3W05A

Crystal structure of oryza sativa dwarf14 (d14) in complex with pmsf
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
264
structure length
264
Chain Sequence
KLLQILNVRVVGSGERVVVLSHGFGTDQSAWSRVLPYLTRDHRVVLYDLVCAGSVNPDHFDFRRYDNLDAYVDDLLAILDALRIPRCAFVGHSVSAMIGILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFDAMGANYSAWATGYAPLAVGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLRGVLGMVRAPCVVVQTTRDVSVPASVAAYLKAHLGGRTTVEFLQTEGHLPHLSAPSLLAQVLRRALARY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of D14 and D14L in the strigolactone and karrikin signaling pathways
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Signaling protein
molecule keywords Dwarf 88 esterase
total genus 92
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3w05A00
2ONCA 1P0IA 4ARBA 2XUHA 4GHWA 1E5TA 5AHXA 5A7FA 3DEAA 3BL8A 3WA7A 1M33A 2JGIA 5JALA 4DMHA 4BYMA 3E4DA 5JATA 2QM0A 3CCBA 5FOQA 4ARAA 2CUTA 2C0PA 4H7DA 5AKYA 2QZPA 1UKBA 4AX4A 1Q84A 1WB5A 2XMZA 3HSSA 1JMKC 5A62A 3CN7A 4B0OA 4OSEA 3JYHA 2OLEA 4W1QA 4HS9A 2YYSA 2GZSA 2OCLA 1CQZA 4U2BA 2DR0A 4HVTA 5EFZA 4BRZA 4RGYA 3IIIA 1FFEA 2G5PA 4W1PA 1SCKA 1WOMA 1TCCA 2Y1KA 3DL4A 4B85A 4PV7A 5IVHA 4Y2VA 4F21A 1EDBA 1W76A 4EHBA 5AKJA 5LZ5A 2WFLA 3STUA 2BUCA 5JZ9A 3G9ZA 4KJXA 3DKKA 4Q34A 3I2FA 3WK4A 1SCQA 1IUOA 4FNMA 4V2IA 5AM4A 1W4LA 5D3KA 5ESRA 1FFAA 3HEAA 1N1MA 2AJLI 1Y7IA 4U2FA 4DMCA 3ANTA 2HA3A 2HA7A 2O7RA 5IVKA 3D3NA 3HI4A 1PFQA 4QWMA 1QONA 1JFRA 1DTEA 2H7XA 5EHXA 4GBGA 3C5WP 5ALSA 4CIBA 5AK3A 3D0KA 3VJKA 3O0DA 4WFIA 4CCWA 5IH7A 3GELA 1MPXA 2WHPB 3WIBA 5ALEA 1DQZA 4NZZA 1W75A 1XQWA 4OPMA 4DLNA 3FVRA 4QNNA 1VOTA 2XQGA 5KBYA 3FYUA 4JEIA 1TRHA 1EK2A 3DS8A 4AZ0A 2LIPA 3SC2A 2C5GA 4UPDA 5K3BA 2PKYX 1WHTA 2RIPA 1UXOA 1MO2A 4MXDA 4K6HA 2VT6A 3ESBA 3G0GA 5E4YA 4X6XA 3O4GA 2RI6A 5E2IA 4N5HX 5DYTA 5DNWA 4GLBA 5JAPA 2HU8A 2VJDA 5CBKA 3WLAA 4CG1A 4CG3A 4G9EA 2BAGA 3R3UA 4Y2QA 3D2CA 4X71A 3SX4A 1D07A 1ZJ5A 3C43A 4N8DA 2DHEA 3UUFA 4B0PA 5AOBA 4YK7A 2H7YA 3PICA 4M0FA 4HXFB 1VE6A 1EI9A 4G8BA 3DL7A 3DOHA 3H17A 3D7RA 3G0CA 5AH0A 1DQYA 3ZLTA 1KU6A 1H23A 1YR2A 5CTAA 4B9AA 5HFNA 4X94A 4BC0A 1QIGA 4EZIA 1J07A 4BB0A 4UHBA 3U1TA 2XUAA 3BJRA 3I2HA 3T52A 1YB7A 3C45A 4QDTA 5HK8A 2AJBA 4BTVA 5EIEA 2X5XA 3F97A 3WYNA 4QWWA 5DYYA 2QXTA 3DNMA 1AQLA 3WKBA 1TKRA 1VXRA 1VZ3A 2WJ3A 5C81A 1U2EA 4QDUA 2JGFA 3G0IA 4QEKA 4WFJA 3WL6A 4PQEA 2GZRA 4QE3A 3FNBA 2VATA 4C89A 5HF8A 4A16A 4Z49A 2VA9A 3FSGA 4LXIA 3WWCA 1R9MA 2OPHA 5AP9A 1ODSA 1XZBA 5AI4A 1Q0RA 4A23A 3AINA 2WKWA 2VSQA 2I3DA 4HRXA 5JASA 1CUCA 1CUVA 1ZGCA 1JT2A 4CFSA 1MX9A 1XZIA 4E14A 4P93A 4RPCA 5AM2A 3FOBA 3I2IA 3JW8A 1HDEA 3BIWA 3QBJA 1QLWA 2K2QB 2OGSA 4JH0A 2V97A 2ROQA 4J0GA 1W1IA 1TCAA 4U2GA 4D9JA 4KACA 4AN0A 4FLEA 4L0CA 2XLBA 2XUOA 2IITA 3D4LA 5C7YA 5CT5A 1HL7A 1GT6A 2XMQA 3WWDA 3H18A 5JD5A 4QDOA 2QTBA 3NUZA 2CB9A 1XZEA 4G8CA 2DQYA 2QJWA 5AI8A 1OILA 2XI4A 3EQ9A 3U0VA 1B6GA 2ZJFA 1J2EA 5CXXA 1MNQA 3OPMA 1DT3A 3ED1A 1ZIXA 1R50A 1ZIYA 3DD5A 4GXNA 1GPKA 2X8BA 2VEOA 3D2AA 5D7BA 2BUAA 5ALTA 3STVA 4KE6A 4NMWA 4EY7A 1C7IA 5ALLA 4X90A 1ODTC 1BRTA 4JYPA 1XLVA 4U2CA 1H2XA 3DYIA 3QMWA 4BDTA 1K4YA 1JU4A 2ZJ6A 5ALMA 4P92A 4CI9A 2HIHA 4FHZA 4RNCA 4RE5A 4L3WA 4WDQA 2OG1A 3ICVA 3IB3A 3SK0A 4GWLA 4NVRA 1BN7A 1CUEA 1XQXA 2RHTA 1X2EA 2ZVDA 4EY8A 2XUJA 2C58A 1WB6A 4XJVA 4WDRA 1CUZA 3F9CA 2VJAA 5AI6A 1UOOA 1UOQA 5EIAA 1VLQA 4PSUA 3BWXA 3V1KA 4KYVA 3DDUA 3PE6A 3IUJA 1WCYA 3IA2A 3OTQA 1G4HA 2DFPA 2WLSA 1IMJA 3FWHA 3WK5A 5AM0A 4UHDA 3KOOA 1LPOA 5ALWA 1HPLA 1IUNA 2QR5A 1CUIA 4H7KA 2IIVA 1XRPA 1XKLA 2Y2VA 1AURA 3NOXA 3D2BA 3BE8A 3CCCA 5AKGA 3TGLA 1TAHA 1JKMA 4M0MA 1E8NA 4BBZA 1PJAA 1TQHA 2JBWA 4FMPA 1CQWA 3OM8A 3M81A 1UKCA 1BN6A 5CRIA 1MX1A 2WUFA 3VXKA 1JMYA 1XLUA 1GZ7A 5AKIA 4AO8A 3RARA 2C5FA 3GROA 3I2JA 4LKOA 5BOVA 5JAOA 3R3YA 3MGAA 5JAUA 1N8SA 3VVMA 3K2IA 3FYTA 3FSGD 4AZ3A 4BCDA 2XMRA 4ITVA 4C87A 4G1FA 1R88A 5DWDA 1IZ8A 1Y7HA 3WZLA 5EHNA 4B7ZA 2XUPA 2PU7A 4AMZA 2JGEA 3P2MA 3RK4A 3OOSA 5HF6A 2PSHA 1EH5A 3QPDA 1R9NA 1QIEA 1O6GA 4X92A 4OU5A 1R3DA 1ACJA 3D5EA 2Z8ZA 2XQKA 5ALXA 1A8UA 1LBTA 2WU4A 2PL5A 4K6GA 1JJFA 2WG1A 1R4ZA 4Q82A 1X2BA 3HXKA 5A2GA 4PF1A 1KEZA 3STXA 3W06A 1CUBA 1W6RA 1EDEA 1FJ2A 3H2HA 1CUJA 3AIMA 3BF8A 3HYSA 1JI3A 1HBJA 4EB0A 2HA4A 3A6ZA 1LZLA 1QFMA 4X7BA 4E11A 2PVSA 1N5RA 2XQJA 1UK7A 1JJIA 1LBSA 1DINA 4KRXA 4MQLA 5KWIA 1THGA 5EHZA 1YAHA 3FLEA 3LLCA 3HZOA 1H2YA 2GBIA 3C6XA 5K3DA 2H7CA 1CPYA 4F60A 1YA8A 5FPQA 1GQRA 2O2IA 3DLTA 2EDAA 4Q3KA 2VAVA 1HQDA 4Y7DA 5HK9A 1XZLA 4DM7A 3WL7A 4O08A 4JUIA 4U2EA 4AO6A 1CFJA 2WHRA 2O2GA 5JANA 3PUIA 5ALIA 2BGRA 5T4HA 4WY5A 3VDXA 2ORYA 4UUQA 4XIIA 5ALKA 4UBMA 4RE6A 5IKXA 4IHAA 3BJMA 3DYVA 1C7JA 5DJ5A 1DWQA 2BKLA 4X85A 4UBKA 4FDMA 2Z5GA 3V48A 1WPXA 1UKAA 4LXHA 4LHEA 2JEYA 1VJ5A 3C6YA 3E1GA 3H0CA 4WJLA 2VAXA 5J3JA 1LPPA 4LIPD 5AK4A 4INZA 4IQ4A 3GFFA 4WY8A 1VKHA 1T2NA 4E15A 3A2LA 5CW2A 3VISA 1Y37A 5D3ZA 3I1YA 4S0XA 5FLKA 3F96A 3ESDA 3STTA 4G4GA 2QT9A 2HFJA 2DCMA 2HADA 3EQ8A 4MEAA 1IUPA 2PBLA 3MUNA 3HJUA 4H7IA 5ALDA 5DTJA 3B5EA 4E46A 4BAZA 4G4JA 3ZV7A 3G0BA 1CV2A 5K5EA 3BDVA 3WKAA 5AJHA 4LYDA 5HCUA 3HACA 4IO0A 4G8DA 3ZLUA 1T4MA 4OU4A 2OAEA 1SC9A 2QMQA 1QIKA 1A8QA 5JD6A 3WA6A 2CZQA 2WG2A 3IUMA 5DTIA 1QO9A 5AO9A 3QMMA 1EDDA 5AK5A 1SFRA 4F5ZA 2DHDA 2ZSHA 4FFWA 1BROA 2OQVA 3T4UA 4UFPA 5FRDA 3WKDA 4QLOA 3GA7A 3D59A 3M3DA 1MAAA 2XUQA 3C6ZA 3EIOA 4HRYA 5JADA 1RP1A 4Y2SA 4H7JA 4DIUA 4BAUA 5K3FA 2V98A 3FYUB 1JU3A 2BFNA 3ZI7A 3STYA 2WHPA 5AOAA 4C88A 1NX9A 3KWFA 2CBGA 5AM3A 4QLAA 4MJ3A 1YA4A 3EBLA 6YASA 1S8OA 5C8ZA 3N2ZB 2R8BA 4EBBA 3BXPA 3X3HA 4C6HA 1L7RA 2WFZA 3G0DA 4MWSA 1GPLA 1K6EA 4DMKA 2BCEA 1B41A 2BJHA 3H1AA 1GXSA 1AKNA 3JWEA 4UHHA 2XMCA 1U8EA 4Y2UA 4Y2RA 5JARA 5CT6A 4OYYA 1CUFA 3HC7A 1UK6A 1CIJA 2PUJA 2WFLB 4EA6A 5FXMA 5AM5A 4UBOA 1ISPA 1QIJA 4H18A 1F6WA 2ZJ7A 1P0MA 4Q3OA 1K8QA 5LLSA 4L9AA 3B12A 3LP5A 2XQIA 1EVEA 3A70A 1XRRA 2PSEA 5FP0A 5JZBA 2ACEA 4HAIA 2I3ZA 2GYWA 1ZD3A 5LZ7A 4G9GA 5LYYA 1J06A 1AC5A 1G5FA 4H77A 5CH3A 3R3ZA 3H2JA 4UFOA 1QGED 4BZZA 4DNPA 1UT6A 3PI6A 4J7AA 5IVDA 3B3QA 3C8DA 4GW3A 3NGMA 2HL6A 1J1IA 4GI1A 1IVYA 5AOCA 4W1SA 1RWQA 5AICA 4TPKA 2WUEA 3O9VA 1ORVA 5SYNA 3H04A 4Y9SA 1G42A 1QO7A 3ILSA 3GZJA 4CIAA 2CJPA 3UMJA 3R3VA 2C0QA 4DTCA 5FUMA 3C87A 3H19A 5DNUA 5BWCA 3FAKA 2JGJA 5A7GA 5DYWA 4FBMA 3AUKA 4H0CA 1SOMA 5K3CA 2I78A 1MTZA 3I1IA 1E8DA 5AKZA 1XZJA 4KRYA 4FTWA 4ROTA 1YAJA 1GKKA 4N8SA 3V1NA 3HLKA 4FKBA 1CUDA 4XX1A 2XUKA 4C01A 5CT4A 1Q0ZA 1EVQA 5HKBA 4QDZA 5BV7A 4IH1A 4IH9A 4BP8A 2GBGA 3IURA 4KE9A 4UBJA 2R11A 3FCXA 3QMVA 3WL8A 1MNAA 1GPNA 3LIIA 1I6WA 2OGZA 2ZYHA 3A2NA 3TJMA 2VJCA 5ALFA 4YX9A 2ZYRA 2HA2A 2XMGA 2WG0A 2PU5A 1YS1X 1QTIA 3PFBA 1U65A 2EEPA 1K63A 2VQ6A 2QKYA 3WMRA 4KE8A 1E66A 4PO3X 1XLWA 2QJRA 1QZ3A 3FVTA 4FLFA 2V96A 4BC1A 1YASA 1EINA 4MYDA 4CG2A 1L7QA 1DWOA 1H2ZA 1UFOA 3F98A 1LPAB 5AK6A 5A7HA 5EGNA 4EY5A 2Z8XA 1QE3A 4B80A 3VJMA 2DHCA 3C6BA 5EHQA 2JF0A 5KREA 5ALNA 5IVIA 1U4NA 2QS9A 4FOLA 1EK1A 2PX6A 3RM3A 2PSDA 5ALHA 4J0JA 4X97A 4WCVA 4DNFA 4AO7A 3FCYA 4K2AA 4ZXFA 3DQZA 4BCCA 1F0PA 3WJ1A 1DT5A 3SWWA 5HF9A 4OB7A 5CT9A 2HHAA 2VJBA 5LKRA 1UK8A 1ACLA 1C4XA 1ZOIA 5T4FA 4NS4A 4TGLA 4H7HA 2WU3A 3TRDA 1ORWA 5JYCA 4B82A 1EXWA 4XWGA 2I03A 3QPCA 4FNGA 1H2WA 4XVCA 1MU0A 5T4BA 1DX6A 2QOEA 1XZAA 4PNZA 2XUIA 3LCRA 1ODCA 3WYDA 2H1IA 7YASA 2WIFA 4N8EA 4UFNA 5AM1A 3WWPA 1OCEA 2WTMA 4Y2TA 1XRQA 5HQ3B 4KE7A 2FJ0A 4B84A 3IDAA 5EIHA 5A71A 2JIDA 4I3FA 1THTA 3QITA 4PW0A 2ECFA 1LNSA 3G9TA 2WJ4A 3OC0A 4B83A 2D0DA 4BE4A 1A8SA 4I19A 1WM1A 2HRQA 1UOPA 2WSLA 5HF5A 5F4ZA 2PM8A 2WIDA 3W2TA 4M0EA 2E3JA 1MX5A 2XQFA 2XMSA 4OD0A 3AZQA 5A6VA 3L1HA 1Z68A 2ZSIA 2XUFA 1CUXA 1YB6A 3WZMA 2YXPX 5CMLA 4ETWA 4BP9A 3FLAA 3V9AA 1QIFA 3LS2A 4LYEA 4DMFA 5C8VA 1A88A 1YSCA 2WUGA 4MQMA 1BS9A 2OCGA 3R41A 1QIIA 3G02A 3M83A 1HLGA 5AKLA 1CUAA 2QVBA 1CUHA 1AZWA 2YASA 5DLPA 2WTNA 1A7UA 3WWEA 4LXGA 4EUSA 3R3XA 5JIBA 2GBCA 5I8PA 4HZGA 1FFCA 3MUOA 3W04A 4MYSA 1DWPA 5ALJA 4X93A 4C4XA 3V1LA 2ZYSA 1CUUA 2UZ0A 2PSJA 1GQSA 4OB6A 5LIPA 2WIGA 1CLEA 1XZFA 2W22A 1ZI6A 4BAGA 4IH4A 1NU8A 3QYJA 3ZLVA 2B9VA 4AB1A 2QUBA 4PSCA 3DKRA 5I7UA 3WK7A 4QDXA 2CEKA 3KSRA 5FDFA 2QXUA 3C5VA 3FLBA 1ZI8A 2OGTA 4OUKX 4AN1A 3HRHA 1YCDA 2ZYIA 5CH8A 3HABA 2OAGA 3H2KA 4H35A 1CEXA 2G63A 4J03A 5T4EA 1UWCA 1LPSA 5BWBA 4UBIA 4GDMA 4ZREA 4MWTA 4UBLA 2WIKA 1XRMA 2BUBA 5LP1A 1IZ7A 3OURA 4ZWNA 2FJPA 3QM1A 2NW6A 2VTVA 1GGVA 3MVEA 2JGMA 2WIJA 5E4JA 2JGKA 1R1DA 5H3HA 5C8XA 1G66A 4AXBA 3O4JA 4Y2YA 1PV1A 3AILA 4P9NA 2XT0A 1ZD5A 4Y2PA 3I6YA 1CRLA 2CKMA 2DSNA 4CCYA 1LPNA 1K5PA 3VVLA 1XZGA 5JZSA 2Z3WA 2HA0A 4HXGA 3S8YA 5K3AA 2AJCA 1CR6A 4ZRDA 1SCIA 2XLCA 5HZGA 3IUQA 3W9BA 1P0QA 1USWA 3PF9A 2B4KA 3N0TA 4W9RA 3OG9A 4F0JA 1F8UA 2RHWA 3WKEA 4DYHA 4W63A 4BRSA 3UUEA 1MJ5A 3DCNA 3H1BA 4BVLA 1Q83A 4C4ZA 4B81A 3AZPA 5K3FB 2H9YA 2GBFA 3A2MA 4UHFA 4X6UA 4KAJA 1WB4A 4YPVA 5D6OA 4W1RA 4FWBA 4Y2XA 1LPMA 2WFMA 5HFAA 4PSDA 3E3AA 5AIAA 4J0DA 1CVLA 5JAHA 4Q3LA 5FPPA 3RKSA 5E4TA 4QA9A 4CCYB 1CUYA 1DX4A 4DNQA 3AIOA 1CUSA 2O7VA 4WFKA 2C7BA 4ZV7A 4YASA 4AQDA 3PDCA 4MEBA 2Y6VA 5FV4A 1EB8A 4FLMA 1XZHA 5YASA 2C4HA 3WI7A 1ZJ4A 3BDIA 2YH2A 1QIHA 5LKAA 3AFIA 1YS2X 2QUAA 1XZCA 1H22A 1JJBA 3L1IA 2XUDA 3QPAA 3W05A 1QIMA 4BZWA 2VF2A 3IUNA 1P0PA 3H2IA 1F0NA 2WM2A 1RYYA 4EY4A 2HU5A 1BEEA 1XZKA 5AI5A 1ZI9A 1E8MA 5ALZA 3CXUA 3YASA 5CXUA 2V9ZA 2AXEA 2XUGA 5AIBA 5AI0A 2PUHA 1N5MA 1FFDA 2XB6A 2HA6A 1MT3A 1XZMA 3RLIA 2WILA 2B20A 2IX9A 4X95A 4N5IX 4J0HA 1XKTA 4ZV9A 2GYUA 4BE9A 3ANSA 3PUHA 2HM7A 4Q05A 3H2GA 3WK6A 2QRUA 3QVMA 1WPRA 1MN6A 3PF8A 4X91A 5AKKA 5ALYA 4HTAA 3I2GA 1BU8A 4OB8A 3WKCA 1W52X 3KD2A 4G4IA 4FBLA 1CUGA 3EF3A 3S2ZA 4I4CA 1BEZA 3W9UA 2Y2UA 3VKFA 4BVKA 5ALQA 1X70A 1CUWA 5CURA 3K6KA 3PFCA 3CN9A 3EQ7A 3WK8A 1OXMA 4J3JA 5AKEA 4TVKA 3LIPA 4UHCA 5ALPA 1LZKA 2XDWA 5FKJA 4H7FA 1EB9A 4UBNA 3KDAA 3QZUA 5CH5A 3O95A 4J0KA 1BCRA 3K9BA 3DJYA 4KAFA 3AZOA 3I6MA 5ALOA 1WHSA 3C8HA 2WHQA 1XQYA 3NWOA 1XQVA 1QOZA 3BIXA 4Y2JA 1ZICA 5SYMA 1EA5A 5HQ3A 2CMFA 5AI9A 4ZGBA 3F8SA 1HKHA 1QIDA 1ZGBA 5LZ2A 1LLFA 5CT8A 5AKHA 3O4IA 2O2HA 3GUUA 4K6KA 3BF7A 3G9UA 3IBTA 3ESCA 4A5SA 2JGLA 1ZD2P 5ALGA 3Q0TA 1AGYA 1FSSA 5AKXA 2WUDA 4X6YA 4KEAA 4ZI5A 5ALVA 1UK9A 3R40A 1UZAA 4BTLA 3FBWA 4L72A 1LGYA 4C4YA 2HA5A 1AX9A 4DSAA 3Q8WA 2XMBA 2Y6UA 4JNCA 1GKLA 2AJ8A 3GBSA 3IVMA 2X76A 3KWJA 5LZ9A 1FFBA 5LZ8A 4B9EA 5KWJA 1QJ4A 2VT7A 1XRLA 3AIKA 3KXPA 1EHYA 1VXOA 3ICWA 4UHEA 3WK9A 4JYMA 5LZ4A 2J4FA 1ZD4A 4X00A 1XZDA 2AJDA 4X3CA 5ISMA 2J3QA 1TIBA 1VA5A 2OCKA 3I28A 2HFKA 3WIOA 3ZPXA 5DNVA 1MAHA 3F67A 4P08A 2PPLA 2HRRA 4OCZA 2P8SA 4DGQA 5ALRA 1LPBB 2XMDA 2WJ6A 3WWOA 4FFVA 3AJAA 4U2DA 1KU0A 4B6GA 3ZWQA 1BCSA 4DSZA 2OCIA 1NU6A 2B61A 3M82A 3G8YA 3R3WA 2XE4A 2OQIA 3O9MA 3WQHA 3TEJA 3C70A 4J0IA 2EDCA 2WQZA 1E89A 2BGNA 3R0VA 5I9IA 5EI5A 3V1MA 4H7EA 1VE7A 1DU4A 1O6FA 2Z3ZA 1EX9A 2D5LA 4KAAA 1XRNA 4HXEB 4AMYA 1QTRA 1XFDA 1VZ2A 4K5QA 2HDWA 2J3DA 1ETHA 2G5TA 4KR0A 4DNOA 2J4CA 2RONA 3STWA 2FUKA 3I6ZA 2JEZA 3G7NA 2ES4A 1AUOA 4BCBA 2PSFA 2ACKA 1XROA 4BATA 3O4HA 3WJ2A 5HKAA 4G5XA 4EY6A 3QH4A 2DQZA 2Q0XA 5JD4A 2FX5A 3VJLA 1TCBA 3I2KA 2RGUA 1VA4A 1QFSA 4GECA 3G9XA 2RAUA 4OYLA 3DOIA 2W6CX 5K3EA 3L1JA 2HU7A 1L7AA 3FYUC 3ESAA 4Q1VA 4BVJA 2G4LA 5ALUA 4QZVA 2OXEA 3IULA 3E0XA 1BE0A 4GEGA 2GYVA 1E3QA 4J0CA 1TK3A 4BDSA 3WL5A 1AMNA
chains in the Genus database with same CATH superfamily
2ONCA 4W8OA 3T1YB 1A7JA 5MN6A 4LA4A 2XUHA 3GEHA 3OLZA 1GFSA 1KEEB 2Q46A 2XKAA 2XAAA 4M8LA 5DRYA 3WOHA 3ZGLA 4ZO9A 3O2QB 4M53A 1U7UA 2VIIA 1CRPA 3ONFA 3CZAA 4PLGA 3VI4B 1GU7A 4MNTA 3MOGA 3CLKA 2LUOA 4TTRA 2HSDA 2Q2NA 3AVWA 2QNIA 1RD4A 2JGIA 2JJ1D 2VP5A 2WT4A 3KHSA 4JJZA 4R3UC 7GPBA 5JALA 5EKUA 5DNCA 3OKFA 1YJAA 2OLKA 2IBTA 3MRVA 1MEJA 1LI7A 1PJQA 2Q5JA 3AFOA 2DU8A 3TLCA 2C0PA 6ABPA 1AZSC 1TK9A 5TQJA 4ZOLB 2RFLA 4EHAA 1Q84A 1V6SA 2G7ZA 1EWTA 2XMZA 1T3LA 3HSSA 3INGA 4PBRA 4N3AA 2YN2A 1FMTA 1T2VA 1SZJG 2A3RA 2BM1A 1YMUA 5DFAA 2PKCA 4WSOA 4B0OA 4K9LA 4OGWA 4K0RA 1ISIA 2FQWA 4DM3A 4D57A 3IO3A 1DHTA 4KGDA 4MWZA 3W5DA 2ID9A 5EKTA 2Z2KA 2YYSA 1SXJB 2P65A 3BRQA 4C0HA 4P3XA 4D9NA 4DR2B 4RKYA 4MPTA 4RYDA 5KUTA 3BXHA 3RV4A 2FQQA 2WD7B 2FPOA 4MUAA 5DBIA 4F4CA 3VBEA 3THYB 1DWUA 1X86B 2DECA 4HZUA 4KWTA 4V3BA 2DR0A 1MLDA 2VYNA 1GGKA 2J45A 5EFZA 1XMOB 1XEWX 3PGA1 4DUPA 4YRQA 3MSCA 3IIIA 3C6KA 3N8NA 1PT8A 3NDPA 1RQ2A 4LDZA 3IOYA 4DDHA 3QKSA 1P1CA 1O94D 2PUDA 3L0PA 3GMDA 1DUVG 4MB6A 4TLBA 4Y2VA 4L73A 2EARA 4RPIA 1JHUA 3AB8A 2W9XA 5AHKA 1DP4A 1FQWA 1F5NA 1W76A 4JC0A 3SFZA 1KY5A 1I4LD 4F4DA 2OBYA 1DTSA 3QNUA 3STUA 3LBNA 3OZSA 2BUCA 2H5JA 1RRCA 3JAMA 4R3WA 2EKQA 3W5HA 3CRVA 4IHJB 4KJXA 4WEOA 5BXQC 1C4KA 3R6GA 2ACVA 3R20A 1FMLA 4FNMA 4CF5A 1Y8CA 3L9WA 1XCJA 4CMHA 4JP3A 3WLIA 3P0RA 3RKRA 1FU8A 2HMTA 3SE0A 2SKCA 2QN1A 1SZDA 3SC2B 4YIHA 2BFMA 5MDHA 2P68A 4IVQA 3IBGA 2AJLI 3WRYA 5BVHA 5AVXA 3HA7A 1NIPA 4ND5A 4PHCA 2GCOB 5KTMA 5ILQA 1Y7IA 2FN9A 2IY8A 3F8WA 2VHEA 2K5UA 3GHHA 1G5RA 2IU0A 1NM5C 1RXVA 1CF9A 1DCFA 2D13A 3W9YA 3KYCA 3NCHA 2GAAA 2IOFK 3A6EA 2F62A 3QXJA 4ZDKA 3ANTA 2AOTB 2DVMA 4S2UA 4AKSA 1EQAA 2HA7A 2IOFA 2QU7A 3DNFA 3NJRA 2EHJA 5ESWA 5BNFA 3SKVA 3ZGXA 1DQNA 5I5EA 3KVRA 2JLYA 4FBGA 3QYPA 1WUYA 1TLTA 3ID6C 1JECA 1Z22A 1UQTA 4GBGA 3QOXA 5TEVA 5TPWA 2CBXA 3FPHA 1ADFA 1B42A 3EXFA 4PZEA 2FEPA 3LBAA 5LVAA 2I4NA 1G5QA 4I4IA 5AK3A 4NWIA 1RVDA 2BEVA 4DSUA 4RH3A 4J91A 2M6RA 1CY8A 1N2HA 4CL8A 4PN7A 4NULA 2GZDA 3OOHA 3ZH9B 4UHJA 1UJ2A 3AYXB 4RD3A 1Y7PA 3NWPA 2B0CA 2V6MA 4RA9A 4M1KA 4B3MB 3GGSA 5F2OA 1VL0A 1I2CA 2O48X 3FCEA 4RS3A 3CMCO 4AT1A 3FWPA 1TVCA 4EA9A 1BKSB 1K68A 1P1JA 3UFBA 4BX9A 2C92A 5HMMA 2GM4A 4FFNA 3RHFA 2NV6A 4DNXA 1W75A 1XQWA 2WJYA 3GEDA 3LHDA 3LT0A 3VOTA 2ADOA 4XUCA 2X1MA 1LJUA 1QDUA 2QW8A 3NAQA 4PAOA 3NVAA 4MQ4A 3FYUA 1NYQA 5LJIA 3CO5A 2I1VB 4CF4A 1KARA 4L4XA 5LBIA 4ENPA 3U26A 2XOXA 1PT5A 2RBGA 1A2KC 1DPGA 1HDIA 2LIPA 2Q3LA 4KUGA 2DKNA 1W59A 4L85A 4UPDA 4RKFA 1TA0A 1ZNXA 2FSVA 5KQRA 4GM4A 2FPGB 1E9FA 3VPSA 2YWCA 3CPSA 4ZVVA 1TA4A 3CH4B 3W7BA 2IYAA 1UXOA 3PX2A 4IDHA 3TQIA 4B3SB 4AJIA 3QSYA 1T0UA 4KK3A 4K6HA 1E7SA 2VT6A 4BNIA 3E7PA 3ESBA 4C3VA 4C4TA 3VX4A 5I7OA 4LV5B 4X6XA 1ZKMA 1WS6A 1E3TA 3GJ0A 1Q2UA 1IEWA 1D6JA 3UFXA 3PUWA 1V5IA 4Q3NA 5CVEA 2DPMA 1FRQA 3C98A 3FFXA 4GLBA 2HUNA 4BBJA 5JAPA 1TZMA 2HU8A 1EP3B 2VJDA 1ECJA 2VR1A 1XP8A 4CTMA 3DR5A 3T5PA 3KQLA 4OHCA 5D1NA 1N5IA 1Y34E 1BMFA 4G9EA 2FZ5A 4JVNA 3R3UA 4Q4LA 3SR4A 3VFDA 5ITVA 1RJDA 4Y2QA 5D00A 3BXFA 1FYEA 2HF7A 2F43A 1QS0B 1KJJA 3N8IA 3J7AC 2LW7A 2R44A 1W2WB 1ZJ5A 1J23A 2XRMA 4D56A 4N8DA 4TZ6A 1XV5A 2ZBRA 1KKLA 3NORA 4IL5A 1XTIA 3HK2A 2IS6A 1V3VA 3E9YA 5BWOA 3K96A 4B0PA 2ZRMA 2ZSAA 4K88A 4XD7A 9ATCA 2OFOA 2HKIA 2OCBA 3DV0A 1PG0A 4G0QA 4HEHA 4HNAB 3CF4G 4K3UA 2C78A 5FPYA 5IBQA 2GCIA 2I9KA 4R40A 5CDUA 3AJ9A 5AW8A 2DH5A 3W8NA 4DMUB 1I14A 1EI9A 2VSFA 3JRNA 2H0AA 3TDMA 3W4IA 1GFZA 4RELA 3EJWA 5CLQA 4M46A 3UGKA 1NUQA 3MINB 2DAPA 3G2QA 1L4UA 2PO7A 1WL8A 2ZYVX 4UVEA 3GFOA 2PXCA 2F64A 5BWMA 2X0NA 1DQYA 1L4GA 5KTKA 3M34A 2P0EA 5CTAA 1C8VB 3N2YA 1ZAYA 3LXUX 4X94A 3JWPA 1QIGA 2QBYB 2QSYA 2AKYA 4AS1A 3REFA 3VHXA 4CLRA 5CVDA 1WDWB 4E5SA 1FC0A 1R8SA 5JQGA 1C9DB 1YB7A 2W4MA 3FMOB 2PUBA 1BXRB 3IPCA 1P31A 2JFBA 2PAAA 1GNQA 3DXFA 4P22A 2QYHA 3GJ5A 2N9UA 4N9QA 4Q16A 5TQ0B 2OFXA 4QUJA 1VL5A 4YBZA 4D4IA 1I13A 2R8EA 5HK8A 4ZU3A 4IJVA 2A5DA 4F84A 4C5BA 1EZZA 1WXIA 2P3OA 3FETA 3JAKB 1J70A 2Z1DA 4HNUA 2OO7A 1G5IA 2X5XA 4XUEA 2X2PA 3JR3A 1RMYA 3L46A 4KGXA 3SZOA 3TS1A 3WGQA 2N75A 2JPDA 3VHRA 4CMIB 3AERA 3CR3C 5C1OA 2QXTA 2F3UA 2XQVA 1H4TA 2Z6VA 3G2JA 3OQNA 4KWHA 5JJLA 4DA6A 1O6BA 1TKRA 1VXRA 4RXTA 1KBOA 1OPXA 1U2EA 1U9IA 1Z17A 2WINI 1XDGA 3F2IA 3KYCB 2IFTA 2WDZA 1EJ2A 1Q12A 2I4RA 2WMNB 3LBFA 1Y8QA 4QEKA 4WFJA 4EPWA 1M2KA 4PQEA 4Q9JA 1H4VB 1FVOA 3SCZA 4YQFA 1U1GA 2V9CA 4KZKA 3DAPA 4JKOA 4F4FA 4HMQA 2WEKA 1AF7A 4E6PA 1R37A 1PWXA 3MPOA 1AK1A 4XGIA 5IVPA 5KYWA 1I32A 2Y3IA 4KVAA 1XYYA 3PA8A 2VA9A 4Z49A 4ZI7B 3Q7RA 2P2ZA 4HH1A 1E9VA 3LSYA 3HKEB 4MWCA 1G5HA 1ODSA 4WXYB 4WY2A 2PT9A 1Z6YA 4ILEA 4GXTA 3TSOA 4EIWA 4CE6A 1Z7GA 2MDTA 3BSYA 3DO6A 3N28A 1CUCA 3BCRA 4U7WA 1JLLB 4LY9A 4F3TA 4JI5B 4QJBA 2JFUA 1AQNA 3GJ6A 3A9TA 4FDLA 2X0FA 1SNYA 2GNAA 4RGBA 2YWJA 1NVAA 4FONA 4C30A 4D1YA 3NRCA 2Q6LA 1KI6B 3LT5A 2HCFA 2DLDA 2FY8A 3FOBA 1M2FA 5BYBA 1NMSA 2O2CA 1HDZA 1NPYA 3JW8A 3I3OA 2UKDA 3ELUA 3NHBA 4HJXA 3U9TA 2PT6A 3N9IA 3ET5A 4TOIA 4JH0A 2Y0DA 1CIVA 3WNZA 4C29A 2ROQA 1R4MA 3RAGA 4IIXA 1AQJA 1FS5A 4ITUA 4LRWA 4U2GA 1SZPA 4JUDX 4FLEA 4FW8A 3RNLA 2VYVD 4LSWA 2XLBA 2ZFUA 4OQ4A 3QEBZ 3OAAD 1CDEA 2X1HA 2PANA 2XCIA 3D4LA 1JTVA 2NU8A 2D74A 4ARZA 3GGJA 1KOFA 3JQ6A 5JCOA 1GT6A 3WWDA 4E5KA 1JFFA 3ZJVA 3GLKA 5C35A 5JD5A 3TLGB 3PJRA 4PRKA 3HP1A 5E7MA 1U28C 3T5TA 3ZV6A 4YLGA 5TGTA 3TMAA 3LT4A 3THXA 2EYUA 3ASUA 1SHUX 1OILA 3EQ9A 2ZE5A 4INAA 4M2LA 4AG3A 3DVSX 4CEJA 1RVV1 2ZAMA 1B6RA 4K6FA 1JX6A 3Q2KA 4P2BA 5JEDA 1XCMA 1KJNA 3OPMA 1GLVA 1KMNA 1SCUA 1IY2A 4DQXA 1QKJA 2DFTA 2JCYA 1B2LA 1TAGA 2V8OA 3AR9A 2FXIA 4OH7A 5CIQA 4DBLC 5K51A 1OHHD 1A50B 1NP6A 1Z0DA 2EXXA 5I7SA 3PR2B 3OECA 1PX0A 4L5IA 4F04A 4X5OA 3JQ9C 4NCBA 5HEKA 2FR8C 1EUYA 2NUTB 4F8YA 4LWPA 3KYIB 5F1OA 4DCGA 1OLUB 2GBLC 3KB8A 1OXUA 3D2AA 3GNLA 4OJYA 3H1FA 3C8ZA 1R74A 1PJZA 1GGEA 2BFDA 3AI1A 2BUAA 3OC6A 4EDHA 2IHZA 2V6BA 1GQFA 1N34B 1X9GA 4KE6A 1G21A 2FW1A 5B58T 1U2SA 4EY7A 3EVDA 3N0VA 3FI9A 4Q9HA 5C18A 2VBCA 4FNAA 3A31A 4JB3A 1FS6A 2FG7C 1BRTA 4GLLA 3HZRA 4IIJA 2IHNA 1NW7A 4UEKA 4TKVA 1B4DA 5TQ2A 4BNMA 1T6NA 1DKRA 1KP3A 2RB4A 3GR6A 3DYIA 4DCNA 4YMSA 1FPQA 2WYUA 3F9RA 4AF8A 1TGYA 3N8HA 5B7PA 3RIYA 4NXMB 4LG1A 2Q99A 2ZEJA 5HKKD 4EW2A 4R41A 1GPUA 5BW4A 1IY0A 3AR8A 1A9OA 3W8RA 2OHGA 3T5AA 2HIHA 2WNHA 3DDZX 2OC9A 2MHCA 2BTOA 2OR3A 4CU2A 1ZLXA 4K6MA 1MB2A 4RE5A 4WDQA 1GTRA 1AJEA 4WZZA 1BGWA 2VI5A 1L5RA 2QRLA 1TJ3A 2HV8A 4JUAA 3SK0A 4RA6A 2GT1A 2VBFA 3LVRE 5AJTA 4X62B 4CF6A 1BN7A 3K4HA 4IYJA 5KYNA 3CO0S 1HNXB 3HU2A 1XQXA 2R97A 1NVKA 1NXQA 3QYAA 2XUJA 4PYJA 5HKKA 1PHRA 2RDMA 5DWQA 3CBGA 1K6IA 3RVDA 4X60A 2GEUA 1VHLA 3IXLA 4N5LA 3ADPA 4AJLA 1HNZB 1CUZA 1KTVA 1PR6A 2E6KA 2QTTA 2VNSA 3CKKA 5JS7A 3CEMA 3F9CA 4HKTA 3UGJA 5IBPA 4A92A 1LJLA 2IODA 3AXSA 1DRKA 3AOEA 3I2YX 3QX7A 4J0QA 3H0KA 3K9LA 2CXXA 5IT0A 1R15A 1I5RA 4YB8A 3ROFA 4PSUA 5F3WB 4YP0A 2RHDA 5TT1A 4DG8A 3V1KA 5DNYB 1MXFA 5AVUA 4RA6B 3M4ZA 5J40A 5JVDA 1WCYA 2JFPA 3KKMA 3IA2A 3SSOA 3U9SA 2ZVQX 4MI6A 1N3YA 2RK6A 2OESA 5HMLA 3KOXA 2J33A 3H3XA 4JS0A 2R1UA 1Q7GA 3IVAA 4G0XA 1NN3A 1YS6A 2WC1A 5DN9A 1XU9A 3NAGA 4EKNB 4ZHQB 1JA9A 5C4IA 5C5CA 3D43A 2QTNA 2HHCA 4B6EA 3A14A 4TQGA 3WK5A 3KE8A 1GTZA 5EN4A 2FUEA 1FPMA 4IW3B 4HQ0A 3WDKA 2CV2A 4MCJA 2J5BA 2D54A 2MYNA 3RV3A 4Z1MD 2AWNA 3CBQA 5ALWA 2V1UA 1CUIA 3M6VA 4BMVA 1BXGA 1U0EA 4L5CA 1KS9A 2NU9B 1AZTA 1XRPA 1XKLA 3TH5A 5KSZA 5IDXA 5LMNB 1Q0LA 2ZUFA 3E9DA 1YDEA 3IJEB 1XPRA 5CFPA 3EVTA 1Y89A 1RI4A 3NOXA 3UN1A 4AU1A 5A3JA 4OM8A 3PITA 1KDRA 2XWQA 3A1FA 1DO2A 1AUPA 1GPAA 4GI2A 4NPHA 2H2AA 2ZI9A 4M88A 4YUVA 3OAAA 3E05A 1WB9A 4NSNA 1OJLA 5BY2A 1MBZA 3GVPA 1FNNA 1CHDA 3DC2A 4R5HA 5L95A 4RZSA 4CKBB 1NMQA 4M0MA 5DGCA 5F5NA 1WW2A 3PXEA 1Z83A 2FR8A 2WABA 1TQHA 5CP8A 2O05A 1JYEA 3PIRA 4HRAA 4E51A 3JQBC 3X2FA 4YCMA 3VHQA 1J9ZA 4RJTA 5TJ9A 1CQWA 4RPGA 1EVYA 1VI2A 5HDQA 4WZBE 1Y6GA 4FOOA 1AS0A 2ZQ5A 1IYZA 4TTPA 5BSMA 3RRBA 3IAS6 4OQFA 4HPJB 1QH0A 3RF7A 5D84A 3NOOA 1D1QA 4IIBA 1R4NB 1UKCA 2G6TA 4RD1A 4OHUA 4MUIA 3KXKA 3JVEA 2B25A 4IQ8A 3AVPA 5IT9A 4O4JA 5LCXA 2MMGA 2B21A 1SVUA 4G5SA 1XLUA 1KDYA 1GZ7A 2FDCA 1RXYA 5AKIA 5KJCA 4NL4H 5FYQA 1IM8A 3FWNA 3HCCA 2A58A 4WKGA 3RARA 4C6SA 2C5FA 4FGJA 4G4SO 1NFQA 3I2JA 3ZX4A 3GG9A 4JI1B 5K45A 4QNRA 5JAOA 3KSAC 1D2MA 1V47A 1JJAA 3R3YA 4QUBA 1PDWA 5AW7A 1PJSA 3AVUA 4N6OA 2XECA 4NENA 3GUZA 3VVMA 1VYVA 4X1KA 1M75A 1NYTA 2GK6A 5SZKB 3OEYA 3H9CA 4L51A 4AZ3A 4CRWB 3QTBA 5KX5F 4S1WA 2PD6A 4XUDA 5ICEA 1T6YA 4NRDA 2A9JA 2AYZA 3LCUA 3ZGYA 1P7CA 4MRPA 3SN6A 3ZX5A 1R66A 4G5OA 3GU3A 2OMEA 1DPFA 3HL4A 1IZ8A 5H4HA 3WGHA 2RHCA 1D2NA 1G8SA 3WZLA 4A0FA 1OLXA 1Z8NA 1SIWA 2XUPA 1P9NA 2SKEA 2PU7A 3IQFA 4L74A 4LDRA 4P7FA 5EFOA 5BR8B 4FFPA 1DIRA 1EFUA 5IWCA 2SNIE 4YMIA 3B7WA 4EHFA 3IEVA 3G85A 1XTQA 1EH5A 2X5OA 4IWYA 4D81A 3QPDA 4WCDA 3QVTA 4RTPA 1FLVA 5J1SB 2HPVA 2X8JA 2WNIA 1U3WA 2J0QA 1VI6A 2GZAA 4QU8A 5BWNA 4UTZA 1PU2A 1AVTA 5G0VA 2P4QA 2Z8ZA 4EWLA 2R84A 1N92A 1N0WA 3VVBA 3FDFA 3FCUB 4C22A 4EVIA 1A8UA 1FBTA 3PBKA 2WU4A 1EWRA 4BFZA 1QGUA 1D7AA 3NEYA 3L7AA 3O7MA 4UW9A 1PV4A 3GH1A 5KEIA 1BA2A 1SUDA 2QTVA 2RMKA 3O1JC 3HVRA 2IOQA 1FTWA 1SBTA 2L42A 1G9TA 3IRUA 5A2GA 4PF1A 1LWOA 2A9PA 4BGDA 1H05A 3SQLA 1Z9BA 1PBNA 2J3MA 4AROA 2ICAA 3BXGA 2IQIA 5CJJA 3STXA 3W06A 4BNXA 1HETA 1X1QA 3MN1A 2CLCX 3V8MA 1O54A 1T4CB 1W6RA 3PC2A 1Y6RA 4FHEA 4L28A 1MRSA 2HQRA 3P71T 1R16A 3ZQKA 5I47A 1EDEA 4HAXA 3QWIA 5FULA 5FOXA 2VJQA 3CEAA 3RVOA 4JFRA 4ZOBA 7REQB 2E0IA 2VPXA 3SEZA 5JC1A 4KQXA 3U16A 2J48A 3AIMA 3BF8A 1JI3A 1IM2A 2FPIB 3GHYA 1O0CA 2P4UA 3D8SA 3WO1A 4X65B 1OI2A 3D8NA 1RI1A 2YNMD 5THXA 4EB0A 4LRTB 2R5WA 4O3FA 1CW2B 4IJQA 2GJ8A 4GR9A 1JAXA 3F47A 1QYDA 4MIYA 3EMVA 3TI9A 2DQ4A 2G1UA 1Z75A 4GKVA 4LZNA 1S2IA 2OZKA 4HAYA 2XT6A 5NLLA 1W8DA 1EWQA 3IIMA 1YHZA 1BHSA 2C9CA 3U13A 3IMFA 2JJMA 3TQRA 1VFNA 3WIUA 1QFMA 4HRVA 4YY3B 4X7BA 4E11A 3ZCXA 5CVUA 4TYQA 1LBSA 1T0PA 3LO8A 2BKUA 2DUMA 5JYBA 1IOZA 1P2SA 3GZNB 2G36A 4LJ6A 1NTOA 4D2IA 4B4UA 5CLIA 4KLAA 4I55F 2YL2A 4M0LA 4AZ3B 1Z7BA 3AM5A 5EQTA 1UWVA 4NMLA 3IE2A 2WIBA 1ENZA 1DV2A 3R0QA 3FLEA 1AXEA 3MS7A 4UOQA 3UKOA 1X13A 4D9EA 1IEVA 2KPOA 1WV1A 3HZOA 1ARZA 4C4SA 5MGNA 3U4HA 3C6XA 4DEYA 4KYTA 5K3DA 2LRHA 4O4HA 5T7BA 4ENRA 2GAJA 3TNFA 1K88A 3ZNPA 4C1NA 5LMZA 3ZJYA 1G8JA 4I9GA 3AEQB 4OMFG 2O2IA 4PZCA 4UASA 1O96A 3GF4A 5I3ZA 1KZ1A 4KFSA 1MB9A 3R7FA 3UWKA 5M34A 1NF2A 3FB1A 1KMIY 5HJEA 4HFRA 4E3ZA 4Y7DA 4QFCA 3ZVKA 3ONNA 1WLSA 3TOXA 1XOIA 4HLCA 1O9GA 4MKZA 4QJ5A 3TIIA 4JUCA 4P58A 3UA4A 2FZ4A 2FN8A 1H94A 2WSBA 5B4UA 1TT5B 5K0LA 2Q3FA 1LD3A 4R9NA 1R4MB 2BHTA 3R5FA 3WG9A 3RUPA 3LTEA 2JRCA 2O2GA 3VPAA 4LZZA 1RJFA 2XVMA 3EY9A 1RQGA 5A9SA 4J1QA 1I7SB 4LN1A 4AY4A 4ATNA 2FK8A 4M83A 2CVFA 3KFXA 3S99A 3RQIA 4B6SA 1Z88A 2YWGA 2HN9A 2PZLA 3KKPA 3C5HA 3OOWA 4F2PA 2WWGA 4JLBA 5ALKA 4RE6A 3JYPA 2JJYA 5E7JA 1I6MA 1V9LA 3PCRB 4YRRA 3KK0A 1I3LA 4ZOAA 4ZOCA 1T8WA 2PL1A 4Z5XA 3BMXA 4NHEA 3R6WA 4GL4A 5FR1A 3LY7A 4KUHA 3BERA 2F1RA 3L8CA 4LMBA 5SICE 1NBAA 2ASVA 2V3VA 4I9UA 4EKIA 4A27A 2ZJZA 4YP7A 1XF9A 3H83A 5F51A 4QTTB 3WB1A 2C77A 1DBPA 1MQ8B 1BS2A 4K87A 5JFGA 1U3CA 6NULA 4CT4B 2OXFA 1PR3A 2A4MA 4UKDA 1QB7A 5GONB 4ZZ3A 4LRXA 2W5UA 1BFKA 2I4OA 5B7QA 3OD5A 3K09C 4MGIR 3H0CA 1IWBB 4PX9A 4RHXA 5A4JA 5JNVA 3G82C 4Q00A 2O1XA 3AEYA 4X8HA 3WNVA 1KGSA 2YX1A 5JAIA 3OIDA 3SSNA 5AK4A 1P18A 2PRIA 2WWYA 3I72A 4IP0A 4FZ5A 2WPNA 5KDLA 4CDGA 1HO3A 2FHSA 1VKHA 1MEEA 2MYUA 2XY4A 4ZI2A 4LJAA 4DUZB 1T2NA 1XUOA 2KYRA 4IXWA 1G38A 3O7WA 2DWUA 4US2R 3I1YA 4D5GA 4S0XA 5FLKA 4JV5B 3ADBA 1T91A 1Z4QA 2D7CA 2ZE7A 2GA9A 2FPPA 2P79A 3H3FA 4RHFA 4FUTA 5F33A 3QEOA 2QTCA 3OHMA 4MLDA 1GTJ1 4S0ZA 2NTVA 4CL0A 1QG2A 4YAEA 3EQ8A 1EM6A 2RK4A 4MLPA 3OJ0A 1IUPA 2O5CA 2F1IA 4TWZA 3MUNA 4YDHB 2VUHB 3HJUA 4OXXA 3OSZA 2YHIA 1X1SA 4L22A 3GRKA 2VDJA 3RBAA 1JHQA 4QUHA 1J90A 3GUYA 4NI5A 3LT2A 3N6XA 4QOIA 3VR6A 3GV0A 2OD7A 1SELA 3X1YA 2W43A 2BR5A 3ZV7A 4XSVA 2G88A 4BMOB 4HL6A 5K5EA 3ZYCA 3BDVA 4R83A 3LECA 4DUYB 1C9NA 1VI5A 3WKAA 1Z25A 3TQTA 1R64A 2NO5A 3HACA 3WXMA 1VKOA 1ZOSA 1DC6A 2G9VA 2I33A 2X5NA 1LY1A 2QNRA 3D6HA 1OSNA 3I37X 4JN6B 4OU4A 2OAEA 4G56A 5EMHA 3Q0IA 2EFYA 2PZFA 3SJAA 1QIKA 3HGQA 2O57A 4GZLA 2VBIA 3QVWA 4WN3A 3TL6A 4HXYA 421PA 2R85A 1G2PA 2Y27A 1I3CA 2CZQA 3M70A 3ST7A 3UJDA 4RPKA 2V5AA 2R6ZA 1ADJA 3EEBA 4UNQA 3GUHA 4YC7A 3KPYA 3TQCA 1UJ6A 2C2MA 3S2EA 2PKRA 4ITRC 2YW9A 5FLYA 3Q6MA 5L45A 1A77A 3Q1KA 1XWFA 4JB8A 1Z15A 4OY3A 4IJMA 3QMMA 1JLMA 2I6UA 1YE3A 3TRJA 1NJ2A 2CL7X 4JU9A 4O02B 3AI3A 1SFRA 4R98A 3FJOA 2DHDA 1YF3A 4IWXA 2PLFA 2EYQA 4I1OA 5T8KA 2VYFA 3EUEA 3RWOA 2OQVA 1Z6ZA 5I7RA 3WKDA 4QLOA 4LZLA 3D59A 1N8TA 5GZ1A 4HLUC 4Y6LA 4RPHA 2QVCA 2UZ3A 2G71A 4L6CA 3PC6A 2XUQA 3FDXA 4AG5A 4Z7QB 3P7MA 1VLHA 5H82A 1ZIOA 1NE7A 5JADA 4I8DA 4Q7MB 2PK3A 2P9CA 3U60B 2AA3A 3AMVA 4WBNA 1DCMA 1JR3D 3HVHA 4Q6BA 1JR6A 2V6GA 4J4BA 2XYQA 1I3NA 5HFJA 1C9EA 1DIOB 3DCJA 1KBQA 4FD3A 4J0EA 2ZRKA 4RDIA 2P4EA 3C1TA 1XTPA 4PCUA 3PJDA 5G3ZA 4TQUS 1JQJC 2O2EA 3B53X 3BZBA 3GRCA 3D8TA 3OZGA 3FYUB 1JU3A 3ZGOA 4DABA 5KJFA 1XMQB 3FWYA 3ZI7A 3STYA 5DSTA 3P0FA 2NIPA 4KFTA 5FBRB 3MM4A 1CYEA 1GUZA 5T3YA 2BGWA 1PTJC 5AW4A 2WU1A 4AJEA 2DC1A 2YHBA 1NM5A 1IZZA 1G2QA 1KVTA 1XMSA 3LPLA 1TF7A 4QLAA 4XVQA 5TMBA 2HMVA 2J9FA 1YA4A 2YQ4A 5CLLA 721PA 5H3LA 1QNLA 3E84A 1S8OA 3RFXA 4KK4A 4G2NA 4Y2HA 1Y5NA 4FC6A 1RHRA 1L5LA 2Q5OA 3GDHA 1KMCA 2BEWA 1MIHA 4JLWA 1W96A 3II6X 3RUIA 3X3HA 2MSLA 3EOAI 4C6HA 1Z0FA 2WFZA 3SX0A 2OXRA 1T8RA 1G7CA 1T8PA 2ECPA 4FGWA 4DJJA 5TLSA 1U2RA 3S3TA 4WVFA 4U8HA 1ZVVA 1MJGA 2WV9A 4XDYA 2FN3A 2PT5A 3BSWA 5BSGA 2HRCA 2F9MA 5E4FA 5E3IA 1NKVA 1ECBA 5E3JA 4EYEA 1YULA 5KYVA 4ZYXA 1KMHB 2XXJA 4US0R 1B41A 3O93A 3FYHA 1FX1A 1GXSA 2MSWA 3HWX1 2B6NA 2OY0A 1ORIA 2VRNA 5AXCA 1X7YA 1AKNA 1WSAA 1A3CA 3OA2A 3UVEA 1Z5GA 4DIBA 1O95A 4DCUA 5KTTA 5KU1A 2HGSA 2BMEA 2CDBA 2A84A 2IIBA 6GPBA 4MKFA 1N2CB 1LBIA 4A6XA 4RFSA 4Q0MA 5FWDA 2J32A 2FUCA 1JMVA 5BQ5A 3JQFC 5LWHA 2QD1A 4Y2RA 1O0SA 5ITSA 3LQYA 1ZCBA 1FW8A 1W4CA 3A9CA 1U5BB 2Z1NA 3K16A 4JR1A 4JR2A 4D9IA 5D8DA 3IJPA 1TM3E 1URPA 1UK6A 4MB2A 3C3PA 1WMAA 1CIJA 2AI3A 4KUEA 4DJ5X 1BZYA 3QU9A 4W9MC 1UDXA 1ZDMA 2WFLB 3O92A 5LNK6 3IEMA 4DV6B 2VJNA 4PANA 2OV4A 1WZEA 2VUUA 4FT4A 3JATB 3Q3EA 5C5IA 1XR3A 1ST2A 3HXQA 3JR7A 2XD4A 2JDID 4QGHA 1IBRA 2QZJA 2I2AA 4N3GA 1DUSA 4RCVA 5DBHX 2CK3A 4D3XA 2BTQA 1LVUA 2ZJ7A 4D96A 1SOWA 1QPZA 3BQMB 1YS7A 3PNYA 3QUCA 3TD6A 5LOVF 3H5RA 3NTXA 3VZBA 4ARCA 2GOYA 4IX9A 4MS1B 1VE3A 4G1VA 3NIGB 5IANA 3U3JA 1L7EA 3B12A 4W5QA 1XK6A 1PKXA 3V8EA 2ZJAA 1BMQA 3LP5A 5BVGB 1NSYA 4RDHA 4F9EA 1BGVA 3OEEA 2Q9BA 4HDMA 4COKA 3FPGA 4G65A 5JDCC 4CKEA 1L5OA 1XRRA 3B7PA 1Z5WA 5E8RA 1QRDA 2XNKA 3CKLA 3NW9A 4F1KA 4ZOLA 2B36A 3QVUA 3QFRA 4I0WB 4XM0A 2DM6A 1E63A 1QHGA 4Z2YA 1DXYA 3DMTC 3NU1A 4JMLA 1U98A 4IUDS 3LCVB 3KLBA 3LDFA 2GEDA 2Z98A 4V0OA 2C8LA 1EE2A 1AOXA 2ZRNA 1D2HA 4QBTA 1YJBA 2QRNA 2AS0A 2ODEA 4XX0B 4G9GA 1OFIA 4H77A 5ESDA 1YUBA 2FE1A 4JI8B 3CF4A 2P2YA 2E2WA 1Z62A 3IL2A 3R3ZA 3TXAA 2JLBA 2IDJA 5HXAA 3H2JA 3I34X 3C14C 4UFOA 4AI6A 1IBSA 1OA1A 5FWXB 3DWFA 3LCMA 2V8BA 4OXQA 4JLPA 1GL3A 4QD3A 3VQTA 4TUYF 3HCWA 1UT6A 2V7GA 2ZZKA 4J7AA 4M89A 1LRJA 1NMXA 3EGWA 4GW3A 2F59A 3HFSA 3LW7A 3F3MA 2HL6A 3OI7A 5JW6A 3ABSB 3ZHQA 1U7XA 2O3JA 1NUTA 4ZEOA 1J0DA 1O97C 2V7PA 4PZ9A 1DJNA 2R25B 3MRSA 5D6NA 4H6XA 1P81A 3Q2IA 5IZCC 1XYVA 2WUEA 4TPKA 1E3DA 3LOQA 1ORVA 3H04A 3DAFA 1O6ZA 1XHLA 5C51B 3S55A 3GJ4A 4IDPA 3MWLA 4RJ2A 3WYFA 1QWSA 2YHIB 1VG9B 2IPXA 1XRSB 4A8JA 2CJPA 3UMJA 4FGKA 4C04A 3WMFA 1E1RA 4EECA 2QTVB 1QSGA 1K06A 1NBME 1T8YA 4FEAA 4YFYA 2VK8A 2Q3HA 4U3JA 4DL9A 1JZTA 1WXFA 2C1XA 3ANNA 3C87A 1DXQA 2GETA 2I4TA 1LBHA 5BWCA 1JAIA 1IVNA 1FYDA 4ZAZA 4PLZA 2DE0X 4BRWA 4ZMBA 1CR1A 1JG3A 3DMNA 4FBMA 3SLKA 1E3EA 2R1TB 2ZXEA 2Q5FA 1HQCA 2VH1A 2ZTUA 4HDSA 1HE1C 1RPTA 1XF1A 3TNLA 1M7BA 4E13A 2ZROA 1JKIA 3ORSA 5DBGA 4DDTA 2AMJA 4BVGA 4LRQA 1H9AA 1XZJA 2F1OA 3LX6A 4L75A 2HO5A 4WVLA 5TF4A 4ROTA 2PZEA 5AW5A 3B8EA 2BI7A 2QP3A 1GKKA 1DUIA 1K4KA 2Q4DA 4H1TA 4LPSA 4RTRA 3EVGA 1CB0A 4JFAA 4YP9A 1I3KA 4N8SA 5B58C 3AF2A 3BE6A 1E0SA 2IGBA 5D01A 2IF0A 1PWEA 3RUFA 5KNCA 2R62A 4DLXA 4DC9A 4NP6A 3A3YA 3VNAA 4XX1A 2XUKA 4C01A 4AP5A 3IP3A 4YQYA 2FPWA 4AJ4A 1QVAA 2R87A 2FPMA 1Q0ZA 1Q77A 2YV5A 4JOQA 2NQ8A 3LWZA 4O4IA 4HT3B 4GOKA 4MUJA 1QCDA 3OF3A 4L8YA 2CVZA 1KDPA 1JLRA 1POXA 2GBGA 3D31A 3EGOA 4KPGA 3CVYA 2OV2A 4CQMD 2YV4A 3EK2A 4DUGD 3UJ6A 2ZT7A 1GSOA 4UBJA 1NP7A 2VPZA 2PGNA 4YONB 4E6EA 4YRKA 3A3NA 1RWBA 1WW8A 2C2YA 2I2XB 2XTJA 3QMVA 2OXIA 4CBVA 1MNAA 2XDAA 3RSCA 5JSUA 4KTTE 4GI3A 3LIIA 5ILGA 1I4EB 4EDFA 2WAYA 2B69A 3Q3CA 1XIVA 2FP4A 2VDKB 3ISJA 3L9XA 5EZ5A 1OD6A 3HADA 3NFYA 4CLEA 2J7PA 3WHIA 1P0CA 2CNNA 2P1RA 1REQA 3COSA 3A2NA 1C7EA 4R2JA 4B87A 1E59A 3GXOA 5K6TA 3TJMA 3K0CC 3PTLA 5K8CA 1R4NA 5ALFA 2G4VA 4TV8B 3FTDA 3HQ4O 4WESB 1VB5A 3OQOA 5JMWA 4KI0A 2GXSA 1JNYA 2XMGA 1EFDN 1W1WA 2ZQZA 1NFFA 5EZSA 3TZ6A 1XXLA 1H6CA 5BN4A 3K6JA 3A1TA 4JOCA 4CQLB 1ZJZA 4YACA 1RXWA 1B8OA 1M74A 2AT1A 2GSDA 3TUJC 3EXHA 1JLSA 4AC9A 4KE8A 3K94A 1UKZA 2ZCVA 2NWQA 3CX3A 5L40A 2D1RA 2JFZA 3FAZA 4Y6RA 1P5HA 1UL1X 4DMMA 3GDWA 4OHWA 2H06A 1XLWA 3RAJA 5EJ7A 2QJRA 1PEDA 4QIHA 5ENZA 1PEKE 3VU9A 3ETJA 1QZ3A 3A28A 4CYMA 2H6EA 4E33A 3V4RA 2VSOA 5IULC 3SBEA 1MEOA 2CV1A 5K6AA 2B4QA 3AH8A 2NXCA 2Q49A 3T3OA 4G37A 5KNCH 3T12A 5J2TA 4QU5A 1B73A 2OOKA 3IR5A 4FKZA 1IXYA 2ODQA 3UAWA 1FTGA 3Q5GA 4Z0HO 4F6CA 3DWIA 2BM8A 3QQPA 4GT1A 4XGQA 1JU9A 1L7QA 5H9VA 2FI1A 1H2ZA 1HF3A 3NO4A 5GMOA 4J3NA 3KVVA 3K70B 2X6RA 3F98A 1SMKA 3SF0A 1CNEA 3R7WB 2IS4A 1VIYA 3EZ7A 4QQNA 2DTDA 1OUMA 2WF9A 4XAQA 1II0A 3PGVA 5ANRB 3T5BA 1EPUA 1UPBA 3ICQB 2PO5A 4LHZA 3A1UA 2AD5A 4ACAA 1D4OA 1NQ5A 1AKRA 2DPGA 4ML3A 3VJMA 3FCAA 2DHCA 4QDKA 4NHOA 4US1R 3FKQA 3HYRA 3BCSA 2JF0A 3KR9A 5F5LA 2ALJA 4XLTA 2C2WA 3VPDA 5M04A 3I5XA 3SQXA 3UXMA 4M1EA 2JAHA 1QC5A 3C7TA 1U4NA 2CUNA 4DQKA 1N7JA 3P27A 3RTGA 1EK1A 3TDNA 2HMSA 4IVRA 1DAFA 2G04A 3IBCA 3GP8A 4EGSA 1MJFA 4JYZA 3RM3A 1TRKA 4NCJA 2CXTA 4C2AA 4HAUA 3CNQS 3D4PA 4IMPA 2A35A 3AVQA 3D3JA 1F2UB 3FCCA 3FPKA 2JEOA 2I3BA 4Z2AA 1UINA 2IZOA 3W5JA 2C88A 3FHJA 4YRNA 1VBMA 2FUG1 1IK4A 1N2BA 1J2JA 3DTVA 5FBZA 1QQAA 2C8KA 2DBRA 3O8OB 3PJEA 3QY0A 1SKYB 3JQPA 1TMGE 2C00A 4N5DA 4OB7A 5CT9A 3HWWA 5AVJA 4ZVLA 5GM1A 3RKUA 5AHOA 4EZEA 4MS3B 2VJBA 3KKZA 4TTSA 3K2BA 1TM5E 4JBNA 1WKVA 1MOZA 1UK8A 1ACLA 1ZH2A 3NV9A 5AJZA 3R9WA 1BVYF 5T4FA 4NS4A 5HIKA 3SDZA 5BVGA 3WFIA 1PS9A 3GVHA 7MDHA 4TGLA 2PL9A 5HM6A 3JARA 4H7HA 3AF4A 4O63O 3VU0A 1I0ZA 2BEJA 5HM8A 5ES4B 2R8OA 3IA7A 5JV5A 4ZT6A 4XWGA 2IXFA 3L0IB 4II2A 4WJKB 3RTEA 3K6SB 1M1NB 4GFDA 4ODIA 1VSQA 2DF8A 4R9VA 1UBJS 1XNHA 4B7XA 2VTBA 1PO7A 5AXAA 4PRLA 1U7WA 3T3MB 4EJ2A 6Q21A 1RCFA 1MU0A 2K2WA 5HQJA 2B2XA 1XZAA 5T4BA 3FMFA 4LQDA 5K0ZA 4EY3A 4UTOA 1EU1A 2VWHA 4L1KA 2H1IA 1FF9A 3D81A 3UUWA 1OB5A 7YASA 5FI1B 3CLUD 3WLQA 3O84A 1KEWA 2BDEA 3AL3A 3A7DA 3A9SA 4L76A 4LJRA 4KOEC 2V7QD 3IEKA 1OX6A 4QICA 1FTNA 3REQA 5CPBA 3DG9A 1WDMA 1YS9A 2DYKA 3K0FA 4Y2TA 3RDPA 1AKWA 4AM8A 5DKFA 3PEYA 2VHXA 4IQFA 1LU9A 4KE7A 4X1KB 3TOZA 4GGMX 2C4KA 3UB2A 5HQ3B 1NJ5A 1EUQA 1S3SA 2JIDA 2VUSA 1AXRA 4GLJA 4I5GA 4RLHA 3QITA 4MVJH 3K8ZA 3WGYA 3H4MA 5A1JA 2ECFA 1VRVA 2JH3A 3M6AA 1SO8A 1LNSA 1P4HA 1YDWA 3G9TA 2G7MC 4XTRA 5CM8B 3ZWWA 2I62A 2D0DA 1OV6A 3DDOA 3HKBB 3JQ8B 1VBNA 4MP8A 5DM4A 5E6UA 2H1FA 4ZALA 4CLOB 1TA9A 1Z38A 1TADA 2GGSA 1X7ZB 3T7DA 1RLOA 5HBGA 3X2EA 2X8AA 3O4VA 4MDYA 3RANA 4JBWA 1R18A 3W8DA 4NMXB 2PM8A 3AGQA 5KOHA 3A1WA 4M0EA 2XPCA 3K0HA 4RVFA 2ZE8A 1NN0A 1ZD1A 3H6KA 3N6VA 4NAUA 4KSBA 5EZYA 3VR2A 3VVCA 1QAQA 2FF7A 4LQCA 4HWRA 1RAFA 1NF9A 5DT9A 4FHFA 1FP2A 1PSZA 1GYQA 3TXYA 2FN7A 4MQEB 2E4ZA 3S2FA 1WSWA 2XQFA 4KREA 1IN7A 4RVSA 1GTSA 2WF5A 4GX0A 3AZQA 5LFAA 1FBNA 5EYPA 3WNQA 1SVWA 5A6VA 4NBUA 4HNQA 1TM4E 4HQRA 3GAMA 1XQ1A 1KI6A 4NS1A 1Z68A 2BMVA 1GFIA 1UBKS 2NAFA 3D54D 4BWGA 1PK8A 5CA1B 2IW3A 1YHNA 1HMPA 1WXGA 2XUFA 2QL5A 2VA8A 3MT8A 5DCUA 1ZITA 4NFHA 1FNMA 4ETWA 4QUDA 2C29D 1O9BA 1L5ZA 3BE4A 4CM8A 3LQ2A 5IASA 3TIVA 3P9KA 3O3CA 4YO7A 3BK2A 5H81A 1SA0B 3T3HA 3C3MA 1ZHHA 5D2CA 3O8NA 4DMFA 5IT5A 2QL6A 4GP6A 4FZRA 2IEDA 2R0QC 2OCGA 4G85A 1ZK1A 2C57A 3RIMA 1GDTA 1QIIA 3KPJA 3RT9A 2XOKA 1HLGA 4ZJYA 1VCIA 1W8IA 2O9JA 2FJUA 2J9YB 1F2VA 1CUAA 1FTYA 4GNKA 4IJ5A 4QXMA 5KYWB 1AZWA 1HQYE 1UCFA 1CP2A 1KYWA 4DJDC 1GYRA 3H7AA 4CQMB 5DLPA 1DMSA 2POQX 1A7UA 4PYKA 1O8BA 4LXGA 5DXJA 3S7ZA 3EDQA 4UU7A 1NC1A 3HFGA 1NQVA 2ZB8A 4FS3A 5JIBA 5D3QA 1NXVA 3E82A 5F7XA 5KI6A 2WK1A 1J5EB 4MV4A 5AVSA 4RVCA 4FJ2A 1JG1A 4ZHSA 3CH7A 4OXYA 1SQ5A 2RGDA 1SVSA 5ALJA 4MUNA 3HKCB 3RRMA 4MR7A 5IJWA 2HMAA 1J8DA 2ZYSA 2PYIA 1KYYA 1DARA 3W6OA 4OQDA 4ZP1A 2QBYA 3ZZTA 3T4XA 2KM1A 4JI3B 2CFTA 2JRLA 2UVPB 1NVEA 3BGWA 4P1ZA 2YXBA 3BULA 4TUYA 4UEJA 4BAGA 1NU8A 1TECE 5I4KA 3LZDA 1DNPA 4M0KA 2B9VA 3L05A 3KJNA 3QKSB 4KSYA 1T5TA 3RSFA 4U6QA 1EK0A 4LE1A 1NVMB 9LDTA 4QU0A 3PEWA 2ZPTX 4I8XA 4PSCA 1QRSA 3VC7A 2VT3A 5DNDA 3VA7A 1NMEA 4URHA 5I7UA 1ZMRA 4W99A 4Q19A 5FTKA 3JTEA 2RHGB 1BDBA 3IILA 5FDFA 3JQ7B 3SYNA 1NR7A 1EUDB 1BXZA 3MWGA 2FG6C 1NW9B 4OUKX 3RFUA 1ZM3A 2GFQA 1QGDA 3W7VA 1XTZA 3LNCA 5C32A 2UVQA 1L8XA 4H35A 1PNOA 1TQ2A 2Z56A 1ZMOA 3C39A 3V42A 3PTAA 4CEJB 1EK5A 1FW6A 4CJXA 5B36A 2WNSA 3FDZA 1R0ZA 2DKOA 2ZS9A 3DV0B 1IXKA 3MCTA 4C0AC 1K3TA 1RYFA 3OKAA 2M1ZA 1BMTA 2I66A 3ANMA 3Q11A 3TLGA 1OIVA 3HI6A 4OGGA 1GLGA 4HFMA 4TTAA 2WIKA 3M9XA 2LNDA 3TE6A 4D7AA 1YBMA 5LOVB 1YFKA 5ITWA 1KYZA 4DQDA 4NC9A 3QM1A 2BCGY 2ZANA 1SBNE 1Y3HA 2HTFA 4NQZA 3SDSA 3THWA 1ADGA 2RI0A 5A4IS 3PUYA 3T95A 2F2TA 2JGMA 2WIJA 3OCJA 5PGMA 4DEVA 5E4JA 3T7IA 2JGKA 3FYCA 3PFNA 2D3TA 4ZCQA 1J0BA 1YZ3A 2ZBUA 2XV1A 1BYUA 3T7EA 1DC5A 2PS0A 1ZR2A 1NW5A 1B2RA 1G66A 1Q92A 2V5UA 1FA9A 2Z2IA 1R7RA 2NPOA 3F5FA 3IXMA 3CV3A 1AK2A 2P41A 3NHSA 4HJRA 4MV5A 3CS3A 1TYAE 3B1FA 1ULUA 1WETA 2ZBFA 4GPAA 4H6PA 2OV3A 4Y6GB 1R6VA 4O1MA 3ZWKA 2ZWIA 2FPRA 1KH3A 5F1KA 4ETNA 5FO0A 4UU1A 2C2HA 1CRLA 4HAZA 1Z4KA 4LVOA 5COQA 1SKUA 2CKMA 3PJFA 4WKOA 1KHTA 5ENDA 2OORC 2C61A 4GVXA 1YO6A 2HTEA 3TW0A 1PP4A 4KITB 4NESA 4BMPB 5JZSA 4RTMA 1E2BA 4W5NA 1UBGA 4RCYA 2CNLA 2FZWA 3F46A 5DSZA 4HNVA 2J9RA 3LP6A 1DADA 2AJCA 5K3AA 2DMRA 5DHRA 3UHJA 2AX3A 4GRIA 1A5SB 3PA6A 4EO4A 3K8YA 5HCIA 4C76A 4CL2A 2XLCA 1F8XA 2BRUA 2BTQB 3P9SA 4Y6SA 4Q3AA 4FPXA 1I2AA 5G4LA 4B76A 1YR8A 3N0TA 4AVYA 3BEDA 4IZOA 2QAGA 1Q7RA 4YYZA 2Q5LA 1F9EA 1TNDA 3OG9A 1IBMB 2A1UA 3JATA 1FL9A 2IYFA 4FFBA 2FWIA 2NYRA 3COVA 4AZSA 2RHWA 3OQIB 3I8SA 1ZVKA 1SC4A 2DWPA 3WKEA 4FHDA 5GADl 1NQOA 3AIIA 1J09A 2C97A 1SOAA 4B6JA 4ZYTA 2IXAA 4FJ0A 5IJXA 4HMPA 1CQXA 3EVFA 4OTZA 1DXOA 2IUSA 4L3OA 5FKJA 4JSTA 2RGRA 1V3UA 3K72B 4BMDA 2X4LA 1KEPA 2E4WA 4KJZA 4D9GA 1G98A 4ILKA 4AWXA 3V80A 1MORA 1QUFA 3BIJA 1E0DA 2OZPA 1G3RA 3K7EA 2JK1A 1EX6A 1RKVA 1SB8A 4O8CA 4P5DA 1ULAA 2QW1A 4C4ZA 1JF8A 4HQLA 2PFSA 4BIMA 1YHYA 3PENA 2QW0X 1HRKA 3AONB 2GBFA 3EAQA 3SXUA 2UAGA 2YHAA 2O07A 4WZAA 3FF4A 1M2GA 1U2PA 3NHFA 4X8MA 1V48A 2OQ2A 2PLWA 3IAHA 1JT9A 3NB0A 1M72A 2GXQA 2REXB 3JV7A 3M33A 4UAUA 4ZCSA 5L51A 1NQTA 4FMDF 4TZ0A 5BUZA 1IUKA 1LPMA 1PRYA 2LDBA 2Z04A 5CHEA 4RPLA 2PUWA 4PSDA 4NECA 5AIAA 3U39A 2Y1CA 1PZHA 1KQGA 4N0EA 4HGZA 5TQVA 2IDKA 2PWYA 2ZJ1A 3K9CA 2J3HA 2DUWA 4QA9A 3DBRA 5EJ5A 1TU4A 4CCYB 1CUYA 1LRLA 5TY0A 4E1VA 1GRCA 1Y8RB 1CU1A 3E7DA 1N2SA 1Z5PA 2C4WA 1P8JA 2DBZA 1L7VC 2B8JA 4NE2A 3G8BA 1X1TA 2EW2A 3NPAA 4WFKA 4XCQA 6LDHA 5IBCA 2IH5A 4MWBA 2JCSA 1K98A 1WAMA 4KWCA 4YASA 3TTTA 2Q28A 4XDGA 2RHMA 3EBOA 2YDXA 4RDCA 1X9HA 4K46A 1L2TA 4ZO8A 2PQMA 1WLYA 3KEMA 2GJAA 1W5SA 4NAHA 1XA3A 1W34A 1XZHA 4WK4B 3L18A 2QPOA 1OXKB 1PGOA 1UBLS 2C4HA 1Z45A 3NP9A 1GPDG 5UKDA 3WI7A 3HB5X 2EVWX 5TMDA 3UFXB 2Y68A 4Q4JA 4EI8A 5KNBD 3F90A 4RVOA 1QIHA 2ZCUA 5K0GA 1FU4A 1A97A 1RHKA 1T6XA 3M4NA 3VV3A 2C5SA 4C0XA 3PNOA 4FE3A 4GSLA 4J1TC 4C4RA 3UBTA 3VTAA 1MOQA 3GJ8A 3NEAA 4BY9E 2A9RA 2ZS8A 3Q2OA 1WDTA 4JBIA 4E88A 1K7YA 5CR9A 4ERXA 5K9ZA 5K8UA 5TPZA 1JJBA 2HI0A 3I39X 3E18A 4ONEA 4I4LA 3RE1A 4GAEA 1QIMA 1QS0A 4H1HA 4BZWA 1WBBA 2VF2A 3H2IA 1M0SA 3MNFA 4G86A 1I9CA 3A4IA 2JAXA 1TX4B 5EXXA 4FYIA 4RHTA 3SVZA 4DC0A 4YMHA 4XWKA 4B7AA 4MMZB 3LC0A 1HZZC 1CE8A 4IIGA 1SXGA 1QU2A 4JP1A 1Q1ZA 3AQ4A 4AJKA 1O97D 1UC8A 1CZUA 2O50A 3OLYA 4HN4B 2QN6A 3ROKA 2EGUA 3OQMA 1SQGA 2EZ9A 5WRFA 3CXUA 1SIBE 3UAYA 4IUYA 2X3YA 4FYKA 4TQ9A 1HUQA 2XUGA 3ICCA 5AHRA 4D9MA 4QX6A 5I01A 1FSZA 1ZLYA 4PGGA 2XCTB 1WXXA 2XB6A 4URXR 3WTCA 2QX4A 1EWYA 1XZMA 3U6KA 3I61A 2CCKA 3FZNA 1RQNA 3HCPA 5FV7A 1FLAA 4P86A 2C2OA 4ND4A 4W7HA 3P9YA 2PN1A 2O0MA 4P4SA 5ICSA 2QZ4A 5F9MA 2TS1A 3K0AA 4YJHA 4NYJR 3HXMA 4J0HA 4Y9TA 3FTEA 1QVZA 2WD9A 1X80A 2VP2A 3WFJA 3WISA 5F2EA 2ATVA 1EUDA 2QN7A 4V2UA 5C7LO 1VGVA 4FFOA 4JB2A 4L50A 2P9JA 2C54A 3GJRA 4CIDA 5CCEA 3RJTA 4WUTA 3N0WA 5JCXA 4J4HA 4PZZA 4QFBA 1DZIA 4GYWA 2QRUA 2CYBA 4MW2A 3V4FA 2A78A 2R7MA 3VTFA 3PF8A 4FU0A 2CVQA 1ECPA 3TNDA 4RTNA 4EYSA 4CM6A 4HTAA 4ALIA 5EWJB 1B1CA 1XMVA 3Q7IA 4WACA 4CLHA 1CJCA 4Q21A 4CQMA 5K03A 1NVUQ 2AMFA 2IY7A 3Q1LA 3L4JA 5EKXA 2B98A 2ZRJA 3DAOA 3RW9A 2C8JA 3UYKA 1H93A 3KD2A 1K8XB 3PHJA 4G4IA 4FBLA 2XYGA 4NKRA 2R4UA 3GMTA 3NWJA 2IEAA 5FNVF 1CKEA 4YUXA 4I4CA 1NXWA 2BGIA 5EMMA 1EFVB 7ADHA 1L6RA 1MW9X 2XSZD 2BFWA 3W9UA 2GJ4A 3SE7A 3W2GA 3VNVA 3DE1X 4BVKA 4C03A 4QC2A 3NBZC 1GSAA 1ORDA 3O8BA 1Q5PA 1K75A 1QFZA 1SVLA 2B8NA 4MQBA 5A9SB 2O8NA 3QF4A 2PSSA 4TTTS 3G2OA 4OKSA 2QQGA 1U7PA 3RIEA 2Y76A 3UV7A 3D6VA 1GZDA 3K6KA 3WE7A 1VIDA 3EQ7A 2IP1A 2X0EA 1P33A 3HVKA 1DIGA 4PS0A 3RS5A 3GLFB 3C3XA 2EOAA 4FDTA 5AJYA 2G9NA 4QYXA 4Y1RB 5IC4A 2R8ZA 2PZMA 4MVJF 4UHCA 5JPCA 2PKXA 3EF0A 4EATA 3NKFA 4DT1A 4RZHA 1EB9A 3O47A 4JD5A 5EIBD 3NAZA 3O95A 1SXJC 4D9KA 3FBGA 2QTLA 7MHTA 1R0CA 2IK8A 1OI4A 5J2UA 1X7ZA 2CEAA 3JQQA 3M6UA 1PI3A 4KAFA 2LCQA 2R751 5FTNA 3I6MA 3OBBA 5H7XA 4GPD1 5MF6A 2W8ZA 3LUDA 2NVOA 3G2IA 1KPIA 3L7JA 3QBTA 1PWHA 1IAVA 1NG1A 4YRFA 1KNXA 3KSUA 3LMKA 3GA0A 3SSMA 4B2IA 3C8UA 4A8PA 3TL3A 1E9DA 1ZICA 2C5HA 4HQFA 4P0PB 4U5XA 3Q5DA 2ODWA 4OHVA 1GAWA 4EG3A 2WB2A 2NTJA 2P9GA 4HDRA 5EIFA 4BN4A 5KTRA 4HSGA 3A36A 1N3IA 3QUSA 3KD3A 5IAGA 3O4RA 5JNSA 4QYIA 5EYPB 3AB3A 2IYZA 4GMDA 4X3PA 3RFCA 3HHPA 1PYGA 4H31A 4RVNA 5B2FA 2G4CA 1ZGGA 2JJ2D 1QIDA 2IYLD 1WV0A 2O0LA 5HWSA 3KLNA 1T9DA 2VPYA 3WICA 1J56A 1G5TA 1XCOA 3IKVA 3T9BA 1E92A 5G2OA 5CT8A 3INTA 5H02A 2FFAA 2CKDA 3O4IA 3RGGA 3CKMA 2XHEA 1E79D 4LDPA 5EWMB 3BK7A 1YH3A 4JEMA 3SC4A 3TINA 5I9NA 3VH1A 1XT6A 4JGGA 3NWBA 4Z4IA 3MLAA 3R3SA 2I8CA 3ESCA 4OGLA 2RGNC 3BFJA 1FB5A 1HYBA 1OWOA 4J3FA 5GGXA 2CXNA 2G0AA 3IP6A 4C0WA 4BFVA 1ZD2P 3LBYA 4ZQHA 1YQUA 3RNOA 1AGYA 1L7BA 2OHJA 4GO1A 5DNAA 3EEOA 2HHHB 2CLLB 4RKQA 3NM4A 3KTAA 3ZHOA 5AKXA 5SZHB 3ZE7A 3IKMB 1TJNA 2NPFA 3JQGB 1S9DA 2FEOA 5BN5A 1UK9A 3R40A 1EXMA 5AOVA 1ZBDA 4JL5A 1ZCFA 2R00A 3EEYA 2RGGA 3H99A 4ZMSA 1P45A 4NBKA 4WN9A 1CZNA 1UEIA 2AG6A 2C96A 1A27A 1YE8A 3FBWA 2LCFA 3FKSD 2A5LA 4L72A 2DQSA 4EP1A 2NSHA 2O4UX 3NBQA 4C4YA 2YJNA 2C4TA 1F17A 2P90A 3HWRA 3C3KA 4BN5A 2I29A 2ZRHA 3BCHA 2DHRA 4FE7A 2X6QA 2DFDA 1F20A 1QK5A 3B6IA 4EABA 5LQJA 1GKLA 2AJ8A 5F98A 5FPHA 2VUTA 4EHKA 2X76A 4C0JA 1RKBA 4D4HA 1MAWA 1IBLB 2AQHA 3K8QA 4M36A 1ZUHA 1Z6GA 5LZ9A 3GLVA 1JLHA 1TD9A 4B9EA 5K0CA 3DLIA 5CFLA 5KO2A 4PLWA 3SDBA 2VT7A 2X7HA 1NSTA 2H1LA 4N0DA 4D82A 4P7KA 1COWA 3ILYA 1FK8A 3A11A 1NPDA 3IPLA 2ANBA 3WK9A 4TZKA 1EGVB 3PEEA 2EZUA 1L5HB 3RC1A 1VJ1A 4EJ0A 5JWHA 5IK2A 5CDTA 3MCVA 2XA1A 4J4TA 1A9XB 2CMHA 2J4FA 1I3OA 2HF9A 1MJGM 1J8VA 1E69A 5IF3A 5KSYA 1CJUC 4MA5A 1VMEA 3HBJA 2CT8A 4M8IA 1E9RA 3EPLA 2A9OA 2BI4A 3MMPA 1CRWG 5GJVC 4JP8A 1VJCA 2D8MA 2VDWA 4ISCA 4JU8A 5DHAA 2XAUA 4Q4AA 1FSGA 3ADDA 4F3RA 5C2JB 4YHBA 2HFKA 1NN1A 1BRMA 4HH4A 5KVCA 5C5EA 2Z1MA 5JAZA 4P80A 5JRZA 4MJ7A 1V25A 4LGVA 4RVUA 4ZVOA 1T13A 5H80A 3RUCA 3WIOA 1VLZA 2I6GA 3QPWA 1FDRA 2L17A 2FZGA 3L0OA 4LJSA 4XD7D 5JSFA 4WXRA 4FINA 3F67A 2B35A 2FW0A 1DEKA 2YZ2A 3IAM6 3MLBA 3R6DA 3VC1A 3AEZA 1CY0A 3HJTA 4OLHA 4IF4A 1SWWA 4BX2A 2SECE 4Y3UA 2PPLA 3JAWB 1LX7A 2HRRA 3F7TA 1G21B 2QYSA 3IX7A 2HIMA 1D4AA 4KYUA 5CYOA 4UXHA 2JNWA 2P8SA 4I50B 1HDRA 2Q1XA 3OP4A 3TFOA 1JFSA 2V3CC 1K97A 3GAFA 4DPKA 1PAUA 3ZJUA 3UF0A 1UH5A 4DDWA 4PGFA 5SZJA 1OLUA 2QX7A 2RGBA 2ZJ2A 1HM5A 4PYQA 3F5DA 4LNHA 4ADSG 4B7UA 1B23P 1EM8A 4EMTA 3KEOA 1U0RA 4DKJA 3L01A 1C3JA 1UMBB 5FYDA 2WTXA 2XXAA 4C7BA 1O8CA 3V8BA 2X1LA 1BCSA 4WMLA 4DV3B 3ZWXA 1WSDA 2P77A 3R7SA 2OCIA 1NU6A 1SHKA 4HTFB 2XWSA 3H3JA 4BL5A 5IJ9B 1E9EA 3G2MA 3A6JA 2CDAA 4H9GA 4PINA 2EAUA 4QQFA 1YB1A 4Y0NA 2K87A 2BELA 3G8YA 3DT8A 1HGXA 3GDFA 4L78A 3PLNA 1N7IA 2P67A 5FTWA 2X9QA 2XE4A 3D6FA 3M6MD 2HBRA 3O9MA 1UC9A 3OSUA 3U4MA 3I92A 2ZITA 5JO9A 3TEJA 4IJUA 4OAPA 2WQZA 2EDCA 2ZIZA 3DKPA 2BGNA 4PQFA 2WWRA 3RREA 1NHWA 1E0AA 4WINA 1S4MA 1EBUA 4P2GA 4MV0A 1E64A 3TZLA 1U9CA 3V1MA 3WO0A 4A26A 4FI3C 1VE7A 5FQOA 5HIMA 3E3MA 3H11B 1EX9A 3WC4A 4YCNA 2D5LA 2Z5FA 4B5KA 1ZMBA 4R51A 5JCPA 3UJ3X 1WQ3A 4D02A 2H5IA 9ABPA 4CIYA 3A9VA 1G0NA 4G0WA 4BQSA 5TX7A 1ETHA 1Q1QA 2G06A 1VL1A 2Y0EA 3E7FA 4IAOA 1JSCA 4Y1FA 2ENWA 4RYLA 1I2DA 1BW9B 3PRJA 5IN5A 2RONA 3ZDFA 4M87A 2A5JA 4F5DA 1VHWA 4OMUA 1ND5A 3L8DA 4D44A 1FJGB 2R8PA 1Y6JA 3G7NA 2ES4A 4UTXA 5L3SA 5D1HA 5F4BA 2PSFA 3TTVA 4XVUA 2RHBA 3HUFA 3QF4B 4CGZA 2QHXA 1XROA 1R8QA 4FDVA 2BEWB 4R2WA 3PXDA 5A2QA 2A0FA 2VAMA 1RHUA 2P0AA 2WSSD 3E58A 3O4HA 3FPLA 1K27A 4UMFA 5HKAA 4IFBA 4QREA 3COPA 1GNPA 1K7EB 2FPXA 1W4AA 3B20A 4NOKA 3VU3A 1ZVQA 1FFYA 2MYTA 3UJPA 4X7PA 1OXTA 2FX5A 1JEYB 5JY6A 4DMRA 3VJLA 1UC5B 1ZEMA 3OCUA 2BBWA 4NATA 1ZG3A 3ZD8A 4MOWA 1SBCA 4UUOA 2CJXA 1QFSA 1KMHA 3NBFA 1Q1EA 4HWGA 1U0NA 2R1TA 3DD1A 4XIGS 4BVEA 1N5KA 4D8XA 5FOVA 3DLHA 4P35A 8AT1A 4LNAA 3EIWA 4CG0A 4YCCA 1CS0A 3NANA 3VZPA 4HYTA 4D3DA 1Y8AA 1S4QA