3VZHA

Crystal structure of crispr-associated protein
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
214
structure length
194
Chain Sequence
GHMYRSRDFYVRVSGQRALFTNPARSSYSVPTRQALNGIVDAIYYKPTFTNIVTEVKVINQIQTELQGVRSYVSYLSDVVYLIKFHFVWNEDRKDLNSDRLPAKHEAIMERSIRKGGRRDVFLGTRECLGLVDDISQEEYETTVSYYNGVNIDLGIMFHSFAYPTPLKSYFTKTVMKNGVITFKAQSECDIVNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conservation and Variability in the Structure and Function of the Cas5d Endoribonuclease in the CRISPR-Mediated Microbial Immune System
pubmed doi rcsb
source organism Streptococcus pyogenes serotype m1
molecule tags Dna binding protein
molecule keywords Putative uncharacterized protein
total genus 52
structure length 194
sequence length 214
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09704 Cas_Cas5d CRISPR-associated protein (Cas_Cas5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2660 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vzhA00
5H9FJ 5CD4H 3VZIA 4QYZJ 3KG4A 5H9EJ 4F3MA 4U7UK 4R0JA 4N77A 3VZHA
chains in the Genus database with same CATH superfamily
2DHXA 1EHWA 3G82B 4PKDB 5LOQA 3TUIC 3C6TA 2ASJA 2UUTA 1TL4A 2VFUA 7AT1B 3GILA 1JLFA 3NS5A 1H0HB 2AX1A 4WZMA 3PJ9A 1VMBA 1VQ9S 3HK2A 1AA1B 4OHWA 1KC8T 1X4HA 2IBKA 2IVMA 3VVUA 2EEYA 3HXMA 4B3MJ 3MAQA 3M6UA 4LF9J 4WKRA 1BD6A 4FYVB 4DV6J 3DHWC 4DL6A 1MLAA 4K4XA 4DR7J 2VFRA 4HDGA 1U1PA 2HYIB 3NNCA 4OZ0A 2MB0B 1RADB 2YKQA 1Z2ZA 5DLGA 1R6YA 4DV0F 3UCGA 1M5OC 3R5BA 5C25B 3BGLA 3BH6B 4B08A 2Y9HA 5CA5A 1PC4A 3HJVA 5A8WA 2MY7A 3I96A 3CJRA 4DEZA 2MHNA 4JI2F 1RTIA 4ZA1A 1HNWJ 1O5JA 2LQJA 1KOHA 2J5AA 2FIUA 2YNHB 2ZHAA 5JVHQ 1DRZA 1WHWA 5ETNA 2E5GA 1X0FA 3W8PA 2ROPA 1HYSA 5JVGQ 1F2HA 3TAQA 3KK3B 4K2JA 2IMOA 2BABA 1FWLA 4UOGA 1D09B 2XCPA 2BE9B 2UUAJ 2OPPA 1ZA2B 4KGXB 1E6YA 1NUEA 4WF9Q 4OV1A 3SMZA 1K1SA 2P9EA 1P6TA 4CCHA 1X5SA 1PYTA 3B54A 1RTZA 3EXCX 5G0RA 1RT6B 3QATA 3J7YU 3VWSA 1YIJS 2ZC4A 3DU5A 3QLHB 2F7VA 5GAEI 5C2CA 4Z7YA 1N5TA 2CNLB 3FZBA 3BKFA 4C11B 2MDAA 4M94A 1N32J 2PI4A 3MR7A 1ZAWA 4EBDA 1M5KC 1R8PA 2A2DA 3FDSA 1RWWB 1UP1A 4QIFA 3OR1A 5CHCB 3TYTA 2N3OA 4LBPA 1Q53A 3KFWX 5F8IA 5DG8A 2HFUA 5FLXU 1ZZFA 3PZPA 2HVZA 2VB6A 1XNRF 4JYAJ 1YX2A 1SJRA 3CULA 4ZP6A 1Q4RA 3D4JA 3PKMA 3E01B 2NSCA 4EI2A 3HF5A 1U1NA 3BZQA 4PYDA 4YY3J 3J80Y 1T05A 2KZZA 1SQEA 1BLUA 2HHPA 4XDDA 1UA0A 4ZMMA 2AGQA 4XTTA 2CUYA 3HHLA 1FJEB 4KV8B 1PYOB 1RXOB 2FVCA 2ZD1A 2ZBPA 3EE3A 2B56A 4PG5A 5H9EK 3T19A 2KJWA 3H2UB 1GT8A 4PPZA 5CZXA 5THWA 4B9SA 2Z58B 2BDPA 2XS7A 2FTRA 4G3IA 4R0EA 2XMKA 3I4HX 2AHOB 3M8YA 2A3JA 2CG4A 2HVEA 2ZUGA 2FJVA 4RR5A 1QSYA 1UL3A 4UT4A 1I5OB 1HW9A 1IM4A 4CLLA 4FBUA 2ZJRQ 2R7SA 2RF2A 1J5OA 2GMLA 5HJYA 2WSEC 3L4BC 4WFZA 5K20B 3RYLA 3QAEA 1X9WA 1HNXJ 2Z4PA 1U1QA 2VBXA 1R8HA 3PNIA 1VYAA 2R2UA 1VQMS 1U48A 4DCPB 7FD1A 4JI4J 2XB2D 1WF1A 4FYXB 3W2VB 1RDRA 2MKKA 1HWUA 2MQPA 4IUFA 2J76E 2FDNA 3MMAB 2BOAA 2RT3A 8RUCA 4JI1J 2CVEA 4NZ7A 2BMBA 1HNIA 1J2VA 1RP5A 2NLWA 1N5VA 2GO8A 3N6NA 4O4GA 1F9HA 4QQBA 4DQPA 4BC9A 4I64A 5IWAJ 1FX4A 1WSVA 3I5CA 2KYXA 3QT5A 5B0AA 3JYTA 3DDIA 4ZJOA 1QTNB 5D4PA 2QFIA 4R5PA 3K57A 1VQ4S 2CQGA 4EZ9A 3SZ2A 1HPZB 4Z37A 4RJVA 2MTLA 4MIBA 3T1AA 4DUZJ 1MMLA 1F5CA 3C6TB 3LANA 3PR5B 2VF3A 3I0RA 4NEZA 4DG1A 3M2UA 4F26A 4B3SJ 1AZSA 1JLFB 3Q8YA 1ACMB 2M8DB 3UCZP 3U1LA 1HBMA 1RT4B 2E66A 1J27A 2XI2A 4ZPBA 1RABB 1H2UX 3UD5A 2QC3A 4J91A 3ULHA 3ITHB 3TP2A 2WSFC 3D6HB 8ATCB 2YXLA 5CQGA 1V3SA 1ZA1B 2E1RA 4NLOA 5D0HA 3DCAA 5IZHA 5K5MA 1IKXB 1VCTA 4GO5X 4Y34A 2V4JB 1WC1A 2QLWA 4CNYA 3TA1A 3F73A 4DV5J 4PQAA 2C2OB 1JK9B 3NGUA 3MXHP 1H7XA 2ZNZA 4DR6J 2XYGB 4B9UA 3PDNA 2JLGA 4X2BA 1EZZB 3O2IA 1KTVA 4HHJA 1EARA 1UPPA 4YUDA 3KDOA 3WQPA 4ZPVR 4OYPA 2B51A 4RNOA 2HMIB 1Q95G 1H6KX 3W8GA 4HT7A 4DUZF 1SKWA 4V19X 5KTQA 5ETOA 3EX7B 3TVYA 4LRBA 2LXUA 1CJVB 5HROB 2K3KA 4IRDA 4RWWA 5G4DA 1B0TA 4LF1A 5IC6B 5L8RC 4BWMA 1N52B 4NA1A 3J80U 2MGZA 5JUMA 5BYQA 3MR6A 1B7FA 3DOLB 2B9WA 3IR5B 1ZM3A 5K14B 1J5EJ 4DL3A 3SEOA 3PX6A 1DBDA 4OYAA 5B0GA 4NWBA 1JMTA 4TY9A 1NPPA 3H5YA 3FSXA 4K4WA 1TL7B 2LQBA 1SPBP 1VRTA 4A8MP 2DNOA 3CT9A 3EM1A 4NI2B 2OHDA 3OD2A 3JSYA 3S7RA 1X4AA 1CJUB 1REVB 2NPIA 3AA9A 3NS6A 2HBYB 4M63A 4MJKA 2XMAA 4ZKAA 4IYQA 5AE1A 4O0NA 3C19A 3J81Y 1S9EA 2PFDA 4L73A 3VQTA 1B7YB 5J1EA 2GQCA 4ECWA 1FRXA 1YRUA 3D3CJ 4C11A 5KFDA 4UW2A 4JI5F 3OTBA 1RE1B 5HO4A 2QSFA 3QIPA 3W9IA 1U45A 3G9CA 3T5LA 2KB2A 4RL1A 2OD6A 4UOCA 4BLGA 2VASA 4LSNA 1ZOTA 2XMTA 2R3VA 3WX4A 3RRHA 2VQFJ 2WVCA 2KG1A 3ICLA 3KJFB 1Q7LB 1EKRA 2FHJD 3RTVA 3KLFB 3MTKA 3PYEA 2GIQA 2K1RA 5BYSA 4WPAA 3SCKE 1R0CB 4WE1A 5E3PA 3W2WA 3IBFB 2F4VJ 3NNAA 2W7OA 2Y3YA 4Y2CA 4G1QB 3FBEA 4WIIA 1FWPA 5KT2A 3DRPA 2AMCB 5D77A 1YLXA 2BEFA 3MMCA 1KVJA 2EPIA 4KBIA 4KFBA 2J6SA 2N82B 2YWFA 1KNZA 4ECTA 1VQ5S 1NJYA 4LF8J 3CEDA 4JV0A 4OI0A 2BJDA 4RW7B 1DAXA 4TVAB 2HGNA 4PEOA 4YFUA 4KRWA 2MQ8A 2AQ4A 2CPEA 1OJ4A 1HR0F 3J7AN 2HHTA 2A10A 2L9DA 3JSBA 2HRUA 3PJXA 3V6DB 2AX0A 4MYTA 1RAHB 4OI3A 4X4PA 1U49A 1RTDA 1X7VA 4O23A 1FFGB 2M52A 5KT7A 4PRFA 1G1XA 4M5DA 2L41A 3NWGA 5DETA 2UUAF 2FJEB 4MYUA 3CIZA 2NXUA 2N7YA 4CYUB 1MWZA 3DN9A 3OLBA 1K73T 1X31C 3Q2TC 2ROGA 3RU0A 3N9UC 1VQ6S 1YQHA 2EBGA 5J2NB 2H4WB 5A8RB 4K50A 2XMMA 3L7UA 5IQQA 4DN0A 4JV2A 4M5LA 4QIVA 2AF6A 4DV4J 3DDNA 1DTTB 1P8GA 4LF7J 3AOAA 2I9SA 3MF5A 3RW7A 2CPXA 3M8PB 2XMJA 2VG7B 4EYIB 1S0MA 4X4UA 1N33F 2JLEA 1KFDA 1AZSB 1RWOB 1S1WA 3RBDA 1M5PC 1L5UA 6AT1B 2J0XA 4L3KA 1XNRJ 2M2BA 2RDIA 3G6XA 3NOGA 2VDIA 4FS1A 5KG0A 2QYGA 4NCGB 4DPOA 1KHVA 1U1LA 3GFHA 3CCSS 2OPPB 1CULB 4P71A 2JEJA 3AQPA 1IKXA 2ZVSA 3TJ9A 3T5HA 1W25A 2RSQA 1NCLA 1MW7A 2V63A 3IO1A 2BKNA 3OFGA 3CDEA 4GKKF 3MEDA 3EZOA 1JIHA 4G1IA 4B3OB 5DQHA 1LQ9A 3W7BA 2X1BA 1SJ1A 2CAJA 2F4FA 2CQCA 5LXRA 3QAUA 1E6VB 4QYZJ 5DGBA 4C6AA 1QVGR 2EFQA 1HLWA 3ILOA 3NGSA 1WNEA 2GHVC 3BGRB 2UXDF 4FXDA 1RWVB 4NLXA 1EQ0A 1JLEB 2VIHA 4ZP8A 3I55S 3W3SA 4JI0F 4CLPA 1TMMA 4EMDA 2YNGB 4AUKA 3OFFA 2X1GA 2M5YA 1K47A 3MPVA 3DLGB 2XZWA 3LA0A 5M2PA 2JOQA 4NCBA 2MGZB 2B8PA 1PYSB 4YMEA 2VQFF 1U2CA 3NG8A 5CYJA 5I4MA 1OWXA 4TQRA 4Y6IA 1M1HA 3NAHA 3ZO7A 2DT9A 3Q8PB 3HT3A 4A8OA 4A8QA 1HBOA 2VOPA 3AY0A 3IXQA 3K5OA 1DTQA 2PN6A 4NYZA 1WF0A 3T5JA 3M32B 2AJQA 4LVOP 2OI2A 3HFVA 2GIFA 4QOTA 1TV6B 2ATCB 2HQIA 1X5TA 4ECSA 3DLKA 4Q43A 2QE5A 1UJ6A 3R5GA 2FVSA 1SJ3P 2BUNA 3OTEA 4TU9A 3LUYA 3KJQB 4NRUA 4ZK7M 3B6BA 3PHTA 5GAHI 3A8EA 3EGNA 4O4RA 3AD8C 1R8AA 4DU8A 1IBLF 4K4VA 3IBCB 3G71S 2LA6A 3TR5A 2XGPA 1FI4A 2U1AA 1RAEB 4ED8A 3DXSX 1RWKB 2YKMA 4G6VB 4JB8B 3TZYA 4RNMA 2H9ZA 3NCQA 4MH8A 2OGUA 3IR7B 3MPUB 2DH9A 3W62A 5F8HA 2CFXA 1D3WA 5KFLA 1NK7A 5KFEA 3QRPA 1RCOB 3M6XA 2FYXA 3R5JB 1W2IA 1TL1A 2NYHA 4WXOA 2BE7D 1UVNA 2KTQA 1HNIB 5B0BA 2HZVA 4KHPJ 3LGNA 3N4WA 4JP8A 3H4DA 4JV1A 2Q6CA 4FPRA 2ZOGA 4IH5A 5J2QB 3QYYA 3RGIA 2VBZA 2CZVC 1ZETA 1YJWS 4W98A 3UN2A 3W2WB 2A6MA 4OL8A 1FNMA 1TVRA 1YZ6A 2M8HA 4MMOA 5KG5A 5GAGI 4PUOB 2R7QA 3JSMA 3W63A 1RWPB 2K7KA 4L75A 3MM7B 3BB5A 4ZJLA 5KG2A 5HI7A 1FRHA 3ONQA 3KK2B 2PEBA 4J9VA 4DR6F 2DY1A 3GU0A 3EVWA 2AD9A 1WUUA 3ENVA 4UUWA 1S0OA 3TQEA 5EDWA 1IKVA 4J90A 2V9WA 4LMZA 2OTJS 3UFCX 1FDBA 3ZXWA 1IBCB 3ITHA 4YHHF 5U47A 3J7ZT 4EYHB 2F63A 3CDAA 2VDHA 3OPKA 1K0TA 4MK8A 3SBMA 3GMGA 4N77A 4L6V3 5CYMB 3V4IB 2XCAA 5ETSA 4XIUA 2IVYA 1N8RT 1NO8A 1XWLA 1FXRA 1U0HA 2YKNA 2E5JA 3D5MA 4MAKA 1IR2A 2KT3A 2OFHX 1OPIA 3N0VA 3UR3C 1SUQB 3QJPA 3JS9A 3IRXB 4OFZA 4YP3A 3KK1A 4AL6A 1YVFA 1SC6A 2VU5A 5EWGA 5CD4A 1S10A 4CI0B 3HVWA 2FJXA 3O44A 1CEZA 4ZPAA 4DUYF 2J9EA 2IIHA 4K7QA 1LNQA 3IBWA 1FCAA 5GAGU 5AXNA 2F9DA 2YX7A 2EFGA 2YKPA 4YB6A 2FUG9 5D6GA 4ZPDA 5T41A 2EFVA 1JXVA 1Y3KA 2CQ0A 1UPMB 2DGOA 2QLXA 3PYDA 2V8PA 5CCLA 5J2MA 4I1TA 2GX8A 5L1KA 4ETZA 2ZH8A 3IC1A 1RAJA 5H9FJ 1R0AA 1JLCA 2B4UA 2MJUA 2MKCA 3CO9A 5E0OA 1S49A 4K2XA 4DN9A 3D6TB 2ZM6F 2ASDA 3D67A 1EETB 3L7PA 2RU9A 3A4TA 1IN0A 1RKIA 3MOZA 4TY8A 4Y0FA 1HNXF 2KFNA 1OQ6A 2YX1A 5ETMA 1HIYA 5F3ZA 3UQSA 3C2PA 3VF0B 2ACYA 3Q8UA 4PXDA 6FDRA 2GIRA 3I31A 2I1RA 1YJVA 1ZAXA 2KHDA 2QL7B 3IM8A 4WYLA 2H65B 3DHXA 4BC7A 4CP5A 3OL6A 3M9MB 2IMWP 4PQUA 4E8UA 1OY8A 2KT2A 5F8LA 1Z2LA 1WTBA 4K0KJ 2CQ4A 1TL3B 4Y2AA 4B3OA 1RT1A 2QYCA 4LUBA 4DFMA 2LU2A 3LGHA 4LQ9A 1E6VA 1TMJA 2V2VA 3GYGA 2XHCA 4MT1A 2XG8A 1NU4A 1VGYA 4RW8A 1JLEA 4AE5A 4ELUA 2BRLA 2QT7A 4HH1A 3JAMU 1RT5A 1VK3A 4YS2A 1KONA 4ER8A 3PW7A 2VJVA 3C14A 3K8WA 4O44B 4ECVA 3QPIA 4KGKA 1W7WA 4IG0A 2D3O1 2ZHBA 1TKZA 2EW9A 3S8SA 4ED0A 2UU9F 2EKNA 3FKBA 2H4YB 1HQEA 3AFGA 4KTQA 1OY6A 4K0KF 2OPSB 4IRKA 4HHUA 4KHMA 5LJ5Y 5KFKA 1NKEA 1VQSA 4FYWB 5D0EA 2GVZA 5CZVA 4QWBA 3W65A 2CQPA 1WC5A 1M0SA 3M32A 4M95A 2DHAA 1A0OB 1R43A 1OSCA 3UNGC 4CLSA 3KLGA 2NXCA 4U9RA 3UDVA 1H98A 2C3MA 2EC0A 1LWEB 1QUVA 3CJ3A 5HBMA 1FK9B 3CMAS 2CPIA 2NPFA 4KH0B 4IO9Q 4HTJA 4JI0J 1SC3B 5E33A 1MWQA 2GVDA 4PWDA 4ID5B 4IDKB 1MG7A 5L38A 1RT2A 3ILLA 5HATA 1KRPA 4WBFA 4OV6A 5IQ6A 2QL5B 3WZ0A 2W9CA 4RUBA 3OLAA 1QD1A 2W24A 4YB1P 3NMRA 1N32F 2DNPA 4A46A 3KUGA 1TL5A 3PEJA 2V94A 4K8RA 4RKUC 1TU0B 4F25A 1S76D 3U7JA 5GADU 1DQ8A 2F5GA 1IJFB 2CXEA 2MYFA 2DNZA 3M6VA 5HAOA 3WHIA 4F3MA 3HVAA 2HHHJ 1FEEA 4FVCA 2V8HA 2LQ5A 3K59A 4DQIA 1LWFA 3HZGA 3H2LA 4ANEA 1KVKA 4KY3A 3THTA 2RRAA 4KGMA 2DYAA 2M70A 1XMQJ 1WC6A 1QM9A 2JC0A 5L1JA 4NXMF 4J5OA 3DLEA 2ZWOA 1CJVA 4IH6A 1VHIA 2ZKUA 3DM2B 4QZVB 3D9BA 4DX8H 2C2KB 4ZS6A 3UD4P 3QJJA 1V6HA 3L95X 2PEHA 4OI4A 1N0VC 2HFSA 2IDLA 4DHVA 3BSOA 3TJAA 5C42A 1C0UA 1RWNB 4FN5A 3ZZYA 1OSDA 1VQYA 3E3XA 2N4DA 1P1LA 1UVKA 3LP0B 4LFAJ 1JLAA 2MY8A 3M6WA 2AJFE 5GVQA 2RKIB 1X4GA 4X62J 1UEUA 2YWGA 2YNIB 5FLXY 4QCLA 2P9GA 4LR8A 4PZVA 3VZHA 3PW5A 3T9ZA 4WTOB 1FKAF 1Q1KA 2F9JA 3N01A 5I42B 4QW8A 2YNFA 5J1PA 2EKYA 2VG6A 1RB0A 4A8WA 2OAUA 2XNQA 1VIXA 1T11A 2Y8WA 2FVPA 2ABYA 2FZCB 2OJ3A 3AXKA 2UVWA 4IR1A 1HL6A 3DOKA 2DIUA 2V69A 2DJWA 3FEZA 1VC5A 2BQUA 1CVJA 4HLBA 1KDNA 2JX2A 2D74B 3QSYB 4USTA 3GR1A 2X7IA 2XQCA 2H5EA 1TFYA 1T0TV 2UXCJ 4WFBQ 2J0SD 5KFSA 3EPGA 1HYSB 1PJ6A 1YG0A 2CDQA 4OIXA 2HBZB 2M88A 4XAKA 5HMZA 1JLCB 1VBZA 2QLJB 3ZTQA 3H7HB 3MFIA 1KLNA 2WVBA 3J7Z5 2XMVA 1HBOB 4CH7A 2YY3A 4F04B 1HI0P 5DRKA 1LWCB 2G4BA 4TU8A 4OZ1A 4USKA 1P27B 3TA0A 4C2MA 3LP2B 3K5NA 2YH0A 2IRYA 5EX0A 2E1CA 2I2YA 2VHGA 2GAHC 3B4MA 1FRKA 4ZVOB 3Q23A 4IFYA 3FJ2A 5KFXA 3THPA 4Q0BB 4QU6A 2FGCA 2R42A 4EEYA 1SBRA 2B4OA 2Z2YB 4ALZA 1Y0HA 2HIQA 2WB4A 5AT1B 3U27A 3R2DJ 3LWLA 1DURA 3DOMA 3LH2S 2RIJA 1JKHA 1QJHA 3GTYX 5DZ6A 3D3BJ 3NGDA 2GJFA 1KQGB 3PIOQ 1VBKA 5L46A 1NKCA 2R7UA 4Q8EA 2KVIA 5CXTA 1YJTA 5KG3A 4ZVTB 2Z2LA 4IG0B 2CJBA 2L9NA 3BS9A 3R8YA 5CAAA 4M8LA 2YWEA 3GR0A 3JQJA 5HVHA 2F3JA 2AEJA 5BR8F 3E51A 3E01A 4CIOA 1T03A 1MWYA 5M2UA 1ZH5A 3TO8A 3FUYA 4R8UB 4CO4A 3CCLS 2LVWA 2H1YA 3JTNA 3CWJA 4C0HA 4DDFA 3IS9A 4OX8A 3TX0A 3OL7A 3RB3A 4W90B 3HHLB 3M2VB 3QO9A 4JI7F 3LALA 3H98A 2XMUA 3V6JA 1Q86T 1N5YB 3K2YA 5LSRA 2G1DA 1FF2A 1WG4A 2VG5B 2VH7A 2W01A 4ZN1A 4NLYA 2W2MP 5HSPA 1A6LA 2V4RA 4ED6A 3MUVP 2B9YA 2AP6A 1SKRA 1S1TB 4IG3A 3PW4A 3W9JA 4C8NA 3KK2A 2KRRA 3EGWB 1NHVA 4NYPA 5GMEA 3DI6A 1UJ5A 2Y1RI 3GONA 5CABA 3Q86A 3UPFA 3VAJA 1NJWA 4LSLB 4QJVA 3ZZOA 3KG1A 4OZ5A 5IT0A 1H2VZ 3EGZA 2SXLA 3KG4A 3NS7B 4W4MA 4FF3A 1TKDA 3QRQA 1GXLA 2FJAB 3T6BA 1LOUA 4Q44A 1FDNA 5HMXA 9RUBA 1SCJB 2DISA 3GV7B 2ZFHA 1Q8IA 2BW2A 2VBWA 1SV5A 3NGRA 3BQ2A 1VC6A 2YQ3A 3X3UA 2J6TA 3SV4A 1N4LA 1CLFA 4CO0A 5LM7E 1HI1A 1LXJA 3CCJS 2CQHA 3S01A 4ECZA 1NB7A 1ZZNA 2HHHF 1CG2A 3TRGA 5HQLA 1RT7B 1RYSA 5C24B 3CJKB 3TUPA 4FXVA 2HHXA 4C8OA 1REGX 2VPWB 4OX6A 2FHKA 3ZZUA 2UUBJ 4YB7A 3QGPA 4OYXA 1HPZA 1NSKL 2NYIA 3MGJA 3RBZA 4R25A 5E5NA 5KT5A 1N56A 4KKOA 1ELOA 2P9CA 3IAM9 4GC7A 1N88A 3FGVA 4U96A 2RQ4A 1ZM9A 3VGVA 1VFJA 3RW6A 4DG1B 4LREA 2V2QA 3DRRA 2AEMA 3ADAC 1YRXA 4NX9A 2OH2A 2OUGA 1XR7A 3NKYA 1YBAA 4DL0C 4DR4J 1VOMA 2QA4G 1EETA 2OPRB 2FPHX 2HHVA 1K1QA 3DFEA 3GIKA 2VJUA 2ZUAA 4W92B 4DCJB 3M9OB 5FJ4A 2PGCA 2QRRA 3FEXB 2HFNA 3UI3A 3SQOP 1N5QA 3JTPA 4RWXA 2IRXA 1JJCB 4RX6A 2AWZA 4TYAA 4U8VA 4PG4A 4DSJA 1F3VA 1TKXA 1U8SA 2DNYA 2UZAA 1FHTA 5DDPC 2BVZA 3NXZA 1VRUB 2CQ2A 2QZ8A 3DMJA 4WK3A 3C6UA 4A8SA 4AYBD 4EO6A 4WIQA 1UAWA 5KFJA 3BO4A 1UA1A 3CSKA 5KFRA 1YJUA 4Y00A 1QY7A 3FRZA 1F60B 2B4VA 2FY8A 2RB7A 3RG6A 3PV8A 3C46A 2FLPA 1CS4B 2ZITA 4DOZA 3HULA 2V8DA 5C5JA 4IRCA 3SCJE 2CYYA 1Y4ZB 3NWRA 4X4QA 1WI6A 2ZDOA 2O1PA 3FRYA 3SQGA 1S1VA 1WEZA 1AYEA 2G9OA 4K5RA 1P1TA 4FKYA 2MEWA 3DRYA 3W60A 3ZNUA 2ERRA 1JX4A 1JLQA 1I94F 2XS5A 2E29A 4RPFA 1WTFA 5DJBA 4C7QA 3L09A 4YY3F 3B78A 5HLFA 4DSLA 2E1MC 2DR6A 1NM2A 2B9XA 4KO0A 3PIPQ 4DV1J 2C2RA 1T3NA 3AD9C 1SL1A 2BKOA 5DS7A 1G7CB 3PRVA 1X5OA 3G96A 3J7A1 4ZJQA 1VQ8S 3BGOP 4F2SA 3KJNB 2AJ4A 4KIAA 1D9AA 5DM6Q 5HQ8A 2A0FB 2C2ZB 2LQ9A 1FDDA 4I56A 4ZHRA 2BQRA 4J7CA 1RAAB 1SL2A 5D3GA 1O6XA 1X4DA 2GZOA 1T94A 4IH7A 4CLKA 4QBUA 1IXKA 5IC4B 2PMZD 5KT4A 1N36J 5D15A 4B9NA 1H3DA 2C2EA 4NI2A 2Y1JA 4Z2XA 5A8KB 3FSIA 1SJFA 3MMBB 2WCXA 2ALZA 4MKAA 2XEXA 4BCAA 2IRUA 2F65A 3PCOB 2CQIA 3TUZC 1ULRA 2P8IA 3QQCD 3CCZA 3UCUP 1TUGB 5EWEA 4OX7A 3IRXA 2K1RB 3KK1B 1U1MA 3GIRA 4CRJA 3LPEA 3FQKA 3LP1B 2JZ5A 3R97A 1UWAA 4X65J 1N5YA 2BE2B 3I6PA 4RU9A 3HI9A 2FJWA 3AHPA 3DRPB 5E3AA 1U4BA 5JXSA 2X1FA 3OL9A 3OFHA 2CVIA 2VC0A 2D3ZA 1YBUA 3DLJA 4A8YA 3UVJA 3MD3A 1K0VA 3DI6B 2QIFA 4NLWA 3SI8A 2NZCA 2DNMA 3FQLA 2DEJA 3D68A 3GJTB 5IT9Y 1HQUB 2BACA 3VCDA 1D9DA 3SFUA 3ZZ0A 1QLNA 4MIAA 2AYBA 2DGTA 2XULA 2L48A 3HZEA 2HS3A 3OTCA 1S6QA 2CPJA 2KO1A 1I51B 2QSWA 2RDJA 2ZZTA 1OO0B 1RU2A 1DZ5A 3PR4A 1B4SA 3QBCA 4WK1A 3P3DA 5IT9U 1I1GA 1IBMF 2DNGA 3PHEA 1QSSA 1GEHA 4C4WA 2LXIA 3T1HF 1OQ3A 2EWHA 3H20A 3HHEA 2Q1LA 2KVQE 3D6FB 4OJ3A 4PAAA 1RI7A 4LIWA 3W1YC 3OV7A 3OQ2A 4HI1A 3CUNA 5HP1A 2IC3B 4LF6J 4CWBA 2CZ9A 2QFJA 4DV2J 1IBKF 2RRNA 2DGUA 2GFFA 4QIWD 5KOWA 2W7PA 3KHHA 1T9VA 3U02A 3H42A 2LLZA 3DGVA 4RBUA 3HSDA 3W61A 3PX4A 4CLFA 2GGPA 3THVA 2UUWA 1OYEA 2D9PA 4M1KA 5LT5A 5A8RA 4ZVEA 3J81j 2K06A 2YPYA 2WONB 3POTA 5IM0B 3QGHA 2C2DA 1H38A 3MPDA 4ZLPA 1H72C 4JYAF 4OZLA 3HVTB 1Y00A 3JAMY 4DSKA 5E3RA 1F6TA 5H9EJ 4KGZB 1MN7A 4DSFA 4RW9B 3Q24A 2RQMA 1IR0A 3MI7X 2GA7A 3KUEA 3PVXA 1VJQA 3C6UB 2IAJA 1KP6A 1RHMB 3M2RB 3BBFA 3MURP 2HRYA 5I3UA 2E5LF 2KN4A 3IM9A 2MKHA 1R8BA 4QR0A 2R2RA 4F4XA 1CULA 3MR5A 4F4AA 1S4FA 4AFFA 1JLBA 1OS5A 1AUSL 2O3DA 4DR5F 4UQGA 3JQMA 1R31A 3LAKA 4F4KA 4KB7A 3C8YA 3NMAA 3W2VA 2HQFA 4WP8A 4ZPTR 2VFSA 2VBYA 2ILZA 1Q16B 5HANA 2QX0A 3IS9B 3BPSP 2J9DA 2CADA 1FERA 3IGNA 4RUHA 2V5HG 3PACA 3R5DA 2EBEA 3CCVS 1N34F 4LF5F 4P2XA 4ZP7A 4F50A 2HNDA 2APOA 3K5LA 4ZVPB 4R5PB 1XTZA 1WHXA 3HD1A 1BC6A 1NNDA 1TKTA 4KPCA 2HLUA 4YQWA 2PMWA 2VODA 1CJKB 2OEJA 1HNWF 1FKOB 4ICLB 3HCXA 3MCMA 2QLFB 4R0JA 3M8RA 4G1PA 5HK4A 4DX5A 4O3NA 3GV8B 4CDIA 3ZZTA 4FF4A 3V4MA 2OSRA 3M8QA 1F9FA 3WIVA 3TQ1A 2DRBA 2B7BB 3US5A 4WFXA 3N5BA 4EUVA 3FK4A 4H4OA 4XK8C 2ZH2A 1BXNA 2XWXA 5DM7Q 1I94J 4L74A 2NXEA 2P5VA 3GWCA 2WHOA 1BQMA 1DLOA 1WC0A 2VKZG 4USMA 2GO9A 5C42B 4QIEA 3N5FA 1LK5A 4ZCKA 4ZLJA 1JXEA 4LF2A 1JLAB 5DDRC 1RU1A 3LGMA 4HI2A 4YR2A 4JBCA 4V1Ak 2MZTA 4H54A 2RILA 1NH8A 4DWIA 4LF9F 1KLMA 2FLLA 5L9XA 1SVDA 4DUTA 1EP4A 1KS2A 3X1LB 4HL9A 2ZE2A 2RMLA 1EIYB 2MZJA 2CIMA 2V4QA 2AKWB 2D41A 1QAIA 4LR7A 2F4VF 2WBRA 4PUOA 3OVBA 4N8OA 3FBCA 3O3LA 2M7SA 3Q2SC 2RUGA 5F41A 4DR2J 4USJC 1GQEA 1KVIA 1FD2A 2ZM6J 1L3KA 3G8QA 1H7WA 3V5RA 1UVMA 2Y1IA 3BREA 3QT8A 2JSXA 1UEVA 2B5JA 3ISZA 3TANA 1R27B 3D1OA 1UFKA 2CJQA 1M1GA 3DOLA 3GIMA 3FSYA 4LF8F 2M4MA 4DXLA 2IM0A 4CNZA 5IOLA 1UCNA 2NCKL 2C3OA 1RWXB 1XQIA 1RZMA 3A12A 2OKQA 3A8IA 3CJSA 5DQGA 4J9OA 2XNRA 3IR6B 3TNVA 4I6AA 1M5SA 2G13A 2LQ8A 1NAQA 2WAQD 4FPIA 3UDLA 3PRBA 4J9SA 4U7CA 2DNKA 1EJ7L 4DS5A 3CJ4A 3UDCA 1TKXB 1V9OA 2HAFA 4AT1B 2P2CB 3QNWB 2RHSB 4DPYA 5AJ3F 3OJUA 2MKYA 3IG1A 1S9EB 1XERA 2YWKA 4QW9A 1S6PB 3FC9A 1PKUA 2KJVA 2VPXB 2IJNA 3FFIA 3RAQA 1KBRA 1WOSA 2AT1B 4NZ6A 2J0QD 3G8SA 2ZEJA 3ILJA 2IC3A 2V2ZA 3UWTA 9ATCB 3VAHA 4DFJA 5IFMA 2NUHA 2ZH9A 4J9RA 2NZ4A 5CYQA 1VJWA 4NLVA 1SXLA 2ATLA 1J5EF 4P75A 4DPXA 1R0AB 2VUGA 2AV5A 4DQRA 2MZSA 3D0IE 1U8WA 3EICA 3MFHA 1U02A 4N7TA 4B9LA 2LFVA 2VQEF 1PIEA 2VFTA 5C7PA 2AYGA 1ZM2A 3MM5B 1GMUA 1Q78A 5F9NA 2PSZA 3ZTOA 1R89A 1GTEA 2D1CA 2ZHOA 5D0GA 5E3CA 5L39A 3G86A 1YHQS 2R7TA 4NE9C 1TQLA 3BSCA 3MCOA 3D0HE 3NLCA 3BO2A 1U0SA 4DU7A 1RT3A 2K8GA 4N56A 2VQEJ 1MMNA 2A6OA 1UZDA 2ASLA 2H54B 1JWWA 1VISA 2OD4A 3GJSB 1HWLA 5SUHA 2WZ1A 1TELA 2IVFB 2MQOA 2GJIA 1UFWA 4LSLA 2X3DA 1DARA 3KOAA 3BM7A 4HTIA 1RCXB 1S4EA 3V6HA 3OR1B 3R6LB 2MKJA 3NBPA 4Q5VA 2MKIA 1O8BA 2E5LJ 2AEFA 4I2QB 4KHRA 2YH1A 1HFEL 5D8HB 3C15A 2EG1A 4OLPA 4BWJA 5KFOA 2I38A 2NUUG 3D1QA 1NEEA 2IM3A 1BMQB 1UMJA 2KT5A 1YZ7A 3KLIA 1V5IB 1NPKA 1X60A 2MQLA 2YQ1A 4H4KC 4WTYA 4K5SA 3NGTA 4DPUA 5MAOA 3T1YJ 2VA2A 5AJ3J 4JI3F 5G0RB 5LMUF 4OZ3A 4DF4A 2YQ0A 4Q2MA 4EBEA 4L72B 4X4OA 2G0JA 2GAGC 2HK2A 2QA1A 3SIPB 1HWJA 3D54A 4A4JA 5KFFA 2R7RA 4J9PA 2UVRA 1G3OA 2XGQA 2XLJA 2DD8S 1S5ZA 1HQ2A 4LRDA 1U6BA 3CD5A 1UTAA 1CJTB 1XMOF 3MM9B 2H5IB 4P52A 1CJKA 2RHQB 1EKSA 4C3MA 3CD0A 1LW2B 4OI1A 3UVJB 2XI3A 2VZ9A 4B9MA 2J7WA 3M8QB 2DHGA 2RU3A 1T05B 2RF2B 5A2QU 1J5OB 3AJDA 3CDBA 4N5SA 1XR6A 3BBCA 3MEGB 3O8WA 4JI8F 1QUPA 2B6AB 2GVZB 1UWBB 4KV8A 1JB0C 4NCGA 4C98A 4V19J 2W9BB 4F0MA 1HHSA 4B3TF 5D4OA 1EQMA 3RBEA 4FBTA 1YRTA 1ZAVA 2UXCF 4JV5F 5GAEU 3EZ5A 2DXFA 3KDNA 4C9DA 4MFBA 4FNHA 4Y2MA 1R3NA 3BQ0A 2LEAA 4JI1F 3I9V9 3P8BB 1FDAA 2DH8A 4IDKA 2AGPA 2OIHA 3H2VE 1ZPVA 4YEAA 2BJ3A 2JHEA 1D8ZA 1GMWD 3HX9A 2KXHA 5KFQA 3EYZA 4DV7F 1UZHA 3KUHA 4JI4F 1WG1A 1MROA 4K4YA 2DRAA 4OHVA 4HYKA 1F9EB 4BDPA 4USIA 4NMXA 2P6SA 3K89A 4C48A 1BQNB 3TEGA 4LFBF 4RU2A 2E1PA 2HVHA 1F5AA 2FJBB 2KL8A 5GMDA 2F40A 1WC4A 1I6JA 3K17A 4CM2A 4P9SA 2B43A 3K8VA 2CQ3A 3M7VA 4F4ZA 2QTWA 1BY9A 1V5VA 2VKRA 2XLKA 3CJTA 1NSAA 3HDSA 5T7LA 5MLCV 1CPZA 1WHVA 2J9CA 3ELHA 3I5AA 1NK5A 2V9KA 4ZCMA 4M5IA 4IOBA 3KMQA 5DG9A 1QSLA 2FHJA 2V2KA 3LOUA 2AJ1A 3EDQB 2PIIA 2WOMB 2ZBCA 3M4XA 2ZOFA 4MKBA 4PXBA 5F3TA 5F8MA 1MNEA 4IQXA 3B4DA 4O3SA 4U7UK 1RGVA 1QVFR 4HVZA 1WOPA 2UXBF 3CCTA 3J81U 2MSTA 5GAHU 2FY1A 2DGWA 3M2RA 4ZHRB 1UVJA 1U2RA 3BPDA 4P74A 5I3UB 2OMLA 4HHHA 1X5PA 5ETRA 3HFKA 4X66J 3G2XA 5F9LA 4AL7A 1DFDA 5CYQB 4B9VA 4I67A 3OL8A 4CO3A 3A8JA 2RKIA 1VLOA 2BJ7A 5FDLB 3MR2A 2RQCA 4ERDA 1WJ9A 1FTCA 3HD2A 3MMBA 4P2SA 3G87A 2WB1D 2I8EA 3RB4A 4F0HA 2OMOA 3PEHA 5HL7Q 1LWCA 2OEKA 3FMWA 5B08A 2JC1A 1L3TA 2RE1A 3LP2A 1PO6A 1NK8A 3PY8A 3CTRA 2B9EA 4WP3A 3SXLA 1P9YA 4RNFA 4F02A 2BANA 1CC8A 1SC1B 4RW4A 4LFBJ 1X4CA 1PAEX 2IM1A 3K7RA 4PPDA 4DMZA 2CJXB 2ZH5A 2Y0SD 1C1CB 3MM8B 3CCQS 2JEGA 1NLKL 5K14A 1DY3A 1YWXA 3R7SB 1VQKS 1LFPA 2BX6A 3NNHA 2VL1A 4X4TA 5LMNJ 3MCSA 5HVFA 4ED2A 1DLOB 1RYRA 1RHQB 3C16A 4TLQA 4USUA 3QIDA 2ZZMA 1Q8LA 4TN2A 3LAMA 4ZVFA 4Q8FA 2PD1A 4JV5J 2RNEA 1VQNS 5KG6A 3IWNC 5H1SV 5F8JA 3ZZPA 1S6OA 1RLCL 1U6FA 1R8CA 1X4EA 2LKZA 1OYDA 1JKHB 1KOOA 5T14A 2ZE2B 2VOOA 1GNKA 4AD6A 4Y28C 2AZ1A 3GJQB 2XZTB 2KKHA 2W1BA 2XSJB 2E9ZA 3AXMA 4DV6F 3OUYA 3FVYA 3Q83A 4HKQA 1JJHA 2H51B 2R4FA 4B3MF 2UP1A 2WBMA 1C0TA 2DR5A 2UU9J 4UUXA 1XMOJ 1SKUB 1JQGA 3ETOA 4NEYA 4EO8A 1U24A 2FHOB 4N41A 4DUYJ 1YKWA 4R8UA 3KK3A 1PCAA 3GQCA 2FVRA 4ZITA 4DV3F 4B02A 4DSEA 3DU6A 1UWBA 2B6AA 3G8TA 2GGPB 4DQQA 2BOPA 1V3RA 4X84A 2W9BA 4CH1A 3PO4A 4UOFA 1RTDB 1FT8A 1T9WA 3CB4A 2H48B 2A18A 3DXBA 2BV3A 3HT0A 3O5TB 5A8WB 3I56S 5DGAA 3VGTA 3ENWA 5HQMA 3MMCB 1RTIB 1HD0A 2AW0A 3N6LA 2LEBA 4GVBB 1RA6A 2ZKTA 1Y7PA 2YNHA 4KT0C 1IQZA 3OR2B 3RUBL 4P2FA 3FMBA 4UF4A 3TOQA 3CXCR 1KTQA 1KQKA 2ZBQA 1PG5B 4USHA 4JI5J 2E9TA 2X1AA 2KFYA 3NCRA 3GIJA 2KYZA 4WFYA 1VQPS 4J9QA 4DL7A 3PRDA 3CJQA 3G6VA 2IYGA 4JOUA 2VD3A 4C3LA 2IY5B 5LSLA 1PJ5A 2RD5C 4QWDA 4NZ0A 5JJBA 1K9MT 3DRRB 5A2QY 1URNA 5KG1A 4OZ2A 3TZWA 4GKKJ 1RBOB 1S1XA 1OMSA 4URSA 4JUZA 2Z30B 4D3HA 2VA3A 1PILA 5FD1A 1HBUB 2LXFA 1LK7A 4DFKA 1GX6A 2CPYA 1FRLA 1FVQA 3F0NA 3B82A 4M5GA 4DV3J 3CCRS 5J2PA 1C4AA 4QYZK 1KHWA 3MM5A 5D4LA 4ETXA 2BBEA 3R3TA 3NP5A 4OHXA 4OYZA 4TNOA 5ETLA 5IWAF 4F2RA 5L1LA 4MKYA 4C8ZA 4O3OA 1UETA 2ZNYA 1VC0A 2J8AA 1FKPA 1G6BA 1CBKA 1B70B 1S57A 1S0NA 5E2QA 1S99A 3G4SS 2VPZB 3V6KA 3A3OB 2YWHA 4O3RA 4IO1A 1YITS 5KFPA 1BQXA 1XBWA 2GJ2A 2W9CB 1RWUA 1S1UA 1NBEB 3OVAA 5HJXA 3TVKA 1T3OA 2CPHA 4I2PA 2OPQA 3UDEA 2BYCA 4ITSA 4DI6A 3RAXA 4CLWA 3KLEA 2ZH4A 4KSEB 1Y5NB 3SCLE 2QGFB 1TR0A 3T6JA 3VHQA 5KFCA 2G1HA 4DV5F 1A7GE 1RAIB 4B9TA 1RQ0A 1S6UA 4A8XA 3MMAA 3AOBA 2CNOB 5L1IA 2QEXS 2R9LA 1QAYA 3HSZA 1VRUA 3DMJB 3F44A 4ID8A 1Q5VA 4O4GB 1IKWB 4CT9A 4ZIWA 2R8JA 4QU7A 4RUCA 2ZOMA 1S72S 4ED5A 4KO0B 3CD7A 2JDJA 1LWFB 2IJFA 2W2NP 4QYRA 1DQ9A 3HP6A 2LECA 3IWLA 4B3SF 1LV5A 3TAMB 1FJGF 4E98A 1U6ZA 4XPCA 2CNKB 3VAIA 1FE4A 2V6AA 1HNZJ 2LYVA 3OXLA 1FJ7A 2DGVA 2YX4A 4RO0A 3ISNC 1X8DA 3TWZA 2UXDJ 1U26A 1WDDA 1YK9A 2CWKA 4OJGA 4QR2A 2R8IA 2CKWA 3S1TA 1TK5A 1SQGA 1VQLS 2EK1A 1S79A 2IPOB 1QAXA 1PBUA 4WXWA 5A6WA 2EFPA 1YBTA 2Z0GA 4OZNA 1PSDA 2CRLA 2LDYA 3MUTP 1H74A 4CH0S 2V0NA 3JYTB 3LP0A 2HURA 2HW3A 1NZAA 3EZUA 3KJVB 1WORA 5AE2A 2G0CA 2YNIA 3TI0A 2LCWA 3DLKB 3VGSA 3CVKA 1NHUA 1IWGA 1WHYA 3F56A 1KD1T 4DR3F 1JJ2R 1FRIA 4DR2F 2YNFB 3BBBA 4NA2A 4DQSA 2I5JA 2KDOA 3TX8A 1AT1B 2E9RX 4ZDNA 1NMEB 2VPYB 4LF4J 2JFDA 3GP9A 1NDKA 5EHHA 2WRMA 2XSJA 3FCHA 4NOHA 1WKJA 3GFZA 1N6QB 3GPAA 1G4CA 4LFAF 3HHNB 4LSZB 1U09A 4QWEA 1PAUB 2XYPB 2ZBIA 3EJMA 2C28A 4Q7AA 4CZCA 2KM8C 1D0EA 4C8KA 4DV4F 2GNKA 5KFYA 4ED3A 2K3IA 3I0SA 4I7FB 4J9MA 3AT1B 2V67A 3ENQA 3R27A 4J37A 5LSOA 4URGA 3IGVA 1HW8A 1HQUA 4NMLA 4NRTA 3CE8A 5SZTA 4ELTA 1N34J 4LF5J 1H2TZ 3JSRA 5K8OA 2WTFA 4QWAA 4JI2J 4MKVA 1MSWD 2HNYB 3MEEA 2YWWA 4KC5A 5DO2A 3HSJA 4JI6F 2NREA 4D3GA 1HWKA 1HR0J 2JNJA 3D7SB 2WW8A 3HM9A 4NYOA 2C3YA 2YPZA 2DXDA 3MAAB 3IMQJ 4UQTA 5ITHA 3MHYA 1SUQA 1HNVA 1FX2A 5E7OB 2WOMA 3G82A 1RT3B 5HMYA 1D8YA 3SDEA 3H4BA 3UN3A 2I6WA 4F0KA 4KR0B 1SQFA 2HKEA 3DOMB 3I5BA 4C8MA 4NLQA 3CCWA 2DCUB 2QMXA 4WZQA 3ZTSA 2MKSA 2W4DA 3QZ8A 2IA0A 5HP1B 5F0WA 4CO1A 2JVOA 3NOCA 4OI6A 2IA6A 1WG5A 5ETPA 1VRTB 2CWXA 2HG4A 2IBOA 2GHPA 3AQOA 3MM6A 2ZVIA 4NLDA 2ZJPQ 1GH8A 1X4BA 3ILIA 2W9AA 3HVRA 2UXBJ 3UNYA 2DPJA 2YKAA 4LRCA 4DR3J 3EPIA 1JXLA 1HBUA 3KYLA 2W4CA 2JLFA 4WFNQ 3D2WA 1GX5A 1L3SA 1KFSA 3NY0A 3FZ2A 3R2CJ 5C25A 1KN6A 3P4UB 4RLEA 5CD4H 5A0YA 3G6ES 3OXFA 5BYRA 2XYHB 3TARA 4PCQA 2QN6B 1WI8A 2G0IA 2EXUA 5KG7A 2VG5A 3GSIA 3HFZB 2HHQA 4Z7CA 1IBKJ 3HO1A 1GMWA 4ENOA 3IWXA 2D69A 4P72A 4LF6F 4LSNB 4I69A 4KJIA 2ZJQQ 4PABA 4IFVA 2KHCA 2XO7A 4NLUA 5E3QA 2IDEA 2FZKB 3BKTA 5DQIA 4TY8B 4CLTA 3A8KA 1ZS6A 5B0FA 1UVLA 5KFGA 2ZBRA 2FHMA 4LRFA 3GZ7A 4PR6A 3T1HJ 2MZRA 3T1YF 4O44A 1XIQA 2N4CA 3VGUA 3T9NA 2BJ1A 3EVMA 4GKJJ 2DHHA 4G1QA 3IRWP 4M5DB 3AOCA 1C1BB 3TZZA 5BJRA 1RTHB 4DV2F 3OTOJ 4OJ1A 1Y10A 1NZ8A 2ADBA 2VFVA 3QLHA 3M30A 4UZCA 4UY85 3H0PA 2X3GA 3UN5A 2XC9A 1RT7A 1RACB 5B0CA 4FKXA 3AD7C 4RW8B 1U1RA 2D3UA 4ZLLA 4XPEA 1TUVA 3BN7A 1I3OB 2EFNA 1DHMA 5KFAA 1MROB 5HBMB 4FNIA 3BSNA 1SH2A 3IP0A 3ZNJ1 3EVOA 4P7VA 4DPTA 5DLFA 3BV8A 3G6YA 2HS4A 4O3PA 3M1VB 2DO0A 4X65F 2OPSA 4NXNF 4NCAA 3R1LA 4H4OB 2VONA 4IOAQ 2KFZA 2RQKA 1LW0A 1WD6A 4LIRA 5KFZA 2MLZA 4QPXA 2R8HA 5K8PA 4CYUA 3BJYA 1HHTP 2R7OA 3VALA 4C0OC 3QWUA 4OMFG 4C3KA 2CJAA 4X4SA 3KLHA 4YR0A 3MOJB 2HQDA 3AODA 2DEIA 1O51A 1S12A 4ECUA 2WK4A 4L76A 3BSAA 1FXDA 3KXDA 2FC9A 4QR1A 4CLZA 3MECB 3AB2B 3H5SA 3Q22A 2I5JB 3CD6S 4ID5A 3SSSA 1URRA 1L3VA 3GSDA 3HHLD 1GK8A 2UV8A 1H73A 2GC8A 4OYIA 1DJ0A 3ISND 5F8NA 4OQJA 3T5KA 3BDPA 2MMYA 1T7PA 4LBIA 2XS2A 3LW5C 4YHHJ 1EX8A 3FNNA 3KNAA 1VHFA 2M9KA 5IXUA 1NJIT 2F8MA 4M5NA 5D0RA 1LKZA 4AL5A 4NLPA 2OELA 2QO3A 3W64A 4EK2A 3DC2A 4MK9A 3DRSA 1OY9A 4P2MA 3AAWB 2RJZA 1CQMA 4KH1B 1D1UA 4WU2A 1N36F 1C2PA 1EP4B 3OSPA 2HNYA 1LWXA 5J2PB 4PYAA 4K4UA 1JLQB 4YDXA 1DTQB 2OFGX 4NXNJ 2HVIA 4M5KA 3HPOA 1BWVA 1WEXA 1AXQA 1HNVB 4ED4A 2GW8A 3I87A 3O1LA 1NSQA 4MK7A 1N54B 4ZLNA 3BR8A 3DM2A 2XBPA 3IG1B 4M5JA 2OSQA 1T02A 1RUSA 2FGOA 1XMBA 2QMUB 4CQ1A 2JH3A 4DR1F 4HDHA 4ECQA 3U1NA 4RNNA 2WSCC 2J6UA 4I4BA 2XY6A 4ILLA 2MLYA 4FYYB 4F3QA 5EGYA 3VAFA 4X4VA 2AYEA 3HKZD 3OTOF 1S1UB 4E0DA 3ZTRA 3OHAA 2YKMB 1UEKA 4HEA9 1IKYA 1IM6A 3C16B 3CDUA 3D1HA 4NASA 3FEYB 2HS0A 2BXJA 1TK8A 1N33J 4GKJF 5LJ3Y 3PG9A 1RAGB 1MU2B 3GV5B 3SSQA 2BJ9A 2KRBA 5IV3A 2XZDB 3J7YI 2BJ8A 4WFAQ 3HHLC 2JEIA 4IQMA 1R7IA 2Z2MA 1D9FA 1Q8KA 1FA0A 3TJ8A 2HFOA 3SV3A 3BYRA 3LP1A 3V81A 3Q8QB 2PMHA 3Q8RB 2FLOA 4QWCA 1FRJA 1WC3A 2E5IA 2W4PA 4H4MB 1QDUB 1TP7A 2HQGA 3TAMA 4NLSA 3VTIA 6FD1A 4CLUA 2IFXA 4Y2KA 3OUYB 5HROA 1Z4UA 2L08A 3HLUA 1C0TB 1ZM4A 2O67A 4B17A 1U25A 3UR0A 3GIIA 5LL6d 1RK8A 3RB6A 4DPWA 1R0BG 1S7IA 3BN4A 4MIWA 1HKAA 3HSGA 1GMVA 2AU0A 1TL1B 2DHSA 1UKUA 3DYAA 4X66F 3PO5A 2VC1A 2OP5A 2JJ4D 2C3PA 2E44A 5GADI 1KWMA 1RLDA 1Y3JA 2J9DE 5CYMA 3V4IA 5LXYA 3KJVA 4ZVUB 5HVGA 1FFSB 1S6QB 4DR5J 1U0HB 2HIYA 1C1BA 4Q45A 2HQCA 1IQTA 1PJ7A 3JXOA 2HWHA 2ALYB 2UVUA 4IOCQ 3OR2A 5J1EB 1XK8A 4J9NA 2V34A 3CJ0A 3R7NB 4F4YA 2DR9A 3QRRA 2UVVA 2COLA 4I6YA 3D0GE 4NL5A 3QIPB 1MN9A 1CJTA 1WF2A 1N6QA 3QJLA 4ZN3A 4QPTA 1CSJA 1U1OA 3V2UC 3QGGA 2Q66A 1T9TA 1WELA 3RJMB 3TEHB 3GB0A 2EI5A 2HFVA 3PYGA 2RUSA 1VQOS 1C4CA 1RSCA 3M1VA 2YKNB 4HR2A 1NDPA 3KKFA 1LW0B 2MQQA 4EBCA 3FCVA 3NEKA 3GG1A 2HZAA 4U95A 3MEEB 3JQKA 1F3FA 2CQBA 2G2OA 4WE1B 3ET6B 4WWSA 1OPZA 2Z8QA 1NJZA 3HKWA 2J0WA 4DV7J 2XSFA 1SV5B 3POTB 2W2OP 4C0BA 2IM2A 5KAKA 5BR8J 4DZDA 3KHGA 2R7VA 2KH9A 4C8LA 2XTJP 3EMTA 3HVTA 4FDFA 3VVTA 4ES3A 4RBTA 2HHSA 1ICEB 4MFBB 4RW9A 2YVSA 3GCWP 1RT1B 3A1YG 2W2PP 3GJRB 5IT4A 2F1FA 1FRMA 5HMWA 2NS1B 5AXMA 3VR1A 3CMQA 4LF4F 1ZBTA 3MEGA 4EGLA 4J9KA 4DV0J 2YBVA 2QJ3A 3PM9A 3V6DA 1Z1ZA 2RAQA 3EDRB 1KKHA 3W9HA 3CCMS 4JI8J 3C14B 3MM6B 1EAYC 2DY9A 3EGVA 4I2PB 8AT1B 4ECRA 1JLBB 2W2QP 2F8EX 4PQUB 2DKOB 2WVEA 1FO1A 1NB2A 1RWMB 4DLEA 4RZRA 1VS3A 2XO6A 2C2NA 1S9FA 2OPRA 1W2BR 2HBRB 1UW9A 3BEGB 1T8EA 2R2SA 2GCFA 4U7UD 3WX8A 3CJKA 5A0YB 1TAUA 4WJBA 1GXTA 2DGQA 4LR9A 4OLOA 1RAFB 1DTTA 2GMJA 2HNDB 4LT6A 3BDEA 1S9GA 5AXKA 3UE2A 1HD1A 2VG7A 4OX9F 2ROEA 4ECYA 1LWEA 1BQNA 2HZCA 2DH7A 2CZ4A 2LP4A 3MUMP 4ICLA 3MPYA 3IFEA 4IFVB 2HLTA 1B99A 1TTHB 1Y5IB 4ZP9A 3GCXP 2CPFA 3WDOA 3DDKA 3Q8SB 3NL0A 3CC2S 3EWGA 3JTOA 4Y2IA 4ECXA 4LFCF 1TFWA 1XNQF 3E2EA 4ZPCA 5A76A 3BGFA 1IR1A 3RR8A 3L9ZA 3LO3A 4QIGA 3LF0A 4ILRA 1NSPA 3AA8A 4OZJA 4X62F 4I68A 5DZ7A 2E7XA 3IN5A 2ZH6A 1B0PA 3SQGB 1YSJA 3CCUS 5LMUJ 1SH3A 2AJ0A 2HWTA 3PW0A 2AGOA 1NK0A 3BKUA 2GS8A 3IAS9 4NPOA 3M8SA 1XC9A 1NK9A 1M1KT 1JJ4A 1NRKA 2DB1A 2GVDB 5HLFB 4PWDB 2MQNA 2ZH1A 1Q81T 3K5MA 3Q0AA 3W66A 1S97A 4H4MA 1L3UA 5J1NA 3H5XA 4RW4B 3ENAA 4EFAC 4OYMA 3OSNA 2X51A 5KG4A 4RUAA 3MWBA 4UY8T 2R2TA 1YJ7A 3CPWR 2R7XA 1C1CA 3MM8A 1VRQC 1UJ4A 3M2UB 4HH0A 3SFGA 4DZ6A 1YGYA 3CJ8A 4H4KA 3VAKA 2BA9A 4JI6J 1HBMB 1RT4A 4DX7A 4ES1A 4ATNA 3R7BB 3I9ZA 4LBHA 2FD2A 5AE3A 3PKYA 1SH0A 5A8KA 3L7OA 2FJDB 2J7KA 4ANCA 2CG8A 2HNZA 4HACB 5KFIA 4CM0A 4PG7A 4F36A 2XLIA 2CJKA 1QE1B 1LXNA 3PFEA 5K8NA 4NXMJ 4IKAA 2HBQB 2AYMA 1JNZB 1U47A 1TZ0A 1HMVB 1SIWB 4PG8A 4WCEQ 2DGSA 3WC0A 4X4RA 3I0RB 4DL2A 3ZFVA 1NKBA 2MHEA 2C1EB 3NGKA 3DOKB 4BS2A 1PBAA 2EK6A 3DKDA 1RHUB 3CJ5A 2EVZA 1PGZA 2E7WA 5DDQC 2HHWA 2OLWA 2N7CA 3QT7A 2QL9B 3DGPA 2U2FA 3A3NB 3MAHA 1Q7YT 3MMJA 4FXWA 4U8YA 4A48A 1S77D 2NQPA 3Q8VA 2V50A 4PG6A 4LJMA 4CTAA 3F41A 3P5BP 2H5JB 4HT5A 1DQAA 2VG6B 3K58A 4ZIVA 1IVZA 4NLTA 3DLLQ 3CIMA 1OIAA 2CJ9A 1RBAA 1TVRB 2YKOA 1VBYA 2CJYB 4XO0A 3CCES 2HMIA 1BWEA 2NXJA 3JSMB 1AB8A 2L9WA 4FP9A 3CGIA 4IFYB 2DNQA 4DLGA 1VK8A 1HNZF 4K4ZA 3MR3A 1K8AT 1GAOA 1F2GA 1F5BA 1NPRA 1YJ9S 1FJGJ 4L3NA 2KM8B 2DIVA 4OYBA 3P6YC 4LRAA 2B7CB 2DNRA 3R1HA 4ZVRB 5BXIA 1FJCA 2IJRA 2HRTA 1KQFB 3SSRA 5KT6A 2FVQA 3ZTPA 5KFMA 5EUHA 3PXGa 3OXGA 5KFHA 4I2QA 1QAJA 2QA4S 1X9MA 1IUJA 4F4WA 4X64J 1LEOA 1CJUA 1REVA 1IWAA 3JB9k 4URQU 4A8FA 2NSBA 5JMNA 3BGUA 4USWA 1ROFA 3T41A 3TVZA 4GVBA 1QTMA 4Q0BA 2RVJA 5IV4A 2FLNA 2DXEA 1GXUA 3BQ1A 3MPWA 3DLHA 3CF5Q 3O6QA 3DRXA 2DNNA 2KI2A 3M30B 2WONA 3GE9A 5IM0A 3WC2A 2A1BA 3K5PA 2JL9A 4XDCA 1ZTWA 2F8HA 1VR6A 2QA2A 1S9GB 5H9FK 2WVFA 2ZH3A 1FKPB 4KYZA 4RBVA 2PA3A 3AJ1A 1U2FA 2E1AA 2Z57B 4CLYA 2VICA 3LQVA 4P10A 1JLGB 5A6PA 2KZMA 3W5ZA 3RZAA 1LFWA 1FVSA 2D7SA 4O0IA 2LMIA 2W25A 4K59A 4UOHA 4DR1J 1T03B 5K8MA 2BW7A 2V68A 1HARA 3DYAB 5F8GA 1RJJA 3KMSA 2C42A 1TK0A 1TUWA 3R9LA 4KPYA 2DITA 2OPQB 5IS2A 1E6YB 3OFEA 1VLYA 3D28A 4ZCIA 5KFWA 4PWWA 3KHLA 1N0UA 2FZGB 2HGLA 2ZDPA 2MZQA 5K9FA 2ACMA 1SKSA 4F3OA 4K4SA 1Y11A 1M5HA 1Q79A 4MTPA 4NLRA 1HHQA 1S1TA 4IG3B 1VQ7S 1NK4A 4KFBB 2OEMA 2QG9B 2RRBA 1SB6A 1RHRB 4LQ3A 2PFFB 4I0WA 1BGXT 4GO7X 3AH6A 4RW7A 3L3CA 1O0PA 2ZC3A 3HJFA 4YR3A 3CMES 4N8NA 3R5CA 1RT5B 2HPUA 2RH3A 3RBXA 4KQZA 2DPIA 3N28A 4ZVGA 1VDHA 5AXLA 1XNQJ 2UUCJ 4Y3CA 1FKOA 5B09A 1PC5A 4KKOB 3KLEB 4RW6B 4WU3A 2GQ2A 5HN0A 2XM3A 2OO4A 2UV8G 3QGIA 2Q43A 3OJSA 2POKA 2Y0BB 1XN9A 4OYOA 3BF4A 3UW1A 1B3TA 2JWNA 2Z56B 4CO2A 3GFXA 1Q5YA 2BQ3A 1YJRA 5ETQA 4UTGA 4OX9J 1KEKA 1Q0NA 2ASYA 4J9UE 4WYWA 3TW0A 3QT6A 3WBZA 3T3FA 1Q8BA 4LVNP 3GG0A 4DL5A 1YDLA 1SIZA 4O3QA 2HEKA 4EU0A 2XY5A 3KLGB 5T7LB 2DNHA 2PE8A 3ETMA 2A2CA 1G2EA 3OTDA 3UO0A 3KHRA 2GMHA 2QV6A 5KOXA 3OHBA 2V8GA 3MEKA 3S6EA 4JI7J 3M8PA 1KLMB 1XR5A 3M05A 5EWFA 3FBBA 4DL4A 4DSIA 4RNHA 1S48A 3VAGA 4ILMA 2M3DA 3CW2C 4DFPA 4F8RA 4DR7F 3BGRA 2R8KA 2JFKA 2CPDA 3NAIA 1HBNB 1MMDA 3AB4B 3QFWA 4ELVA 1BQMB 1AUDA 1KSPA 3I4PA 2KXNB 5M2RA 2YNGA 3RAMA 4TU7A 4FVMA 1NDCA 5KFUA 2MLXA 1FTRA 3AJ2A 5L9NA 1CC7A 4ZPWR 3CO0P 5GMKa 2GQQA 2MSSA 2PA8D 4OYWA 1RAOA 2N3LA 4TXSA 2XY7A 1X9SA 4F7VA 1NK6A 4B3TJ 1MU2A 3MEDB 3RB0A 4PWUA 1IBMJ 5LMNF 1N5SA 5E41A 1RKJA 1M90T 2PI5A 4LFCJ 2D9OA 1IBLJ 4C8YA 3BH7B 3ZC4A 2VV5A 3PFOA 3V81B 3MAAA 4Y65A 3UD3P 2DR8A 1WKKA 2UUCF 2BANB 1S0VA 4FF1A 1SJQA 4KHPF 3SDEB 2Q3PA 2AJ2A 2W8KA 3I0SB 1T95A 1BE4A 2B5JB 2C3UA 1CS4A 3QWPA 1Y5LB 2PC6A 4I7FA 1S6PA 4DBQA 3SYZA 4B3RF 2BM1A 1WEYA 3QFHA 5B0EA 1UW4A 1VIOA 3C66A 5FIIA 2ZWPA 3ZZRA 4CO5A 4TQSA 4ZVSB 2DCLA 1C0UB 1A9NB 4TLRA 3M8ZA 4YDDB 4JI3J 5F0UA 1U7LA 2LU1A 2YTCA 4A47A 2MJNA 1V3ZA 1JNRB 4BBYA 3M9NB 2EFOA 2L3MA 1B64A 1FXLA 3CDWA 1K44A 3GYXB 1F0XA 4AQYJ 2XMWA 4OHYA 1P9QC 3I82A 4NA3A 4U6PA 5DG7A 2HVDA 1RTJA 1IJEB 2HAIA 2FC8A 5B7WA 2IHR1 2DNLA 2B4PA 3FFIB 3P96A 5I3QA 4DV1F 3KNGA 1APSA 2HGMA 3RRKA 2Q6BA 2FB0A 2LEPA 2XHWA 3R6GB 4P73A 3HMJG 5D3GB 3EUNA 1AFJA 1WKLA 2PO4A 4FS2A 5B0DA 5RUBA 1UFLA 3W5YA 1FEHA 1W26A 2PT0A 1JLGA 2CQDA 3LPYA 3PW2A 3VAMA 2D3OR 2BM0A 1X4FA 3CC7S 2CQ1A 3VQSA 2CNNB 1WACA 4M5HA 3SCIE 2JEFA 4I6WA 1IKVB 3TZXA 4OI2A 4ZVHA 1GTHA 1TL7A 1WWHA 2G2ZA 2RDDA 2DO4A 4GMKA 4ED7A 2ZD1B 3DNCA 4OHZA 4N76A 3ET6A 1XMQF 4X64F 2WW4A 2HNZB 4HACA 2BE2A 2DGXA 3LTOA 3MZIA 4OJHA 1FD8A 3P49B 4KAIA 2J7UA 4FZVA 3BYPA 5EX3A 3HHDA 3H59A 3MM7A 3PTWA 4DCOB 3GYNA 2HSEB 1HMVA 4E2FB 1UVIA 4LF7F 3N6MA 3KG0A 2ADCA 2WVDA 2BJEA 2Q79A 1VBXA 4ED1A 1CQNA 3W5XA 2EC2A 2G2YA 2M0GB 5I3PA 4J9LA 1S59A 1SC4B 2BZ2A 3NBPB 4GVLA 4WP9A 5KFTA 5J2QA 1U1KA 2CA9A 4X4NA 1AW0A 1TAQA 5J2MB 2MQMA 2XWYA 3C15B 4RW6A 1M5VC 4KGVB 4DR4F 4ZCLA 5CCMA 3KLIB 5KFVA 2B0GA 4PXCA 4PXEA 3KLFA 2OTLS 4UZBA 1RTHA 4CTAB 3D6MB 1S1XB 4S0MA 3ZZZA 5C2GA 3LWMA 3M2VA 3QO9B 2AZ3A 3QSIA 3TAPA 3M8WA 4AXJA 3FCWA 3R5AA 5ADZA 2RS2A 1YJNS 5CH7B 2B3TB 3K0JA 2ZH7A 3H8YA 4YN3B 5KT3A 1GFWB 2LDIA 2O01C 1ZYQA 2P6TA 3MM9A 3PJWA 5J2NA 2IYIA 1S7HA 4Q2LA 5DDOC 1LW2A 1TL3A 3D66A 3KWMA 3MECA 5ETTA 3EXYA 2C22A 1F1BB 2BRKA 1X0PA 4ES2A 1SJ4P 3GFYA 2IAJB 5EN1A 2O66A 2ILYA 2B8QA 2JRSA 1HBNA 4TYBA 2BR0A 1FNOA 1T9XA 3NCPA 1HI8A 2UUBF 1T9UA 5ETKA 2E5HA 2V8VA 3KLHB 3PX0A 4DF8A 1FNXH 2AIRB 3H40A 3OT9A 3H25A 2R8GA 2V4JA 4CT8A 3DLBA 2GHWA 3U1MA 2W8LA 3A3PB 3MDFA 1YTYA 1NH7A 2NXNA 5D4NA 3TA2A 2R7WA 1RT6A 3A13A 3E8OA 1YI2S 4F67A 1AFIA 1XJWB 2HHUA 5C24A 1IKWA 2PDAA 1WDTA 1KQSR 4K4TA 4GRSA 1HWIA 2MZ1A 2DRDA 4ZOSA 2O5DA 3VZIA 4FYDA 3OVSA 4GC6A 1TKTB 5D78A 2KU7A 1RHJB 3H5UA 3P5TL 2Z2ZA 3FBFA 2Y1LB 3NRBA 4AXIA 1Q82T 1ZPWX 1EB0A 1TKZB 1S1WB 2HFZA 3DRSB 3N79A 3MD1A 1HQEB 1T9YA 4P7TA 3MCNA 1SI9A 1BHNA 3RRGA 1HA1A 4DJBA 2DBBA 4USVA 2LA4A 3KTQA 1NDLA 2NR0A 2J8SA 3B8HA 4N47A 2MXYA 3QZ7A 2W7AA 3C3LA 1VI7A 2CDRB 2CPZA 2BKPA 2C2MB 3VV2B 2KG0A 1RHKB 2DK2A 3GLJA 3Q89A 3CC4S 4M5MA 4DS4A 3WIUA 1SL0A 3OW2R 1RBLA 1QE1A 4P6QA 1FK9A 1WOOA 4YB5A 1RTJB 4AQYF 1NHKL 4DX6A 1FESA 2Y8YA 3I32A 1KR4A 3MTJA 1NJXA 1FFWB 1NXIA 1RA7A 1XEZA 1WSRA 3PYFA 3TUJC 1N48A 4FF2A 1RT2B 2K7JA 4NLGA 2KXFA 1FWKA 1AROP 2JVRA 4KE5A 4ANDA 4ZVQB 3KLVA 3HHKA 2RS8A 4YOEA 2QLBB 1Y9OA 3DLGA 4IR9A 1IKYB 3OBIA 3DLEB 5FDLA 7FDRA 4U67Q 3DGPB 2GV1A 1ZTTA 5ETVA 4B3RJ 2HWIA 1R6VA 2FQQB 2ZZNA 1B0VA 1S1VB 1BUXA 3CNQP 2H3EB 2EG2A 4G65A 2DTJA 2QMWA 3BO3A 2DVIA 4EZ6A 1RISA 1FE0A 4BHQA 3QMQA 2HQ3A 3IA0A 2K2PA 3CJ2A 5KFNA 2DR7A 3BR9A 3P45B 4WKYA 3H90A 1ITPA 1TV6A 2MPUA 4TKTA 3RR7A 4C97A 2E7VA 5KFBA 4EWTA 4A8KA 2HK3A 2I0XA 5I42A
chains in the Genus database with same CATH topology
2DHXA 4PKDB 2ASJA 1U49A 3TUIC 3C6TA 2UUTA 1TL4A 2VFUA 3GILA 1JLFA 3NS5A 1H0HB 2AX1A 4WZMA 1VMBA 1VQ9S 3HK2A 4OHWA 1KC8T 1X4HA 2IBKA 2IVMA 3HXMA 3MAQA 3M6UA 4WKRA 1BD6A 4DL6A 3DHWC 4K4XA 2VFRA 4HDGA 1U1PA 2HYIB 3NNCA 4OZ0A 2MB0B 2YKQA 1Z2ZA 5DLGA 1R6YA 4DV0F 3UCGA 1M5OC 3R5BA 5C25B 3BGLA 4B08A 5CA5A 1PC4A 5A8WA 2MY7A 3I96A 4DEZA 2MHNA 4JI2F 1RTIA 4ZA1A 1O5JA 2LQJA 1KOHA 2J5AA 2FIUA 2YNHB 2ZHAA 5JVHQ 1DRZA 1WHWA 2E5GA 1X0FA 2ROPA 1HYSA 5JVGQ 3TAQA 3KK3B 2IMOA 2BABA 2XCPA 2OPPA 1E6YA 4WF9Q 4OV1A 3SMZA 1K1SA 2P9EA 1P6TA 4CCHA 1X5SA 3EXCX 5G0RA 3J7YU 1RT6B 3VWSA 1YIJS 2ZC4A 3DU5A 3QLHB 2F7VA 5GAEI 1N5TA 3FZBA 4M94A 4C11B 2MDAA 2PI4A 1ZAWA 4EBDA 1M5KC 1R8PA 2A2DA 3FDSA 1UP1A 4QIFA 5CHCB 3OR1A 3TYTA 2N3OA 1Q53A 3KFWX 5F8IA 5DG8A 1ZZFA 3PZPA 2HVZA 2VB6A 1XNRF 1SJRA 3CULA 4ZP6A 1Q4RA 3PKMA 3E01B 2NSCA 1U1NA 3HF5A 1T05A 3BZQA 2KZZA 3J80Y 1SQEA 1BLUA 2HHPA 4XDDA 4ZMMA 2AGQA 3HHLA 1FJEB 4KV8B 2FVCA 2ZD1A 4PG5A 2B56A 3T19A 2KJWA 3H2UB 1GT8A 4PPZA 5CZXA 5THWA 4B9SA 2BDPA 2XS7A 2FTRA 4G3IA 4R0EA 2XMKA 3I4HX 2A3JA 2CG4A 2ZUGA 2FJVA 1QSYA 1UL3A 1HW9A 1IM4A 4FBUA 2ZJRQ 2R7SA 2RF2A 1J5OA 2GMLA 2WSEC 4WFZA 3RYLA 3QAEA 1X9WA 2Z4PA 1U1QA 2VBXA 1R8HA 3PNIA 2R2UA 1VQMS 1U48A 7FD1A 2XB2D 1WF1A 3W2VB 1RDRA 2MKKA 1HWUA 2MQPA 4IUFA 2J76E 2FDNA 3MMAB 2RT3A 2CVEA 4NZ7A 1HNIA 1J2VA 1RP5A 2NLWA 1N5VA 2GO8A 3N6NA 4O4GA 4QQBA 4DQPA 4BC9A 4I64A 3I5CA 3JYTA 4ED0A 2KYXA 5B0AA 5J2NA 3K57A 5D4PA 4R5PA 1VQ4S 2CQGA 4EZ9A 3SZ2A 1HPZB 4Z37A 4MIBA 3T1AA 1MMLA 1F5CA 3C6TB 3LANA 3PR5B 3I0RA 4DG1A 4F26A 3M2UA 1JLFB 2M8DB 3UCZP 3U1LA 1HBMA 1RT4B 2E66A 2XI2A 3TQ1A 4ZPBA 2PFFB 1H2UX 3ULHA 3ITHB 3TP2A 2WSFC 5CQGA 1V3SA 2E1RA 4NLOA 3DCAA 5IZHA 5K5MA 1IKXB 4GO5X 4Y34A 2V4JB 2QLWA 4CNYA 3TA1A 3F73A 4PQAA 1JK9B 3MXHP 1H7XA 2ZNZA 4B9UA 3PDNA 2JLGA 4X2BA 3O2IA 1KTVA 4HHJA 4YUDA 4ZPVR 4RNOA 2B51A 2HMIB 1H6KX 4HT7A 4DUZF 1SKWA 4V19X 5KTQA 3EX7B 3TVYA 2LXUA 5HROB 2K3KA 4IRDA 4RWWA 5G4DA 1B0TA 4BWMA 5L8RC 1N52B 4NA1A 3MR6A 2MGZA 5JUMA 5BYQA 1B7FA 3DOLB 2B9WA 3IR5B 1ZM3A 5K14B 4DL3A 3SEOA 3PX6A 1DBDA 5B0GA 3H5YA 4NWBA 1JMTA 4TY9A 4K4WA 1UVIA 3FSXA 2LQBA 1VRTA 4A8MP 2DNOA 3CT9A 3JSYA 3S7RA 1X4AA 1REVB 2NPIA 3AA9A 3NS6A 4M63A 4MJKA 4ZKAA 4IYQA 5AE1A 3J81Y 1S9EA 3VQTA 5J1EA 2GQCA 4ECWA 1FRXA 1YRUA 4C11A 5KFDA 4UW2A 4JI5F 3OTBA 5HO4A 2QSFA 3QIPA 1U45A 3G9CA 3T5LA 2KB2A 4UOCA 2OD6A 2VASA 4LSNA 1ZOTA 2XMTA 3WX4A 3RRHA 3RTVA 2KG1A 3ICLA 1Q7LB 2FHJD 3KLFB 3MTKA 2GIQA 2K1RA 5BYSA 3SCKE 4WE1A 5E3PA 3W2WA 3NNAA 2W7OA 4Y2CA 4G1QB 4WIIA 5KT2A 3DRPA 5D77A 1KVJA 3MMCA 2EPIA 4KBIA 4KFBA 2J6SA 2N82B 2YWFA 1KNZA 4ECTA 1VQ5S 1NJYA 3CEDA 4JV0A 4OI0A 2BJDA 4RW7B 1DAXA 2HGNA 4YFUA 2AQ4A 4KRWA 2CPEA 1HR0F 2HHTA 2A10A 2L9DA 3JSBA 2HRUA 3PJXA 3V6DB 2AX0A 4MYTA 4OI3A 4X4PA 1RTDA 1X7VA 4O23A 4PRFA 2M52A 5KT7A 1G1XA 4M5DA 2L41A 3NWGA 5DETA 2UUAF 2FJEB 4MYUA 3CIZA 2NXUA 2N7YA 1MWZA 3DN9A 3OLBA 1K73T 3Q2TC 2ROGA 3RU0A 3N9UC 1VQ6S 1YQHA 2EBGA 5J2NB 5A8RB 4K50A 2XMMA 5IQQA 4DN0A 4JV2A 4QIVA 2AF6A 3DDNA 1DTTB 1P8GA 3RW7A 2I9SA 3MF5A 2CPXA 3M8PB 2XMJA 2VG7B 4EYIB 1S0MA 4X4UA 1N33F 2JLEA 1KFDA 3RBDA 1S1WA 1L5UA 2J0XA 2M2BA 2RDIA 3G6XA 4FS1A 5KG0A 4NCGB 4DPOA 1KHVA 1U1LA 3GFHA 3CCSS 2OPPB 2JEJA 3AQPA 1IKXA 2ZVSA 3T5HA 1W25A 2RSQA 1MW7A 3IO1A 3OFGA 3CDEA 4GKKF 3MEDA 1JIHA 4G1IA 4B3OB 5DQHA 1LQ9A 3W7BA 2X1BA 1SJ1A 2CQCA 5LXRA 3QAUA 1E6VB 4QYZJ 5DGBA 1QVGR 2EFQA 2UXDF 1WNEA 2GHVC 3BGRB 4FXDA 4NLXA 1JLEB 4ZP8A 3I55S 3W3SA 4JI0F 2YNGB 4AUKA 3OFFA 2X1GA 2M5YA 3MPVA 4NCBA 3DLGB 2XZWA 5M2PA 2JOQA 2MGZB 4YMEA 2VQFF 3NG8A 5CYJA 5I4MA 4TQRA 1OWXA 4Y6IA 3NAHA 3Q8PB 3HT3A 2DT9A 4A8OA 4A8QA 1HBOA 2VOPA 3AY0A 3IXQA 3K5OA 1DTQA 2PN6A 4NYZA 1WF0A 3T5JA 3M32B 2AJQA 4LVOP 4QOTA 1TV6B 2HQIA 1X5TA 4ECSA 3DLKA 4Q43A 2QE5A 1UJ6A 2FVSA 1SJ3P 2BUNA 3OTEA 4TU9A 3LUYA 4NRUA 4ZK7M 5GAHI 3A8EA 3EGNA 4O4RA 1R8AA 1IBLF 4K4VA 3G71S 2LA6A 3TR5A 2XGPA 2U1AA 4ED8A 3DXSX 2YKMA 4G6VB 4RNMA 2H9ZA 3NCQA 4MH8A 3IR7B 2DH9A 5F8HA 2CFXA 1D3WA 5KFLA 1NK7A 5KFEA 3M6XA 1W2IA 1TL1A 4WXOA 2KTQA 1UVNA 1HNIB 5B0BA 3LGNA 3N4WA 3H4DA 4JV1A 2Q6CA 4FPRA 2ZOGA 4IH5A 1ZETA 3QYYA 1YJWS 2VBZA 2CZVC 4OL8A 3W2WB 1FNMA 1TVRA 2M8HA 4MMOA 5KG5A 5GAGI 4PUOB 2R7QA 3JSMA 2K7KA 3MM7B 3BB5A 5KG2A 5HI7A 1FRHA 3ONQA 3KK2B 4DR6F 2AD9A 3ENVA 4UUWA 1S0OA 1IKVA 2V9WA 4LMZA 2OTJS 3UFCX 1FDBA 3ITHA 4YHHF 5U47A 3J7ZT 4EYHB 1K0TA 3CDAA 3OPKA 4MK8A 3GMGA 4N77A 4L6V3 5CYMB 3V4IB 2XCAA 4XIUA 2IVYA 1N8RT 1NO8A 1FXRA 1XWLA 2YKNA 2E5JA 3D5MA 4MAKA 2KT3A 2OFHX 1OPIA 3N0VA 3UR3C 1SUQB 3QJPA 4OFZA 3IRXB 4YP3A 3KK1A 1Q82T 4AL6A 1YVFA 1SC6A 1CEZA 5EWGA 1S10A 4CI0B 3HVWA 2FJXA 3O44A 4ZPAA 4DUYF 2J9EA 3IBWA 5GAGU 1FCAA 5AXNA 2F9DA 2YX7A 2EFGA 2YKPA 4YB6A 2FUG9 5D6GA 4ZPDA 5T41A 2EFVA 2DR8A 1Y3KA 2CQ0A 2DGOA 2QLXA 5CCLA 5J2MA 4I1TA 2GX8A 5L1KA 4ETZA 2ZH8A 3IC1A 1RAJA 5H9FJ 1R0AA 1JLCA 2B4UA 2MJUA 2MKCA 3CO9A 5E0OA 1S49A 4K2XA 4DN9A 2ZM6F 2ASDA 2DR7A 4TY8A 1EETB 3L7PA 2RU9A 2KFNA 1IN0A 1RKIA 3MOZA 1HNXF 4Y0FA 1OQ6A 2YX1A 3C2PA 5F3ZA 3UQSA 3VF0B 2ACYA 4PXDA 6FDRA 2GIRA 3I31A 2I1RA 1YJVA 1ZAXA 2KHDA 4BC7A 4WYLA 1SL2A 2IMWP 3DHXA 4PQUA 3OL6A 3M9MB 4E8UA 2KT2A 5F8LA 1Z2LA 1WTBA 2CQ4A 1TL3B 4Y2AA 4B3OA 1RT1A 2QYCA 4LUBA 4DFMA 2LU2A 4LQ9A 1E6VA 2XG8A 1NU4A 1VGYA 4RW8A 1JLEA 4AE5A 2BRLA 2QT7A 4HH1A 1RT5A 1VK3A 3PW7A 1KONA 4O3RA 3K8WA 4O44B 4ECVA 3QPIA 4KGKA 4IG0A 2ZHBA 1TKZA 2EW9A 3S8SA 2UU9F 1HQEA 4KTQA 2OPSB 4IRKA 4KHMA 5LJ5Y 5KFKA 1NKEA 1VQSA 5CZVA 4QWBA 2CQPA 1M0SA 3M32A 4M95A 1R43A 2DHAA 1OSCA 3UNGC 3KLGA 4U9RA 1H98A 2C3MA 1LWEB 1QUVA 3CJ3A 5HBMA 1FK9B 3CMAS 2CPIA 2NPFA 4IO9Q 4HTJA 5E33A 4PWDA 4ID5B 4IDKB 5L38A 1RT2A 1KRPA 5IQ6A 3WZ0A 2W9CA 3OLAA 2W24A 4YB1P 3NMRA 1N32F 2DNPA 4A46A 1TL5A 3PEJA 2V94A 4RKUC 4F25A 1S76D 3U7JA 5GADU 1DQ8A 1IJFB 2MYFA 2DNZA 3M6VA 4F3MA 3HVAA 1FEEA 4FVCA 2V8HA 2LQ5A 3K59A 4DQIA 1LWFA 3HZGA 3H2LA 3THTA 2RRAA 4KGMA 2M70A 1QM9A 2JC0A 5L1JA 4NXMF 4J5OA 3DLEA 4IH6A 2ZKUA 3DM2B 4QZVB 4DX8H 4ZS6A 3UD4P 3QJJA 1V6HA 3L95X 2PEHA 4OI4A 1N0VC 3BSOA 4DHVA 5C42A 1C0UA 4FN5A 3ZZYA 1OSDA 1VQYA 3E3XA 2N4DA 1P1LA 1UVKA 3LP0B 4JI6F 1JLAA 2MY8A 3M6WA 2AJFE 5GVQA 2RKIB 1X4GA 5FLXY 1UEUA 2YWGA 2YNIB 4QCLA 2P9GA 3VZHA 3PW5A 3T9ZA 1FKAF 1Q1KA 2F9JA 3N01A 5I42B 4QW8A 2YNFA 5J1PA 2EKYA 2VG6A 4A8WA 2OAUA 2XNQA 1VIXA 2FVPA 2ABYA 2OJ3A 4IR1A 2UVWA 1HL6A 3DOKA 2DIUA 2DJWA 3FEZA 1VC5A 2BQUA 1CVJA 4HLBA 2JX2A 2D74B 3GR1A 2H5EA 1TFYA 4WFBQ 5KFSA 3EPGA 1HYSB 1YG0A 2CDQA 4OIXA 2M88A 4XAKA 5HMZA 1JLCB 1VBZA 1KLNA 3MFIA 3J7Z5 2XMVA 1HBOB 4CH7A 2YY3A 2G4BA 1HI0P 5DRKA 1LWCB 4TU8A 4OZ1A 4C2MA 1P27B 3TA0A 3LP2B 3K5NA 2YH0A 2IRYA 5EX0A 2E1CA 2I2YA 3B4MA 1FRKA 3Q23A 4IFYA 3FJ2A 5KFXA 3THPA 4Q0BB 4QU6A 2FGCA 4EEYA 1SBRA 2B4OA 4ALZA 1Y0HA 2HIQA 2WB4A 3U27A 3LWLA 1DURA 3DOMA 3LH2S 2RIJA 1JKHA 1QJHA 3NGDA 1KQGB 3PIOQ 1NKCA 2R7UA 4Q8EA 2KVIA 5CXTA 1YJTA 5KG3A 1UA0A 2Z2LA 4IG0B 2CJBA 2L9NA 3BS9A 4ELTA 4M8LA 2YWEA 3GR0A 2F3JA 5BR8F 3E51A 3E01A 4CIOA 1T03A 1MWYA 5M2UA 1ZH5A 3TO8A 3CCLS 4R8UB 4CO4A 2LVWA 4DDFA 3JTNA 3CWJA 4C0HA 3RB3A 3IS9A 4OX8A 3OL7A 4W90B 3HHLB 3M2VB 3QO9A 4JI7F 3LALA 3H98A 2XMUA 3V6JA 1Q86T 1N5YB 3K2YA 5LSRA 2G1DA 1FF2A 1WG4A 2VG5B 2VH7A 2J0SD 4NLYA 1SKRA 2V4RA 1A6LA 4ED6A 3MUVP 2B9YA 2AP6A 1S1TB 4IG3A 3PW4A 4C8NA 3KK2A 2KRRA 3EGWB 1NHVA 4NYPA 3DI6A 1UJ5A 2Y1RI 3UPFA 3VAJA 1NJWA 4LSLB 4QJVA 3ZZOA 3KG1A 4OZ5A 5IT0A 1H2VZ 3EGZA 2SXLA 3KG4A 4FF3A 1TKDA 1GXLA 2FJAB 3T6BA 1LOUA 4Q44A 1FDNA 5HMXA 2DISA 2ZFHA 1Q8IA 2BW2A 2VBWA 1SV5A 3BQ2A 1VC6A 2J6TA 2YQ3A 3X3UA 3SV4A 1N4LA 1CLFA 4CO0A 1HI1A 1LXJA 3CCJS 2CQHA 3S01A 4ECZA 1ZZNA 2HHHF 1CG2A 3TRGA 1RT7B 1RYSA 5C24B 3CJKB 4FXVA 2HHXA 4C8OA 2VPWB 4OX6A 2FHKA 3ZZUA 4YB7A 3QGPA 3GV7B 1HPZA 2NYIA 3MGJA 4R25A 5E5NA 5KT5A 1N56A 4KKOA 1ELOA 2P9CA 3IAM9 4GC7A 1N88A 3FGVA 2RQ4A 1ZM9A 1VFJA 3RW6A 4DG1B 3DRRA 1YRXA 4NX9A 2OH2A 3NKYA 1XR7A 4DL0C 1YBAA 1VOMA 2QA4G 1EETA 2OPRB 2FPHX 2HHVA 1K1QA 3DFEA 3GIKA 4W92B 3M9OB 5FJ4A 2PGCA 2QRRA 3FEXB 2HFNA 3UI3A 1N5QA 3JTPA 4RWXA 2IRXA 4RX6A 4TYAA 2AWZA 4PG4A 4DSJA 1TKXA 1U8SA 2DNYA 2UZAA 1FHTA 5DDPC 2BVZA 1VRUB 2CQ2A 2QZ8A 3DMJA 4WK3A 3C6UA 4A8SA 4AYBD 4EO6A 5KFJA 1UAWA 3BO4A 1UA1A 3CSKA 5KFRA 1YJUA 4Y00A 1QY7A 3FRZA 1F60B 2B4VA 3PV8A 2RB7A 3C46A 2FLPA 2ZITA 4DOZA 5C5JA 2V8DA 4IRCA 3SCJE 2CYYA 1Y4ZB 4X4QA 1WI6A 2ZDOA 2O1PA 3FRYA 3SQGA 1S1VA 1WEZA 3E2EA 2G9OA 4K5RA 1P1TA 2XS5A 1I94F 3DRYA 2ERRA 4K0KF 1JX4A 1JLQA 2E29A 5DJBA 1WTFA 4C7QA 4YY3F 3L09A 2EC0A 3B78A 5HLFA 4DSLA 2E1MC 1T3NA 1SL1A 2B9XA 4KO0A 3PIPQ 2C2RA 5DS7A 1G7CB 3J7A1 1X5OA 3G96A 1VQ8S 4F2SA 2AJ4A 4KIAA 1D9AA 5DM6Q 5HQ8A 2LQ9A 1FDDA 4I56A 4ZHRA 2BQRA 5D3GA 1X4DA 4QBUA 1T94A 4IH7A 4B9NA 1IXKA 2PMZD