3W06A

Crystal structure of arabidopsis thaliana dwarf14 like (atd14l)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
267
structure length
267
Chain Sequence
b'GVVEEAHNVKVIGSGEATIVLGHGFGTDQSVWKHLVPHLVDDYRVVLYDNMGAGTTNPDYFDFDRYSNLEGYSFDLIAILEDLKIESCIFVGHSVSAMIGVLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLAVGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQILPFVTVPCHILQSVKDLAVPVVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIRNDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, alpha/beta fold family protein
molecule tags Hydrolase
source organism Arabidopsis thaliana
publication title Structures of D14 and D14L in the strigolactone and karrikin signaling pathways
pubmed doi rcsb
total genus 100
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2012-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3w06A00
4X97A 3GZJA 2O2HA 2XUDA 3W2TA 4AZ0A 1LPOA 5AOBA 4C88A 5LZ5A 5SYMA 5ALSA 3PDCA 1BEEA 3MUOA 3ZLVA 4S0XA 2DQYA 1MTZA 1TK3A 1GKLA 1W1IA 4N5HX 1EDBA 4Y2XA 1O6FA 1AURA 1CUAA 3G0CA 2ACEA 2GZRA 3KSRA 2ONCA 4PF1A 2XUFA 3BDIA 3JW8A 3BJRA 4P08A 1QIMA 4PO3X 2JEZA 1EDDA 3WQHA 1R88A 4ITVA 5ALKA 3BF7A 2Z3WA 2OQIA 4HXFB 3I1YA 3WK4A 4I4CA 3YASA 4KAJA 3H2KA 5FRDA 5AI5A 2CBGA 1QIJA 2BUCA 3Q8WA 4DYHA 3VVMA 4UBOA 3STXA 2DCMA 3VKFA 5T4BA 5C7YA 3WYNA 1GPLA 1XZLA 3LIPA 2VF2A 2DSNA 1EHYA 3DQZA 3HXKA 1KEZA 3AZPA 1XZMA 4C4YA 3DJYA 5DTJA 1F6WA 1CUXA 4F0JA 1CV2A 4ZRDA 2H7XA 3ESCA 5HCUA 1XZJA 1ZGBA 4BCCA 3PFBA 3RARA 3EQ7A 4BCDA 4F60A 1CUGA 2WU3A 1Q84A 3HYSA 1RWQA 5ALJA 1C7JA 4FDMA 2OGZA 1BROA 5C8VA 2GBGA 1CEXA 1WPXA 5EIAA 4XX1A 1UKBA 3WL5A 2JGEA 1WCYA 2RONA 3IB3A 5H3HA 1CPYA 1VE6A 3IUNA 5LP1A 2HA6A 4E15A 2G4LA 2WLSA 2XQKA 1HKHA 3GUUA 2O7RA 4JEIA 2BKLA 4X6UA 1EDEA 3H2JA 5IVHA 5FPQA 4ZI5A 1Y7HA 4OD0A 5ALZA 3HI4A 5HFNA 3W05A 1YAJA 1OXMA 2GBCA 1G66A 1LPBB 2CZQA 3WL6A 1SOMA 1WPRA 1MX9A 4GWLA 2HA0A 2YYSA 4BB0A 3LLCA 1ORWA 4Y2YA 1QIFA 1ZD4A 3F8SA 2WTMA 2HA5A 1K4YA 2IIVA 1YS2X 4EUSA 5ALOA 1AUOA 4DMKA 3IURA 3FAKA 3O4JA 5CW2A 4X91A 1JI3A 1N8SA 1UKCA 5D7BA 1DQYA 1PV1A 4WY8A 3CN7A 3G9TA 3QZUA 1TIBA 1T4MA 1XQYA 1WOMA 1BCRA 3I6MA 2X76A 3TGLA 4EB0A 2XMDA 4M0FA 2X8BA 4X95A 4MWSA 4NZZA 4U2FA 2AJ8A 3JWEA 3D0KA 5AOAA 4E14A 3D59A 4AO6A 5FKJA 2K2QB 3IUMA 4QLOA 4UUQA 3C6YA 4G1FA 2W22A 2ZSHA 3I2KA 1N5MA 2XUGA 3O9VA 4IH4A 4C87A 4CCWA 1DQZA 4L72A 1EK1A 4M0EA 3DL4A 1IUPA 5JATA 5AM0A 3FCXA 1H2WA 2C4HA 4PSUA 4H7DA 1JJIA 1MX5A 1DINA 4DNPA 3D2AA 2EEPA 5E2IA 1R4ZA 4Q3OA 5ALDA 3C70A 4AN1A 2VJBA 2XMQA 5LZ9A 1FFEA 1PJAA 1AC5A 5DTIA 5I9IA 2HU7A 1FFBA 1P0MA 3I6ZA 5AM5A 1FFAA 2PVSA 5AM4A 4OB8A 4BRSA 2AJCA 4CG3A 3WJ1A 1YASA 4B9AA 2ZJFA 4LKOA 3F98A 4DTCA 1JU3A 2XLBA 1ZI8A 5HQ3A 2JGIA 5AHXA 5CH3A 3HRHA 5D6OA 2HRQA 3WWCA 2R11A 1HPLA 1X2EA 3IULA 4BTVA 1BN6A 3H1BA 4J0IA 4G8DA 4BP9A 4Y2JA 1ZJ5A 3O9MA 1N5RA 1DX4A 5AI0A 4C6HA 4BVKA 5JALA 5KWJA 2GYWA 4OU4A 5JZ9A 3WYDA 5JAUA 2V97A 4ZWNA 1JFRA 2WIFA 5EHXA 1XZEA 5JANA 1UK9A 2GZSA 2PUJA 4N8SA 3FLAA 5T4FA 3STVA 1VKHA 2FJPA 4RNCA 1CUZA 1WB6A 1CUSA 3LS2A 5FLKA 3CN9A 1EX9A 4PSDA 4IQ4A 5YASA 5EHZA 2WJ4A 5ISMA 4OPMA 2XUKA 2WFMA 1UT6A 5AKYA 4Y2QA 3FYUB 1UWCA 3H04A 5AICA 5CXUA 3N0TA 4W1PA 5DYWA 5DNVA 2XMZA 4J0GA 2WIDA 5JAOA 4N8EA 3FWHA 2PU7A 1XZBA 5AKHA 1KU0A 3DLTA 2CMFA 5A6VA 1LNSA 2OCIA 4WJLA 2Y6UA 2H1IA 4KACA 3TRDA 2WFZA 4RE5A 2B61A 1QO7A 4DNOA 1WM1A 1U2EA 3WKBA 4KJXA 2Z8ZA 2QRUA 4P93A 4JYPA 3ICVA 1T2NA 5IVDA 4X7BA 1ISPA 2PSDA 3E3AA 5LZ7A 5LIPA 2XMGA 4WY5A 4J0DA 1XROA 2ZJ6A 4FHZA 2I78A 2OXEA 3WKAA 3ZLTA 2BFNA 2GBIA 3WK5A 2JGJA 4J0HA 5A62A 2VT7A 3RLIA 1Y7IA 4RPCA 4YX9A 4ARAA 2HDWA 2OPHA 1DTEA 1UK8A 3R3XA 3I2HA 3QM1A 1G42A 3G02A 2WJ3A 2I3DA 2QZPA 4TPKA 1WHTA 5CH8A 2HFJA 4FKBA 4Y2PA 5HK8A 5ALUA 1XQWA 1TRHA 4G4IA 4EBBA 4DMHA 2XUIA 4INZA 1TKRA 3ZV7A 4J03A 3E1GA 3WWPA 1A7UA 1ZICA 2HA2A 4Q1VA 2PSEA 4UHDA 1VZ2A 3HLKA 4D9JA 4I3FA 2DFPA 5JAHA 5FV4A 2HU5A 1XQXA 5IVKA 3M3DA 4AMYA 4JH0A 4QDUA 5JARA 1TQHA 4H7HA 3CXUA 2XMSA 3B5EA 4BBZA 4H7IA 3VXKA 1CUYA 1AZWA 2QM0A 3R3UA 1YCDA 1QGED 2D0DA 1PFQA 4YASA 1E3QA 1G4HA 4KEAA 4BZZA 3OM8A 2XI4A 4X6YA 5D3ZA 3EIOA 1XLVA 4M0MA 1ZJ4A 3BIXA 3DYIA 4KE8A 5CXXA 3FLEA 3H0CA 3QVMA 5BWCA 4MEAA 4KE6A 1ODTC 4C4ZA 2Y2VA 4HTAA 4WDRA 4UBMA 4TGLA 1RYYA 5KWIA 5CT5A 3O4IA 1BE0A 3AIOA 4K6GA 4HS9A 3HABA 2VJDA 2XUOA 1DU4A 5HKBA 3IVMA 5AM1A 1EVEA 1UXOA 3H2GA 1EH5A 2Z8XA 1CUEA 1SC9A 4DNQA 1THGA 4FBLA 3A2LA 1ACJA 1A8QA 3KXPA 4J0JA 4UHEA 3E4DA 4U2DA 1XRLA 5AK3A 1QO9A 2VAVA 4GECA 5HZGA 1BU8A 3C6ZA 4MEBA 4OB6A 2V98A 4X92A 4A23A 3BWXA 2YXPX 4AZ3A 3IUQA 2D5LA 1AMNA 4ZGBA 2QKYA 3WKDA 5AIBA 2WG1A 1QIIA 5ALEA 4P92A 1UOPA 5CURA 1H2ZA 5HK9A 5AKEA 2B4KA 1VLQA 3FBWA 1DWOA 2QR5A 4UBKA 1XZCA 2OAGA 5HFAA 1AGYA 3WK8A 4CFSA 4B0PA 2CJPA 4MWTA 2DHDA 1EXWA 2JGLA 1QE3A 2OQVA 4MJ3A 5ALYA 1CR6A 3WI7A 2XDWA 1K6EA 3WA6A 4Y2TA 5I7UA 5IKXA 3FVRA 3DKKA 4BAGA 3F9CA 2ZYSA 4UHHA 5K5EA 1QTRA 1CQZA 2HHAA 1FSSA 2V96A 2OGTA 1XZFA 4AMZA 5KBYA 3AJAA 3C8DA 1IZ8A 1ACLA 3F96A 5ALPA 3WIOA 4UFNA 2CKMA 1H2YA 2WJ6A 1R9MA 5DLPA 5DYTA 1CFJA 4DMCA 4J0KA 2WG0A 3AFIA 4U2CA 1WB4A 1UOOA 3QMWA 2HM7A 5AKKA 3R41A 4F21A 5F4ZA 2PSJA 3PF9A 4H77A 1ZIXA 1CUJA 5JD6A 2RGUA 4L9AA 2QS9A 1ZD3A 3R3ZA 2JGKA 1U8EA 5AK5A 1F0NA 3SK0A 4QDXA 1A8SA 1YA8A 4KR0A 5A7HA 1C7IA 4H7KA 1CRLA 5E4TA 1QTIA 1DWQA 3HEAA 1P0IA 4IH1A 3VJLA 4MQLA 4UBIA 1MNAA 4H7FA 3C87A 4BDSA 4CI9A 1CUBA 2VSQA 1QIDA 2E3JA 2HU8A 3QPAA 5EIEA 3V1LA 5JADA 3L1HA 5CT6A 1TAHA 3MGAA 4XJVA 3AZOA 5AJHA 2PUHA 1CQWA 3R0VA 2OCLA 1CUWA 3M81A 1TCCA 2Y6VA 3FYUC 1E5TA 5ALTA 3EQ9A 4Y7DA 3WWOA 2GYUA 5CBKA 1QONA 4K6KA 1SFRA 1S8OA 4DM7A 3E0XA 1ZOIA 5FP0A 1GKKA 2IX9A 2GYVA 4QZVA 5KREA 2OCKA 3VISA 3H18A 2H7YA 2WFLB 3PUHA 4KAAA 4LHEA 2Y1KA 4P9NA 4FBMA 4G8BA 5AKLA 3K6KA 3DS8A 4F5ZA 1MPXA 1L7AA 1EB8A 5HKAA 3FYTA 3WK7A 3V1NA 5IVIA 4X71A 5CT9A 2ZYIA 1ZD5A 1LZKA 2VQ6A 2QXUA 1UZAA 1MNQA 5EGNA 2X5XA 3PICA 4B81A 1VXOA 2Y2UA 4UHCA 5FUMA 3O4GA 2QVBA 2XMRA 5AK4A 3G9XA 4EY8A 1VA4A 3FLBA 4Z49A 1XKLA 2O2IA 1Z68A 2JBWA 1NU8A 4PQEA 2BJHA 4ZXFA 2PX6A 3MUNA 5AM2A 1QFMA 3C5WP 1EVQA 3FSGA 2QTBA 1U65A 4EHBA 1DT5A 2QXTA 5T4HA 1XRMA 4ZV7A 3WMRA 2FUKA 4J0CA 1NU6A 2XB6A 3A70A 4LIPD 3HZOA 4MYDA 3ANTA 4GBGA 3NWOA 3T52A 1J07A 3I1IA 3IA2A 4K6HA 3D7RA 3I2IA 4ROTA 4YPVA 4RGYA 5ALIA 4B80A 1IUNA 2WU4A 4EZIA 4H35A 4GW3A 4LYEA 3ZWQA 3DD5A 4QA9A 1JJFA 1LGYA 5FDFA 5E4JA 1IVYA 1O6GA 5CT8A 1C4XA 1R50A 1ZGCA 1HDEA 2HIHA 2HA4A 5LKAA 4U2EA 3NGMA 3WL8A 4Y9SA 1RP1A 1LBSA 4BP8A 2UZ0A 4UBJA 2ORYA 5CT4A 3WWDA 1USWA 1G5FA 4PSCA 2B20A 5C8XA 4BC0A 1EK2A 1MU0A 2RIPA 2RAUA 2VT6A 1XZAA 3LP5A 1YA4A 2WIKA 3OTQA 4W9RA 5K3FB 1P0QA 2AXEA 2QJWA 3N2ZB 1LPNA 4AO8A 3ESAA 5SYNA 4FLMA 1QIEA 1SCIA 5BOVA 1W75A 2OAEA 4XIIA 5AKIA 4KE9A 4B6GA 1IZ7A 4BAUA 3D2BA 2BGNA 5K3AA 1Q0RA 1CUUA 4FNMA 2G5TA 5LKRA 3L1IA 1JMYA 1DX6A 3L1JA 3W06A 3QMVA 5CH5A 2CEKA 4OCZA 4W1RA 4O08A 4CIAA 4K2AA 2BUAA 1E8NA 5LZ2A 4X85A 2RHWA 2IITA 3EF3A 5ESRA 1MJ5A 3O95A 5JD5A 3SC2A 5K3CA 3EQ8A 2DHCA 4B85A 4BE4A 4OYYA 1WB5A 1P0PA 1GPKA 4OU5A 1EB9A 5DNUA 2PSFA 2XUAA 1JJBA 2ROQA 2PL5A 1HLGA 4W1SA 4Y2SA 4TVKA 3BIWA 3DDUA 4FTWA 3AUKA 2FX5A 4L0CA 2I3ZA 1THTA 1H23A 4CCYB 1VA5A 1XLWA 3C6BA 2JGMA 4AB1A 3ED1A 3V1KA 2NW6A 5AP9A 3ZI7A 5BV7A 2HADA 3JYHA 3PFCA 1OILA 3D3NA 4B7ZA 4Q05A 4RE6A 1N1MA 1X2BA 2C7BA 2WFLA 1SCQA 4AQDA 4WDQA 3QITA 4GLBA 4HXEB 3STTA 1FFDA 3R40A 3G0GA 1GPNA 3D5EA 3OOSA 4A5SA 4BVLA 1XRRA 2QUAA 5AM3A 5I8PA 1BEZA 1HBJA 1VZ3A 1AQLA 4BE9A 4NS4A 3QBJA 1GQRA 4WCVA 3I28A 4HXGA 3MVEA 5EFZA 1HL7A 1B41A 2WIGA 2VEOA 5EIHA 3HACA 1XLUA 4H0CA 2ACKA 2OCGA 1QLWA 4QWMA 2XE4A 2XT0A 5DYYA 2HA7A 3DL7A 1MT3A 2HA3A 5LLSA 1YS1X 5C81A 4QNNA 3IIIA 4OYLA 2C0QA 3C45A 2HL6A 4BCBA 2XUJA 3WKEA 3A6ZA 4J3JA 4B82A 4G9GA 4L3WA 4WFJA 3I2JA 1QJ4A 5LZ8A 3V9AA 3RK4A 3GELA 4LYDA 4DMFA 1SCKA 4UBLA 5FOQA 1FFCA 3AZQA 4N8DA 4QDOA 2HFKA 2Z3ZA 1J2EA 4ETWA 2FJ0A 3HSSA 1XQVA 1YSCA 3M82A 3VJKA 5E4YA 2W6CX 4KYVA 5HF9A 1H2XA 3FNBA 3Q0TA 4DNFA 3I6YA 3I2GA 1M33A 4BYMA 4GHWA 4Q82A 3QPCA 3RKSA 5JZBA 4LXHA 3GROA 4FWBA 1XRQA 3KOOA 3V1MA 5ALLA 4WFIA 2WILA 3K9BA 1BS9A 1MN6A 4QDTA 5HF8A 2XUHA 3HJUA 5AO9A 4Q3KA 1I6WA 1MAHA 2DHEA 4GI1A 3GA7A 4FNGA 1E8MA 3DEAA 1ORVA 3AIMA 3CCBA 4Y2VA 3EBLA 2OG1A 1U4NA 1K63A 5A71A 2J4CA 4G8CA 2WKWA 2PBLA 2WUGA 5ALNA 4FMPA 5AKXA 2XQIA 5ALMA 3ZLUA 4B84A 1R1DA 1ODCA 4FOLA 1YAHA 1F0PA 1XRNA 3NOXA 4Y2RA 4U2GA 1VJ5A 4JUIA 1W52X 3G0IA 1QIKA 3PE6A 4CIBA 1FJ2A 2OGSA 5BWBA 1UKAA 3R3WA 4HAIA 2Z5GA 3WK9A 5JASA 2PKYX 2O2GA 3IBTA 4X94A 1B6GA 3F97A 3VDXA 4H7JA 4LXIA 3W9BA 3WL7A 4EY6A 2JIDA 3BE8A 3QYJA 1JKMA 1LPMA 1GXSA 4MXDA 3WA7A 5AKGA 4CCYA 1L7QA 2XMCA 2GBFA 1NX9A 1L7RA 3OC0A 4HZGA 2RHTA 4C4XA 1ZIYA 4BC1A 1IMJA 4I19A 4OB7A 4W1QA 3C8HA 3WZLA 1W4LA 2CB9A 2EDAA 4ZREA 2VATA 4WFKA 1GQSA 2JF0A 3BXPA 5HF6A 2AJLI 5LYYA 3KD2A 4FFVA 3QMMA 1MAAA 4EY5A 4QDZA 4UHBA 3ESDA 1YB7A 3S2ZA 4JNCA 4CG2A 3FVTA 5AK6A 2XMBA 1CIJA 4UFOA 4KRYA 1ZI9A 5K3EA 1EI9A 1UOQA 3DCNA 1XKTA 1CVLA 1K8QA 1JMKC 4DIUA 3K2IA 4Y2UA 4U2BA 2O7VA 4HVTA 1J06A 2WHPB 3WJ2A 3H2IA 4V2IA 3UUFA 1QIGA 2QT9A 3ZPXA 5JYCA 3ESBA 5A2GA 4X3CA 4C89A 4FLFA 1CUDA 1DT3A 4G4GA 5JAPA 5ALRA 2AJBA 1JU4A 4KRXA 2WUFA 3C43A 2XLCA 3H1AA 4UPDA 1LLFA 5C8ZA 4XVCA 4CG1A 4GXNA 5CMLA 3DYVA 3GFFA 4IO0A 5JZSA 3DOIA 2PM8A 3OURA 3KDAA 4K5QA 1CLEA 2DQZA 1XZKA 3AIKA 2R8BA 4H7EA 1EA5A 4BAZA 1UK6A 2PSHA 1VXRA 4BATA 1AKNA 2ZSIA 3A2MA 4JYMA 3H17A 1QIHA 5ALWA 3W04A 4X6XA 1J1IA 2CUTA 5FXMA 2WSLA 2BCEA 5K3DA 3AILA 1XZIA 3VJMA 2WG2A 4UBNA 3ANSA 4X93A 3G8YA 3H19A 1AX9A 3H2HA 5ALGA 5HQ3B 2ZYHA 4QLAA 4G9EA 2B9VA 1CUIA 2QMQA 4OUKX 1VE7A 3STYA 5D3KA 1W76A 1ETHA 2BAGA 3D2CA 3D4LA 1QFSA 1WHSA 5CRIA 2J3DA 1MO2A 4ZV9A 3SWWA 4NVRA 2BUBA 3QH4A 4B0OA 3FCYA 1XFDA 3CCCA 2XUPA 5CTAA 1H22A 2VJCA 1LPAB 1CUCA 2I03A 3B12A 3G0BA 5AH0A 1X70A 5K3BA 1UFOA 1R3DA 4EY7A 5AI6A 2VJAA 5EHNA 4G5XA 4XWGA 4N5IX 1F8UA 5ALVA 5EI5A 3WKCA 2OLEA 3PF8A 1ZI6A 4FFWA 5AI9A 1D07A 2QOEA 2WHPA 3WZMA 4E11A 3IDAA 2C58A 3U0VA 2ZVDA 3DNMA 2HRRA 6YASA 4DSZA 5HF5A 3F67A 4PNZA 3DKRA 2WHQA 3X3HA 3LCRA 1BCSA 2YH2A 2C0PA 3BL8A 3G9UA 1LPSA 3S8YA 1GT6A 3UMJA 1Y37A 5T4EA 3OG9A 1Q0ZA 1UK7A 3P2MA 2WTNA 1A88A 3ILSA 2WHRA 4FLEA 5IH7A 2WQZA 1TCBA 3VVLA 1KU6A 1K5PA 3FSGD 4G4JA 2J3QA 2PU5A 4BRZA 5EHQA 4QEKA 5DNWA 3GBSA 3O4HA 5ALQA 1E8DA 2EDCA 4EY4A 3WLAA 4EA6A 3SX4A 5AI8A 4X00A 3FOBA 3AINA 4Q3LA 3M83A 4NMWA 2WIJA 4UFPA 4AO7A 2Q0XA 5ALXA 1MX1A 1E89A 3DOHA 4Q34A 4B83A 1CUFA 5AOCA 2H9YA 5DJ5A 2P8SA 5K3FA 2PPLA 4BTLA 1XZHA 4GEGA 3BJMA 5JD4A 2ES4A 3G0DA 2ECFA 2ZJ7A 1JT2A 3QPDA 1HQDA 4H18A 1E66A 3WIBA 5ALFA 5J3JA 3G9ZA 5AKJA 1GZ7A 2WUEA 4C01A 3R3VA 4DSAA 3A2NA 2WM2A 3TJMA 4A16A 1EINA 4MYSA 4OSEA 2QJRA 4HRXA 1BRTA 1DWPA 2ZYRA 5ALHA 4KAFA 3C6XA 3R3YA 1LZLA 1R9NA 3O0DA 4AXBA 7YASA 2JEYA 1BN7A 4DLNA 4LXGA 4DGQA 3HC7A 2VTVA 3B3QA 3PUIA 5AKZA 2G5PA 4PW0A 2C5FA 4W63A 2H7CA 1TCAA 4B9EA 2QUBA 2J4FA 3UUEA 3V48A 2C5GA 2XQJA 4BDTA 2DR0A 3TEJA 4YK7A 4BZWA 3IUJA 2YASA 1A8UA 3C5VA 2WUDA 5LZ4A 3FYUA 5JIBA 1ODSA 4E46A 1VOTA 5A7FA 1YB6A 2VAXA 2JGFA 2XQGA 3BF8A 3I2FA 1XRPA 3RM3A 4PV7A 4UHFA 2AJDA 3WWEA 3BDVA 3STUA 3STWA 4MQMA 4GDMA 2XUQA 3OPMA 3G7NA 4KE7A 5DWDA 5A7GA 2VA9A 4IH9A 4QE3A 1XZGA 1GGVA 4X90A 1LPPA 1OCEA 3W9UA 1W6RA 5AI4A 1IUOA 4IHAA 1XZDA 2RI6A 3KWJA 4ARBA 2BGRA 4BVJA 1YR2A 1CUVA 4HRYA 2V9ZA 1ZD2P 2XQFA 4QWWA 1LBTA 4J7AA 1QOZA 4AX4A 3ICWA 3LIIA 3PI6A 5FPPA 4AN0A 3KWFA 2LIPA 3WK6A 1QZ3A 3T4UA 3U1TA 1CUHA 1Q83A 2G63A 5AIAA 3NUZA
chains in the Genus database with same CATH superfamily
4X97A 1V7QA 1OTHA 1Z6TA 3P45A 3GZJA 3GP5A 2P78A 3IKJA 1IBLB 1G9XA 3PL1A 2W2VA 3JY6A 5L3RA 5DTRA 2FEXA 5EIBD 3RYCA 2C2XA 4J1TC 4AZ0A 4LF7B 1SKQA 3DZFA 4OQXA 4L3OA 2JLRA 4I7EA 5AOBA 3UANA 1MGPA 4IXTA 2PUAA 1SC3A 2H8GA 2GJSA 2VZLA 3LQ2A 5DN9A 4AW9A 4S2UA 1OBOA 1T9GS 1V4NA 3ZH9B 4CTOA 3CTMA 4MQEA 2I71A 1WMFA 5GAJA 4YUZA 3TG2A 1OBFO 2C4TA 3W2FA 1R6BX 4M6WA 3RDPA 2WU1A 2YNMC 2O4CA 3OT1A 4XIJA 3CBQA 4IO1A 1NTOA 1BEEA 3RS7A 3MUOA 3ZWOA 5GIOE 3E9RA 3FI9A 3OVMA 1BC5A 3RWBA 3HB7A 3Q9NA 1W1IA 4XGNA 4F2WA 1GG5A 1EDBA 3H6HA 2HSDA 3UMRA 2ANBA 5LYJB 4HNTA 3R6DA 1ZH0A 4M37A 1O5IA 3NJ4A 3DD1A 2PGIA 2GZRA 1FPQA 2OKGA 2ONCA 4CQJA 4D8WA 2XUFA 2L82A 1AXRA 4H3SA 4RKYA 5DEOA 4EITA 4FYJA 3B6KA 1BA3A 1CDZA 4IGKA 4P3NA 2FQYA 4CMHA 3IBYA 1EDDA 3DVLA 3RWOA 1HYEA 5DT9A 4A0FA 4B43A 3I4CA 3TW8A 1C2TA 1A7AA 2CLDX 2X6QA 1N2CE 1SKYE 3RQIA 1TVMA 1P2FA 3BF7A 1A8IA 3WLKX 1NNLA 2Q5JA 2QV7A 4M7PA 4OHMA 4C0BA 4LZPA 5KVQA 3R5TA 1LNQA 3EMVA 4KAJA 2O8EB 5FRDA 4F2GA 3GEMA 2JLSA 4KVFA 5BXYA 5KYUB 3JSXA 2CBGA 2YJ6A 3EZ2A 2QI9F 4NZYA 4E5KA 4BMNA 1II8B 1JALA 4FHCA 4N3GA 4FYMA 4TQ9A 4G0YA 2Y68A 5TQJA 4DLLA 1OUMA 2UYYA 4UBOA 3KPJA 2TMKA 2GVZC 1BWPA 1E6LA 4F04A 1N1GA 1SBHA 2YL2A 1AZLA 3KJQA 3WYNA 3L6EA 4ISCA 5SV2A 4ZDIA 4OM7A 1Z0SA 3I53A 3NHLA 4DZRA 2BJVA 1KI6A 4DQDA 3TINA 4JEUA 1EGMB 2DSNA 4L4SA 3L4SO 3C97A 3TN7A 2SKCA 1KS2A 2QX8A 2W6MA 3B13B 1XEFA 3BIOA 3HXKA 3GUHA 4FFOA 3GH3A 4KVGA 4O4JF 2HMUA 1Q3TA 2BONA 2VYCA 4XQGA 1OGYA 3DJYA 4PLCA 1F6WA 1EUDB 5DTJA 3B1JA 1FJGB 3AUJB 1R18A 4PZCA 5AR1A 3DLIA 3AEQA 1V8DA 1BHSA 3PSAA 3F7NA 4KQIA 1X7ZB 4X62B 5DIFA 4DR3B 4C7OA 4Z9FA 3QOYA 5LOVF 2V7QD 1O4VA 3ELUA 1OC4A 1ZGBA 2FA9A 3NEJA 2IEZA 3BXOA 4FS3A 2IVFA 4A0RA 4DWVA 2WYIA 4X20A 2ZOSA 1KE1A 3QY0A 4EG8A 3MD9A 4RZXA 3RTAA 3EGOA 2V6IA 1GTJ1 4YFYA 4GMFA 2ZS8A 3DEYX 4PQGA 4QHSA 3EOZA 1ZCJA 4ZEXA 1JAHA 1KO5A 3OFKA 3OZXA 3H1FA 5ALJA 4DMLA 1L4KA 4OLJA 1OLXA 2OD9A 2QD1A 1DELA 5U4QA 1BROA 4M6WB 1RQPA 2R97A 3LPDA 4WBXC 2Z09A 4BNHA 4EG7A 3GJSA 3KKNA 5F98A 3ET4A 2DY1A 4RK6A 1ZM3A 4HDMA 3SFZA 2RHDA 5J4HA 4FGJA 2LWIA 2H1SA 1LFDB 2D59A 4P1ZA 1ECFA 1WW3A 1R7RA 1KZ6A 2QPAA 3HB5X 1SZPA 4M1EA 1X8KA 4XX1A 5EIAA 4WZBB 3THRA 3C8ZA 5B1SA 3WL5A 4KXFB 2AOXA 3BWMA 2O14A 3BBLA 2JGEA 1ZAKA 4DLUA 1HTWA 4Y6GB 3Q9SA 1WCYA 4KFRA 1PYGA 2FZKA 2NZ8A 2RONA 3IAS1 3R6WA 5H3HA 4V3BA 1N1DA 3HCPA 4GMHA 5B2ZA 4FYWA 1R4AA 5LP1A 3U13A 4JNKA 4PYIA 5FOVA 2R9VA 5A5GA 1YJAA 3MFQA 3CVYA 4ZHQA 4MVYA 2HZBA 3B7GA 5J63A 4EF6A 1Z56C 2QORA 2WNIA 2WLSA 2BFEB 4QFDA 5J2TA 1WXIA 1T29A 1KYVA 1DKRA 2PLAA 2Z57A 4J4BA 4AU1A 1H8HD 3HI6A 4HFMA 4QOSA 5TQ2B 1A1VA 2JIOA 3IP6A 1BJTA 1M5TA 3PUVA 2C2KA 1QMPA 3S2IA 1V5WA 3H2JA 4IJUA 5IVHA 4Q1FA 3TLZA 4OAOA 3W34A 2O8FB 1TUBA 4M49A 4ETNA 2C5AA 2WWTA 4PRLA 3SS7X 4EIWA 3RAEC 1VKNA 1VJRA 5HFNA 3RASA 1G38A 4F4UA 2R44A 3BHIA 1W5SA 4A2PA 2O07A 2W58A 2BMDA 2O20A 4TLCA 3W4IA 1FQOA 4RD1A 4GPEA 1SVWA 3SBEA 5FF9A 1I3OA 3HJHA 4L0DA 3K6RA 4O4HA 5BRJA 2F55A 3UG7A 3U9SA 2ZZMA 1D4FA 4U1RA 5EL0A 4DCJA 3E58A 2YYSA 2FMHA 4MW2A 4QATA 5TQ0A 3RVRA 4X8MA 3CURA 3RSSA 1B8VA 2P91A 2A84A 2QSJA 3LVFO 1V5IA 1PQ4A 2Q3CA 1LQTA 3BILA 3HZZA 3KZ1E 2LP4Y 2DBQA 2FRDA 3IDQA 3BL5A 3OIUA 4QUHA 4RKEA 2H4ZA 3LAWA 3KJIA 1G17A 4R9UC 4WCFC 3CUSA 1B76A 2BEWB 3QKTA 1E61A 2XNKA 4M22A 4QQRA 1FX0A 4B4WA 4F7WA 4TYQA 2NZWA 1P1RA 5L3ZA 1EFKA 4QUIA 5JDIC 4QYSA 4OI1A 4JAVC 2F1KA 4MV0A 2W4QA 4M1MA 5GOTA 3BYZA 3EVAA 1ZNZA 1NM5C 2IZOA 2JGDB 1LXCA 3A9RA 4K9PA 4MZXA 2VTEA 3CEAA 1DDGA 4U9IS 4E7OA 2ZAGA 1M5RA 3ICQB 1XP5A 4I9GA 1HXHA 1A4IA 5GQSA 3D3JA 1T2AA 3Q2KA 2YY6A 1Y1LA 4CL8A 1UQUA 3FE2A 3VHXA 3OCUA 2KLBA 3O4JA 2D13A 4QEDA 2MDTA 1UPAA 4TV8F 4X91A 3UHJA 1N8SA 3UJAA 3BSSA 1VSBA 1QHEA 4A8HA 3SS8A 1TAGA 1B8PA 1UJBA 1YBAA 4ZDJA 3CN7A 4HY3A 4IIFA 4MUNA 2QRNA 2VDLB 3ITKA 1ZN7A 1BCRA 1BGVA 1IXZA 1O8BA 1UM9A 4UQOA 1K8ZB 3N0WA 4FPXA 1P1FA 4KTVE 4RETA 5KOYA 2B7CA 1PRYA 1FSPA 4FQ5A 2XMDA 3KKLA 4M0FA 4ZT6A 4DA4A 2WAMA 5J4YA 3LC0A 4KVAA 2GJ4A 2OV3A 4G24A 3NTVA 5BVHB 5DRYA 1XJCA 3BD8A 2AJ8A 3JWEA 5AOAA 3JR7A 5A0TA 2XKBA 2LRHA 4ALNA 2Y76A 1RI2A 1MG5A 3D59A 3CXRA 4Z1OA 2G04A 5LXTB 1T0BA 1NMZA 4AIRA 1QFXA 2K2QB 1JHAA 3IUMA 1YF3A 1Z74A 1RACA 1NP7A 3K9WA 5AW7A 2GEBA 4G1FA 1MO6A 3I2KA 3WV4A 2XYQA 4R9NA 1MO4A 2VHUA 2OB2A 3ETEA 4HEA1 5M5BA 4CIVA 5EJ9A 1PL6A 2IDZA 4L72A 1JDBC 1GN9A 2JBAB 4NZNA 5HDBB 2WB2A 3SX2A 4LRYA 5EJFA 4XIGS 4CWAA 2QXYA 1N4DA 1TUBB 4PFQA 2QLFA 5AM0A 4Q12A 4ZOBA 4TROA 5CVDA 1H2WA 4BVBA 3IQXA 4TV9A 3HNRA 3ZHZA 3O91A 4YRPA 2C4HA 4PG8A 2WJPA 3OQVA 4LYGA 2C83A 4OY3A 3BE5A 4QNMA 1GUFA 2AG5A 1HUQA 2NNLD 1YMVA 2Q6TA 3JQ7B 2EEPA 1R4ZA 3CRQA 2DWCA 2GPJA 1E7YA 1S3FA 1F4PA 3C70A 3LCJA 3Q3EA 2VJBA 3USES 4AN1A 1N5IA 4C1NA 4PVDA 5EKUA 3AR8A 4PM4A 4EJSC 5A1JA 3QUQA 4DLKA 2YFYA 1VPWA 3WE7A 1G5IA 2ODEA 1URPA 5M3BA 5CAEA 1NVAA 1SURA 2JCYA 2BEKA 2Q28A 5I9IA 1FFBA 2YWBA 4AJLA 4KR6A 4HWGA 4RD0A 5L45A 4RULA 3M9WA 1C4WA 4O2BB 3C6MA 2PVSA 1KEWA 1AGPA 1RXSA 2R60A 1YQEA 4XWKA 4EL5A 5FEUA 3R9WA 1YOVA 2AJCA 1NUUA 3WJ1A 4DQLA 1IZZA 5HFJA 4KYIB 1X1RA 2BFCA 2YZNA 1CRQA 1P6XA 3BK2A 5P8WA 1UUFA 4F5WA 2B1QA 2CVQA 2ZJFA 4LKOA 2JCXA 3U1VA 4E30A 3QE9Y 3F98A 5B4VA 2D2FA 3JR3A 5DBOA 3CEHA 3OA2A 3P9ZA 1JU3A 1S6YA 2ZRFA 3IIEA 5HIIA 3TLEA 4F91B 4ARZA 1TB4A 2DSTA 5IM5A 1AQJA 1I2AA 4CM9A 4O1HA 4AURA 2P67A 5F3WB 2FDRA 4KXUA 1ZI8A 4JI5B 2GFIA 3D8TA 3UTDA 4EA8A 5ELMA 1VBMA 3HJAA 2OP0A 1YO6A 2WWVD 2ASVA 3ULKA 2AXPA 1EUDA 4EJSA 2B1JA 1LWNA 3ETLA 4LDQA 5K0JA 3DR5A 3PFKA 1BN6A 4YRZA 3COZA 5LIRA 4J0IA 4P54A 2XE6A 4XYEA 3GGOA 3NASA 3PL5A 1AHPA 4G8DA 4CPDA 1MA3A 3FZNA 4TSKA 4TZ6A 3OQMA 2F43A 3RJ5A 3O21A 4EVSA 2O59A 4HDQB 4NBSA 1X1EA 4UPVA 3VBCA 2JJ2A 1VHWA 2ZQYA 4LEIA 3A3YA 5JALA 2CV1A 2QN9A 4RW0A 1QK5A 2XUZA 3CNOA 3F4LA 3FF4A 2J45A 2AN3A 4IXNA 3B85A 1ICIA 1VG1A 3RJ9A 3OAAD 3AOEC 1FUEA 2VRNA 4RHXA 2HWWA 3DXXA 1J24A 1DV1A 1RKBA 2QX4A 3QU9A 4OX9Y 4HNHA 3CZMA 2GZSA 2PUJA 4D3FA 4ROSA 4L8FA 3PTAA 5ITWA 3R7BA 2BZ1A 2JFPA 2ZTUA 4HK4A 3FDZB 2QR2A 2W43A 3OQIA 1B00A 1ORIA 3VMMA 4YQFA 4OHZA 2RSLA 1UZNA 1S7GA 2HWUA 3A4LA 3MMXA 3RRBA 4NNJA 1KWGA 3LS2A 1FB5A 2GZ3A 5FLKA 1J23A 1JWBB 3X0DA 4PSDA 3O84A 4JB2A 3KDSE 4IQ4A 2CFSA 3PPWA 4G1UC 5EHZA 1V9LA 1SQ5A 2FOXA 1EGHA 3F78A 3S7TA 2VZEA 3TPZA 2C29D 4FI3F 1FYEA 2B1RA 2WFMA 1ULHA 2YOHA 1UT6A 2VNAA 3OPXA 3RSOA 2FTKE 1PDVA 4CDMA 4F2DA 2P9CA 2IS4A 4B6RA 1GPH1 1P0CA 5JD4A 1V11A 3HU1A 3NOOA 4QBHA 3H04A 1OAKA 2PMKA 3LO5A 1G6KA 3K8ZA 4E21A 3EQ2A 3UQZA 1Z47A 1XZQA 3QE3A 1UJ2A 3RVDA 2P5YA 3L4BA 2H1FA 1ZRMA 3SJAA 2ZVPX 2HSEA 1ZEJA 3RSQA 4JVMA 3TSOA 4D9IA 1D7OA 4ER3A 4JYAB 4IJKA 2FUNB 2AKYA 4AYXA 4JUAA 1IEVA 2QMHA 4O4IA 3ADKA 4CR6A 5E4FA 1QJCA 2GHQA 2QROA 2V0NA 2GCOA 4LWQA 4RPKA 2YV5A 4MRVA 2MINA 3T7DA 3IDOA 1YRYE 1XZBA 5AKHA 1KU0A 1DRJA 4MW4A 1NJ6A 2CMFA 1DJOA 3B60A 4WK2B 3EXHA 3M6FA 4M87A 4A27A 5BMOA 2KYRA 4JU8A 3PC8A 5DX8A 5A6VA 5K3SA 1KZ1A 4UDXX 1FP4B 3VC7A 4WJLA 2H59A 2VWPA 3RRJA 3FPBA 2OQRA 2ALJA 4MPDA 1SO8A 4CLXA 2GZ1A 1FXUA 4BX9A 2FG6C 4LMPA 1QO7A 5F78A 4HGNA 5JI2E 4LBVA 4LF5B 3EY4A 3OPYA 4DNOA 1EM8B 5F35A 1D4ZA 2BELA 3FF1A 3PQCA 3QEAZ 1KMHA 3KNZA 3GDHA 3IQIX 2PKRA 3WBFA 2G36A 1DV2A 3UJHA 4D4MA 2VBCA 3FFBA 3HM9A 2Z8ZA 5B4TA 3N0RA 3ORQA 1R0RE 1T2NA 4KQ1A 4X9XA 1LI7A 1NIPA 1V4BA 2PSDA 4JQZA 1P1BA 4JSYA 3JU3A 4R1LA 1QYWA 3EIHA 4LY0A 5DMXA 1WKVA 3RUFA 4MKIA 1NBIA 4ZDWA 3EEOA 1UZMA 1UBUS 3QUSA 1YQGA 5EOVA 5IJ9A 1N5JA 1NXQA 4YWJA 4KQ9A 1NSTA 1YBFA 3B3AA 3EEFA 4N7MA 1V37A 2CB0A 3EUEA 3NWPA 3BXGA 5CA0A 4TYNA 1A76A 4CM4A 2KB0A 3HKCA 2R68A 3QFTA 3T41A 4WLUA 3ZLTA 3ZW9A 2GJKA 3O7MA 4D96A 5M34A 2VAMA 5T5QA 4V1CB 1O5TA 2FPKA 3NC0C 3C98A 4C78A 3MXOA 4OGLA 2QD3A 3I45A 2ZSKA 1MEEA 2YJTD 1MJGM 5ENVA 2JGJA 1Y80A 1YDHA 2G28A 3RLIA 3TXYA 2EFDB 1YJXA 2V6MA 2A3NA 1Z6QA 3BH0A 1AKWA 3ECCA 4IX9A 1DBRA 3AR7A 3MSCA 3CZ9A 3KV1A 4C0LA 1R4NA 2IQIA 1U9IC 5IJ0B 4Z53A 2W83A 2FWNA 3OEED 1AV7A 1G42A 3G02A 1YRLA 4IEEA 4JD5A 2I3DA 2QZPA 4N3BA 1ZA2A 1KO7A 1WHTA 2JHAA 3HBLA 2HFJA 4RJKA 5CH8A 4EB6A 2FHPA 2IXBA 4FKBA 4Y2PA 5HK8A 3P26A 4OM8A 3R7NA 1TRHA 1XAHA 2FKAA 3I12A 1NVBA 5KHAA 1USKA 4GX2A 4H15A 2EQ5A 3OCZA 1IONA 3IHWA 1M2OA 4AM8A 4ZEMA 2JLUA 3BMNA 1V8ZA 2RI1A 1WQ1R 2CHVA 3B82A 2HZ7A 3CJTA 2V5UA 4YCNA 4POOA 5KVCA 3QEJA 2OFXA 3BGOS 3E7XA 2NM0A 3EC7A 3IOEA 4JBNA 1Z62A 2GILA 2HA2A 2MOKA 3R6LA 3GRCA 4UHDA 2XA2A 3KG2A 1PWZA 4MVJD 5K3OA 1RIFA 5FR2A 3L9XA 4I4IA 4I3FA 1G98A 1C41A 1ZK4A 1KQPA 4H1VA 2QW0X 2XF2A 4RA9B 4RMGA 3HVHA 2NADA 5AT1A 5IZCA 1YFLA 4EBFA 1VLHA 3IVAA 1E1DA 1EFPB 1Q1AA 5EZQA 3N8KA 1PZMA 1NNEA 1V41E 5JMTA 3VX4A 3H11B 2G1AA 4H7HA 3CXUA 1ELOA 1EVLA 4KMMA 3B89A 1KP9A 4DXHA 4LHYA 3E22B 1CUYA 3NT5A 3VXKA 4I8IA 1LTQA 3CJRA 4ESOA 2FNAA 2NXJA 1TIPA 3U4AA 3BFVA 4RIIA 4N41A 2MR6A 1QZUA 1T1RA 4B2PA 1E1QA 1RAIA 5GJBA 2RHHA 3NDBB 4L4YA 5SZIA 4KB5A 2G6BA 3UB2A 1PFQA 4F8EA 2JI9A 4V1CI 4YIHA 1WLYA 5T7BA 4U7DA 4UNRA 3P94A 4A2WA 4BZZA 3BSYA 2QL5A 3GA5A 1A5AB 3RYFB 1P5FA 4NWIA 1C29B 2XI4A 3K8YA 4X6YA 2UXBB 4QJIA 5D3ZA 3D6UA 4DA8A 4BWYA 4E09A 2B2NA 1TJNA 1SRRA 4B3DA 3HR4A 5I8WA 2FN4A 2AIRA 1HG1A 4ZOEA 1GNLA 2HK8A 4BXOB 1DC8A 5KKCA 2NVBA 3OA0A 1ZJ4A 2D2IA 3BIXA 3FBGA 1D6JA 4PS1A 1MBZA 1IMOA 1UF9A 3NVAA 3MK31 3U3KA 1ZK2A 5CXXA 4P5DA 1JHXA 3FHLA 1PE0A 5E7IA 4I08A 2JHPA 3VGJA 4CMEC 3JYNA 2RGNC 4WNAB 3VU1A 3IOCA 1NMYA 4G3XA 3VZQA 2PL1A 3TZBA 1ODTC 1UFVA 1E58A 2FGJA 1G60A 1JPVA 3E5MA 3FW1A 3K9CA 2Y2VA 3A9UA 1COWA 2REQA 3UK2A 4N5MA 2GN8A 3WQSB 4TGLA 3V3KA 2BP7B 4FYIA 5H0IA 3EB9A 1GN8A 4DW8A 4HD8A 5LQCA 3EULA 1P6QA 1BE0A 3AIOA 4HNSA 3RABA 2WP8J 3SBXA 4DQKA 3NBUA 2GQ0A 1JR3D 5K2MA 1KZ4A 1AD2A 4BO5A 1E4OA 3OFND 4PX2A 5SZHB 3QJ5A 4QG3A 4FXPA 2PTGA 1XR3A 2QVYX 1VC2A 3HABA 4NBTA 2V7QA 4FONA 3SZ3A 4H1WA 3O83A 4M36A 3CF2A 3G5MA 4IFEA 4NZPA 1FYVA 1DU4A 3TL3A 3L06A 4J1TA 4LX0A 5J4LA 5IT0A 1KMCA 4KQ2A 5KU7A 2YDXA 2FEAA 1X0XA 5E0OA 4ENWA 1DKPA 2WJYA 4QPCA 1SC9A 1GGEA 1ZY2A 4JROA 2O23A 3GT7A 2ZUTA 9LDTA 1KOJA 3NAGA 2GDJA 1THGA 5DT2A 3AVWA 1NYRA 1JE1A 5T41A 1ACJA 5IF3A 4GZ3A 5KQGA 1QXSA 2FMUA 3GI1A 3QVUA 3EPRA 3GCZA 1LLCA 3PR3A 4FXOA 3TRHA 4F1KA 3HLTA 4MS1B 4G07A 4XYGA 2YWDA 3MQ2A 2QHXA 2NPIA 5AK3A 3H4IA 2JFNA 3JQCA 3IOYA 2O0LA 4DRXA 2OK8A 3EYWA 1NNUA 1PD1A 3GCXA 2JFQA 1P7ZA 2WHYA 3DFIA 1NI4B 1G3MA 1WVGA 3GFVA 4QU9A 5BYKA 5JS1A 5BV2P 5BMVF 1OIVA 3B3FA 3E18A 3QTBA 4DQVA 4RV4A 1K8YB 1ZNYA 1U0HC 4LOIA 4MQBA 3FYCA 4MVJF 1G16A 1DQSA 3WL4A 7ABPA 5HZGA 2N1MA 3MW8A 3ZWYA 4YMVA 5IM4A 4IHQA 2CD7A 1TMKA 3O3NB 3SYNA 4EJ0A 5BR7A 2YX1A 1QE5A 1SVSA 3T9FA 2O8DA 3T4EA 4QSMA 4X92A 3QWAA 2EFCB 3NHMA 1CQJA 1I1HA 1JG1A 2X9GA 3C1UA 4TRMA 3DOFA 2UZ1B 1N3LA 4B6EA 1SVUA 1N6PA 1KYZA 2QKYA 4R1OA 3WKDA 5AIBA 2ZRGA 5HOQA 5JH7B 2VZ8A 3PR1A 1PFUA 4TUYF 3VUFA 1QIIA 4XRRA 4RQBA 3RRZA 4BQEA 1U0GA 3UAXA 1C81A 1QYVA 2VF5X 1TPYA 3HYRA 3CS3A 2H2IA 3FNQA 4JOQA 4DTIA 3QUCA 2RH9B 3RROA 3WRXC 2WHXA 5LD2B 5FI0B 4GMKA 4JZKA 4EFKA 1R8QA 3UJ3X 1II0A 1XEWX 3GLSA 3M4YA 2VXOA 1DWOA 3H6KA 1KI6B 3HP4A 3KJEA 2FZ4A 4UBKA 4WUVA 5E2AA 3DWEX 1E3MA 3EMDA 1D4AA 3OZFA 4PAMA 3CB2A 5EQTA 1QNFA 1YJCA 5EE3A 4CFSA 5BO5A 3DBRB 1XD2B 1RQ7A 2CJPA 2O3UA 3EFBA 1YRWA 3LK6A 3OTGA 4MWTA 2JGLA 3BA6A 1SA0A 1ADFA 4L95C 5EJ4A 1E2UA 5U1PA 1LVGA 2OV4A 3WI7A 2FR1A 6REQB 1BH6A 1ONSA 3LC7O 4ZVRA 4C2BA 3U48A 1ZNWA 3MCWA 1DS6A 5REQB 2W11A 4WIAA 4BO6A 2ZXEA 4UAJA 1E2HA 5JLJA 1J0CA 1Z0UA 4MKZA 4TMKA 4CDGA 5I7UA 2GEUA 3FVRA 3TZEA 1VI6A 1IOLA 5KYWA 3TIVA 1W0KD 5JTUA 1ZCAA 5BQ5A 3X2SA 2PT7A 5JCJD 1R5JA 1LDEA 2BI8A 1JMVA 2ZYSA 3A28A 3B2EA 2C3YA 2EFEB 3D1VA 4U0KA 4WCFA 1ZJ6A 5K5EA 4YCBA 2I1QA 1FSSA 2IHNA 1QGAA 2OGTA 2V96A 5I47A 3GLFA 1KF0A 1Y9JA 4MRAA 5KBYA 1P4JA 2HF2A 3C8DA 7GPBA 2K6GA 1ID1A 3QX7A 3F96A 1BQEA 3RVKA 3LPNA 2R6CA 2WWWA 2DERA 3JARA 4FT2A 4LMRA 5DSTA 2WM3A 2AGVA 5BYJA 2CKMA 3C14C 3S40A 4IIJB 2Q5QA 3HCEA 2V7TA 4MLPA 1IATA 4E4RA 3LUDA 4ZO6A 2TYSB 1YBMA 1AS0A 3H1TA 3PUXA 4CM4B 1L7BA 4PO9A 7AT1A 2NYAA 2W37A 3I5UA 4DLPA 4LOKA 3L6CA 2ZRCA 2ILTA 3L7JA 5DYTA 1CFJA 3TTUA 4CTJA 2V7WA 3LGAA 3W2EA 4B6PA 2UUAB 1A96A 1PR2A 3AFIA 4QGHA 4U2CA 3MMPA 3IR7A 4X7MA 2QGFA 3ZX4A 1L2TA 1KZ9A 4PLZA 5HCIA 1DVRA 1HQCA 4EQ6B 1QK4A 3ROMA 1FS4A 4AJ4A 1FFXA 3UJCA 2EIXA 1M72A 5LCXA 2Z9CA 3VR3D 1G7RA 3PF9A 2O1WA 1ZIXA 3IVCA 4DJ5X 1T0JB 3L6RA 4OX9B 4BLOA 5EQFA 3EGXA 3FHOA 4QULA 4UMVA 1CUJA 2BGTA 1CQIB 3F74A 4QU0A 1NURA 1Z2CA 2XAAA 4K05A 4L9AA 1U11A 1YIOA 1TMYA 1FU7A 5B2EA 2VLIA 4QFMA 3KQHA 3K0KA 2XXJA 2R1UA 3KFLA 1L7NA 3C24A 2WIAA 1HO3A 3H9UA 2WTBA 2H07A 4INAA 2CXRA 4MW9A 4Q4AB 8GPBA 4AQYB 5EWJA 5D7NA 3T3OA 1IH8A 3CLKA 2AQIA 2EU8A 3QEOA 3N2EA 1C7IA 2QZSA 3HDQA 4DA9A 5D3MB 4ZIRB 1DXQA 1U7XA 2VPXA 3G89A 4GRDA 5HKKD 1P4AA 4D4JA 4DCGA 3VR5A 3PQFA 3G8BA 2G0NA 4UJ5A 721PA 4HNUA 2AD5A 1DWQA 2JFHA 4F11A 4FSDA 4PGAA 1JVNA 4MQLA 1N1EA 3AF3A 3VPAA 3H97A 2E7ZA 2Q6OA 1JEQA 1AB6A 2G07A 1Y1SA 3KTFA 1QPGA 2VSQA 3D5QA 4BWVA 4EEZA 5JXHA 3NP7A 4EM6A 1QQAA 2R8XA 2VBGA 4R9SA 2O8DB 2A7QA 3QPAA 4RAOA 5ICEA 5EIEA 3KR9A 3V1LA 4G5FA 3P9XA 4GOJA 2V1XA 5DGIA 1CP2A 2HHLA 4P7FA 5FORA 1JPUA 3L1HA 4OBXA 2NUPA 2YWGA 1UAYA 3L0IB 4LHZA 4CEHB 2GPNA 1TAHA 1X14A 4G97A 3MGAA 4R71A 4BV2A 2WKQA 2HBYA 1HDXA 2HKIA 2XDYA 3KSDO 2FPPA 3OP4A 1E62A 3H13A 3X2EA 3ZLJA 3A3KA 2I6SA 4ABTA 2A33A 2M6SA 2MYUA 4ML3A 1UWKA 1CQWA 1VSQA 3QFFA 3JQPA 5FOWA 2BE7A 4ZVVA 1E77A 2VAWA 3R0VA 5FBZA 5TGTA 1DRUA 3COWA 2VJPA 4MUEA 3DDWA 1Q5PA 1CUWA 1KDOA 2XE7A 4KQKA 3GFTA 1C3XA 4DEXA 1M67A 1WXEA 1DWUA 1V96A 3MTIA 4HDRB 3JARB 4D0RA 2GPBA 2PXHA 2ZI5A 2VBFA 1E0KA 1Y89A 2JGNA 2PUTA 1WTAA 1FIUA 1CEYA 1SD2A 5CM2Z 3X2FA 1JG4A 5E7JA 3IR6A 3DOCA 3OM9A 4JLPA 4FQ7A 5H16A 5CNIA 1RT9A 2B98A 2FFJA 3OZTA 3UMVA 3C16C 4K6KA 1SFRA 1W8IA 1U2PA 5G0UA 5LMNB 4HAOA 2C2YA 1QHHA 3DE3X 3PHCA 4NCIA 1NW3A 1JQBA 2FPWA 3WYFA 3K73O 1G291 3OOWA 1CQPA 2NG1A 4KV7A 4DR5B 5FP0A 5BOSA 1Y8RA 1REQA 3VDMA 1PV4A 5JWHA 4IGIA 1C8VB 1X74A 2XBUA 2YIMA 3LHFA 1UFKA 4F46A 3VYWA 2OCKA 4TMVA 3VISA 1JHDA 4QHYA 1PJRA 2H7YA 3W6OA 1Y8QB 4QPDA 1E1YA 3IQFA 1YI1A 1KO4A 3U62A 4UEQA 4RTKA 1F8YA 1TL7C 3LJKA 3KYCA 4NF2A 3D3EA 1YS9A 3VR6A 1DUVG 5DOZA 4DWWA 1K6IA 4IF6A 4Z7QB 2HXSA 1YRAA 1LDBA 5FWYA 2O3RA 1OWPA 3N3AC 4HWTA 3EXEA 5AKLA 5FA8A 3K6KA 4LSMA 4GD3Q 1X1BA 5EZ6B 2WAYA 1LS6A 5CIQA 5EWMB 4C7MA 3HDYA 1DG9A 3L41A 3NJRA 5HKAA 4B3TB 1GPYA 1YQUA 3RS0A 3TSAA 3V1NA 3WK7A 1P81A 1RHQA 2GRJA 3B1XA 1TVEA 3VPCA 2QBYA 3H0KA 1AUVA 3EIEA 2POQX 2ZYIA 4G37A 4GOXA 1LZKA 4FWIB 4JBHA 2J1LA 2RGBA 1DIHA 3CF0A 4B3JA 4I1PA 3OHSX 3DOEA 1XFAA 2QMYA 3SIXA 4PG4A 2OL4A 1OOEA 2Q3HA 1OZ0A 3SJZA 3DE6X 4XKJA 2TMGA 1MNQA 3EQZA 1YBHA 2HI0A 1VMEA 3PICA 2J8ZA 1UINA 3MN1A 4RH1A 1CIVA 1UXJA 4LDNA 4ZO7A 2ZZKA 3FZGA 5IKPA 2J9YB 1N7HA 3QJGA 1RWXA 3FPJA 3UGTA 4CRWB 3BXEA 1XCJA 4QECA 2VL7A 4UHCA 3O4GA 1UKYA 3MAJA 1BCRB 2P2DA 1DEHA 3C1TA 5DM70 1FE8A 2W6QA 2AB0A 1XEWY 1JKIA 3G9XA 1Z4JA 1VA4A 3GL9A 4Z49A 1TFRA 3EUWA 5CEEA 2O2IA 3AM5A 3LRTA 5CPBA 5GONB 3CZCA 3W3AH 4EI8A 1I3MA 1Z68A 2R47A 3GMSA 1F7VA 2C77A 1KDYA 2JBWA 1XGKA 1DLJA 2C1EA 4FZVA 3RRNA 1GAQA 3ZXIA 1JXAA 4E1AA 4Z4CA 1TYDE 3MUNA 4F7DA 5C0OE 1L3CA 4C43A 4CEJA 1EVQA 4POAA 3KR2A 3JQFC 4RFVA 2QTBA 1JVBA 4D0NA 2OMKA 1U65A 1Y3FE 2FE1A 1RBZA 3IQGX 3ELDA 1AVTA 5FTKA 2CJWB 1DBPA 4G5SA 2C98A 4S04A 3F6SA 4YAEA 2Q6IA 1ZVMA 4I14A 2D2EA 3FKJA 3G2MA 4IDHA 5KJ1A 2FKNA 2VHWA 3BPSA 2CL7X 2WF6A 1NU6A 1M2EA 1P3JA 3MS4A 3GN2A 1EFCA 1C30B 2RH5A 2XEDA 1N0VC 4RNDB 1XNQB 2YFKA 3ZE7A 2Y1FA 1DAHA 3HZOA 3JAKB 3NLLA 4MQUA 2B5VA 1PQWA 1T9CA 3L0ZA 3NWOA 1EJBA 1OKKD 1UDAA 4JXJA 4US1R 3DR3A 3T52A 1B6SA 1J07A 1NFQA 3I1IA 3IA2A 4YP1A 4B48A 1U0LA 2Q49A 2YOFA 4EUFA 1OWNA 4MA4A 3ZCQA 3OKAA 1ITZA 1DKMA 1ULSA 1YDFA 1K88A 3HU5A 3LYLA 4GVLA 5ED4A 4MUJA 5BW6B 4DQUA 2KSQA 4J75A 2ZW9A 4Z7JA 2WF9A 4I50A 1OXKB 5ALIA 4Z0TA 1SUFA 4GZMA 4OI2A 1FXWA 4RSMA 1UBGA 1XELA 2H1VA 4XPIA 1BDJA 4EZIA 1CY6A 1ZQ9A 3KZCA 1U3UA 2KPOA 1GWNA 5I7FA 4JZYA 3I8OA 1D2GA 2FN7A 5CW1A 1JJFA 1LRKA 4TRNA 1LGYA 1N2GA 5E4JA 4O8ZA 5GPBA 1IVYA 3K9HA 2VQEB 1T6XA 3N53A 5CT8A 1T91A 3KLBA 1C4XA 1A8PA 3RVSA 4KGVA 2OBLA 3VR3A 2D0OB 4D0GA 2JCGA 3IT3A 3TW6A 4EMBA 4J16C 4N5NA 2SKDA 4QQKA 5K8UA 3HB0A 5BV8A 1QZZA 1LW6E 1K4MA 5KSWB 1CR4A 1EK5A 4PWZA 2J5BA 2Z08A 1UJ5A 2BFBA 3GRKA 2PIDA 5KNLA 2ORYA 1NE7A 1XC7A 2QRMA 2QPOA 3BHMA 4KXMA 2IF2A 4MGKR 2IYAA 4K46A 1P2UA 2AFIB 3IKMB 3P9SA 4N0MA 4BC0A 4UUOA 4WK6A 2ZULA 1F2UA 2BMJA 3GQVA 4P31A 2HBRA 2RIPA 1L5KA 1XZAA 3NTQA 5EJAA 4IR7A 3WOVA 4ZI2A 2IWRA 5AVXA 3DZ8A 1IK6A 3TX2A 2V7UA 3V97A 2N42A 4MRRA 3E7DA 4NMHA 5KVSA 5LD2C 2V1UA 1N32B 4HAYA 3MM4A 3T06B 3LUFA 1F5SA 3N2ZB 2ZZNA 4PLYA 4GGPA 4EAQA 5B53A 1T0HB 2QG4A 4F1JA 1GYRA 2NQTA 3WOHA 4B6GA 2JG3A 2VDOB 3PPIA 2IF0A 1TKCA 4WLEA 1ZO8A 1U2DC 2IHVA 1VTKA 1F3OA 3L8DA 2TECE 1Z07A 3UXYA 3IP3A 4XE5A 4H2DA 4X8LA 5THXA 4LY6A 3CJQA 3WLRA 4A3SA 3PLNA 4BV8A 4FX2A 3D6MA 3P5BA 3DQQA 1K8RA 1ZS9A 3KTAB 2H0AA 5FJJA 2QD4A 2C57A 2OZPA 3CSSA 4XX0A 3QG1A 4I5GA 3SY8A 3W06A 3AIIA 4UNSA 4M38A 4D0LB 3EH1A 3HB9A 1WV1A 2OGWA 1PT6A 4UOZA 3GEPA 4L0QA 1VJ1A 1KIFA 2FXVA 3QMVA 4C20A 3CLRC 3OO0A 4X66B 3ASZA 4IFTA 3LCCA 1TVCA 4LFBB 3DBOB 2VZ9A 1CC1S 1OZHA 3RFTA 1FFSA 4YNBA 5C7IO 1P62B 1NX6A 1QCDA 1QGDA 3CNQS 3CY6A 2ISSD 1MH9A 2GEDA 3KEMA 3MLAA 4HQOA 4O08A 2P3OA 1FRZA 1JHPA 4M1KA 4K2AA 3T7SA 2QW1A 2BUAA 3TR6A 4EW3A 5C52B 1E8NA 1NIJA 4TS1A 3ZU4A 5IXYA 4YHHB 3ILHA 1JFFA 2ZJ5A 2FPPB 3L93A 1HEIA 2HF8A 1EHIA 1QLHA 4UCQA 4D1YA 2B21A 4CV1A 5BWMA 1H4TA 2D2XA 4BV9A 3SKXA 3O95A 3V4LA 5JD5A 1L5YA 1S9DA 4E5VA 1CE8B 1I5EA 1XCLA 3G68A 1KMIY 3S5JA 2P9ZA 1NJGA 5DI3B 2YVKA 1TCVA 1NRXA 4TWAA 4TV8B 3ONWA 3QA9A 1SU7A 4G26A 1LJLA 1RMQA 1EFTA 2AZTA 2YWEA 5JEEA 1YKFA 1N2EA 1GSHA 4HX9A 3HUDA 5DXJA 3QQ5A 3F0TA 2FMFA 4RX1A 1J8MF 3HM2A 1NJ8A 1WEKA 4ZQEA 5TV2A 3MYYA 3OZIA 4D6XA 3BHNA 2XUAA 5B58C 1WS6A 2G06A 5HJ7A 1RBYA 2OCDA 2PL5A 3G2OA 3AO0B 4MNTA 1BFDA 4L8LA 4O5OA 3WAGA 1VPTA 1D2AA 1PTKA 3DTVB 4L75A 2GN6A 5DM2A 1Z6PA 2FW0A 2AR0A 1ENYA 2FSSA 2RKOA 4KMRA 4TVKA 4QOGA 1G2QA 2SHKA 3DDUA 4AJ1A 3BC1A 2CVFA 2GF9A 2UZ1A 3DH0A 1UCFA 3PD1A 4MWEA 2YHAA 4P4GA 1YZHA 4FTWA 1LLQA 1WSAA 2L42A 3TLXA 2QX6A 4C0XA 2DQ4A 2PKEA 3BTOA 5KC9A 1OIWA 3KT8A 3RAFC 5FLXA 2DHRA 1BXRA 3UK0A 5IDXA 1ONBA 3R8FA 1B43A 3M34A 4G85A 1J1ZA 2BKVA 3DMGA 4QT0A 1H1LB 2I3ZA 1M8JA 1H23A 1M2NA 3CRMA 4MVCA 4XQ9A 4HAUA 2J9GA 2E6KA 2ADMA 2R8RA 3IKTA 3ACBA 2G9ZA 2FZVA 2JGMA 3NHYA 3R5FA 4AB1A 4DLZA 1FLNA 3IXLA 2DBZA 2FEPA 3B36A 3D8NA 3V1KA 1N0WA 2GBPA 2NO7A 5DGTA 1E9RA 1JQEA 2OC4A 3LVBA 3D4NA 3S5UA 2HPVA 4F6LA 3AB8A 1U3GA 3D3NA 1X1AA 1XB2A 1HQYE 1X2BA 2G09A 1GGJA 2JFYA 2IS6A 1ND6A 2PBZA 5EXPA 1N6LA 4FVTA 3R5KA 3CZRA 2GESA 2P68A 3ROXA 4U6SA 3BMOB 1Z7WA 3QA3E 3A26A 5FUXA 4AQDA 1OYYA 3EFEA 4GKKB 1O1YA 2OCAA 4IOMA 1WUYA 1J6UA 4R51A 4E2FA 1K97A 1KAOA 2RG1A 2SCUB 2JI4A 1JHMA 4LYYA 4QYIB 1PK7A 4RLHA 3WTBA 3T7IA 1NP3A 1KR2A 1Y3HA 3G0GA 3OX2A 1PYDA 4DE5A 5AXDA 3SGLA 1JKJA 4P0TA 3RTGA 1CY2A 4EKIA 2FW1A 1M1UA 3LX8A 4IUCS 2Z98A 3H42B 5JBQA 2FN8A 3AGQA 1FPMA 4D6PA 4YV7A 5HZMA 3ORRA 4IDQA 3K0FA 4AXXA 1H69A 5CYGA 4I55F 5KNBA 3EOAI 4YRTA 2J0UA 3KZVA 3EVNA 3ZVKA 5TARA 4TWZA 4FGLA 4UEWA 2YOGA 5JZMA 4RK5A 3GAMA 4J94A 4YMWA 1AQLA 4AMVA 4UNIA 3KSBC 2QYHA 5G2OA 1EGVB 4KJZA 2X9NA 3HMQA 3I28A 3VO8A 1AN9A 1DHTA 2QSUA 1WXHA 1SAYA 4OHBA 2IUUA 2HHJA 1JAXA 1LJUA 5H3LA 4PEVA 3IELA 3AHFA 2VEOA 2YZ2A 3FD8A 5EIHA 4B5LA 5L53A 1U8ZA 1UPCA 1XLUA 1QKIA 2IOQA 2NQ8A 2A5FA 3CH4B 3I39X 3MWYW 1I0LA 2OCGA 3D3WA 4D9HA 5K7SA 4UAUA 1N57A 3CLRD 1PSWA 1JLKA 5J1TB 4AZ0B 1X8XA 1GPJA 4YRCA 4C4OA 3W2HA 1NV9A 3QXJA 4ENSA 2XT0A 5DYYA 1N34B 1OXBB 4Z4GA 4IDOA 2BIFA 2HRBA 3RUEA 4HQLA 4R0VA 4V3CA 1I6MA 5G02A 1E5QA 3PD7A 4I55A 4K1XA 2HA7A 4JFRA 2HA3A 2JAUA 4YV0A 3IIIA 3A1NA 1Q74A 2OCBA 2V3VA 4FR2A 4UUAA 2AVDA 1IEWA 3N8NA 4NCKA 5JCOC 2ZAOA 1ZCFA 3B7PA 1U6IA 2FZ5A 3R8CA 5K0ZA 5E9JA 4N7JA 1PJ3A 1YQWA 2JK1A 1NAIA 2QM8A 3PC3A 2DBYA 3UWOA 2PS9A 5EUQB 4DJFC 5KVAA 2O3SA 2C2GA 1HWYA 4UULA 2R7MA 4NP6A 2QUKA 5J5VA 1G5PA 4QU8A 1VDMA 5JY6A 3G2PA 4F4DA 1PKXA 4F9TA 5P21A 2VQFB 5CDFE 1UQTA 2UV8A 3AFGA 4KUGA 5DCLA 2P0YA 3SQDA 1X1DA 4KITB 3ONVA 4OQPA 1NQ5A 3C4QA 2EKPA 1ZSNA 3KD3A 1ADYA 4HDKA 1FFCA 2IX3A 3KSUA 1CB0A 1Q17A 1Q20A 2FPSA 2VPWA 4F6CA 3VYUB 3ZZNA 1E0AA 1ML4A 2Z3ZA 1A82A 3NHFA 1PNOA 3IAM1 2HHCA 3T3EA 1Y34E 4JWKA 4AS3A 4LBYA 3JQAA 2FJ0A 4GRIA 4GR5A 1XN4A 3V46A 3HCFA 1XQVA 1I7SB 3RT7A 1YSCA 1O3YA 2FWPA 1YIDA 1ZOSA 4TT3A 8OHMA 5LYJF 3DV0B 3LUAA 4X6LA 3UQYS 4KYVA 5HF9A 2XZPA 2FSIA 4MYTA 1H2XA 1NOKA 4DCTA 3FNBA 2BP7A 4CV2A 4PR0A 4NE2A 3SQMA 1PWYE 1U94A 2O3TA 3HDVA 2YNMA 5HA5A 5ECDA 2AD1A 1V43A 1TYCA 1F2UB 5J1SB 3B1WA 3FROA 4L22A 4O0LA 2I91A 1D2CA 1NW5A 2FEOA 1KK3A 4XM1A 3K6SA 1XRQA 3MZ0A 3V1MA 4UHJA 4DA0A 1QS0B 5ALLA 2IWHA 3RYHB 3TNLA 4AULA 1BGXT 1SCJA 4WFIA 3RRMA 4D92A 4ICIA 1ZGZA 3CE6A 3O82A 3MWFA 4EGSA 3SVLA 1JHQA 1I1QB 3UHOA 1OREA 2PPVA 2XUHA 2DF8A 1K6JA 1T5SA 1Y3BE 4RDCA 1I6WA 2O2SA 1MAHA 3EUFA 3TNJA 4GI1A 3R6TA 1RMTA 3ZI0A 1F8GA 1D6MA 4LF6B 4OUDB 2R8OA 1MT0A 2Y1EA 3B51X 3I58A 1Q11A 3OAAA 4RJLA 4BNFA 1CYDA 4K1LA 5EE1A 1TO2E 1V6AA 3JVUA 5K0GA 3GVXA 3AIMA 1C50A 2HPHA 1E6EA 1I7DA 2FFQA 3CCBA 4Y2VA 3B1ZA 4C05A 4HNVA 3EBLA 4KKXB 4N0EA 1EWRA 1IN8A 4R8RA 1LF0A 1Y9DA 3A4IA 3FPSA 4WASA 3THOA 5HKLA 1TT7A 1U4NA 3DMPA 1XUOA 3T1NA 4GR4A 3V00A 1DCFA 4JLUA 2NXEA 4KR3A 3EPLA 1KI8A 2VSXA 3AK4A 4NAUA 4XUEA 2OCPA 1PSZA 2BGUA 5B12A 3C2QA 1JEYB 1KGDA 3D7MA 1NVVQ 1FP1D 2LBPA 2XQIA 5CNJA 3ZLUA 4B84A 1R1DA 1ODCA 3N6RA 4B09A 4D80A 4GXTA 1YAHA 2Z2IA 1P7CA 1F0PA 1XQ9A 4AZWA 4ZOQI 1CRPA 1XWIA 2FV8A 1RVV1 2IU3A 1XRNA 3JVVA 5GTDA 3NOXA 3MRTA 4KUHA 1SCBA 4NS1A 3E1KA 4Y2RA 1TD1A 1WQ3A 2R1TA 4U2GA 5LA6A 2X5NA 2HDOA 2HXGA 1LY1A 3CKLA 2X5OA 3E70C 2FDXA 3PE6A 1UIMA 2X77A 5IEBA 2VC2B 4CIBA 3OX1A 4MVJH 1XPOA 2WWYA 2X3YA 1Y6QA 2YFHA 4GDFA 4S35A 3DF7A 3R3WA 3N8DA 3GLIA 1H2AS 2IT1A 1F9AA 3CPHA 1G41A 4UU8A 4DNXA 1PZGA 1NPDA 1SQSA 4WZBA 1MHPA 3HBNA 4NJEA 3WK9A 2B30A 1EVZA 1N2JA 5A3QA 1Y8CA 3HDTA 2IK8A 3CMMA 5EG5A 3JQ6A 4R98A 3T7JA 5DXAA 2HREA 4QTZA 5EVJA 4G9BA 3WIUA 1IN5A 4BE7B 4GQIA 1L1EA 2UYQA 4PPQA 2I7TA 2R6ZA 4WVLA 4KXVA 4U7GA 4B3MB 4QBKA 5C53B 1AE1A 2XTJA 4MHTA 2FJUA 3U4MA 1JIIA 3LYUA 4LXIA 2XB2A 3W9BA 1SIBE 2VSYA 4D3ZA 3CUWA 5L3QB 3FDIA 1RAAA 3V2UA 4BPBA 2ZJAA 4FFMA 4R40A 1WCIB 4ZZIA 5JSKA 1NBEA 1BXRB 2JCBA 2OUIA 2O5CA 3L49A 2XECA 4XVHA 4FNOA 5AKGA 3L7BA 4KLCA 4BNYA 1FMJA 3WSWA 5D00A 2HCTA 1PVDA 4ER7A 4CCYA 4ZYLA 1XYGA 4HQFA 3MUFA 3T15A 1NRIA 1YVUA 4E5UA 3R5XA 2BV3A 4HBGA 1IOWA 4C4XA 2ZQ5A 5FBWB 1ZIYA 3V6MA 5KYXA 4V2UA 2NTJA 1GSIA 3IV9A 2IW1A 1JNYA 3OD5A 5IFLA 2J87A 5GJWC 4BP3A 2XCIA 5G53C 4OB7A 4W1QA 2OD2A 1PNVA 2LDBA 3QLJA 2QTRA 4L85A 4TUYA 2ZIXB 3GPLA 1NVFA 2AFHE 3G59A 1QRDA 621PA 1AG9A 1U8CB 3UATA 3DDOA 4IGAA 3D8RA 4U00A 4ZREA 4XJTA 1LSUA 1ZNQO 4RKQA 5AQ1A 4Q7LA 1YACA 3JRWA 2R5FA 3QOWA 1G9TA 3NCHA 2R8PA 2GA8A 3LNCA 1F6BA 4H0NA 2ZJYA 4RHTA 3LQFA 2M1XA 4CR8A 4O8CA 5I45A 4Z2AA 1ODJA 4L5YA 2CVZA 3PGJA 4YRSA 1MAAA 4LQ4A 3MHTA 1TAUA 1VMAA 3FCUB 2C92A 1T4BA 3H8SA 3KZOA 4S1NA 4QDZA 4M76B 4FEAA 1QKKA 1ZRSA 4EPWA 3ESDA 5M7EA 1JYSA 4OV6B 1H1TA 3AV3A 2XR1A 2NTEA 4CG2A 5CFRA 4BNUA 1ZVKA 1RQGA 2PVCA 1CIJA 3UTCA 4NQZA 4B3XA 3QOXA 3RAGA 3KBOA 3DFMA 3PYXA 3PDHA 5LLTA 4WECA 3DEFA 4KRYA 1K6XA 1DCTA 1DIBA 3JWIA 1BDHA 1ZI9A 1TZBA 4FDUA 1A3CA 1KI1A 4H3HB 2ZJ3A 9GPBA 2VT3A 3GLGB 1A1SA 3U3ZA 4D79A 2JARA 1CVLA 3V6LA 5K8JB 4GM0A 3CUYA 1ISFA 3URKA 1MOQA 2C31A 1ENPA 1U7UA 4CMJA 3GXOA 2DLNA 3K53A 2J3EA 1GDDA 1NYQA 4MO9A 5LA6F 1QTQA 2QUJA 5AJYA 5BQFA 3LH5A 2X7HA 1QX4A 1O58A 1GTSA 2AMFA 2YV3A 1ISIA 1LLUA 2AMLA 3KZMA 5LDGA 4BNJA 4CBVA 1I4TD 3NNNA 2ZUVA 1VIVA 1XVVA 1ZUNA 4U2BA 4YUXA 5BXQC 1FA9A 1J06A 3H9EO 4TS9A 5HIKA 2WHPB 3WJ2A 3MJFA 1T13A 1UKZA 3DWFA 3E53A 4PZPA 3BRQA 1T10A 2JJMA 1BZYA 1QIGA 4RIEA 4Q9NA 3P32A 3QUTA 1OV4A 1FS6A 1N5OX 4IEFB 2HSGA 4EYQA 3R2JA 3K16A 5LM3A 4X3CA 4URVR 3M9XA 3D3WB 3SEQA 3O93A 1XOIA 4TLMB 1TZMA 5JAPA 5A4JA 3ENVA 1F60A 5IYZF 5ALRA 5H68A 4JN6B 4F2HA 4PFSA 2Q29A 1GTRA 1Y1TA 1PGPA 3R4CA 4Q00A 3OE1A 1IPEA 1R4MA 3F47A 4ECAA 5KJFA 4UDYX 3SBOA 4MDEA 1DAPA 2P1RA 2ZRDA 3ZD8A 4Q9IA 1J0XO 1SZDA 3CX4A 2BGJA 1M1NB 1E92A 3HA3A 4UPDA 5DBFA 2PMEA 5H3CA 1YZKA 3RUPA 3OZ7A 4MVWA 1Z4OA 3MMSA 1L4LA 5EKXA 3RBXA 4CG1A 4Z7OB 2QTWB 3NT4A 3DYVA 3EASA 1U9ZA 4YUYA 1T6ZA 1CY0A 3GRPA 4FOPA 2PM8A 1J2JA 2OQ2A 2JA1A 4MI9A 1O94A 3L4JA 2V6FA 2XA1A 2YHSA 1NF9A 4CG0A 2ZBGA 4RVHA 5DZSA 5KU1A 4YLYA 1GFSA 1U28C 2EWMA 1GAJA 1BKYA 1GZ4A 3B38A 1WW2A 5HBRA 5TMDA 2FDCA 5LQJA 3J7AC 1XZKA 5IDVA 3NJ8A 3DHEA 2C59A 1T9ZA 2NO6A 3KX2A 3PQ5A 5TGZA 4AZTA 5BN3A 1AMOA 1QH1A 4TTVA 5H4HA 2C96A 3B9BA 2JAXA 1EWYA 3P4UA 4IHJA 3RYIB 1JFFB 1OT5A 4US2R 3NVMB 2KJQA 2PSHA 3OU6A 5TT1A 4XA8A 1AKNA 2EJCA 3BS4A 3ON5A 4C4RA 2IY8A 3R09A 4YJFA 5K8CA 4CQMB 3T6KA 4AZVA 3HMKA 4W5HA 2QQEA 4XR4A 4CLRB 5L8VA 1AKMA 2A30A 5K01A 4R7TA 4YECA 4ZAXA 4E7PA 2I4RA 4DVJA 4ZODA 1YNSA 1J1IA 1N9ZA 2RD2A 1Z8DA 1FP2A 3QKUA 2W2LA 2X14A 4ACBA 3WHKA 2PJZA 3GH1A 1C1XB 1NJ1A 2Z1MA 3BRCA 2WJJA 4RZ3A 4YRJA 3EXFB 1E1CA 2QR3A 4V24A 4DZZA 4RHCA 4EI9A 2ABWA 2OD7A 2QN8A 3ANSA 4LTDA 4X93A 3T1HB 1EA7A 1DBIA 2ASEA 2JRLA 5ALGA 3B1FA 4C6SA 2D74A 5HQ3B 5KX5B 3DA8A 3ZW7A 2VWHA 4G9EA 2OORC 2G9NA 2B9VA 1CUIA 3HP1A 1QG2A 1CT9A 1TQDA 2OXCA 1YQXA 3LXRA 3STYA 5EEGA 3F6EX 4D97A 2ZSUA 2DOKA 2PGAA 2XZOA 5EZSA 5SYAA 5D3KA 1V95A 4D3SA 4YMLA 1VPVA 2MHCA 1ISSA 2PS1A 4YAWA 3DKIA 1CCWA 1KH1A 2OV2A 1E63A 1WHSA 4P86A 2C2HA 2OHIA 5T57A 2B0CA 3W77A 4CM1A 4GMXA 1MO2A 2ODQA 2P2NA 3MQ4A 4RM2A 4N0PA 4ON9A 4ZV9A 1YDGA 4NVRA 3CLVA 5IASA 3KSAC 2YKGA 1KO1A 1O03A 2Q1SA 1ATIA 4LFAB 3IBSA 3LCUA 1FDRA 3EGIA 3KS9A 1TGVA 3LT1A 3U7GA 3AB7A 3GNSA 4DY4A 5B5SA 1YONA 2X1VA 2RGWA 4FFPA 4D9EA 1L7VC 2QU7A 3BGIA 4Q19A 1QK3A 2Q5IA 2QZZA 3VTZA 3F5QA 4DUGA 1JKXA 5DP1A 5BYBA 2I03A 1QPZA 1WXQA 2XPCA 1PBTA 1PEYA 3B12A 3G0BA 5FNZA 3IHLA 1OIXA 5AH0A 4KSYA 4CT4B 2XBMA 2C4KA 3SIPA 1I1OA 1MXFA 3L8CA 3NYQA 1R3DA 2C4UA 3F46A 4WOPA 1DZ3A 2DPMA 2DTXA 2X4DA 4IY1A 4P4LA 1A50B 1NLMA 2IVZA 5EHNA 5GVSA 3RH0A 2X8WA 1J5XA 5IXJA 1R16A 1S02A 1S2DA 2X0KA 1GNPA 5HRAA 1XX6A 4ITUA 2UYCA 4FHDA 4ALLA 1KARA 1VLMA 4ENQA 2CV0A 2GJAA 3PF8A 1KJIA 1PDWA 4YR9A 1QHFA 5K4HA 2ZSFA 1A5BB 1D07A 1C7EA 1NW7A 2GZAA 1OYWA 3T0GA 3IDAA 3EDMA 3WZMA 5FNVB 3GP8A 1N5LA 1PWEA 3DMHA 4K6CA 2I2BA 1EESA 4PNZA 1EZ4A 3PP8A 3FFWA 3KYIB 1M83A 2FPOA 3X3HA 4MQ4A 1Z73A 4Q16A 4GSYA 5A4MS 3CX7A 3SSNA 4P3XA 2RB5A 4E5NA 3DE4X 2JZOA 3SM3A 5LC1A 3E8MA 2IXGA 2RBKA 2X23A 1G21E 3LCRA 3OIFA 1L5QA 1XK6A 3OZDA 4EEKA 3JQGA 1FVHA 4NJEB 3BL8A 5FR1A 1DXHA 2HQRA 1CR2A 3FOCA 3JWHA 3G9UA 3S8YA 1GT6A 2DJ5A 4AG6A 4QJ4A 5T4EA 3TRFA 4TYPA 4K26A 2O5VA 2BBTA 2WTNA 2ORWA 3ES9A 4HPJB 1AUPA 3FCCA 3NHRA 3ILSA 1QPBA 3KFXA 4R8MA 2D4HA 4MIEA 2IBMA 2WTUA 2WQZA 4B44A 1Y3IA 4JJKA 4FE3A 1INLA 3FPHA 2B3TA 1GL6A 1K5PA 2PZLA 2ZUUA 1BS1A 2UVQA 3PHIA 2PU5A 4NXMB 2BFDA 1WXGA 4FZJA 2XCSB 3QJYA 3HKBA 4V03A 1VBFA 3IEMA 4QOJA 2YTZA 1TLTA 2CMKA 4E08A 3AL2A 3GBSA 3L7CA 3O4HA 1OROA 4D3DA 2L0XA 1RBMA 4YACA 2C1ZA 4FUTA 1RD4A 3DONA 1PLLA 5G0SA 3RFUA 1W5BA 3IFSA 3Q7PA 5H9WA 2JPDA 1GPAA 1OZFA 1SVMA 1O96A 2Z58A 2QLJA 3CNLA 1UWLA 4IIBA 1GTMA 4D9MA 4KH0A 2VTBA 2IIPA 3B6ZA 1UFQA 2QE7D 3CT4A 4X00A 3C41J 2PRKA 3AINA 5DRTA 2G4VA 5BSMA 3AYZB 4NOKA 4L5AA 4HDSB 3V1UA 1L1RA 1D1SA 3PNLA 3DHNA 1P45A 1ZCZA 5E6UB 3W1EA 3WHLA 1XXHA 5AVZA 2XW6A 2NVWA 1XA3A 3NT2A 3INNA 1W581 4WERA 4AO7A 4CI0B 5I7RA 2LCIA 1TE2A 3HJTA 1G7CA 3N87A 1Z8NA 1JI0A 4UU7A 1NI3A 5F5LA 4O2AF 5SZKB 3TAXA 2AFIE 4E03A 2JFXA 3GWZA 1WKBA 2C61A 4C7JA 3A7EA 1QHSA 4RWZA 5DJ5A 3ZK8A 5JXIA 5K6AA 3WXBA 4R1QA 4KSBA 4Q7KA 1GITA 4E31A 4GYJA 5K0LA 2FPIB 1FLDA 3OEHA 5EUMA 5EJ6A 3BH6A 1SXIA 3VHRA 1QP8A 2AN9A 1M76A 3BJMA 1FJHA 1YZNA 1ORTA 1RP7A 2A1TS 1WXDA 3HWWA 4FS8A 1PTJA 2ES4A 4DANA 2JL1A 1D5WA 4GT1A 1G2PA 1ZMTA 1X1TA 2VDJA 3JZAA 3G0DA 3PUJA 4BU0A 4LG1A 3T5BA 4JC4A 2PWPA 3RS8A 2E89A 1JT2A 3A1TA 1SB8A 2XKKA 1N0UA 4KAXA 1HX7A 3W6PA 2Q6KA 1U0BB 3PDIB 3IP9A 2GM5A 4M1TA 4GYWA 2R96A 4GKJB 5EINA 2HTEA 1UADA 3A7DA 1IN7A 1N8TA 2ZE5A 4C01A 2JAOA 2D5CA 4Q3DA 4OBEA 5HIMA 1HE4A 2IPOA 4DSAA 1NAHA 5DSZA 3A2NA 2ODPA 3P9NA 3WIVA 3F4BA 1EINA 3KXLA 3GDOA 3V33A 1FDUA 2ZI3A 4MYSA 4HC4A 2FW7A 2QJRA 4HRXA 3R76A 4EECA 1DG3A 5I3CA 4E4YA 2QRJA 4JY7A 2AE1A 4V1CA 2FUG6 4FEYA 4KAFA 4P83A 1LUAA 2R62A 4QREA 5DLEA 3TVYA 1R5BA 5FPYA 2ZBVA 3GW8A 4NEHB 3SR0A 2H5LA 1XHEA 3D0RA 2Q2WA 1JTEA 2H7VA 7YASA 3HPQA 1U0TA 4WEQA 3ASYA 2AC4A 4N12A 2JEYA 4LJKA 4RA9A 4LXTA 2IEBA 2GXQA 1XV5A 3DNPA 3PE3A 1PWXA 2BLLA 3OFVA 5EZYF 1Y4AE 3ND6A 4KR9A 3DGEC 2VTVA 1PG2A 1V45E 4JGIA 2VHQA 4A0GA 4GI7A 1NKSA 4DG8A 1BX1A 3IT2A 2Q4RA 1XNGA 2C5FA 4U63A 4W63A 2E4WA 4YT5A 2VSNA 3S2EA 2I67A 2AW5A 4GMDA 1E4VA 4LRTB 4RLQA 1IQRA 3AR9A 3COPA 3NH6A 1T5OA 1NF3A 1SUWA 2AK2A 2XQJA 2FUG1 3O2SB 4M9CA 2PMFA 3M1AA 2ATIA 1ECGA 3JQBA 3N2KA 4KZPA 1L5SA 2H00A 4I6GA 4L51A 2IXDA 2ZJ8A 5DOVA 5KKAA 4WXRA 4D8YA 4C5BA 2PGNA 1A8UA 3C5VA 3QUBA 4LUCA 3V4ZA 3ZIUA 5CU7A 5JIBA 1O0CA 4PYRA 1MFZA 1WCWA 5ICCA 5AHOA 2Q1UA 2QJOA 3KFVA 4MV9A 1RYFA 1VOTA 3BRWD 1C0PA 3GVHA 3WAKA 3SSOA 1W85A 4UTZA 3V8VA 1XKQA 2JGFA 2VAXA 5BN3B 3FUWA 3Q7IA 4A1FA 4XXHA 1RCTE 2B5WA 1M2GA 4MS4A 1PGQA 2EW2A 5HCNA 4RDXA 3R9IA 3IE0A 1XU9A 3EMBA 3GLVA 4JOCA 2YXBA 4HNAB 4NCAA 2X58A 4HXYA 3V2IA 2HPAA 1WMEA 4PV7A 1E6UA 1FXSA 2ZI6A 2Z2YA 4GI3A 5ECWA 1DFHA 1P6UA 2AJDA 3K9FC 3J7TA 1P1IA 1UJ6A 5JD3A 3BDVA 3I23A 5F7JA 4OIMA 3WGIA 2QAIA 2Y3IA 5JCXA 2WWRA 1DEOA 3GB9A 3K9LA 3ECSA 3JTEA 1PKEA 1SMKA 3T8YA 4D44A 1N75A 1M1NA 4OQMA 4X54A 4WWHA 4CL2A 3BREA 1OI2A 4UCWA 3H9JA 3OEYA 3O1LA 4RQUA 1E6WA 3WG9A 4YRLA 4IJMA 4QE3A 3GMDA 3JRNA 1BDIA 4MV7A 2ZROA 5CB4F 3VQTA 4ZZ0A 3S70A 3TFOA 2POCA 2PZMA 1VYVA 3JS5A 3U4GA 3VV3A 3ORYA 1NW6A 1RRFA 2FUEA 1XK7A 2AX4A 1LRLA 3U26A 1Q16A 2A59A 4XAQA 3C3YA 3RJTA 3T7KA 2ZRQA 3U80A 3QFCA 3TJZA