3W06A

Crystal structure of arabidopsis thaliana dwarf14 like (atd14l)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
267
structure length
267
Chain Sequence
b'GVVEEAHNVKVIGSGEATIVLGHGFGTDQSVWKHLVPHLVDDYRVVLYDNMGAGTTNPDYFDFDRYSNLEGYSFDLIAILEDLKIESCIFVGHSVSAMIGVLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLAVGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQILPFVTVPCHILQSVKDLAVPVVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIRNDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, alpha/beta fold family protein
publication title Structures of D14 and D14L in the strigolactone and karrikin signaling pathways
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 100
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2012-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3w06A00
2Y6UA 1GPKA 4EBBA 4QDUA 3W06A 2XMSA 3ZLVA 1QIDA 1IZ8A 4Y2RA 1T2NA 1PV1A 5AI5A 5E4JA 5CH8A 3EQ8A 5AOBA 1CUBA 1QIIA 3RARA 3D2AA 1SFRA 1YR2A 3T52A 1QIGA 1XZCA 4ITVA 2WHRA 3F97A 2QXUA 1FFBA 4H7EA 3H19A 2AJDA 1AC5A 5ALVA 2JGEA 1U4NA 3V48A 4KRXA 3AUKA 4X92A 3R3ZA 4EA6A 2XQKA 3EQ9A 5ISMA 2WHQA 2YYSA 4PNZA 3DKKA 4J0IA 4QLOA 2XUOA 1EB9A 4DNPA 3ZV7A 2QUBA 2QT9A 3A2NA 5C8ZA 5JIBA 5AM1A 1EDDA 1XQWA 4C88A 1YB6A 1ORWA 1SC9A 2WILA 4I4CA 5C81A 1XZMA 4FNMA 1J2EA 3R3YA 2XUDA 2VATA 2YXPX 3V1MA 1ZI9A 4ETWA 4L3WA 1F0PA 2ZYIA 5AKGA 4ZRDA 5ALEA 1MX5A 4G4GA 1SOMA 3H1AA 2DCMA 5ALNA 2Z3WA 1CUIA 4DM7A 1SCIA 5K3FB 3W2TA 2GYWA 4K6HA 4AZ3A 1A8QA 1MJ5A 3AIKA 3EQ7A 2ZVDA 3PFBA 1R50A 4Y2VA 3VJMA 2VJDA 2IIVA 5T4EA 3FLAA 3QVMA 5AJHA 1AX9A 3ZI7A 4M0EA 4GDMA 3BL8A 2C5FA 1LPBB 2CJPA 1MTZA 2PSEA 4RNCA 4Y2UA 1LPOA 1ZGCA 1L7QA 2FX5A 1UFOA 1NX9A 2HFKA 1UOPA 5HF6A 5AKXA 2RHTA 3STYA 3A6ZA 3KOOA 3G8YA 4KJXA 2QTBA 1R9MA 1YAHA 5JZ9A 1LBTA 3HRHA 3ANTA 3GA7A 4H77A 5HQ3B 4PV7A 4MEAA 4WFJA 4U2EA 4OU4A 5DNVA 4X71A 3AZQA 5E4YA 3WWEA 3H2HA 1F6WA 4X6UA 2JGJA 1WB6A 3WI7A 5FDFA 1THGA 2VT7A 4BC1A 1UK9A 4OB8A 5AKLA 1Q0RA 1DQZA 3WKCA 3H1BA 2OGSA 5LZ5A 1USWA 2PVSA 5ESRA 3WL6A 4J0HA 1EHYA 1BN6A 4AZ0A 4X85A 1QIHA 2R11A 2OGZA 1ZIYA 1BROA 4JYMA 2XUFA 4E15A 4W1SA 3QZUA 1XKTA 2VQ6A 4FNGA 2CB9A 3D2BA 2V98A 2XB6A 1O6FA 4ZI5A 4KAJA 5LKRA 5EIHA 3C6BA 4DNOA 1X70A 3ED1A 4J0CA 1EVEA 2X8BA 3HI4A 3AZOA 3G0CA 3W9BA 4AN0A 3PDCA 4J0DA 1MT3A 2JIDA 5ALTA 1UK8A 1QIKA 3I2FA 1TQHA 4H7HA 2JGIA 4X95A 1CLEA 2QVBA 3G9XA 3E3AA 1Q83A 1EINA 3K9BA 5AKEA 4RE5A 2PSDA 4BP9A 2GZSA 1HL7A 4W1PA 4WJLA 1DWOA 2BUBA 5ALGA 2B4KA 3I2JA 5HQ3A 2QKYA 3GROA 4X6XA 2XQFA 5ALUA 4U2FA 1ZJ4A 5DTIA 4EUSA 1A8SA 4BDTA 1TCBA 4QWMA 5FUMA 1AQLA 2PUHA 2LIPA 5LZ7A 4PSUA 4G8DA 1EXWA 5AIBA 5AK6A 3LP5A 3BXPA 4BRZA 4NS4A 3FLEA 1JJFA 2VAVA 5LKAA 1LPMA 4MEBA 4RPCA 3I2KA 4UHBA 5DNWA 1JT2A 2HRRA 3HXKA 2BJHA 1J1IA 2ZJ7A 5ALFA 2OQVA 1W52X 4Q3OA 4ZREA 3I2HA 2WHPA 3DLTA 3HJUA 3KDAA 4FBLA 4DNQA 3FYUA 4QDTA 3VVLA 4X6YA 1XRMA 2HDWA 4CCWA 6YASA 4BB0A 5KBYA 3DEAA 2ZJFA 1MO2A 3A70A 3WKEA 3OPMA 5A7FA 3BF7A 4FTWA 2O2IA 3R3VA 4U2DA 1JU4A 5FOQA 3C70A 5JD6A 3G9TA 1A88A 4Y2QA 1E89A 1KU6A 4BVKA 5AKKA 4FLEA 1GKKA 1HBJA 1FFCA 3TJMA 1ZD4A 1YA4A 4B80A 4KEAA 1CEXA 4OB7A 3WYNA 1XZFA 2WG1A 5JATA 1K5PA 3OG9A 4H7DA 1QOZA 3ICWA 1DX4A 3UMJA 3DKRA 3KXPA 1LPNA 4ZGBA 1CVLA 1WOMA 5CXUA 3GUUA 4M0MA 5ALZA 1IZ7A 1VKHA 3AIOA 1XZAA 2BCEA 3F96A 1I6WA 3I2IA 4MYDA 1IUPA 4TVKA 3GFFA 5LYYA 4TPKA 4DIUA 4FLMA 2WM2A 5BV7A 2WJ3A 3E0XA 4WDRA 4XX1A 3BIWA 1HDEA 3EBLA 1P0IA 3LIPA 1P0QA 4I3FA 4C4XA 3V1KA 4DLNA 4GI1A 5IH7A 2H7YA 4KACA 4FBMA 2K2QB 5ALWA 5E2IA 5BWCA 4G8CA 4UBJA 4HRYA 5ALXA 3QPDA 4QDXA 4W1RA 2HA0A 3BWXA 4ZV7A 5D7BA 4NVRA 4DTCA 2QR5A 1Y7IA 2HADA 3WA6A 2B61A 5AM5A 3KD2A 2AJLI 4G9GA 3UUEA 1BU8A 3R0VA 1XZKA 5ALKA 1OCEA 1CPYA 2QZPA 3TRDA 1B6GA 1K63A 1QIJA 5DYWA 2HM7A 4TGLA 5AO9A 5FKJA 4EZIA 2PBLA 2WUEA 1SCQA 4D9JA 1UT6A 4G1FA 1UXOA 4MWSA 3JW8A 1FFEA 4AO8A 4K6KA 5BOVA 3B3QA 3W9UA 1C7IA 3STXA 4IH1A 1NU6A 1CUAA 3WYDA 1X2BA 2I3ZA 2VEOA 3ILSA 4N5IX 1MU0A 4A16A 1UK7A 4UBOA 4X00A 4M0FA 4X91A 1H23A 5CT8A 1CQZA 2DHEA 3FYUC 3N2ZB 3AZPA 5HF9A 3C6YA 1DQYA 5DJ5A 4LXGA 3C87A 3JWEA 4A23A 1LGYA 3JYHA 3VKFA 2G63A 4CG2A 1VXRA 1JI3A 4W9RA 4WY5A 1XQXA 2PSHA 5AI0A 1GPNA 5AKYA 1CUFA 1BCRA 2XMCA 1EK1A 4DMCA 3D7RA 1VZ3A 5AOCA 2Z5GA 2JBWA 1HKHA 1JFRA 5ALSA 3IUMA 1UWCA 4I19A 1VE6A 5ALMA 4X93A 4BCDA 5D6OA 2CZQA 3IULA 3R3UA 4F21A 3WMRA 1XRLA 1QFSA 3ESBA 5CT6A 4X7BA 5AKIA 5I7UA 2WG0A 3M3DA 4GLBA 2WIJA 4EY5A 4N8EA 4CIAA 5SYMA 2ZYHA 1ODCA 2ROQA 1XZEA 1N5MA 4Q05A 2D0DA 3DL7A 1IVYA 2GBCA 3WZLA 5JZSA 1XQYA 4EB0A 5CBKA 4YPVA 2V97A 4HTAA 2QRUA 3NUZA 2AJBA 1GQRA 3IUNA 1YS2X 4GHWA 1BE0A 2DQZA 2WSLA 3F98A 5JAPA 2Y6VA 1XZHA 1ETHA 1DU4A 1W1IA 3LS2A 4AN1A 5LP1A 4X3CA 1G5FA 1MX9A 2ZYRA 2OCKA 4B85A 2XMBA 1DWPA 4DMKA 4E14A 3C8DA 4FDMA 4J3JA 3ZPXA 4BE4A 4C4ZA 4NMWA 1H2XA 2PKYX 5FXMA 5CRIA 1ZD3A 4FFWA 2WTMA 4UHFA 1CUZA 5I9IA 5DYYA 4C4YA 4U2CA 1LBSA 1BRTA 2ZSHA 2HA4A 5D3ZA 3R40A 3L1HA 3F9CA 4QDOA 3I1IA 2WFZA 1WM1A 2Z3ZA 3O4IA 2HA2A 4LIPD 2C0PA 4Q82A 3V1LA 5AI9A 3BDIA 3O4HA 3C6XA 2C4HA 4H7IA 2Y2UA 5JAOA 2O7RA 5AP9A 4A5SA 5CW2A 1L7AA 5FLKA 4BC0A 1DTEA 4DMFA 3EF3A 1ISPA 3E4DA 3M83A 4FKBA 4X97A 4GXNA 1K8QA 4WY8A 1XZDA 4N8DA 4PW0A 3S2ZA 1TKRA 4DMHA 1CQWA 1TCCA 4YK7A 1LZKA 4BE9A 4ZWNA 1F0NA 3O4GA 1CUVA 5C8VA 1DT5A 5AI6A 1ZICA 4OU5A 3WIOA 3MVEA 2OCIA 4DSZA 3PICA 3BE8A 3E1GA 2ZJ6A 4ZV9A 4XVCA 4OSEA 1UKCA 5E4TA 3B12A 3ZLUA 5AK5A 4B9EA 3D3NA 4UHDA 3DNMA 2XUGA 7YASA 3CCBA 4E46A 2H7XA 1VLQA 2Q0XA 5IKXA 3IB3A 1MAAA 2JEZA 4BAUA 2WKWA 2I03A 1CFJA 3PFCA 1L7RA 4KYVA 2EDCA 4LXHA 3M81A 5CH5A 1MNAA 2WIDA 1CR6A 5EHXA 3HABA 1BS9A 2WHPB 2BUAA 1J07A 1XLVA 3FCYA 3FYUB 2GZRA 5BWBA 5LLSA 4BATA 4QA9A 4AQDA 1LPPA 4OB6A 2JGFA 5ALPA 3H2KA 1THTA 5FV4A 3WL8A 2XLCA 3RM3A 4HXFB 3HZOA 3O0DA 3WJ2A 2DHDA 3RKSA 2I3DA 1HPLA 3G0DA 3H17A 4Y2YA 4FMPA 3QITA 1QGED 1EK2A 4YASA 4AMZA 4Q34A 1ACJA 4HRXA 5HK8A 1GGVA 1RYYA 2GBFA 4QLAA 2B9VA 2ES4A 2WIFA 4KE6A 2C0QA 2WFLB 2XQJA 4DYHA 2XUJA 5ALRA 4C89A 4Y2JA 3DDUA 2ZSIA 1TRHA 3I2GA 4JEIA 4EY7A 1ODSA 1TAHA 3ESCA 3G9ZA 3QBJA 1GZ7A 2HL6A 1LPAB 2JGKA 2VAXA 5LZ9A 4EHBA 1JJBA 1DWQA 1TIBA 4H7FA 4MJ3A 3NGMA 4BTVA 1MX1A 2XMQA 1KEZA 2HFJA 3H2JA 3U1TA 4BZWA 1CUEA 4DGQA 4B0PA 1C4XA 4UHHA 1H22A 2WLSA 3FYTA 1QLWA 3OOSA 3K2IA 1D07A 1MNQA 3SWWA 2OPHA 5HK9A 3G0BA 1RP1A 2G5TA 3HSSA 5LIPA 5JZBA 4CCYB 3I6ZA 3WK9A 1JMKC 4K6GA 4MWTA 1WHSA 1N5RA 5AM0A 2H7CA 3QPAA 4MXDA 1XLWA 4K5QA 3HACA 3QMMA 4GW3A 4Y2PA 1FFAA 1ZI6A 3QH4A 5JD4A 5FPQA 2Y1KA 4GWLA 5DWDA 1M33A 1YAJA 4IO0A 4OCZA 1ZGBA 2FJPA 1OXMA 3CN7A 3Q8WA 3VISA 1H2WA 3QMVA 4B6GA 1ZI8A 1HLGA 1EDBA 4CIBA 2PL5A 3SK0A 1W75A 3C45A 1UOQA 2IITA 4Q3LA 3V9AA 2HA7A 3VVMA 2V96A 1T4MA 2WFLA 4CI9A 5JASA 3BIXA 3KSRA 2D5LA 4G4JA 2C58A 3LCRA 5I8PA 4UBIA 4OUKX 1GXSA 1CUYA 2ORYA 5EHZA 2Z8XA 5AH0A 2B20A 4W1QA 2OAEA 4O08A 1UZAA 4OD0A 5IVIA 3C8HA 4MYSA 4CFSA 1CUJA 5A71A 4DSAA 1BEZA 1O6GA 2WU3A 2J4CA 1Q84A 1MPXA 3PI6A 3FSGD 3F67A 4CG3A 3BJRA 5SYNA 4OYLA 1CUXA 5T4BA 3DJYA 3HLKA 1K4YA 4CG1A 5FRDA 2JGMA 5JD5A 1XZBA 1R9NA 2CKMA 1ACLA 5AICA 4J0GA 3OURA 4BDSA 4CCYA 1EH5A 3A2LA 3ESAA 2QJWA 1EDEA 4ARBA 4WFIA 5JAHA 2XMRA 5JADA 4UHCA 4BRSA 1G42A 1Z68A 4JNCA 5DNUA 1VA5A 1TK3A 2G4LA 2OQIA 5LZ2A 2PSFA 3P2MA 2JF0A 3WJ1A 2YASA 5CT5A 3GELA 2PUJA 3FVTA 3FCXA 1QO9A 2RI6A 5HFNA 2RIPA 5F4ZA 3A2MA 4INZA 2ZYSA 2VJAA 2GBIA 1CUWA 3I6YA 3IBTA 2VTVA 2O7VA 2I78A 5ALDA 1KU0A 3KWJA 3TEJA 3UUFA 3N0TA 5D3KA 2AJ8A 2H1IA 1S8OA 2YH2A 4IQ4A 3W05A 1LLFA 1QIEA 4B84A 3IIIA 5CT4A 4B83A 4KR0A 3FBWA 1FSSA 3BJMA 3NWOA 1VA4A 4E11A 4MQLA 2DSNA 1WPRA 3GBSA 1WHTA 5ALYA 1VZ2A 2XUIA 4KE7A 1H2ZA 1N8SA 2IX9A 1HQDA 2RHWA 5C8XA 3QPCA 1XROA 3WK6A 4B0OA 2RONA 5AKJA 1ZJ5A 3D2CA 1DT3A 1QE3A 3IUQA 2HRQA 1UOOA 2VA9A 3AJAA 3V1NA 1E3QA 3TGLA 4X90A 4PF1A 4AMYA 4Z49A 2GYUA 1WB4A 5ALOA 5A7GA 2O2HA 5CTAA 2UZ0A 3PF9A 2VF2A 2XT0A 3I1YA 2PSJA 4ZXFA 1OILA 4BAZA 4KAFA 4AB1A 2QM0A 4UFOA 5J3JA 4Y2SA 1XZGA 5AIAA 1GQSA 5JARA 2FUKA 2EDAA 4C6HA 2OXEA 4G5XA 4B82A 5LZ8A 1BN7A 1W76A 2HU8A 5DLPA 2OAGA 3AINA 4G8BA 3WWCA 2Z8ZA 2XUAA 3R41A 1XLUA 3WK4A 1AURA 4H0CA 2R8BA 3C43A 1VE7A 4H35A 3K6KA 2V9ZA 5KREA 1XQVA 4LYDA 3WA7A 1XRPA 3ANSA 3O9VA 2X5XA 3C5VA 4GECA 2BUCA 2FJ0A 5HF8A 1YSCA 4UPDA 5EIAA 4Y7DA 1P0MA 2AXEA 3QMWA 1EI9A 4QDZA 4L0CA 3CCCA 3IDAA 3D4LA 2NW6A 3FOBA 5AI8A 1Y37A 1U8EA 1NU8A 2XMGA 4FWBA 1IUNA 3IUJA 5AK3A 3DYIA 4J03A 1PJAA 3M82A 2O2GA 4W63A 3OM8A 2XUHA 3CXUA 4RGYA 2JEYA 4H7KA 3IA2A 3ZLTA 1YS1X 2GBGA 3STWA 3IURA 4J7AA 2Y2VA 4PO3X 1CRLA 1WB5A 2BGNA 4U2BA 1AKNA 3H0CA 4BCBA 2WIKA 3WWPA 5A6VA 2RGUA 4UFNA 1XZLA 2XQGA 1ZD2P 4RE6A 1ZOIA 3HYSA 4ROTA 3STVA 1QO7A 1A8UA 2ONCA 3I28A 4H18A 3OTQA 5YASA 1CUCA 1J06A 2GYVA 4BZZA 1W4LA 4BAGA 4MQMA 2BGRA 3CN9A 5T4HA 3FWHA 4X94A 4FOLA 3R3XA 1VJ5A 3STUA 2G5PA 1MN6A 1EX9A 5C7YA 3WKBA 2HA5A 1VXOA 1FJ2A 5A62A 3DQZA 2OCLA 3DD5A 2CMFA 2EEPA 2HA6A 2VT6A 2VJBA 3VJKA 1R3DA 1XFDA 4KAAA 4WFKA 2WJ6A 5A2GA 5CURA 4C87A 1W6RA 5DYTA 4IHAA 2DQYA 5DTJA 4AX4A 3L1IA 5JANA 5AM2A 1QIMA 1BEEA 4B81A 4LXIA 1JJIA 2XUPA 4Y2TA 3H2IA 2WG2A 1CUUA 1VOTA 4JUIA 4PSCA 4OPMA 3H18A 3WK7A 2QJRA 3WKDA 4XIIA 4H7JA 5IVDA 3G7NA 4G9EA 1K6EA 1QTIA 4EY8A 3WK5A 4K2AA 3S8YA 1XZIA 2OG1A 5ALHA 2WFMA 4P9NA 4UFPA 1B41A 2XI4A 2HA3A 3O9MA 4HVTA 4Y9SA 1WCYA 5K3FA 3D59A 5JAUA 1E8NA 5EIEA 3FSGA 4KE9A 3G0GA 3MGAA 5AKZA 4BCCA 5AM4A 5AI4A 1CIJA 1QFMA 1E5TA 4AO7A 5FP0A 4UUQA 1CUGA 4BTLA 3DYVA 3X3HA 1GPLA 4AXBA 3G0IA 4EY4A 2WUFA 1AUOA 5AK4A 4J0KA 3ZWQA 2XUKA 2CUTA 5LZ4A 1EB8A 5ALIA 1ZIXA 2XDWA 2OGTA 2WJ4A 4LHEA 2PPLA 1ZD5A 2WU4A 4PQEA 3RK4A 2WTNA 3PE6A 2AJCA 2C7BA 3FVRA 1XRNA 1X2EA 3GZJA 4FFVA 2HU7A 3C5WP 5ALJA 2DR0A 5AM3A 4GBGA 4FLFA 5ALLA 5HCUA 4HXGA 3ESDA 4WDQA 3WKAA 2DHCA 3QYJA 4JYPA 1DX6A 5HKBA 1P0PA 4B7ZA 3F8SA 3LIIA 5IVKA 5EI5A 4UBKA 4HZGA 1TCAA 3FLBA 4GEGA 4G4IA 5AOAA 3U0VA 3W04A 2ECFA 4F60A 5K3EA 3WLAA 1JMYA 5ALQA 4Q1VA 1ODTC 3BDVA 1R1DA 1XKLA 4F5ZA 4BYMA 4P93A 4N8SA 1R4ZA 1MAHA 4P92A 5K3DA 2HHAA 5FPPA 5CH3A 1A7UA 1WPXA 1U65A 4Q3KA 2J3QA 1ORVA 5CXXA 5JYCA 3WIBA 1GT6A 1LZLA 4UBLA 1G4HA 3WWDA 5KWJA 4FHZA 4PSDA 4QE3A 4IH9A 1QIFA 2HIHA 3H2GA 2H9YA 3WQHA 1UKBA 1YB7A 3RLIA 2WUGA 1UKAA 1QONA 1CUDA 5K3BA 3FAKA 3KWFA 4BVLA 3VJLA 2XLBA 3IVMA 1YASA 5K5EA 2E3JA 3OC0A 3WWOA 2BAGA 4LYEA 2WIGA 1EVQA 3MUNA 1LPSA 3L1JA 4AO6A 3VDXA 5AHXA 2OCGA 5CMLA 3O4JA 5EHQA 2BKLA 5HF5A 4QZVA 2QOEA 1Y7HA 1PFQA 4BBZA 3BF8A 1Q0ZA 3H04A 1YCDA 1BCSA 3DS8A 2QXTA 4F0JA 2QUAA 4N5HX 5HZGA 4UHEA 3YASA 1JKMA 5EGNA 1IUOA 3D5EA 1QZ3A 1G66A 2C5GA 3Q0TA 3FNBA 4U2GA 3PUHA 5EHNA 4KRYA 3EIOA 1XRRA 1UK6A 2XE4A 4HXEB 4P08A 2XMDA 5IVHA 4OYYA 3DL4A 3R3WA 1EA5A 1XRQA 2XQIA 4HAIA 5A7HA 5HFAA 3ICVA 2OLEA 3WL7A 3AFIA 1N1MA 2PU7A 1U2EA 2RAUA 3MUOA 4V2IA 2ACKA 2VJCA 2VSQA 3B5EA 3PUIA 3DOHA 1AGYA 1CV2A 3WL5A 2BFNA 2DFPA 1AMNA 3STTA 2J3DA 3VXKA 2X76A 4JH0A 4WCVA 4NZZA 4KE8A 2QMQA 2WUDA 3QM1A 4EY6A 1H2YA 2PX6A 1GKLA 5K3AA 2W6CX 4QNNA 1FFDA 5EFZA 1JU3A 3G9UA 3AILA 1AZWA 4UBNA 4L9AA 4IH4A 5HKAA 5H3HA 2PM8A 4B9AA 4QEKA 4LKOA 3G02A 1CUSA 4S0XA 1E8DA 2PU5A 4ARAA 1IMJA 4HS9A 2W22A 1YA8A 3WZMA 5KWIA 1C7JA 4XJVA 2P8SA 3I6MA 1QJ4A 1LNSA 4Y2XA 1R88A 1DINA 3DOIA 5K3CA 5JALA 4L72A 2J4FA 2JGLA 2QS9A 3D0KA 1CUHA 2CEKA 2XMZA 4C01A 3SC2A 5CT9A 1E66A 1XZJA 4DNFA 4BP8A 2WQZA 3HEAA 3LLCA 2XUQA 3C6ZA 4UBMA 4YX9A 1SCKA 2HU5A 3AIMA 3O95A 3NOXA 1F8UA 5AKHA 3WK8A 1QTRA 1E8MA 3SX4A 4J0JA 5T4FA 4XWGA 3PF8A 4QWWA 2CBGA 1RWQA 4BVJA 3HC7A 3DCNA 2ACEA 3T4UA
chains in the Genus database with same CATH superfamily
2ZAYA 2JFYA 2W6ZA 3V32A 4YQFA 4KN9S 1A9PA 4C21A 3I5XA 1W36C 4YJHA 1GPKA 4ZYXA 2ATCA 4LDJA 3ZIDA 4C20A 4V0QA 5KCZA 3AP3A 4QDUA 1DG1G 5ARCA 3W06A 4C7KA 1Q16A 1QIDA 4MW6A 3VVBA 1W48A 1QF9A 3P9NA 1JG1A 1I4DD 1PV1A 2V3WA 3BMNB 1WW3A 4WLFA 3PSAA 3R8XA 3EQ8A 5AVWA 1AKYA 1XQ1A 3FR7A 2O59A 1D5CA 1RPTA 5KJ6A 3NRCA 5FPYA 3B1YA 4HQ6A 1XR3A 3ACCA 3JYLA 2A1TS 1GZHB 2EFJA 2NT4A 4IEFB 4BJ1A 1COWA 4TKUB 2QP9X 1JFSA 2UXBB 2QD2A 3HCWA 3BD8A 2GZ2A 1BXZA 2H0RA 4MCIA 4NDAA 5KVQA 1BH2A 4CMEC 4DF3A 2PH7A 1JA1A 3QLTA 1KQOA 1X7WA 2CE7A 2QTHA 3MT7A 3UGQA 2C96A 2VSNA 4RJKA 3AFGA 2G7MC 5GVSA 1IN6A 3F2VA 2IBTA 2YVUA 4D92A 3ISVA 1F8XA 2ODQA 4KQFA 3B9QA 1MRNA 1C2TA 3COYA 3CVVA 2D59A 4IDEA 4OX9Y 5JG7A 3C15C 4R16A 2REBA 2J3EA 1NT4A 2A1UB 5ALVA 3FIUA 3HADA 4ZDJA 5ILOA 3N3AC 3NBMA 3BWCA 4IHJF 2BEWB 4X92A 1I4OA 4JQCA 3GNQA 2GTPA 2ILVA 1K3FA 1GYRA 2Y1FA 3B3FA 1G18A 3VHXB 2CF6A 3EQ9A 4M99A 2R8PA 5FUBA 3I64A 1XKXA 2QMHA 5CCEA 3P2KA 2YYSA 3DOJA 1WZIA 3L7DA 2EP5A 3C4VA 3DKKA 4J0IA 3UGJA 3RYFB 3P9RA 1GKUB 2XF2A 1G64A 4DNPA 4BMXA 2JGRA 1VDMA 1YMUA 2C9OA 1TUBB 2NO0A 3GJ6A 3KOXA 3PZRA 1MKYA 1RC8A 1GL7A 1N8KA 2HMTA 2JCGA 2QX4A 4FPXA 4P32A 5AM1A 3UXMA 3TSYA 1UJMA 2EWVA 5CLHA 4R8KA 1KETA 2VRWA 4C88A 3VZBA 1QVAA 3Q2IA 4ND3A 1BO6A 2DLDA 3F1KA 3QU4A 4OLHA 2H9IA 2WILA 4RENA 5C81A 1BWPA 4OGFA 3CKMA 1OX6A 3I9OA 1NGSA 3N6RA 4LBYA 3LCMA 4Q7EA 1W49A 4RMJA 3T9BA 1XZMA 3ZHZA 4DEVA 4DR1B 2CLSA 2JIZA 5G53C 2WF7A 2VATA 2XUDA 3LQYA 1WR8A 3SQMA 4L07A 1XJ0A 3WBKA 3EIUA 4QSMA 4DWWA 4L74A 4BWVA 5AKGA 2R6CA 3VUEA 3I4FA 5BXQC 1OLXB 4UCQA 3O2NA 7GPBA 3HGTA 1EFKA 2YWBA 1XE3A 1MMFB 1XAIA 1Y3FE 3QPVA 1ZONA 3CZCA 3QKRB 4HLCA 5K03A 3MNFA 1UBKS 3X1ZA 4JMPA 2PY6A 1XN1A 4DM7A 1W4ZA 1EM8A 5JJKA 5CIWA 1SCIA 5K3FB 5CA1B 5GIPE 3W2TA 3HEBA 5IVPA 4FEEA 3C39A 2HPAA 2O1WA 1MJ5A 5H59A 1YQWA 3U3KA 4D0LB 2JVKA 5HRUA 1WA5A 3AIKA 2OHGA 4NG4A 4U6SA 1R50A 1RRFA 2B82A 3D4BA 2X4IA 4EQ6B 2EW2A 5T4EA 3TGWA 4BFWA 4CRWB 2H4JA 2XE7A 3QVMA 3GH3A 2GFQA 2F1JA 1NJ1A 3BE4A 4BMSA 3W4JA 1Z7GA 3A25A 4S05A 2IYNA 1PGPA 4F71A 2JAHA 1LSOA 2NPOA 2WMYA 3KZNA 1TJYA 4GDMA 3BL8A 4GOKA 2C5FA 4RZUA 5HQJA 1LPBB 2CJPA 4N0QA 2FR8A 3WIUA 4RNCA 3IOYA 3OHMA 2YRFA 1L7QA 4M9CA 1UFOA 4QG7A 4UU8A 1NX9A 2E4AA 3HCDA 1YR8A 3M2TA 3WNVA 2R65A 4N48A 3N74A 1LSSA 2RHTA 1MG0A 1Y1SA 3A6ZA 4HNVA 3G8YA 2G9NA 1GQ2A 1WUTA 3AF0A 1JPVA 2J08A 5L45A 2ZS9A 2C2WA 2P9QA 3HRIA 3S68A 1KJ8A 1GDHA 3A6GA 4ENVA 1I36A 1E5XA 5JZ9A 3R7FA 3GEDA 1F3LA 1IBRA 3IUEA 4RVCA 3NGXA 3ANTA 3GA7A 4K2HA 4I66A 3VX3A 1NF3A 3N2IA 3IR5A 5F5LA 3HLYA 3T1OA 5HTOA 1DMRA 3KNZA 2JPDA 4XE5A 5DNAA 4Z4FA 5CFZA 4RO0A 1AQJA 5FI3A 3AZQA 4S1TA 5LSAA 4O25A 2C9BA 1FQOA 3ITNA 1FNCA 2I5PO 2V5UA 3AUUA 2DFDA 3BZBA 4JWTA 1HG0A 4QBFA 4KQJA 5JVDB 5LP6C 4OI4A 3WI7A 3X1MA 2VT7A 1G9XA 4BC1A 5ADUS 1UK9A 2NSYA 3PPVA 5F33A 3H1BA 2OGSA 1NZJA 5LZ5A 3IMGA 4KTVE 2CL5A 2E21A 1G2OA 2GM5A 4CDMA 1P4AA 3GRFA 6AT1A 5ESRA 1QU3A 1RHRA 2AFIE 4R1UA 2CMGA 3EFEA 3CPEA 2EC5A 3GGJA 2XNDA 4A4DA 1LC0A 5CDYA 1OZ0A 1LDBA 2P0YA 3IMEA 3WL4A 5NULA 1BKYA 3D4OA 3URMA 1W85A 5JS1A 4FN5A 1OXSC 4YRPA 3W5UA 5AXAA 1GSHA 2A0FA 1Q0UA 1ZIYA 1TO2E 5DHSA 4WNIA 3QFHA 4JYMA 3VPAA 1T0HB 3P9YA 1JDSA 3LDFA 5EKDA 4DC9A 4ARZB 3GI1A 4EJMA 4BY9E 3KKZA 1Y6RA 2PKWA 3N05A 2V4UA 4Y9UA 1UJNA 3D2BA 3OPYA 5CPBA 1JIKA 4JI1B 4E1AA 4RK7A 2YBEA 5KAMA 3W6OA 5C4MA 4QELA 3UY4A 4Z0TA 1KQPA 1R6TA 1O6FA 2CHQA 1K6IA 3Q6MA 4U9HS 3TMYA 3L4SO 2VEDA 5HUHA 4YBRA 4DDVA 3GYBA 4FDLA 5CBPB 2O7NA 4KAJA 4PX2A 1KIFA 3A4VA 4FFMA 4PZYA 5K20A 4WLNA 1NBHA 1QP7A 2NZ8A 4F91B 1NVWQ 3I2YX 4DNOA 1KFJB 4NV0A 1X70A 3PE4A 1WXWA 1FJXA 1OZHA 1U2GC 1W7AA 1YQDA 2BFCA 4EZBA 4OQXA 1E2PA 1IEQA 1WP4A 3AH8A 4JB0A 4M1EA 4QDKA 4RU1A 5TDHA 2EJTA 2ID9A 3JXEA 2FWAA 3PEVA 2C0CA 4R9NA 5BSEA 2VF4X 1RQ2A 1SR8A 3VC1A 1C1DB 1GNRA 3E2MA 2GZHA 2X5KO 2VNHA 1CIPA 1GV0A 2JIDA 2YN4A 1N2XA 1P9RA 2YNMA 3E22A 1UK8A 3F6PA 4W8HA 5F73A 2BTQB 2RAVA 4TS4A 4Z6KA 3PX3A 3ZJ4A 4F93B 5ICEA 3AI7A 2C5EA 3DB1A 1YUNA 2JGIA 4H7HA 1VCIA 2GCGA 5DX1A 5IM5A 1DAEA 3EASA 1UBFA 1V5FA 1IEVA 2G1UA 2Y67A 4PLZA 2B8WA 1GRNA 4B43A 2RB5A 3PEYA 3EVAA 2OWEA 4FYMA 5J5VA 3UFXA 5C4IA 4AQ7A 2C97A 1CSEE 2JFBA 2QUJA 4B7XA 3EVBA 4HUQA 4GZ5A 4EKYA 2BFBB 5AKEA 4ZU3A 4REQB 2FUCA 2BI7A 3FVWA 1X1QA 2ZIAA 4KDEA 2PSDA 3C7AA 4RE5A 2NO4A 1ZXLA 2VQEB 2WJYA 1V8ZA 3JQAA 3K4QA 5I9BA 2HRBA 4ALIA 2ZITA 2X9LA 4UPEA 1NXQA 3F6EX 5TEVA 3TB4A 4F7DA 4J6EA 5EXSA 3JWPA 3DSRA 2QKYA 4AJEA 4O4JA 4J2TA 3L7JA 4AICA 1OAAA 4R51A 5KI6A 2IXGA 4M6WA 1MFPA 2V9CA 2R5NA 5ENDA 2O20A 3NC1C 5KINB 3WLLA 3A37A 4LJ6A 5E6SB 5F7JA 5DTIA 4EUSA 1A8SA 4PG4A 4QL3A 3OMXA 4BDTA 4ZZ0A 2D2EA 1DOHA 4EPTA 4RGBA 5CXQA 1MAVA 3AXTA 1B93A 4MMXB 2LIPA 5DI3B 4AUNA 5FBVB 1HXHA 2FFRA 2WJJA 4G4SP 4L5BA 3FDFA 2GAOA 3I04A 3RIXA 4TM8A 1P7YA 2QB5A 1L5ZA 4PNPA 4UMDA 4RTOA 3HB4X 4RIHA 1ZD9A 1PT5A 4BRZA 4AJ1A 2EKLA 2WM9B 2HXSA 1L7XA 1O2DA 3HVRA 1T5DX 2D1SA 4KQCA 2ZE7A 3KR0A 3QEKA 4GRAA 1LPMA 2Q2NA 3VMFA 1R15A 1IL0A 1Z6XA 2C9ZA 1MABA 2P41A 3OU2A 5DWQA 4BMDA 1QBKC 4AF7A 2ONYA 3FMGA 4MEBA 4HH1A 4NENA 5CDHA 3BL6A 3D81A 5KDDA 3Q2KA 2IHKA 1PGNA 1YE3A 4G56A 3UENA 2AOTA 2TMGA 4RPCA 1E1KA 4QUIA 3GB9A 3KETA 2O8CA 2AXPA 5AVTA 3W5HA 4EB8A 1E0DA 2GKGA 2BR3A 3ZIAA 1LLCA 2BRUA 4E3WA 1OC4A 1PO7A 4MRAA 3HL4A 3NORA 3QWAA 5IDYA 4K9OA 3PXCX 2OYSA 2AQIA 2GDZA 1GR0A 1JT2A 3C8MA 4PO9A 1R8JA 2JIMA 5LL6P 2ZS8A 1TM1E 1XDZA 1ULZA 2HWUA 3BXHA 5ALFA 2OQVA 5ED4A 3E9DA 3ZC3A 4TWAA 2XKKA 2FW1A 4O3FA 2PZLA 4YJFA 1NZFA 3RF7A 3KDAA 1KH2A 1H9BA 4L3VA 3GFQA 1K86A 1R4MA 2QV7A 1G8YA 4HO1X 3R7NA 4CKBA 3VTKA 1F6BA 3GPCA 4FZVA 3KTDA 1Z3IX 3OJLA 5JW6A 4F6CA 4MDFA 4QYIB 5TPWA 2AWOA 1D7OA 4A0GA 4AKEA 4N49A 1TAGA 1M1NA 1QQ6A 1TX4B 4ZPXA 3L8DA 4CTOA 4ZEVA 5B1HA 4CCWA 4IINA 3FCSB 3CIOA 2FEKA 4YJ3B 4JITA 1YONA 1KJIA 2CKDA 3M70A 1MO2A 2R60A 1EEHA 1AIPA 2UZ3A 1TTPB 1KAMA 3AWIA 3OPYI 3WKEA 3OPMA 2ECQA 1SB9A 4R68A 3FJ1A 4F1JA 4QRDA 3MCTA 3OTWA 4C14A 1NXWA 1ZP6A 2C82A 3CC8A 4FTWA 1Q3KA 5FA8A 4DVGA 2HAEA 3R20A 5EYPB 3GJRA 4HDAA 4TM7A 4JP1A 5H5JA 3IA7A 2GCNA 2PLFA 1RI2A 3D1JA 3MJEA 4UKDA 5ABPA 3OQIA 3LKDA 1CEQA 3ETJA 2HGSA 5CR9A 3RVSA 3EMBA 1T6ZA 2OECA 5KQMA 1DKOA 1BS1A 5EMLA 3A6PC 3KT0A 4J91A 5AYVA 5HFJA 5HP4A 4HDKB 1PW5A 3BRQA 4JVOA 4G67A 4JKOA 3R5FA 3WHPA 3Q3HA 2HZ7A 3JVVA 3L0PA 4E13A 4NZPA 5K8TA 2VQDA 4IGIA 1QDUA 4Q03A 1BDIA 2AKEA 1FFCA 2DULA 1ZD4A 4FYHA 1V45E 2RGEA 2VUSA 3KZVA 4KEAA 4XXHA 2I62A 4DUPA 2QGNA 3FTFA 2XRMA 1XZFA 3FCOA 1FNNA 5JATA 3ZY5A 4GDFA 4DLVA 1ZVVA 1LBEA 1O58A 3AKCA 3GCGA 3SMQA 3MJSA 2Q4OA 3FM9A 1PR2A 2HC9A 1SXJA 3I23A 4J2HA 3T94A 3UV7A 5KJ1A 3QW2A 3EPLA 2QUZA 2HRZA 1W0KD 2I7CA 3VZDA 4AJOA 2VJQA 4E51A 4D6YA 1GGEA 2UYYA 2ZR9A 4KSYA 3KXPA 2GD0A 1RS0A 2GLTA 2P62A 4GUAA 4U7TB 4PX9A 2XW6A 2XD4A 1V95A 1CVLA 1WOMA 3Q12A 4M0PA 4M8NE 3GUUA 3L0BA 2R4QA 4DGSA 4YAGA 5LOVF 4M0MA 4G1MB 2VDUE 3VC7A 1G21A 4IHQA 4WZAB 5BPFA 4B3IA 1GRQA 3AIOA 1XZAA 2BCEA 3S2SA 3VU3A 1SHTX 1I6WA 1SA0B 2DFVA 1TYCA 2QPTA 4WSOA 4ZVRA 4ARVA 1ANKA 3CUWA 3QELB 1WUYA 4MYUA 3GZ4A 1TYDE 3SXUB 4ZHSA 1SKUA 1QOQB 3MJVA 5LC1A 4NE7A 4IFTA 1E1CA 2HDOA 4DC1A 3MOGA 5TE9A 1E77A 3PVZA 1DZIA 1WL8A 1Y5LA 4DLBA 5BV7A 3AHCA 1T8YA 3NBYC 1U80A 3K8ZA 2BFOA 5D5QA 2DM6A 1X6VA 3NTOA 3QFRA 3UJBA 1HDEA 1QGDA 3R5JA 3KVVA 4B4OA 4MOWA 2Q2WA 4XWAA 2SHKA 4CR8A 4HSEA 1P0QA 3PNOA 4RDXA 3WB2A 1N57A 2B7CA 4RGQA 3ZZNA 3ZDDA 4Q9HA 2H7YA 2AZ4A 1GUDA 2H54A 5E4FA 5FBWB 3KELA 2V54A 3TZEA 1J1ZA 1EX6A 1ZN2A 1I30A 2H4YA 4IHJA 4RXUA 3ASZA 2Q8NA 2RKOA 1U5CA 3LBIA 2JAQA 4JBWA 4G84A 1SHKA 4P0QB 4LNUB 4DT1B 1YL6A 1PJZA 4FM9A 4NJMA 5LFAA 1RBZA 3JATB 5GMOA 4Q93A 1USVA 3IPCA 4QUDA 5ALXA 3LJKA 1D04A 1WY7A 2V45A 1SULA 3G2NA 3THWB 3UV3A 2GN0A 4L57A 1QX3A 2G77B 3JQ7B 1J2YA 4NVRA 5BN5A 1M1UA 1OFUX 2GEBA 3MJFA 3OCUA 2W4QA 3LA8A 2A1TR 4DTCA 1FCJA 1FX0A 3CYFA 3WA6A 1SVWA 2BGMA 2Y92A 3A11A 4E12A 1YF3A 4JOCA 2A5DA 1RJ9B 2IF2A 2P4EA 3CZ4A 5E1OA 3OA0A 2PLNA 2WSSA 4A3SA 3A26A 3ONVA 1I24A 3SIPA 1BU8A 4ACAA 4RDIA 1OCEA 1U99A 4KVZA 2RHLA 1CPYA 1JG3A 3BAFA 3DKIA 4G5GA 3V5NA 5JVDF 2QZPA 2FEOA 5JY6A 4TWBA 1MQ8B 2FEPA 2ZPTX 1K63A 3TRDA 1J8FA 1I0LA 4MTCA 4Y6RA 2W93A 2AC4A 4LRUA 3EARA 3SNHA 3TFWA 5JT1A 3LI2A 4HDQB 3O8DA 1AKMA 1JVNA 4Y67A 2ARKA 4BNTA 3LUGA 2B34A 2ZRAA 4GKVA 2PBLA 3CF4G 2HK8A 3OJEA 4H0NA 4QBIA 3RJTA 1WXIA 2ZYUX 4GR9A 1KKMA 1ABBA 2YC4C 3AKZA 4RTQA 5AK0A 1WNTA 4JLSA 2VR1A 1BMQA 3SVLA 1G8MA 1YCGA 4KXUA 4PPQA 3AJRA 3GQVA 4ETIA 1Q1GA 1H1TA 3NPAA 5CYGA 2G28A 4ZYVA 4IS3A 5D01A 2AYXA 1U04A 3A1DA 1HURA 3AFHA 3Q3CA 4LSWA 1P6UA 4BBAA 4YMIA 4DCUA 1KDRA 4JI2B 1V8DA 3Q1LA 1E3SA 1RD4A 3B3QA 3HUUA 2BEVA 3HDQA 4TTJA 3WBBA 1R66A 4K0RA 2C2OA 5DULA 4RULA 4MK4A 5F1KA 2UZ4A 2TRSB 1NU6A 3P9PA 4RH0A 3OCVA 1CUAA 3R4VA 4L28A 4TKVA 2HSEA 3WYDA 2F8LA 1KJZA 1Y0BA 1OA0A 2WWRA 3KP1A 4ALJA 3NMUF 1YRHA 1L5HA 3V1TC 1MU0A 3A10A 3OX4A 4A16A 2VPZA 1RLJA 3IRVA 4IMIB 4YS6A 5J2TB 3NTUA 4OFZA 1ZBDA 2O4UX 2QTZA 4MVJD 3VR5D 4MVJG 4EATA 3P97A 4MW7A 1W19A 1A9XA 2A92A 4UAVA 3KT6A 4GVPA 2KLHA 3DO6A 1EM6A 1YZ3A 1GFSA 4X00A 4ND2A 5G2OA 2PZ8A 3RS5A 4ZHQB 3H3JA 7MDHA 1T4GA 5IJXA 2GKSA 4ENWA 1J2RA 2I22A 5G3ZA 4RNDB 3FYUC 1WVGA 3N2ZB 1N92A 2BKUA 1DHRA 4AG6A 1RYBA 1HMPA 2QE7A 3O8LA 5A0TA 5C1PA 4EKGA 3C6YA 2VTDA 4UVEA 4E2XA 2QAGA 4D79A 5KAPA 4DLAA 4QTYA 3LWDA 1OLUA 4Y7CA 3G8BA 1MG5A 4XIGS 4Y1GA 1MPTA 4JEUA 1DIRA 3TFQA 1PZNA 4XWTA 5AW9A 1UADA 1KC1A 3PUVA 3WLRA 4AFNA 4C0XA 1LGYA 1DXQA 1DI0A 3DWGA 3JYHA 4A6XA 4HVCA 4HS4A 4C0AC 1XMQB 4YB8A 1O57A 2RBKA 3IAFA 2PFSA 1NQTA 3K7EA 3NALA 3WGTA 4AS3A 4QBKA 2D4HA 2W43A 1VLHA 4DA4A 4A9AA 4KVGA 1KK3A 2PSHA 2BBWA 1Y98A 2QT0A 3IERA 2Y99A 4G1EB 4OKNA 4R2KA 4WBXC 5E0OA 5IZCA 4DV6B 3C3DA 4J4TA 5B6JA 1NC1A 1Q2UA 1JNXX 2OZKA 4MGKR 3ZWWA 4UQPA 2PJRA 4GGPA 2WKRA 4ANFA 3E3NA 4XCQA 4ARSA 2I76A 1P3DA 4LGVA 5CA0F 2IXTA 1D2AA 4MRSA 1SCAA 2VDKB 1JFRA 4PTYA 3L7BA 3PGXA 4YBZA 2NVUB 1JDUA 2FW7A 3EGXA 2CJWA 3SYRA 1JSLA 3MWEA 1BYUA 1UWCA 1J39A 2Z95A 3LRPA 4I19A 1TYZA 5ALMA 2E55A 1OFHA 1PTKA 1N9ZA 4K87A 4MVJH 3VR5H 1VI6A 1M74A 1SUSA 3IULA 3T5DA 4WOBA 3K70D 2ZPAA 5A04A 1XRLA 1JUDA 1QFSA 3G8AA 4BKOA 3I5YA 1N2GA 3GCXA 1ZSNA 4BQOA 2AK3A 3UANA 5EJ9A 4JJ4A 2AEEA 4RHUA 4NV1A 1EWKA 3NHKA 1Q11A 2H2GA 2JFQA 4PGFA 4GX5A 3V80A 2DLNA 2F9LA 4WK4B 4LYYA 5I7UA 4WGGA 1I51A 2I7DA 1Y9DA 3CNHA 1KH3A 4GLBA 3M6XA 2JBHA 1X92A 3N59A 3OT4A 4EFMA 5SYMA 1SBHA 4AY2A 2ZYHA 2DUJA 3DMDA 1E3WA 1ST2A 2ZKLA 3S2GA 3HHPA 5EPEA 2IS1A 1IN7A 1LXCA 1A8HA 1DRKA 3VSDA 1GCAA 2ROQA 4M1QA 4MRMA 4DDHA 2DUUA 1XZEA 2I3BA 3GGOA 1PF7E 4ZO6A 3U7RA 3UYKA 1OA1A 1JWAB 3HGQA 1Y5NA 4LGYA 4O4HB 5CFQA 3VPSA 4JUCA 1IVYA 3VNQA 2VQSA 1SMKA 3RJMA 4B4DA 3I32A 1D2HA 5H81A 3LH5A 4WERA 2GO7A 3ZVMA 1ODFA 3COPA 2H5IA 2ZBFA 2QRUA 1BXGB 1YBFA 2AJBA 4RCZA 1GQRA 3U0BA 5HKKD 5K8UA 1YS2X 1EFAA 1OXUA 3ZH2A 4PG7A 1C81A 2H1RA 5F2OA 2FX3A 2IEAA 2GXUA 2AG5A 2J9XB 3CRNA 4DDWA 4CT4B 4KC0A 2W4IA 1Q7CA 3CR7A 2LGJA 1XZHA 4J1SA 3WDKA 4L5JA 4HAZA 1J22A 3T4PA 4OK6A 5EOVA 2G9ZA 3LS2A 3BN3A 5KCMA 3ADCA 1VP3A 3MRVA 1SIUA 1G5FA 3OEWA 3EPKA 4D96A 2BFEA 1K5HA 4BMVA 1RWWA 5DCYA 1A4RA 2JGNA 3ZCRA 1JHMA 1DWPA 4GL4A 4DA8A 3OF3A 2YZMA 5FJJA 1WDLA 3OLYA 1I1OA 1DIAA 4CTJA 3ZPXA 4BE4A 1V35A 3SU8A 2C5AA 1UJBA 4NEGA 3LYUA 3KUCA 3IAM6 1U28A 1ZAKA 3G82C 3VPBA 1YS9A 4WKOA 4D8UA 3ROPA 3TL2A 1CRQA 3ABQB 5CHEA 2C7VA 1UMCA 3FUCA 4NY1A 1BYIA 2PH5A 3NDJA 4F1KA 1JEAA 5FXMA 5CRIA 2ZU0C 1LBQA 3I6QA 4GRDA 1Y4UA 3CZMA 2BC9A 1CUZA 1QGOA 3ISTA 5I9IA 4DJJA 5DYYA 4ZGWA 1QO0A 1Q57A 2IZ0A 1O96B 2UYQA 2Z5VA 3BH6A 4YRFA 2HA4A 4KHZA 1YR6A 1KZ1A 3V4RA 3E9NA 5I45A 5DF1A 1SUDA 1J33A 1T36A 1XO1A 1JDJA 3KV1A 1M7GA 3OPYB 3P0IA 4AF8A 4V0KA 4MDEA 1YCFA 1YS6A 3K0CC 3H5LA 3KR2A 1TIPA 3PQ4A 1QGUA 2QN1A 4ESOA 1B14A 3GLFA 4QPNA 1TL7C 4ZO4A 2W37A 4DZZA 1WM1A 4BX2A 2H2IA 1AXRA 1O95D 2FOIA 3HKCB 3T06B 5GWXA 2AHRA 1ZHOA 3EY9A 4UHJA 4AURA 5PGMA 1KOLA 4DBVO 4EZEA 2BSQA 1FTYA 3VHLB 3RT1A 1A82A 2I9PA 2AN9A 3AB3A 3H65A 1P1FA 1YI0A 4XI9A 2FGKA 5EUMA 5FTKA 4FD2A 1OIWA 2Z5FA 4QHTA 3AI3A 5SYAA 1KDVA 4O4LB 3AVUA 3U1BA 1C1HA 1Z0UA 3GWGA 3JD3A 4EB3A 2NP7A 3S28A 1WXEA 2AE1A 1VHDA 3R0JA 2X0KA 4TV9F 4DEXA 1YZHA 2BH9A 3QJYA 2AFRA 1ZKDA 3E22B 4LVUA 5AP9A 4A5SA 1TZCA 2HSDA 3PC8C 3NR2A 5FLKA 3MTGA 2XCIA 1C1XA 2OFPA 3IP7A 4J0EA 4EGFA 1S9DA 1OJ7A 2QRVA 3EF3A 2R6FA 4B6FA 3TTVA 4R2IA 5DE3A 5LQSA 1IY1A 1K8QA 2A9FA 5AVYA 1RQLA 1JHXA 5T57A 4QPDA 1S3IA 3URKA 2QD3A 2V0NA 1C14A 4KRGA 4HUQB 2I71A 2XBUA 3ZCUA 3EXFB 4KV9A 1J5EB 4JSTA 4IICA 3S2ZA 1KDTA 4XRGA 4BE9A 3PFHA 2JRLA 2QTMA 3FMVA 4EHFA 1QMGA 3JQAB 4HDNA 3E8XA 4PZ0A 3WLHA 4C04A 2ZCUA 4EQZA 5L53A 4A2CA 2BP7A 2DH6A 4ZANA 4NF2A 4D8TA 1I9GA 4M7OA 3WB1A 1ZICA 2I1LA 4XTRA 2P9TA 1ADFA 2VJOA 3EDMA 1IBKB 2OP1A 2YMLA 4LSZA 2H08A 5JR3A 2IUEA 4YROA 4JYAB 3EBOA 2CCKA 3MWKA 4HG2A 4W9NC 3T7SA 5JQGA 3UAXA 2RC5A 4M6WB 4I4IA 3MINA 4D97A 2NAPA 5KYWB 3RRBA 2B69A 1XCOA 1QWSA 4LZWA 4DSZA 3VPDA 1W88A 3IILA 5BNTA 2GZMA 5IP5A 3UT5B 3ZCSA 3FPJA 3R76A 1XMVA 2AFHE 2ZI3A 2G67A 4TVSA 2Q5JA 1G6OA 2A7XA 2D1RA 2O4CA 3GT4A 4ZV9A 2HJGA 4BB5A 4MW0A 4QYMA 3SXJA 5E4TA 2AOUB 2HQBA 2X15A 3KEMA 3W5AA 4LYHA 1GPWB 5AK5A 2SCUA 1A04A 2XVXA 3D3NA 4LBWA 4RXMA 2C2KA 5DIFA 4JHXA 5AW1A 3RYHB 5CG2A 4UHDA 2IPOA 2ZYVX 3AUTA 3R7AA 4RLHA 1ZVKA 4LYJA 4DR4B 1E9EA 4N12A 3DFMA 1VLLA 2B4YA 1UMKA 4L8VA 3ICOA 5PNTA 2E6UX 5DK4A 4MTLA 1LQ2A 2RDMA 2XGOA 4XQGA 3WMGA 3NWJA 4NENB 4Q21A 3WGZA 7REQB 1E60A 2JIRA 3FPAA 4UARA 5FTJA 1MDBA 2A67A 4RZXA 1Z2DA 2Q0XA 4GYYA 3LUDA 1W47A 1N6LA 4RMIA 2BH2A 1XCGB 1U8ZA 1VYVA 5IKXA 3IAM1 3FIJA 2GLUA 3IB3A 4KIUA 4GM0A 4KSBA 4ZVUA 4BO2A 1XTTA 3OQOA 1H0HA 4WKBA 4AY5A 1MAAA 3Q7QA 2JEZA 2AMJA 2XRYA 3M4YA 1WCIA 5AT1A 1L7RA 5JDCA 5KJCA 2Z04A 2IE8A 2UVQA 1CNFA 1LX6A 4Q18A 3OJOA 4NH4A 2J5XA 1I7DA 4RS4A 4V0NA 2OK7A 5HIMA 5KHLB 1V11A 4NFLA 3I9NA 3I30X 3W79A 4D3YA 1MH1A 4I5IA 4N82A 3O7WA 3PHIA 1P5ZB 3HU5A 4P7JA 3HABA 1EDZA 4KOAA 4MDYA 4UU7A 2VP0A 3RVDA 2DVMA 1U3FA 3NH9A 2XZTA 2FHSA 1NBEA 2A4MA 1CTQA 1JQ3A 1NQUA 1QFYA 2C8KA 4FWIB 4LOKA 1R4MB 3VSEA 2X0IA 4B75A 3PUKA 3BXGA 1A4IA 4TS1A 4J29A 2ZS7A 4QA9A 4CKBB 2Z43A 5BSFA 3I09A 4EKNB 1T2AA 4OB6A 3EUAA 2JGFA 2KW5A 4ZOQI 4GEKA 3H2KA 1THTA 2B30A 5FQOA 3UJHA 1A77A 5FV4A 5TPWB 4F85A 3H1PA 3RM3A 4E33A 4LZLA 2EKBA 2WBLC 2IC5A 2WVHA 3A4MA 4WX2B 1M1NB 4Q4HB 4XVQA 3TRKA 4ZGGA 2HT1A 2C9CA 1COWD 4X1YA 2DTDA 3WJ2A 5A06A 1K27A 2HK7A 1TJ3A 2M32A 1WHSB 3IDQA 4D4LA 2W6MA 4RPKA 1QLHA 1T9GR 2GZ1A 1UBJS 4H1WA 1KJJA 3L4KA 3GMSA 3INNA 3R7WA 3WR5A 4ZHQF 3QKSA 1HPLA 3F6BX 5J4VA 1M6HA 2C99A 2IQ5A 3K0FB 1XALA 1P8JA 3AKYA 4YAEA 4YCAA 3QEOA 3VPCA 2J5QA 3SHTA 2GM3A 3Q85A 3AJDA 2HPZA 3KT8A 4ESHA 5C7IO 1HE8B 3W9YA 1GNPA 1FUKA 2GVNA 5HM8A 2AF3C 2ONZA 1BIFA 3ILVA 1EK2A 1Z83A 2Z83A 1DC3A 4RHCA 1P2DA 4ALLA 4J7CA 4AMZA 3S0JA 3CLVA 3L6OO 2QVXX 5C51B 2MMGA 2OBXA 3SZRA 4E09A 3ZWAA 2VBGA 3GXOA 4G41A 4YLYA 3WGIA 4ND8A 3THRA 2ODAA 4OQ4A 2P90A 1UH5A 2X0RA 1UEXC 2CCGA 2FOXA 1N2CB 1XPJA 5DGHA 2CUKA 4U39A 5HK8A 4ZVQA 2NU8A 2IU0A 2GBFA 2DPYA 4QLAA 1Z0JA 2JGAA 3LCCA 2B9VA 2XVZA 4KE6A 5J47A 1I8TA 2XQJA 4GVXA 5DOZA 3U7JA 4DYHA 3PHJA 5FR2A 1KWGA 1SXJB 2PS0A 3E1KA 4DBLC 3DZIA 4EPXA 4M8LA 1FTNA 2W2MA 2XSZD 2ZQYA 3PCTA 4ZALA 3V7YA 3VDMA 5C5EA 4PAMA 3PQFA 4ZT3A 3QLEA 1ADBA 4P5PA 3N2LA 1CB0A 1GXSB 1WDKA 2EU8A 3FNRA 2JIZD 4AMGA 4JEIA 1AXGA 1ODSA 3NU1A 5D3MA 3A9CA 1G5QA 3GVIA 4A8TA 3REQA 1G21B 3F9RA 4QG3A 4IR7A 1BW9B 1EJ2A 1GZ7A 1GTJ1 1II0A 2CC2A 2B5WA 2D2IA 2HL6A 2VPTA 4KCGA 4NECA 5FYDA 1LPAB 1F2TA 2VAXA 4M0UA 4OAQA 4OHKA 3ZCQA 2F2TA 1WCXA 4N3NA 4EHBA 4F3KA 4KODA 3FBGA 4JQZA 1CHDA 4MJ3A 2G4CA 5CAEA 1DBRA 4Q48A 1MX1A 2O52A 2XMQA 2AVDA 1T9DA 1XL0A 3FX2A 1GA4A 1GPUA 2LTAA 4ZPJA 2Q5EA 1DJOA 4EDHA 1HG1A 2OCYC 1WO8A 1GZ5A 2ZULA 3RIMA 1CUEA 4DGQA 1MT0A 3O4FA 1WOYA 3I5UA 3QPWA 4RLFA 3WSVA 1SJ9A 3I0NA 3RYCA 1R9GA 3V34A 3GBPA 1QLWA 2Q99A 3OOSA 3DE5X 3K2IA 5CUQA 1D07A 1HNNA 4TRMA 3W34A 4XFJA 1DE0A 3LT0A 1QYXA 3P0HA 1O94D 3QRWA 4M1SA 4KQKA 2YRXA 4X61A 2G5CA 1TO6A 2XV1A 5AJYA 1YBAA 1Q2XA 1NNEA 4NJMB 3MJTA 5LIPA 2UUCB 1N9KA 4MLZA 1Q12A 3UK0A 4D02A 3P26A 1YDHA 3WK9A 2YX1A 4TZTA 3RRFA 4QO7A 1N5RA 2QLMA 2XUZA 4G5YA 3A4NA 4NBSA 3K6RA 2H7CA 3QPAA 3PLNA 3BWDD 1M1YE 4G86A 4O0MA 4P3OA 3KQLA 3O1JC 1A50B 1YRWA 3DB2A 1XLWA 1A5BB 3VO8A 1CY2A 2G9QA 3QMMA 3LT4A 4GP6A 2JFFA 3QNWA 4TWIA 3WWZA 1IXYA 4GW3A 1SG6A 1NRJB 1NBIA 2BL4A 4KQHA 2Q7OE 5LNK1 2ZFUA 3AR4A 1WXHA 4F6RB 1M0TA 1U3WA 1JEDA 1RPZA 1V1RB 1Y34E 2R6R1 4GWLA 5FBHA 3TPCA 2X0NA 1JFTA 3CNLA 3KXLA 5DH9A 4JK3A 4IIVA 4ZAGA 1CK4A 2EP8A 1WQ4A 1ZGBA 2FJPA 4HK4A 3SJCA 3L7OA 4ZK2A 3CN7A 5HRAA 3Q8WA 3VISA 1H2WA 1F4PA 3HJNA 3SX0A 1FNBA 3QMVA 3D0OA 4PFJA 5LJLA 2HNBA 3MELA 4G0XA 1U7TA 4GNKA 4QUHA 4RPIA 3PC6A 4RK6A 4CIBA 4WA7A 2PL5A 4X1IB 2NV6A 4H6XA 4FQ7A 3TLGB 2HA7A 3ZTYA 3KHTA 3VO2A 2OFFA 4E22A 7AT1A 5I9NA 3IAEA 2A1IA 5TIIA 2JW5A 4CI9A 5JASA 4DV3B 1L5OA 4MV8A 3OTGA 3NWPA 4DJDC 1LK5A 1Q44A 1ECFA 1SBTA 3TTXA 5CLJA 1EEXB 4FHDA 3AL3A 2C58A 3LCRA 1YV9A 1YJ8A 5KQLA 1A76A 2BZ0A 3K96A 2FZ5A 4KFSA 5JECA 9LDBA 2MSKA 1ZOPA 5FOSA 4EG6A 2WU1A 3CNBA 1CUYA 2X22A 2ORYA 3MJHA 4DAEA 4OBWA 2Z0MA 3T5BA 2W48A 2V0GA 1PI3A 4AJ2A 1U1CA 2IP2A 4PG5A 5C53B 3OO1A 1UZLA 3R5HA 4RA6B 1IPHA 4HWRA 4WXRA 3VX4A 1MP0A 1FXWA 2GK3A 2Q4DA 1QH9A 2W2TA 3ENWA 3GLRA 3RTEA 5CFLA 4HLDA 1B2LA 4BNWA 1MTOA 3NVMB 1PYOA 3OZRA 4TKVB 3Q3VA 1Q3HA 3QNUA 2HHJA 5B57C 2QPAA 5CLFA 4MYSA 3L92A 3N1UA 3FNIA 3TVYA 1OVGA 1PFYA 4CF3A 3ZZTA 4MI3A 3HWSA 2E4XA 4HGNA 5A71A 3JYNA 3L4BA 3SYMA 5LB4A 5AW7A 4NQZA 1O6GA 4RZQA 3BTOA 4UE6A 5FO1A 3ZYZA 3FSGD 3QMPA 1H5UA 1G5PA 4GLOA 1PG0A 3F67A 4C76A 4E5PA 1T0JB 1NMZA 2PYIA 3UMCA 1FBTA 3BJRA 1NDHA 2HSZA 3GJ7A 1X7GA 3TI9A 1IOZA 1FTQA 2FSVA 1VBMA 2PL1A 3R2JA 4CG1A 3R1IA 2YNMD 2VDOB 4QTXA 3ZGYA 1XZBA 2QAGB 4JGBA 1YT5A 5I7FA 1Q50A 2YN2A 5DN6A 1OLUB 1M6VA 3OURA 3K09C 2NIPA 5KVVA 4ITUA 4UNSA 4G1UC 3ZDCA 1O1YA 3A2LA 1Z08A 4XR4A 4KO8A 2Q3CA 4NBKA 2PDAA 1CP3A 3QIAA 4KGVA 2GPWA 1CQXA 1O5OA 2D1TA 3W6PA 4DW8A 1EX1A 4OLAA 3TUIC 5GONF 1OBHA 2I4TA 4ARBA 4DEYA 3GUHA 5HIAA 2O1EA 3SVZA 1P0CA 1FC0A 3INYA 5CU7A 1W2WB 2HWWA 4G81A 4FE3A 4UXIA 5LMNB 5KTSA 2PJDA 3GZNA 3VTFA 2L17A 2OV3A 2JEOA 4HNHA 5DNUA 3L8HA 1X0XA 4UAUA 3MS4A 3VAAA 1HLPA 1VLMA 4RVFA 3RB8A 2J31A 1OLSB 3EVCA 3O1IC 1YTLA 3RIYA 2PX0A 3KKEA 3P2MA 1JEQB 3ANMA 4AP5A 4B6OA 5CFOA 2X9NA 3ZHXA 3K4HA 1SUBA 3EFOA 5BYJA 2BELA 2F59A 2PKRA 2V7QD 1I80A 4GZMA 4EHDA 1E63A 3BFVA 3MFYA 4D25A 2I54A 3ROEA 1KZ4A 4U2KA 4JJKA 5AVVA 2WM8A 5ELXA 2MJLA 5IWAB 2QZZA 2H8KA 3BGDA 5HFNA 2P5YA 4RY2A 3M6AA 2Q9BA 1OWLA 2V65A 4N7BA 4C30A 4IIEA 5CIYA 3K9FC 1V47A 5BXYA 4HWGA 2VJAA 4E08A 1EK5A 4PWZA 3BA6A 4JBGA 3ZWXA 1CUWA 4YV0A 1HE4A 2BFPA 3IPLA 1O5TA 1X7XA 3BERA 4L4SA 4OSPA 1UM9A 1IHUA 1JYEA 5CM9C 4ZU1X 3AVYA 2OTCA 4P33A 1NYLA 1TZJA 1R0LA 4KXQA 4L2IA 2BHSA 2YJGA 3UUFA 4JROA 3R7DA 4S1PA 4DC0A 3JQ8B 2X7XA 821PA 4R1NA 1NVVR 5IAGA 4TV9A 4ZO9A 4CEJA 3W05A 2W8BB 4NBNA 8ABPA 4ARCA 2BW0A 3MWYW 1J1UA 3GWZA 4HYTA 3HVJA 4PXAA 1KVSA 4BB6A 4KDCA 2PGAA 1E9CA 3D3KA 3IESA 4JXKA 1DKNA 3ND7A 1ZUD1 2R2GA 2R9VA 4UCXA 4Z9XA 1GFIA 3E1SA 3LBHA 2D5BA 2ILTA 3U48A 4YN3A 3NWOA 1VA4A 4KDFA 2CMDA 3C5CA 3RDPA 2HB6A 3KYCB 4E11A 2QSUA 1FSZA 5G0VA 1ES9A 2YV2A 2A78A 1Z8HA 1XL1A 2C54A 3GBSA 3RUPA 1WHTA 3RABA 3FW1A 3EGIA 3GH1A 2CXUA 1NSFA 5CB4A 2ZYTX 3NIGB 1O97C 3MTAA 4ZVVA 1IFXA 3T3MB 1GITA 5LQKA 3OIFA 1JYFA 3H42B 3KXKA 4OLFA 1R0CA 4QYTA 4FHEA 2LDBA 3ZHCA 2R7NA 3GFBA 2HKIA 3EPJA 5T8KA 1D2RA 1UODA 4B0OA 2O19A 2RONA 1CY8A 3JYQA 1ZJ5A 5AKJA 5B7PA 1GEGA 4D4HA 2BFEB 4ACBA 1QE3A 4JKYA 4K9NA 4BRWA 4HV4A 1KEEA 1GNSA 4HNSA 4JX8A 3N0XA 4BJHB 3MHTA 3RGGA 1C50A 2WKSA 1EP9A 2EBFX 2HK9A 3N2YA 4JI5B 5C5DA 2FZGA 1E3QA 1LTHR 3R0QA 4MKGA 2Q3HA 2ZTUA 4TUYF 5L4LA 1W25A 4X90A 3THOA 3PD1A 1LCIA 3N2GA 4BQPA 3L0SA 3UHJA 4A10A 4Q4AB 2C04A 3E5MA 3BZWA 1CRZA 4CIWA 1IDOA 4R1TA 3WNBA 2VWGA 3TZ6A 1UMCB 2Z4TA 1PFWA 3NZEA 3UMMA 1F7VA 4IXNA 3TYXA 3B1VA 5TQ2A 4TWZA 3QYPA 2HJVA 4OKIA 4E4RA 1BXRB 1XTBA 2AMYA 4HTFB 4LTDA 4JXZA 2R5WA 3B7GA 5U1PA 4UOEA 2OENG 2OZEA 4NLLA 2PSJA 2J0SA 3FFXA 4A8HA 1OILA 3EUEA 1NR7A 5DBIA 5DHAA 1Z4MA 3H6HA 3UAYA 4G65A 4BAZA 2IEGA 4ODIA 5JH7F 2AUMA 5CFNA 2IHBA 4AB1A 1A72A 1T36B 4PANA 5DCUA 2FEXA 4KBYA 3AL2A 4AC9A 3EC7A 4DARA 4DKXA 2JD2A 3H0EA 1VGQA 1GN9A 4XARA 2HYDA 3PPXA 5DNYB 2FUKA 3ZXYA 1MOPA 2GF9A 4B82A 2ZRBA 4LV6A 4MIEA 4F6LA 2FWBA 1T34A 5EE5B 5EPUA 3DGFC 1EVJA 1Z2NX 4FZJA 5ICGA 1ADGA 3EJ6A 3F6CA 4P4LA 3JSAA 1NC3A 2VWQA 3MCAA 3RC7A 4GKBA 2R6ZA 2F3PA 3HSYA 4XGNA 3T3IA 2B1GA 4INAA 1H2FA 1P5HA 1ZGHA 4XKJA 1RQXA 4XQCA 5GTDA 4EL5A 3MAAC 3RAPR 2OCAA 1T5SA 2Z8ZA 2XUAA 5HMLA 2RG1A 1QJCA 3M4NA 2PUGA 1GJRA 3W6ZA 3ZE7A 4ABTA 2PGDA 2QRVB 2Y77A 2ATXA 2W8ZA 4KLCA 4CLOB 3C43A 2AUTA 2FI1A 4RIIA 2XOKD 4PO1A 4DQKA 5BUZA 1RLOA 3JD2A 3ZY2A 2XXAA 1XQVA 4ITRC 2PWZA 2V6FA 5IDQA 5KJFA 3AG5A 3VO9A 3QQ5A 2AZXA 3B1JA 5JNLA 1XRPA 2RFLA 3WA7A 2C8JA 1N8TA 3ANSA 5BN3A 5IM4F 1WTCA 2H59A 1UBUS 2X5XA 1B3RA 2DY1A 5GM2A 1BAPA 5CNMA 3ZGVA 1GG8A 3E5RA 3PHGA 4A0SA 1B23P 2FJ0A 3DZFA 3PPYA 3PHLA 4CKZA 2DCUA 5BUCA 4PN7A 3CGWA 2YXNA 5DLYA 3UO8B 1EVIA 2GSWA 3V1YA 3KQVA 3WO0A 2AXEA 1DBPA 5EQFA 3S2EA 2YL2A 3WJ7A 4Z3KA 4HWKA 2OLJA 5JALA 1UXIA 3PJDA 2BMVA 2Q0HA 3UB2A 1EI9A 4R1OA 4FC6A 2K87A 2X1MA 1R00A 3JU3A 4GPEA 4U5XA 1OOEA 3D4LA 1ZK1A 4WXMA 3R6LA 4G5QA 3DLBA 5HOQA 2E48A 3NXKA 3GNSA 1OYYA 1Z45A 3MK31 4KFTA 4UM5A 4WQMA 3I61A 1RR6A 1M34A 1VG1A 3BMQA 4H17A 4AECA 3PEWA 3ZDBA 2VCHA 2K5UA 2PTGA 4RH1A 4O33A 3ZE6A 4EW6A 4I81A 3ZWYA 3LUAA 3TQRA 2RAFA 3DDNA 3IUJA 4HNQA 1MFZA 3AR3A 5AK3A 4DANA 4P8RA 2Q0QA 2TECE 5FNVB 3CM0A 2AR7A 2I6FA 3I5MA 2UKDA 2MMCA 3D7MA 3OJWA 2RGNA 4MWCA 3LX8A 2SCUB 2XUHA 3OKFA 3CXUA 5ETJA 3PIDA 4RGYA 4IIYA 3THSA 1MDFA 1DLJA 3V7NA 2D2FA 2PQ6A 4BV3A 4H7KA 3KTAA 3ZLTA 4EHIA 4OUDA 1J2TA 2BMJA 4HZUB 2JAOA 5B4TA 3GJQA 3KKKA 5C8YF 1KP2A 1Y82A 2Y1LA 2Y2VA 4PO3X 4RLQA 5DCWA 4F8EA 4QTZA 1IBCA 4BNMA 5CVTA 5IABA 1WB5A 2BGNA 1AKNA 3DTVA 2H1SA 1N1DA 2B6HA 3LPMA 3EAQA 2ZZKA 1J99A 3IAXA 4QYSA 4YRNA 3R75A 2FETA 3WWPA 5A6VA 1SWVA 2XIJA 3KHSA 1G19A 1XZLA 2IUFA 1C7FA 1Z7EA 1X1SA 3I76A 4LTNA 1N7GA 5FJIA 4ATNA 4DHEA 1QBGA 721PA 4JI7B 2G9UA 2XZPA 3BXFA 5CHYA 3RJ5A 1KZ6A 2XKAA 2VDPB 2QE6A 3GNLA 5EINA 4IIDA 3OWHA 3HYSA 3WMXA 1V11B 3IEIA 3N8HA 1OI4A 3S8EA 2CNBA 4J3FA 2HRDA 4B76A 3G0OA 1FS4A 1GA1A 3FUUA 1CZRA 5YASA 2QI9F 4PQYA 4R0VA 1KO1A 5IFKA 1OGJA 2X1LA 1X7ZB 1ZL0A 3D8SA 1U5AA 3FHJA 3TEMA 5CCDA 3OZBA 3LHDA 3HFRA 3PWKA 2HT6A 2JLZA 2GNOA 2XNCA 3LWBA 1W4CA 4MQMA 5EXXA 4CM9A 3CN9A 4RQTA 4D5EA 4K86A 1CEYA 3AUFA 4JLOA 1T2CA 2FJUA 5DRTA 3RSQA 2B3TA 4EG5A 3O90A 2AFIA 1NFFA 2WU0A 1KP3A 4M2LA 3M6MD 3W1VA 1DKPA 2JLSA 5EJ6A 1LSUA 1OTXA 3KLPX 2ZGVA 4FGWA 5COBA 4YP6A 5FPSA 4LJ9A 1VJ5A 1F1BA 1P1BA 5IN4A 2HMYB 2Q5OA 1BX3A 1GVHA 3C1TA 2D3WA 4BN0A 5C7YA 1CKEA 4DM4A 2Y05A 1XA0A 5BRAA 1ZXBA 5A62A 2OFWA 5LUAA 1DO0A 4QULA 3ND5A 1E32A 4WE3A 3WGUA 1M2VA 3DQZA 2ZI9A 1AF7A 5DM1A 1YB4A 4G85A 3VR3A 3K16A 2FW9A 2HA6A 1K0UA 1KSFX 1Q7EA 3IKJA 4PPNA 3J81k 4S1OA 1NVDA 4KAXA 3VJKA 3A6LA 3W3ZB 4WCFB 3K2BA 3ZHBA 4ZCTA 5JXHA 4M86A 4F7WA 1XFDA 3KDSE 4KAAA 4QOEA 1T3HA 3ONNA 4QT4A 4EKIA 5BV1A 2DR3A 3B1WA 1GZ4A 3RK0A 5DLQC 3RH0A 4YRAA 5L6LB 3H2SA 5CURA 3WDLA 4AJIA 3SN6A 1W6RA 2VTBA 2LRHA 4N0MA 5DYTA 3RRZA 4DMUB 1S2MA 2KWIA 4JT2A 3BGVA 2DPLA 2P67A 4ER6A 2WMNB 4JBHA 2IF0A 2PZBA 2CVHA 3EOZA 4ZOLA 2NU8B 1MEOA 4EF5A 5BV0A 2XHZA 3MRSA 4N5MA 5I7EA 3AU9A 4BBJA 4Q16A 2AN5A 1ZQ1A 1NVFA 4HPWA 1RRGA 4CE6A 3GRPA 2JC3A 3AERA 2WY2D 4TZKA 3LHSA 5KO2A 1IQ0A 2VJNA 1DKMA 4PXYA 3X0DA 3K72B 4RQAA 5FADA 1VOTA 1K8ZB 4JUIA 1R2QA 4A03A 2OESA 2AZDA 2P6UA 1DJPA 2QIOA 5FL7A 5BORA 2C7GA 3KKLA 2JFHA 4MV1A 1G3MA 4BEJA 3GLTA 3DUWA 1PR5A 4MQ5A 4CLEA 1E98A 1I7PA 1MJNA 2JAUA 2O07A 5D3MB 4YXWD 1DQSA 2Q4EA 4IW3B 4MVYA 4D98A 2O05A 2RGAA 2PJZA 3ORQA 2ABWA 2A88A 3WGMA 5LLTA 3C6KA 1PZEA 1F2TB 2WAAA 3EEOA 3U4QA 3R6GA 4LZAA 2F17A 2QJRA 1BZYA 1DC5A 2IGTA 3DDCA 2NV2B 1IHXA 4FEAA 5CAEB 3L46A 4KFRA 3SOPA 1L8OA 2CL7X 4BGVA 1BJTA 1XSEA 4YRCA 2PMDA 5JS8A 1XCBA 2CZCA 2D06A 3PTLA 1SU4A 2FMFA 3PC2A 3CZQA 3IOCA 5BURA 5E95A 1PR6A 2FWRA 3DXYA 3H6GA 1HTTA 4DIKA 3HI6A 2WZBA 4WRRA 4D46A 3RRMA 1KC3A 5T67A 3RYCB 4W5TA 4NFYA 2WFMA 4HQNA 1WV1A 4M87A 4PGGA 2AYYA 4H4EA 2B37A 3FDXA 1P61B 3UWOA 2DTEA 1J7KA 1QPBA 1DQPA 1Q1ZA 1YIDA 1Z15A 4FX2A 4HNAA 1ZJYA 4QODA 5JAUA 3PKJA 3AVTA 1E8NA 3R0ZA 1KDYA 4G5FA 3B7WA 4IYJA 3QE3A 4KN6A 4OY3A 3G6WA 3VH2A 3G0GA 2GN4A 2A9KA 4QPPA 4ZYLA 1RYNA 5A0FA 1YJ5A 2EZ4A 2FPWA 5TY0A 2QGFA 2L69A 4FFSA 1J97A 1VECA 2PFGA 5AI4A 2FWPA 4WVFA 3CV3A 1F0KA 4MUEA 3WHKA 3KOZA 2WUWE 3TNJA 4AO7A 3LVFO 1UDRA 5DLDA 3GLGE 4EHAA 5GONA 1CY6A 1Z17A 1XI2A 5TVKA 1FUUA 2XEDA 3A4IA 3IDFA 3ORHA 3KV3O 4G89A 4JCCA 4II2A 3X3HA 5A6SA 2K7FA 4PC1A 3F4LA 3WYFA 4AKIA 1U2SA 3K9HA 1TVKA 3B3AA 4H35A 5CVJA 2ZW9A 4TMXA 3IQDB 3GRCA 1P1JA 1U8YA 3NBZC 4V24A 4MWEA 4PAWA 4B1FA 1OX4B 3CRMA 3U7HB 521PA 3EWSA 4EBFA 5LM3A 1QYRA 3I3SR 3MGKA 4RKYA 5TF0A 1IRIA 1U0BB 1AUOA 2AE2A 1Y6ZA 2V6IA 2XB4A 3C24A 3NTLA 1U7XA 3DFZA 5L8VA 4NCKA 3OQ1A 4KK3A 3ZD9A 2R8OA 3V7FA 4CXMA 5ALIA 1M6WA 1OBVA 4I55B 4W7HA 5FYQA 3EOAI 2E0IA 2A4KA 2QM8A 3GGPA 1RKVA 4JLWA 4D44A 3KFXA 1P1IA 1SZCA 1VL5A 5EWJA 5E7MA 2MWMA 3FE2A 4FOSA 2VAPA 1X15A 3AVOA 1EK6A 1SH7A 1ZQ9A 3L0DA 5EHGA 3F5FA 4PQEA 1PNVA 3EWIA 2W2VA 2WTNA 4WHMA 4LNHA 3PE6A 4ZYYA 3SYKA 4ID3A 2KJQA 4EI7A 1XTZA 2AJCA 1WSWA 1F8GA 3F8TA 2C7BA 4JLNA 3UKOA 3ZHOA 4D3FA 4F06A 4DR7B 1X2EA 3GZJA 4CQJA 2HU7A 3JSXA 4V2UA 1ZCJA 5AUNB 1P75A 5IEBA 3PNLA 5DNDA 1OMOA 1M3SA 2CNDA 4RTNA 2DUWA 2QL5A 1FFXB 2GEKA 2ZYWX 3QFFA 4FLFA 2RJNA 1XYYA 3FTPA 2JFOA 4KXYA 5IYZF 1E79A 2YUIA 3L01A 4KLRA 3UA4A 4N39A 3PTAA 5CDSA 3ZZUA 2XD9A 3GX1A 2IH2A 1SUCA 3AHEA 4DIMA 3ESQA 3EHDA 3W8EA 3QYJA 5D00A 3T5AA 4DCSA 1P0PA 2WNHA 1P9NA 2O8FA 3F8SA 5BVHB 3I92A 5JI2E 1ISSA 1KS9A 3SHVA 1IUKA 3OJXA 4I5EA 5KOJA 2B25A 1HE2A 1O9BA 1FX1A 3ML1A 4FI3C 4KYTA 4M98A 3KAKA 4UBKA 5G4LA 2NSLA 1S7GA 3R3HA 4J3NA 3TD9A 4LF4B 1PS0A 1NQWA 4G0YA 2DPHA 3FLBA 2QL6A 1ZK2A 4P34A 4AUEA 2J3IA 1M6VB 4O4IA 1E4EA 5JSHA 1FZTA 2J7PA 2HLPA 3FKSD 4ND1A 1GPJA 1Q0PA 3EAFA 1EG7A 1KYXA 1QUEA 3D2LA 4E4YA 1I0IA 4Q1VA 1B8PA 2ZR7A 3FI9A 2I4OA 3BDVA 2HO4A 3PDIB 3RC3A 3Q9UA 5JPIA 4LJLA 4TUYA 1C7EA 3VH3A 4C3ZA 4MYCA 4N8SA 2JNWA 5LA6A 2VPQA 4PRLA 2PGJA 1KMQA 2AG8A 2QUIA 1O9GA 3GZNB 3ISJA 3JQBA 4EMBA 5FLXA 2QMUA 2FZEA 4TQAA 2VDMB 3OQHA 4RJLA 2HHAA 4W6ZA 5UKDA 1E96A 1G7CA 1LBIA 1R6VA 3P0EA 3CLUD 4JB3A 4ND6A 4IV5A 4RA9B 3TZKA 2XZOA 5F35A 3HXOA 5FLEX 4RTRA 2I6TA 3TE7A 4HQFA 3EA0A 4OJNA 3Q72A 4CT0A 4MR7A 2V3VA 5CJJA 1L0BA 5BOSA 1EZ1A 3RANA 3VSCA 3H13A 3DZHA 2NQ8A 3GJZA 4O29A 3CU5A 3QV1A 1EXDA 2CFSA 1KK0A 3IHLA 5CXXA 2UZ1B 3H1TA 3KKQA 3WLIA 1NPDA 3IEKA 1GT6A 1LZLA 1B8VA 2YYZA 1G5RA 9ATCA 1FLAA 3TH5A 1TU3A 3WWDA 3AM3A 4PSDA 1N4DA 3NP9A 2LDXA 2GMWA 5KQGA 4R8VA 1WPQA 5JZBA 1YUBA 3RUHA 1H0KA 2RH5A 4CMJA 3AHJA 3PDHA 1QDLB 3H0KA 3PPWA 2FSGA 2VK2A 5G0UA 4C7OA 1G8JA 2BKEA 4EH1A 1K7YA 4UEJA 1JHAA 2I6XA 2I8LA 3IEUA 3KVOA 2NUAA 3TDNA 3SKVA 4YMTA 2B2NA 1V6SA 4OQDA 2GHRA 5KKNB 5IJZA 4MVJE 2OCXA 3FAKA 5IF3A 4H9GA 1A5SB 3M3HA 3VJLA 2B4TO 2DPGA 2D00A 5DYIA 1AZSC 3FGOA 3ABIA 1G8GA 2UYCA 3U3OA 2CHVA 1P1CA 2I2WA 3IVMA 1LS1A 4L4RA 4OREX 2AEFA 5BR8B 1YASA 4I4TA 2E3JA 3OC0A 4ER0A 4CLHA 5IANA 2WIGA 1O0SA 1MW9X 1WHTB 3C16C 1EVQA 2QTNA 4KQ2A 3A6HA 3MUNA 3KB8A 3NRJA 3KPUA 1NT2A 5IM4A 2Q3FA 2OO7A 3KQQA 1GCIA 5AESA 3QX3A 3TIVA 2QRPA 2IGBA 3I42A 2YCLA 2X7JA 3L1JA 4MJXA 3ROGA 3SZ3A 2PRZA 3CNOA 3H1FA 5EERA 3IP3A 3TNYA 1U0HC 3QHAA 1OI2A 4EARA 1GM5A 3LNCA 2IP1A 2ODBA 4TYYA 1MENA 1EFDN 1IG3A 1JZTA 1A1SA 4AD8A 5EHQA 4AXXA 1MO5A 1ADYA 3K1AA 4LS3A 1KEEB 4WESB 1VSVA 4EUNA 2V55B 3OP1A 4D45A 5GJCA 2J6HA 3QXHA 2P2CA 4FD3A 2PKCA 2OQ2A 4QUGA 5HF5A 3WVNA 4BO6A 4QZVA 4KJZA 4BBZA 2IYLD 3ZY6A 4ZCMA 4P4TA 4OTZA 1Q0ZA 2A9OA 1TNDA 1RZUA 1YCDA 2L19A 3N2GB 3DS8A 3ZQKA 2Z56A 3BULA 1TKCA 4F0JA 2WWIA 3KOWA 2BV3A 5DM0A 4QUBA 1KTIA 4HT3B 4PBSA 5TQ2B 5A4JA 1QP8A 2I2CA 3IB6A 1C30A 2PTHA 2VDNB 3JD4A 1W5AA 3TX6A 5FI1B 4OFBA 4KQXA 4BNKA 3AHFA 1SUIA 2XWBF 1IUOA 2F4VB 3D5EA 3LCVB 2QG6A 1XK7A 1F1JA 1XA3A 5EZYF 3H7AA 4BEBA 5HJ7A 3K6SB 2C5GA 4BTEA 4U2GA 5FBZA 3KE9A 2KPOA 4L7VA 2VZ0A 5EHNA 3SIXA 3OETA 1X3SA 2VYFA 5P8WA 4NWIA 4EFKA 4Q7JB 3IQGX 5EG5A 2XE4A 3SQLA 5C37A 5CFPA 3EUFA 4O02B 2XMDA 4V3BA 2Q9CA 4DV0B 3CQ9A 3SC2B 1D0SA 3UPDA 2DLCX 4P53A 1PZGA 2K2WA 1YE8A 1KBQA 3DL4A 3N07A 1KMMA 2F4NA 2XQIA 4HDMA 4PAQA 5I5GA 4HZIA 1Z5GA 4IIJA 2AD1A 1MJGA 3ICVA 4L9SA 2HJWA 1JKXA 1G5HA 2C1EA 5KSZA 1ZPDA 2BBOA 2C2HA 5M3BA 1X7DA 5IXJA 4MROA 1AA6A 3HDGA 2NV0A 4IIUA 3F3MA 4JV5B 2GB4A 2WB4A 2OHJA 1ZMTA 3M5WA 2WTXA 5HZKA 2XOEA 1X19A 2VJCA 4C7JA 4C0QC 3VV3A 3KSUA 5EFOA 3CFYA 4C7MA 3DOHA 1NBOA 3HZHA 1WD5A 4FXOA 2GNAA 3H84A 2BFNA 2DFPA 2R1ZA 3VO1A 3WL5A 1JSRA 2XWSA 3STTA 2PZFA 1FYVA 2J3DA 1BOFA 1PJTA 3CISA 1L4NA 1Z6YA 2BF7A 1IPFA 2RHCA 2W6IA 4P2BA 1Z6ZA 1ECGA 2EWWA 1OW3B 2P9JA 3EIFA 4G5RA 3OZXA 3UTCA 2X76A 3D3EA 4OIMA 2MU1A 4WCVA 3S7TA 3Q7SA 4CR7A 5HILA 2AX4A 5BN3B 4YRMA 4C0KA 1P2VA 2OSBA 2FZVA 1UMDA 2N75A 2WUDA 4YECA 3WQQA 1XNRB 4UZEA 3KYJB 3K0HA 2SECE 4WTOA 2IYWA 3PFWO 5TVGA 3RODA 4MDHA 2PX6A 1MB2A 2MOKA 4QRHA 4RADA 3VGJA 5C46F 2VZEA 1NRXA 2YWRA 3UK2A 1YJCA 4ZT7A 3W6UA 1GPDG 1DNPA 1I1QB 3DAFA 1E2MA 3FOAA 3GA5A 5A9SB 1W59A 1AZWA 1RTKA 2E1PA 3SZOA 4E1BA 1OE0A 3P71T 4OP1A 1RWMA 5EJMA 4P4UA 1XLTA 3TCXB 4L0MA 4MARA 4G36A 4POAA 4OEHA 4LKOA 4M8KA 4WK0B 3ROMA 5F23A 3C97A 1ZK3A 1RCUA 2NT3A 1E8DA 4JC5A 1K97A 2OL4A 3HXLA 1GAJA 1E5LA 3OZUA 4MMZB 4J9VA 3W1WA 4C4RA 1XTRA 1NHWA 3EW9A 3FWZA 3K73O 1QRRA 3M6UA 3VPGA 1R0ZA 1YA8A 1W5EA 1JQDA 5CG1A 5KWIA 1NMXA 3IMFA 4LI3X 4PG6A 2JLVA 2H8GA 2MTBA 5AD1A 2JHAA 3IQFA 1QJ4A 2BHLA 3QHQA 4N7JA 5IFLA 4N6OA 2G6TA 1LNSA 3SQXA 3GNTA 1D2GA 3AP2A 4L0DA 3GLIA 2XTMA 3NHJA 5GV7A 1Y7TA 1URPA 2P4HX 3COVA