT1A 2V88A 5KL4A 4X8WA 5LL6R 2UUCE 4LF4E 1G2FC 4X66E 2NABA 2YTPA 3C6KA 2JOXA 2RSMA 4N4RB 3F6GA 3JU0A 1N3GA 2V85A 3KZZA 2GPIA 5KL5A 4WSPA 2EMAA 2YZTA 2D9HA 4MLQA 2WCC3 2ADRA 3KWRA 2EMLA 4DV2E 2DLKA 4BC7A 1X49A 4F9AB 4WX9A 1HNWE 2ODRD 1A1JA 4F9BB 4L8NA 4DV6E 1A1IA 4DMIA 1A1KA 2YU8A 2G7HA 4BHCA 2EOEA 3UK3C 1A1LA 5AE3A 1NEIA 1PJQA 2L2KB 2HGHA 2CTDA 2UUBE 2EQ3A 2YTDA 4DR6E 1QNTA 2JPAA 2JY9A 4LFBE 3M99B 2EJ4A 4ZYEA 1UN6B 2EOFA 3HQ1A 4OOGC 2YTEA 1WXRA 2YTQA 4JI2E 2YSPA 2DRPA 3EPKA 4JI6E 1N32E 2EM5A 4R03A 2EM9A 2YSOA 1GQEA 4LF6E 2EPLX 4MLVA 4DR4E 5AE1A 2VF1A 1UILA 2Q8UA 3C6MA 4TUGA 4DR2E 2ENAA 2YRMA 2M1SA 2YRHA 1T4NA 4DR1E 4B3TE 4JI5E 2VQFE 4M2ZA 1TF6A 4DR7E 2L2MA 5LMUE 1TF3A 1BBGA 2EMBA 4LF5E 2M9AA 2WBSA 2EOZA 2EPOA 3BF2A 1GZ6A 4O43A 2ENCA 4R2DA 4F6NA 2EOHA 1FKAE 1XNRE 5DNYA 2EMYA 2EOMA 4I8OA 2EOXA 1A1FA 1AAYA 2EPRA 4DUYE 2EN2A 1F2IG 4BC9A 1UHZA 1O0WA 2LO3A 2B7TA 3K6QA 2LMZA 2N3HA 1GTKA 1RQ0A 2EMKA 4O4KA 1IMUA 2M4IA 3OMLA 4F54A 4WYQB 1ZBTA 3DJWA 2EM2A 2NA2A 1YYKA 5A69A 2EPUA 1DGCA 4HTGA 1KJKA 2WBTA 2KHXA 4X65E 2F4VE 2PRTA 5F3WA 4WXCA 3F6HA 4DKKA 4X62E 4B3SE 2YTGA 4KHPE 1X6EA 2L33A 2LUQA 1X6FA 4LF8E 4GZNC 4O24A 4JV5E 3BGHA 5AASA 1DQ3A 1X47A 4IS1C 3ECRA 4X9JA 3AUZA 4R8OA 4B3RE 3VHTB 1SFEA 2EPCA 2L2NA 2UXBE 2EPKX 1P47A 2EOJA 4BHBA 5BR8E 5ADZA 4DR3E 2MC6A 2YTIA 1HNZE 2JR1A 3ADLA 2RTXA 4J8ZA 3VK6A 3TQMA 5AC5A 4JI4E 2EMWA 4RHBB 4P78A 2HJJA 3THOB 4F2JC 5LLQA 3JTZA 2EL6A 4P7DA 1X5WA 3BIDA 4WXDA 2EE8A 5KL3A 3BBGA 2B7VA 2N3GA 5KL2A 1QU6A 3HPZA 2EMHA 4YHHE 2YTOA 1XMOE 2LBSB 1WHNA 2EOOA 1EH7A 4LTYA 2M7QA 3P1XA 4JI0E 2ODRC 1T4OA 2EMZA 1N36E 3HPSA 1T38A 1KYQA 2LV2A 1AH5A 2BBGA 4TUIA 2UXDE 2F8BA 2ELYA 2GLIA 2L8TA 1ZAAC 2YPNA 4DV4E 3H09A 2FTXB 4DUZE 1G2DC 3EQ1A 3OTOE 2LE2A 2EOYA 2L6MA 2EL5A 1YZ9A 4DV0E 2N8XA 2HHHE 2EMFA 4M9VC 2EOSA 2KONA 1Z1BA 4R2RA 2E1MA 3J7Yp 2DSYA 2EQ0A 2L3CA 4DV7E 2L3JA 4BBYA 2IHR1 2K7IA 2EN7A 4X64E 2NUEA 4LF7E 4WSGA 5T6JA 1PJSA 2YTJA 2MKNA 4JI1E 4F9CB 2I9IA 2MC5A 1MGTA 2DMIA 2V8QB 2E5LE 3HTXA 2DGCA 4HEIA 1BB8A 2VE7C 2VQEE 4JYAE 1RMDA 3QG5C 4ZYHA 4JI8E 2EPXA 4NXME 1DI2A 1N33E 4R2AA 4JI3E 4LFCE 4GKKE 2CSHA 4LF9E 4DV5E 2EPPA 3IWDA 3VYYA 4R2PA 1YUJA 2V87A 3FIGA 4M0VA 2LCEA 1MEYC 4GKJE 1YPNA 2LTRA 2LUPB 2J7JA 2EL4A 3C4BA 1WHQA 1B69A 1J5EE 1IQSA 3EPHA 1XMQE 4R2SA 5A6AA 1EH6A 2LJHA 2JP9A 5AE2A 1TN9A 3JAMC 5A6BD 2BB8A 2EQ1A 2MDGA 2WZOA 1UBDC 2JVAA 1PKPA 2EOIA 3MSWA 2EMIA 1LLMC 1JK1A 1I94E 5A6JA 4KWYA 4GEQB 2JYAA 1EKZA 2ZM6E 2FGGA 5A6BA 2K4VA 2YTNA 1A1GA 4L5NC 2LVHA 2HC5A 2EPMX 2KOUA 2LRSA 4FK5C 4RH8A 2YU5A 4Q28A 3J7AG 4WPYA 5KL6A 3J81C 2UXCE 2EN4A 2R76A 3VYXA 3EPJA 1IBKE 1YYOA 2EOQA 3AV0A 2NUGA 4WFTA 2LTSA 1FJGE 2RS6A 2DMYA 3MHSC 3ZOQB 2NUFA 3KZYA 2EPAA 2EN1A 1JK2A 4R2CA 1X48A 2EP3A 2EM3A 2DB2A 1T39A 4DV1E 3MHHC 2YRKA 4BCAA 5CFFE 4B3ME 4KZSA 1SR9A 2YWQA 4F6MA 5TSEA 3IWBA 5IWAE 2EM0A 3HXLA 1RC7A 3J80C 2EN8A 2JOBA 1T4LB 1IQOA 4OX9E 1YYWA 3DF6A 2V89A 1A1HA 2EM8A 4Q35B 1IBME 4O5GA 5KL7A 3IWCA 3L00A 4M30A 1HR0E 2RPCA 4LU9A 1ZU1A 4YY3E 4BS9A 5AC4A 2H36X 1YUIA 2B3TB 3LLHA 4R2QA 2WBUA 5A6KA 2YT4A 2R1FA 1IBLE 1PJTA 2EM6A 3C4TA 5IXMB 2EM7A 4ZYGA 2FV4B 1HNXE 2GHFA 2EN6A 2DIXA 2EORA 3T1HE 1BBOA 3ADJA 4NXNE 4JI7E 3ADGA 3THNA 2V86A 2YTFA 1X6HA 2L92A 2RSIA 2EWLA 4DV3E 2LT7A 1X3CA 1ZR9A 2A25A 1PDAA 2JXPA 2RS7A 4R2EA 3T1YE 3ADIA 5IV8B 4ZYDA 2EM4A 2E72A 1STUA 5IT9C
chains in the Genus database with same CATH topology
3MSWA 4BMJA 4DR2E 2M1SA 1T4NA 4DR1E 1I94E 4B3TE 1XMOE 4JI5E 2LBSB 2VQFE 4M2ZA 4DR7E 1WHNA 2L2MA 4GEQB 5LMUE 4LTYA 1EKZA 2ZM6E 2FGGA 3LMLA 3P1XA 2M7QA 1N34E 4LF5E 2K4VA 5A2QC 4AQYE 4K0KE 4JI0E 4L5NC 2ODRC 1T4OA 1N36E 2KOUA 3HPSA 4LFAE 2LRSA 1GZ6A 2V83A 2EZ6A 2UUAE 4Q28A 3J7AG 4WPYA 3J81C 4TUIA 2UXCE 3VYXA 1FKAE 2F8BA 2UXDE 1IBKE 1J26A 2L8TA 1YYOA 3AV0A 4DV4E 2NUGA 3H09A 1XNRE 2FTXB 4WFTA 5DNYA 4DUZE 3OTOE 2LTSA 1FJGE 2RS6A 2DMYA 2LE2A 3ZOQB 5LMNE 2NUFA 2L6MA 4I8OA 4DR5E 1YZ9A 4DV0E 2HHHE 2MDRA 4DUYE 3RMPA 1ZBQA 2JWOA 2KONA 1X48A 4BC9A 1UHZA 1O0WA 2DB2A 2B7TA 3HTXA 5FLXC 3K6QA 2LMZA 2CPNA 2N3HA 4DV1E 1XNQE 1RQ0A 4BCAA 5CFFE 4B3ME 2B9DA 4KZSA 2E1MA 3J7Yp 1SR9A 2DSYA 2L3CA 4DV7E 2L3JA 2M4IA 3IWBA 4BBYA 5IWAE 2IHR1 3OMLA 4F54A 3HXLA 4WYQB 1ZBTA 2UU9E 3DJWA 1RC7A 2V88A 3J80C 2NA2A 4X8WA 1YYKA 5LL6R 4X64E 2NUEA 4LF7E 5T6JA 2UUCE 4LF4E 4X66E 2JOBA 1T4LB 4OX9E 2JOXA 4JI1E 4F9CB 2MC5A 2KHXA 2V8QB 4X65E 2RSMA 3DF6A 2V89A 3F6GA 3JU0A 2E5LE 5F3WA 1IBME 2F4VE 2V85A 3F6HA 4WSPA 4DKKA 2YZTA 2VE7C 2VQEE 4X62E 4B3SE 4JYAE 3IWCA 3KWRA 4M30A 4KHPE 1HR0E 2L33A 4LU9A 4JI8E 2LUQA 4DV2E 4NXME 4BC7A 4YY3E 1X49A 4LF8E 4BS9A 4F9AB 1HNWE 2H36X 2ODRD 1DI2A 1N33E 4JI3E 4LFCE 4GKKE 5AASA 4JV5E 4F9BB 2B3TB 3LLHA 4L8NA 4DV6E 1DQ3A 1X47A 4DMIA 4LF9E 2YT4A 1IBLE 4B3RE 3AUZA 4R8OA 3C4TA 4DV5E 2G7HA 2L2NA 5AE3A 3IWDA 3VYYA 2UXBE 2FV4B 2V87A 3FIGA 2L2KB 1HNXE 4M0VA 5BR8E 5ADZA 4DR3E 2MC6A 1HNZE 2UUBE 2DIXA 3T1HE 2JR1A 3ADLA 2RTXA 4GKJE 2LTRA 4J8ZA 3VK6A 2LUPB 4DR6E 3ADJA 2JY9A 4JI7E 4NXNE 4LFBE 4JI4E 3ADGA 3C4BA 4P78A 3HQ1A 1WHQA 2V86A 5IT9C 1J5EE 2L92A 2EWLA 4OOGC 4DV3E 1WXRA 4JI2E 1XMQE 3JTZA 4P7DA 4JI6E 1N32E 2LJHA 4R03A 5AE2A 2RS7A 3T1YE 3ADIA 2B7VA 1GQEA 2N3GA 4LF6E 1QU6A 3HPZA 3JAMC 1YYWA 5AE1A 4DR4E 2VF1A 1STUA 1UILA 2WZOA 4YHHE 4TUGA 2JVAA 1PKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 E;  1T4N A;  4DR1 E;  1I94 E;  4B3T E;  1XMO E;  4JI5 E;  2LBS B;  2VQF E;  4M2Z A;  4DR7 E;  1WHN A;  2L2M A;  5LMU E;  1EKZ A;  2ZM6 E;  4LF5 E;  1N34 E;  3P1X A;  4K0K E;  4AQY E;  4JI0 E;  1N36 E;  1T4O A;  4LFA E;  2LRS A;  2EZ6 A;  2UUA E;  2UXC E;  3VYX A;  1FKA E;  2UXD E;  1IBK E;  1J26 A;  1YYO A;  4DV4 E;  2NUG A;  1XNR E;  4DUZ E;  4WFT A;  3OTO E;  2LTS A;  1FJG E;  2RS6 A;  2DMY A;  5LMN E;  2NUF A;  4DR5 E;  1YZ9 A;  4DV0 E;  2HHH E;  2MDR A;  4DUY E;  1X48 A;  2DB2 A;  1UHZ A;  1O0W A;  2B7T A;  4DV1 E;  2CPN A;  2N3H A;  1XNQ E;  1RQ0 A;  5CFF E;  4B3M E;  3J7Y p;  2L3C A;  4DV7 E;  2L3J A;  5IWA E;  2IHR 1;  4WYQ B;  1ZBT A;  2UU9 E;  1RC7 A;  2NA2 A;  4X8W A;  1YYK A;  4X64 E;  2NUE A;  4LF7 E;  2UUC E;  4LF4 E;  4X66 E;  1T4L B;  4OX9 E;  4JI1 E;  1YYW A;  3HTX A;  2KHX A;  4X65 E;  2RSM A;  2E5L E;  2F4V E;  1IBM E;  4DKK A;  2VQE E;  4X62 E;  4B3S E;  4JYA E;  4M30 A;  4KHP E;  1HR0 E;  2L33 A;  4JI8 E;  2LUQ A;  4DV2 E;  4NXM E;  4YY3 E;  1X49 A;  4LF8 E;  1HNW E;  1DI2 A;  1N33 E;  4JI3 E;  4LFC E;  4GKK E;  4JV5 E;  2B3T B;  3LLH A;  4DV6 E;  1X47 A;  4LF9 E;  2YT4 A;  1IBL E;  4B3R E;  3C4T A;  4DV5 E;  2L2N A;  2UXB E;  3VYY A;  2L2K B;  1HNX E;  5BR8 E;  4DR3 E;  1HNZ E;  2UUB E;  2DIX A;  3T1H E;  3ADL A;  2RTX A;  4GKJ E;  2LTR A;  4DR6 E;  2LUP B;  3ADJ A;  2JY9 A;  4JI7 E;  4NXN E;  4LFB E;  4JI4 E;  3ADG A;  3C4B A;  1WHQ A;  1J5E E;  4OOG C;  4DV3 E;  4JI2 E;  1XMQ E;  4JI6 E;  1N32 E;  2LJH A;  2RS7 A;  3T1Y E;  3ADI A;  2B7V A;  1GQE A;  2N3G A;  4LF6 E;  1QU6 A;  4DR4 E;  1STU A;  1UIL A;  4YHH E;  2JVA A;  1PKP A; 
#chains in the Genus database with same CATH topology
 4NHR A;  4BMJ A;  1WRJ A;  2ENH A;  4NZV A;  4IJD A;  3LML A;  1N34 E;  2EMC A;  2MKD A;  5A2Q C;  4AQY E;  4K0K E;  2EPN A;  2EN3 A;  4LFA E;  1WJP A;  2RQL A;  2V83 A;  2EZ6 A;  2UUA E;  2I13 A;  1YFH A;  3EPL A;  1J26 A;  2EPZ A;  1NCS A;  5LMN E;  2ELZ A;  4DR5 E;  2MDR A;  3RMP A;  1ZBQ A;  2JWO A;  2EMX A;  2VRD A;  2LJU A;  5FLX C;  2EMG A;  1YSA C;  2CPN A;  1XNQ E;  1EH8 A;  2B9D A;  2DLQ A;  1L4S A;  2UU9 E;  2CT1 A;  2V88 A;  5KL4 A;  4X8W A;  5LL6 R;  2UUC E;  4LF4 E;  1G2F C;  4X66 E;  2NAB A;  2YTP A;  3C6K A;  2JOX A;  2RSM A;  4N4R B;  3F6G A;  3JU0 A;  1N3G A;  2V85 A;  3KZZ A;  2GPI A;  5KL5 A;  4WSP A;  2EMA A;  2YZT A;  2D9H A;  4MLQ A;  2WCC 3;  2ADR A;  3KWR A;  2EML A;  4DV2 E;  2DLK A;  4BC7 A;  1X49 A;  4F9A B;  4WX9 A;  1HNW E;  2ODR D;  1A1J A;  4F9B B;  4L8N A;  4DV6 E;  1A1I A;  4DMI A;  1A1K A;  2YU8 A;  2G7H A;  4BHC A;  2EOE A;  3UK3 C;  1A1L A;  5AE3 A;  1NEI A;  1PJQ A;  2L2K B;  2HGH A;  2CTD A;  2UUB E;  2EQ3 A;  2YTD A;  4DR6 E;  1QNT A;  2JPA A;  2JY9 A;  4LFB E;  3M99 B;  2EJ4 A;  4ZYE A;  1UN6 B;  2EOF A;  3HQ1 A;  4OOG C;  2YTE A;  1WXR A;  2YTQ A;  4JI2 E;  2YSP A;  2DRP A;  3EPK A;  4JI6 E;  1N32 E;  2EM5 A;  4R03 A;  2EM9 A;  2YSO A;  1GQE A;  4LF6 E;  2EPL X;  4MLV A;  4DR4 E;  5AE1 A;  2VF1 A;  1UIL A;  2Q8U A;  3C6M A;  4TUG A;  4DR2 E;  2ENA A;  2YRM A;  2M1S A;  2YRH A;  1T4N A;  4DR1 E;  4B3T E;  4JI5 E;  2VQF E;  4M2Z A;  1TF6 A;  4DR7 E;  2L2M A;  5LMU E;  1TF3 A;  1BBG A;  2EMB A;  4LF5 E;  2M9A A;  2WBS A;  2EOZ A;  2EPO A;  3BF2 A;  1GZ6 A;  4O43 A;  2ENC A;  4R2D A;  4F6N A;  2EOH A;  1FKA E;  1XNR E;  5DNY A;  2EMY A;  2EOM A;  4I8O A;  2EOX A;  1A1F A;  1AAY A;  2EPR A;  4DUY E;  2EN2 A;  1F2I G;  4BC9 A;  1UHZ A;  1O0W A;  2LO3 A;  2B7T A;  3K6Q A;  2LMZ A;  2N3H A;  1GTK A;  1RQ0 A;  2EMK A;  4O4K A;  1IMU A;  2M4I A;  3OML A;  4F54 A;  4WYQ B;  1ZBT A;  3DJW A;  2EM2 A;  2NA2 A;  1YYK A;  5A69 A;  2EPU A;  1DGC A;  4HTG A;  1KJK A;  2WBT A;  2KHX A;  4X65 E;  2F4V E;  2PRT A;  5F3W A;  4WXC A;  3F6H A;  4DKK A;  4X62 E;  4B3S E;  2YTG A;  4KHP E;  1X6E A;  2L33 A;  2LUQ A;  1X6F A;  4LF8 E;  4GZN C;  4O24 A;  4JV5 E;  3BGH A;  5AAS A;  1DQ3 A;  1X47 A;  4IS1 C;  3ECR A;  4X9J A;  3AUZ A;  4R8O A;  4B3R E;  3VHT B;  1SFE A;  2EPC A;  2L2N A;  2UXB E;  2EPK X;  1P47 A;  2EOJ A;  4BHB A;  5BR8 E;  5ADZ A;  4DR3 E;  2MC6 A;  2YTI A;  1HNZ E;  2JR1 A;  3ADL A;  2RTX A;  4J8Z A;  3VK6 A;  3TQM A;  5AC5 A;  4JI4 E;  2EMW A;  4RHB B;  4P78 A;  2HJJ A;  3THO B;  4F2J C;  5LLQ A;  3JTZ A;  2EL6 A;  4P7D A;  1X5W A;  3BID A;  4WXD A;  2EE8 A;  5KL3 A;  3BBG A;  2B7V A;  2N3G A;  5KL2 A;  1QU6 A;  3HPZ A;  2EMH A;  4YHH E;  2YTO A;  1XMO E;  2LBS B;  1WHN A;  2EOO A;  1EH7 A;  4LTY A;  2M7Q A;  3P1X A;  4JI0 E;  2ODR C;  1T4O A;  2EMZ A;  1N36 E;  3HPS A;  1T38 A;  1KYQ A;  2LV2 A;  1AH5 A;  2BBG A;  4TUI A;  2UXD E;  2F8B A;  2ELY A;  2GLI A;  2L8T A;  1ZAA C;  2YPN A;  4DV4 E;  3H09 A;  2FTX B;  4DUZ E;  1G2D C;  3EQ1 A;  3OTO E;  2LE2 A;  2EOY A;  2L6M A;  2EL5 A;  1YZ9 A;  4DV0 E;  2N8X A;  2HHH E;  2EMF A;  4M9V C;  2EOS A;  2KON A;  1Z1B A;  4R2R A;  2E1M A;  3J7Y p;  2DSY A;  2EQ0 A;  2L3C A;  4DV7 E;  2L3J A;  4BBY A;  2IHR 1;  2K7I A;  2EN7 A;  4X64 E;  2NUE A;  4LF7 E;  4WSG A;  5T6J A;  1PJS A;  2YTJ A;  2MKN A;  4JI1 E;  4F9C B;  2I9I A;  2MC5 A;  1MGT A;  2DMI A;  2V8Q B;  2E5L E;  3HTX A;  2DGC A;  4HEI A;  1BB8 A;  2VE7 C;  2VQE E;  4JYA E;  1RMD A;  3QG5 C;  4ZYH A;  4JI8 E;  2EPX A;  4NXM E;  1DI2 A;  1N33 E;  4R2A A;  4JI3 E;  4LFC E;  4GKK E;  2CSH A;  4LF9 E;  4DV5 E;  2EPP A;  3IWD A;  3VYY A;  4R2P A;  1YUJ A;  2V87 A;  3FIG A;  4M0V A;  2LCE A;  1MEY C;  4GKJ E;  1YPN A;  2LTR A;  2LUP B;  2J7J A;  2EL4 A;  3C4B A;  1WHQ A;  1B69 A;  1J5E E;  1IQS A;  3EPH A;  1XMQ E;  4R2S A;  5A6A A;  1EH6 A;  2LJH A;  2JP9 A;  5AE2 A;  1TN9 A;  3JAM C;  5A6B D;  2BB8 A;  2EQ1 A;  2MDG A;  2WZO A;  1UBD C;  2JVA A;  1PKP A;  2EOI A;  3MSW A;  2EMI A;  1LLM C;  1JK1 A;  1I94 E;  5A6J A;  4KWY A;  4GEQ B;  2JYA A;  1EKZ A;  2ZM6 E;  2FGG A;  5A6B A;  2K4V A;  2YTN A;  1A1G A;  4L5N C;  2LVH A;  2HC5 A;  2EPM X;  2KOU A;  2LRS A;  4FK5 C;  4RH8 A;  2YU5 A;  4Q28 A;  3J7A G;  4WPY A;  5KL6 A;  3J81 C;  2UXC E;  2EN4 A;  2R76 A;  3VYX A;  3EPJ A;  1IBK E;  1YYO A;  2EOQ A;  3AV0 A;  2NUG A;  4WFT A;  2LTS A;  1FJG E;  2RS6 A;  2DMY A;  3MHS C;  3ZOQ B;  2NUF A;  3KZY A;  2EPA A;  2EN1 A;  1JK2 A;  4R2C A;  1X48 A;  2EP3 A;  2EM3 A;  2DB2 A;  1T39 A;  4DV1 E;  3MHH C;  2YRK A;  4BCA A;  5CFF E;  4B3M E;  4KZS A;  1SR9 A;  2YWQ A;  4F6M A;  5TSE A;  3IWB A;  5IWA E;  2EM0 A;  3HXL A;  1RC7 A;  3J80 C;  2EN8 A;  2JOB A;  1T4L B;  1IQO A;  4OX9 E;  1YYW A;  3DF6 A;  2V89 A;  1A1H A;  2EM8 A;  4Q35 B;  1IBM E;  4O5G A;  5KL7 A;  3IWC A;  3L00 A;  4M30 A;  1HR0 E;  2RPC A;  4LU9 A;  1ZU1 A;  4YY3 E;  4BS9 A;  5AC4 A;  2H36 X;  1YUI A;  2B3T B;  3LLH A;  4R2Q A;  2WBU A;  5A6K A;  2YT4 A;  2R1F A;  1IBL E;  1PJT A;  2EM6 A;  3C4T A;  5IXM B;  2EM7 A;  4ZYG A;  2FV4 B;  1HNX E;  2GHF A;  2EN6 A;  2DIX A;  2EOR A;  3T1H E;  1BBO A;  3ADJ A;  4NXN E;  4JI7 E;  3ADG A;  3THN A;  2V86 A;  2YTF A;  1X6H A;  2L92 A;  2RSI A;  2EWL A;  4DV3 E;  2LT7 A;  1X3C A;  1ZR9 A;  2A25 A;  1PDA A;  2JXP A;  2RS7 A;  4R2E A;  3T1Y E;  3ADI A;  5IV8 B;  4ZYD A;  2EM4 A;  2E72 A;  1STU A;  5IT9 C; 
#chains in the Genus database with same CATH homology
 3MSW A;  4BMJ A;  4DR2 E;  2M1S A;  1T4N A;  4DR1 E;  1I94 E;  4B3T E;  1XMO E;  4JI5 E;  2LBS B;  2VQF E;  4M2Z A;  4DR7 E;  1WHN A;  2L2M A;  4GEQ B;  5LMU E;  4LTY A;  1EKZ A;  2ZM6 E;  2FGG A;  3LML A;  3P1X A;  2M7Q A;  1N34 E;  4LF5 E;  2K4V A;  5A2Q C;  4AQY E;  4K0K E;  4JI0 E;  4L5N C;  2ODR C;  1T4O A;  1N36 E;  2KOU A;  3HPS A;  4LFA E;  2LRS A;  1GZ6 A;  2V83 A;  2EZ6 A;  2UUA E;  4Q28 A;  3J7A G;  4WPY A;  3J81 C;  4TUI A;  2UXC E;  3VYX A;  1FKA E;  2F8B A;  2UXD E;  1IBK E;  1J26 A;  2L8T A;  1YYO A;  3AV0 A;  4DV4 E;  2NUG A;  3H09 A;  1XNR E;  2FTX B;  4WFT A;  5DNY A;  4DUZ E;  3OTO E;  2LTS A;  1FJG E;  2RS6 A;  2DMY A;  2LE2 A;  3ZOQ B;  5LMN E;  2NUF A;  2L6M A;  4I8O A;  4DR5 E;  1YZ9 A;  4DV0 E;  2HHH E;  2MDR A;  4DUY E;  3RMP A;  1ZBQ A;  2JWO A;  2KON A;  1X48 A;  4BC9 A;  1UHZ A;  1O0W A;  2DB2 A;  2B7T A;  3HTX A;  5FLX C;  3K6Q A;  2LMZ A;  2CPN A;  2N3H A;  4DV1 E;  1XNQ E;  1RQ0 A;  4BCA A;  5CFF E;  4B3M E;  2B9D A;  4KZS A;  2E1M A;  3J7Y p;  1SR9 A;  2DSY A;  2L3C A;  4DV7 E;  2L3J A;  2M4I A;  3IWB A;  4BBY A;  5IWA E;  2IHR 1;  3OML A;  4F54 A;  3HXL A;  4WYQ B;  1ZBT A;  2UU9 E;  3DJW A;  1RC7 A;  2V88 A;  3J80 C;  2NA2 A;  4X8W A;  1YYK A;  5LL6 R;  4X64 E;  2NUE A;  4LF7 E;  5T6J A;  2UUC E;  4LF4 E;  4X66 E;  2JOB A;  1T4L B;  4OX9 E;  2JOX A;  4JI1 E;  4F9C B;  2MC5 A;  2KHX A;  2V8Q B;  4X65 E;  2RSM A;  3DF6 A;  2V89 A;  3F6G A;  3JU0 A;  2E5L E;  5F3W A;  1IBM E;  2F4V E;  2V85 A;  3F6H A;  4WSP A;  4DKK A;  2YZT A;  2VE7 C;  2VQE E;  4X62 E;  4B3S E;  4JYA E;  3IWC A;  3KWR A;  4M30 A;  4KHP E;  1HR0 E;  2L33 A;  4LU9 A;  4JI8 E;  2LUQ A;  4DV2 E;  4NXM E;  4BC7 A;  4YY3 E;  1X49 A;  4LF8 E;  4BS9 A;  4F9A B;  1HNW E;  2H36 X;  2ODR D;  1DI2 A;  1N33 E;  4JI3 E;  4LFC E;  4GKK E;  5AAS A;  4JV5 E;  4F9B B;  2B3T B;  3LLH A;  4L8N A;  4DV6 E;  1DQ3 A;  1X47 A;  4DMI A;  4LF9 E;  2YT4 A;  1IBL E;  4B3R E;  3AUZ A;  4R8O A;  3C4T A;  4DV5 E;  2G7H A;  2L2N A;  5AE3 A;  3IWD A;  3VYY A;  2UXB E;  2FV4 B;  2V87 A;  3FIG A;  2L2K B;  1HNX E;  4M0V A;  5BR8 E;  5ADZ A;  4DR3 E;  2MC6 A;  1HNZ E;  2UUB E;  2DIX A;  3T1H E;  2JR1 A;  3ADL A;  2RTX A;  4GKJ E;  2LTR A;  4J8Z A;  3VK6 A;  2LUP B;  4DR6 E;  3ADJ A;  2JY9 A;  4JI7 E;  4NXN E;  4LFB E;  4JI4 E;  3ADG A;  3C4B A;  4P78 A;  3HQ1 A;  1WHQ A;  2V86 A;  5IT9 C;  1J5E E;  2L92 A;  2EWL A;  4OOG C;  4DV3 E;  1WXR A;  4JI2 E;  1XMQ E;  3JTZ A;  4P7D A;  4JI6 E;  1N32 E;  2LJH A;  4R03 A;  5AE2 A;  2RS7 A;  3T1Y E;  3ADI A;  2B7V A;  1GQE A;  2N3G A;  4LF6 E;  1QU6 A;  3HPZ A;  3JAM C;  1YYW A;  5AE1 A;  4DR4 E;  2VF1 A;  1STU A;  1UIL A;  2WZO A;  4YHH E;  4TUG A;  2JVA A;  1PKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...