3VZAA

Crystal structure of the chicken spc24-spc25 globular domain in complex with cenp-t peptide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
b'RVERLCKSKELFEERLGLEIRRIHNEQLQFIFRHIDHKDPDKPYMFTLSINEQGDYEVTSCTPPLDCISEFQLKVRETNNFSAFIANIRKAFTALSFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
publication title CENP-T provides a structural platform for outer kinetochore assembly
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cell cycle
total genus 28
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08234 Spindle_Spc25 Chromosome segregation protein Spc25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.457.50 Alpha Beta 2-Layer Sandwich Copper Amine Oxidase; Chain A, domain 1 Copper Amine Oxidase; Chain A, domain 1 3vzaA00
5T6JB 3VZAA 3VZ9B 4GEQA 2FV4A 5TCSD 2FTXA
chains in the Genus database with same CATH superfamily
2W0QA 5T6JB 3VZAA 2WO0A 1D6YA 2FV4A 5TCSD 1JRQA 1OACA 3K1LA 2WOFA 1DYUA 3VZ9B 4DZOA 2FTXA 1D6UA 2WOHA 1D6ZA 1SPUA 2WGQA 1QAKA 1QAFA 4GEQA 1QALA 1LVNA
chains in the Genus database with same CATH topology
5T6JB 3VZAA 3VZ9B 3K1LA 4GEQA 2FV4A 5TCSD 4DZOA 2FTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T6J B;  3VZA A;  3VZ9 B;  4GEQ A;  2FV4 A;  5TCS D;  2FTX A; 
#chains in the Genus database with same CATH topology
 2W0Q A;  5T6J B;  3VZA A;  2WO0 A;  1D6Y A;  2FV4 A;  5TCS D;  1JRQ A;  1OAC A;  3K1L A;  2WOF A;  1DYU A;  3VZ9 B;  4DZO A;  2FTX A;  1D6U A;  2WOH A;  1D6Z A;  1SPU A;  2WGQ A;  1QAK A;  1QAF A;  4GEQ A;  1QAL A;  1LVN A; 
#chains in the Genus database with same CATH homology
 5T6J B;  3VZA A;  3VZ9 B;  3K1L A;  4GEQ A;  2FV4 A;  5TCS D;  4DZO A;  2FTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...