3W06A

Crystal structure of arabidopsis thaliana dwarf14 like (atd14l)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
267
structure length
267
Chain Sequence
GVVEEAHNVKVIGSGEATIVLGHGFGTDQSVWKHLVPHLVDDYRVVLYDNMGAGTTNPDYFDFDRYSNLEGYSFDLIAILEDLKIESCIFVGHSVSAMIGVLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLAVGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQILPFVTVPCHILQSVKDLAVPVVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIRNDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, alpha/beta fold family protein
publication title Structures of D14 and D14L in the strigolactone and karrikin signaling pathways
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 100
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2012-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3w06A00
3EIOA 1MAAA 2HA5A 1UK6A 3FLBA 5JARA 1XZFA 4H7FA 2PKYX 2PX6A 3ZPXA 3VJLA 5LZ4A 1AMNA 2ZVDA 1TK3A 4FKBA 1CQZA 3CCBA 5A2GA 1UK8A 2WJ6A 5BV7A 1WPRA 1BEZA 1BU8A 2VJCA 5AK6A 1EA5A 2H7CA 4OB7A 3WL8A 1K63A 2QT9A 4KAAA 3G0IA 3ZLTA 4G5XA 4HZGA 1YA4A 5T4FA 5KBYA 4N8SA 4X95A 3WA6A 4J0KA 3O9VA 1TKRA 2CZQA 3H2GA 1CLEA 1MPXA 3SC2A 5CTAA 2OLEA 4L9AA 3GFFA 4L72A 4TVKA 4UHEA 4OB8A 4P92A 2DHCA 3C5WP 2XUKA 5HK8A 1E8MA 2PM8A 3DLTA 1A8UA 1Z68A 4BE4A 3C6XA 2H7YA 5C8XA 3O4HA 3STWA 5ALNA 1UK7A 4CFSA 1AX9A 3EBLA 3W05A 1DT3A 4PF1A 4BRZA 2HA6A 4UBMA 1H2WA 2H9YA 1WOMA 1ZGCA 1AQLA 3K9BA 1C4XA 3ILSA 1LPOA 5JATA 4BCBA 5FP0A 3Q8WA 1BRTA 2PSDA 3AIOA 3R3XA 3R41A 4QDOA 5K3DA 2VTVA 1U65A 3KSRA 1K4YA 2GYVA 4FMPA 2ZJ7A 3WK4A 2ROQA 3VJMA 1MAHA 2QJWA 3V9AA 1LLFA 1ZD4A 2WU3A 4BZWA 3IUMA 2J4CA 4BBZA 4DNFA 4Q3KA 2J3DA 5HF5A 4OD0A 5F4ZA 1R9NA 4LXIA 4AQDA 2QXTA 2DSNA 1DINA 5JADA 5KREA 1A8SA 3STTA 3RK4A 1QIFA 1UK9A 2GBCA 1XRQA 2XMCA 1K5PA 2DHDA 4M0MA 2XUFA 3I6MA 3ESBA 4BAUA 1WCYA 3AINA 2RHWA 3FBWA 1R4ZA 5D3ZA 2GBGA 3WJ2A 3E3AA 4H7DA 5CXUA 1H23A 1XZLA 2VEOA 1YS2X 1SCQA 4FNGA 2YYSA 2CBGA 2FX5A 1MX9A 1SCKA 1A7UA 5EIEA 3OTQA 2BAGA 3MVEA 5JYCA 4Y2VA 1Q83A 3DD5A 1LPSA 5IKXA 1QTIA 1BCSA 1QE3A 1CUFA 3HRHA 2QMQA 3TEJA 1CVLA 1BCRA 3G9XA 2VQ6A 1LPAB 1DT5A 3DNMA 1SFRA 1XZEA 1DX6A 1U2EA 2GYUA 5T4HA 1AGYA 2WHRA 4QDTA 5BWBA 2WJ3A 3B12A 4X00A 3DOIA 4GI1A 5AM1A 3I1IA 5AI4A 3WK8A 1MN6A 2HA0A 4BDTA 4WY8A 3NWOA 3FLAA 1VKHA 1THTA 1XRMA 3U0VA 2HL6A 2Z3ZA 4X92A 4CG2A 2WG1A 4B0OA 4BB0A 2RONA 1F6WA 3G8YA 1UKBA 4OSEA 4MJ3A 5HKAA 3WKEA 3ESAA 2PL5A 1GPNA 3PICA 2WG0A 5HZGA 1ETHA 4B9AA 4H0CA 1UOOA 4L0CA 5FPPA 2Y2UA 2BJHA 1ZD3A 1FFCA 4W1QA 5JAPA 1BE0A 4HRYA 4UHHA 5EHNA 3P2MA 2WUFA 3H2HA 5AK4A 4X93A 1J1IA 3ICWA 2B61A 1ZJ5A 2I3DA 4J3JA 3V1MA 2Y2VA 3K6KA 4C88A 4CIAA 3F96A 4BTLA 1C7JA 4DNQA 4GBGA 1W1IA 2VAXA 5CT8A 1EB9A 4K6HA 2WIFA 2G5TA 2RGUA 3FYUB 1OILA 2XMQA 2OCIA 4WDRA 1CUHA 5DYTA 1GXSA 4Q05A 3ANSA 1WPXA 4C6HA 2RI6A 4U2FA 4X6XA 1O6GA 4BAZA 4BP8A 1EB8A 2XMSA 3DS8A 4S0XA 4QE3A 3NGMA 1E8DA 4ZWNA 4WCVA 5AM0A 3VVLA 4ZREA 1QIJA 5ALRA 3OURA 4Q1VA 4FNMA 3V1LA 2XUIA 2FUKA 5IVIA 4WDQA 4X85A 3AZOA 1FJ2A 1QOZA 1CUGA 5I8PA 2BCEA 5ESRA 3Q0TA 5ALVA 3FVRA 5CT9A 4QNNA 3HXKA 4WFJA 5ALSA 4AO8A 3EQ8A 3I6YA 2HA4A 1YCDA 4Z49A 1VOTA 3D0KA 2YH2A 4J0DA 4ROTA 2WQZA 1B6GA 1H2XA 2PUHA 5ALYA 3DCNA 2OCGA 3R3YA 3H1AA 3L1JA 1HLGA 1B41A 2HA2A 3C5VA 2C4HA 3VISA 4E15A 4MEBA 4W1RA 3MGAA 4BVKA 5LP1A 2JGKA 5ALHA 5AHXA 3N2ZB 1CUBA 2BUBA 3BIWA 4A23A 1G5FA 4X91A 5SYNA 4J0JA 4EHBA 2CMFA 4H7KA 3ED1A 2JF0A 5CH5A 5C81A 4X94A 6YASA 2DHEA 4N8EA 1W75A 3D5EA 2C5GA 2DQZA 3A70A 1YSCA 1U4NA 4UHBA 3S8YA 1TCBA 4W9RA 5FLKA 5ALFA 3M3DA 3CXUA 1CIJA 3K2IA 3PUIA 5FV4A 1CUZA 2O2HA 1QIEA 1IVYA 3W06A 5BWCA 1WM1A 4QDUA 4J0IA 4OYYA 2RIPA 3BL8A 4ARBA 4B0PA 2Z5GA 1TIBA 4FLMA 3IBTA 5AJHA 1HDEA 3A2MA 4X6UA 1SOMA 4J03A 3WKBA 5AKLA 5ALPA 3HABA 3LCRA 1QGED 3WYNA 2PUJA 2HA7A 1THGA 2XLBA 2WM2A 1HBJA 2GZSA 3C87A 1MX5A 1EDBA 1CUXA 2JGEA 2QKYA 1J2EA 2G5PA 3DL7A 3IVMA 4J0HA 5FUMA 1VJ5A 1L7QA 2XQGA 2P8SA 1ZIXA 5AKGA 3RLIA 1JMYA 1QJ4A 4U2CA 3IUQA 4Y7DA 3VKFA 1BROA 4H7HA 1RP1A 2WTNA 2XQIA 2V96A 5DTIA 1GPKA 1MTZA 3C45A 4W63A 2OXEA 3C6ZA 2XDWA 3C6BA 3I2GA 4L3WA 3O4IA 5JD6A 2XQFA 3STYA 3N0TA 3QPCA 3HSSA 2B4KA 2HM7A 1QFSA 1UXOA 3OPMA 1KEZA 1ODTC 2OG1A 1EXWA 5DYWA 5AKHA 2PSFA 4JUIA 4C01A 5DTJA 3WWEA 2PU7A 1JMKC 3LP5A 1EDEA 2QOEA 1AZWA 1XROA 3NOXA 3I2HA 2GBFA 5ALKA 4YK7A 3KXPA 3IUJA 3PF9A 2CUTA 3AIMA 3A2LA 3G0GA 4F21A 2WSLA 5EHXA 5FOQA 4YASA 1CUVA 3H2IA 3M82A 4U2GA 4AN1A 5CH3A 4ZXFA 2J3QA 1HL7A 2LIPA 3S2ZA 1LPNA 3A6ZA 2HHAA 3KWJA 4B9EA 3DEAA 4G9GA 4QZVA 1BN6A 3BXPA 4Q3LA 4CCYB 4WFKA 1FSSA 1ODCA 4B7ZA 5DJ5A 3ZV7A 2V9ZA 3FLEA 1WB5A 3VJKA 5AKEA 4X90A 4NVRA 1L7AA 2DR0A 4U2DA 4UFPA 3OG9A 5JAUA 1Y7HA 3QYJA 3TRDA 5KWIA 4FLFA 4YX9A 3F67A 3B5EA 4UBKA 3QH4A 1XZCA 2ZYIA 5IH7A 5JASA 5FRDA 1QTRA 3ZI7A 2AXEA 3WKCA 5LZ8A 2R8BA 2OCKA 1QONA 5A7GA 2DQYA 2PSHA 4DTCA 2IITA 1CUWA 3D4LA 2HRQA 2CKMA 2XUQA 3FYUA 3AJAA 3UUFA 3AFIA 2WFLB 1LZLA 2QZPA 2FJPA 4G1FA 3O9MA 4NMWA 4BATA 3U1TA 1AURA 1JFRA 3WK7A 3ICVA 2HFKA 1E8NA 4B84A 4F5ZA 5ALIA 3DJYA 2YXPX 3WK9A 1EDDA 2QTBA 4KE7A 4PQEA 3PE6A 5E4TA 1UKCA 4BP9A 4YPVA 1ZOIA 2WHQA 2W22A 5AM3A 4DNOA 3VDXA 4K6GA 1QIIA 1XZIA 2VSQA 1P0QA 2WIKA 4N5HX 1L7RA 1PV1A 2ZJFA 1P0MA 2HRRA 4BDSA 3OC0A 2XMDA 4G4GA 4FHZA 2JGFA 3DDUA 3DQZA 4JYMA 5ALMA 4QA9A 4BCDA 1E5TA 3DL4A 2DFPA 2XQJA 5D7BA 1X2BA 5CMLA 1EHYA 5JIBA 1DWOA 1YAHA 1QIMA 4QWMA 1VZ2A 1R88A 2VJDA 4UFNA 1VE6A 4EY8A 1UKAA 4AMYA 3VVMA 1VE7A 1JU4A 5AH0A 4QLOA 1F8UA 4AB1A 5LZ2A 1I6WA 3EQ9A 1IUNA 1EK2A 2BFNA 4Y2TA 3QPDA 3A2NA 3FNBA 5JALA 1XQVA 4UBNA 5ALGA 1XZMA 4J0GA 3C6YA 3O95A 4ZRDA 4FFWA 1YB6A 5ALWA 3D3NA 3WIOA 1USWA 2WFZA 5ALLA 1LNSA 3ANTA 2WIDA 3HYSA 4XX1A 1VZ3A 3WWPA 4LYDA 4GEGA 4AO6A 3WWDA 1EVQA 1LPBB 2PSJA 4F0JA 1GGVA 2CEKA 4Y2JA 1ISPA 4OB6A 2H1IA 1MU0A 5DNWA 2VF2A 3WWCA 5D3KA 5HFNA 3QM1A 5CW2A 4HXGA 1W4LA 1IZ8A 4Q34A 1D07A 2E3JA 1JJBA 4GWLA 2ZSIA 3FYUC 3D2BA 1AKNA 4EY5A 3G9UA 4W1PA 2C0QA 2VT6A 5AKJA 3BIXA 3C8HA 2QJRA 4MYDA 1FFEA 1UOPA 1C7IA 4XJVA 3ZLVA 3L1HA 3WI7A 2VT7A 4KAFA 1U8EA 1MT3A 5AKKA 3HLKA 2OCLA 1PJAA 1CUCA 4FFVA 4MEAA 5ALQA 5CT4A 4BVJA 4KACA 5LYYA 4MQMA 4UBJA 5FXMA 3BF8A 4B80A 5T4BA 3B3QA 2BUCA 4UBOA 3FYTA 4DSAA 3HEAA 4RPCA 1UWCA 4QDXA 4AX4A 5CT6A 4KAJA 4Y2YA 4BRSA 4DMHA 4M0EA 1N1MA 2Z3WA 5AI9A 4H18A 5CXXA 1HQDA 3FCXA 3KWFA 1R1DA 5HF9A 2WIGA 4DM7A 1E3QA 4ITVA 5AM4A 3WYDA 5C8VA 3G7NA 1T4MA 3LS2A 4GDMA 5EGNA 5IVHA 4CCYA 1GT6A 4XVCA 4CCWA 3WK6A 1XLWA 2C5FA 1XRPA 1EI9A 1LPPA 4G8CA 3BE8A 1VXOA 1CUDA 3DKRA 3MUNA 3SWWA 2IIVA 2C0PA 3F98A 4LIPD 1BS9A 3O4JA 3W9BA 2BKLA 3G0CA 2HDWA 4EY6A 4KE9A 5CT5A 2OAEA 1Y7IA 1N8SA 5JAOA 1Q84A 1GKLA 1EH5A 1YB7A 2XUDA 5YASA 2O7VA 4B83A 1LGYA 2O7RA 3BJRA 2JGJA 3G9ZA 1P0IA 5ALOA 5ALZA 4Y2SA 4JH0A 4BC1A 5FPQA 1CPYA 2XUAA 1PFQA 3R3VA 5AI0A 1CQWA 1MNQA 4U2EA 5AI8A 1FFBA 4AMZA 1NU6A 3WIBA 2RHTA 1QO7A 1YAJA 3R0VA 3KD2A 1TCCA 2WFLA 2BUAA 1XZHA 1Q0ZA 2ZSHA 5HCUA 2HFJA 3O0DA 5AI5A 4BE9A 1ZJ4A 3AUKA 4EBBA 1HPLA 1MO2A 3WZLA 4C87A 5CRIA 5CH8A 3R40A 1TRHA 5LZ5A 1DQYA 1UZAA 1T2NA 4F60A 4NS4A 3H0CA 4Q82A 5AKZA 3G02A 3CN7A 1J06A 2XMBA 1JT2A 3OOSA 4HXFB 4H7IA 3BDVA 1LZKA 4H77A 5FKJA 5HQ3B 2XMZA 5AK3A 5ALXA 4TGLA 4UHCA 1CUIA 4EUSA 3L1IA 3JWEA 4I19A 5ISMA 2XE4A 3AZPA 4IH4A 3LIPA 4IQ4A 4DMCA 4FBLA 1QIGA 5K3FB 5JZSA 2Z8ZA 2ZYRA 5AM2A 3FSGD 2WUEA 3QZUA 2C7BA 2I03A 1EX9A 2WG2A 1X70A 5D6OA 1LBSA 1ACJA 1E66A 1K6EA 4QWWA 1DQZA 1ZICA 3WA7A 3JYHA 1XZKA 1N5MA 2XUHA 4RE5A 2G4LA 1EK1A 4Y2QA 1DWQA 4RGYA 4HS9A 7YASA 3VXKA 1W76A 3FWHA 1MNAA 3HC7A 3O4GA 5K3BA 4ETWA 4BYMA 2AJCA 5AOCA 5K5EA 2CJPA 4WY5A 2XB6A 1QZ3A 2CB9A 3HJUA 5IVKA 1G4HA 4K5QA 1JU3A 4N8DA 1IUPA 1IZ7A 3T52A 3E1GA 2I78A 4ZV7A 5AIAA 1VA4A 3GROA 2ACKA 5AKYA 1XKLA 2BGNA 3I1YA 2Y6UA 4A16A 4CG1A 3CN9A 4Y2PA 1YASA 5AOAA 5C7YA 4GECA 4EZIA 5JZBA 1HKHA 5DNVA 3QBJA 2JGIA 1DWPA 1ODSA 3R3ZA 1JI3A 1XRRA 2ONCA 4IHAA 4DMFA 4XWGA 2VA9A 2I3ZA 2J4FA 4KE8A 1XZBA 2O2IA 1NX9A 1CUYA 1GZ7A 4PNZA 1ZI9A 2UZ0A 5H3HA 5A7HA 1GQSA 5LIPA 3QVMA 3PFCA 1O6FA 5EIHA 3UMJA 2XMGA 3NUZA 2AJDA 4BVLA 1CUUA 1XQWA 1ACLA 5AP9A 2VAVA 1CRLA 2QUAA 2R11A 4CIBA 2W6CX 1VXRA 5HF8A 3WK5A 4Y2RA 4DGQA 2HU8A 1AUOA 5K3CA 1AC5A 2WHPB 4X3CA 3G0DA 1R3DA 5LLSA 5KWJA 5LZ9A 5DWDA 1H2YA 1LPMA 5E2IA 4N5IX 3JW8A 2ZYSA 1WHSA 4PW0A 2K2QB 1F0NA 4O08A 4I3FA 5AKIA 2WTMA 3UUEA 4J0CA 5AICA 1R50A 2WIJA 1W6RA 3R3WA 5C8ZA 4MWSA 1YR2A 4X7BA 2ECFA 5AM5A 1IUOA 5EIAA 5A71A 3E0XA 1BN7A 5HFAA 3SX4A 4INZA 3WL5A 3H17A 2OGTA 4H7EA 1GKKA 2OQIA 2HA3A 4LYEA 1DX4A 1A8QA 5K3EA 4HTAA 4EB0A 5AK5A 4H35A 1QIHA 3QITA 2XMRA 4MXDA 4IO0A 4KR0A 3FAKA 3LIIA 3GUUA 3WQHA 1F0PA 3D59A 2V98A 4KE6A 1QO9A 3D2CA 2GBIA 5EI5A 1OXMA 1YS1X 2OGSA 2WKWA 4ZV9A 5JANA 5T4EA 2OGZA 2D5LA 4DSZA 2H7XA 4Q3OA 3WMRA 5BOVA 3PI6A 4EY7A 5HKBA 2GZRA 4X97A 3F97A 2O2GA 2Q0XA 4KYVA 2JEYA 1DU4A 1Q0RA 2XUOA 4AN0A 1XZJA 2QR5A 3PUHA 3I28A 1TQHA 2XLCA 2OPHA 5ALUA 2QM0A 3WZMA 3HI4A 1ZI8A 4LKOA 4FLEA 3IIIA 2XUPA 2HU7A 4E11A 4NZZA 2HU5A 3W04A 2OQVA 4LXGA 1X2EA 1ORWA 2PSEA 3WLAA 3F9CA 1FFAA 2D0DA 4H7JA 4UBIA 5LKRA 4QLAA 5JAHA 2WLSA 5ALTA 3GA7A 4FTWA 2RAUA 3F8SA 1H22A 4MWTA 2Y6VA 1XLVA 2GYWA 3QMVA 4IH9A 2WU4A 1XRLA 4X6YA 1QIKA 1UFOA 4GXNA 1SCIA 3WKDA 4P08A 1CUAA 3CCCA 4ZGBA 4JEIA 3IA2A 2IX9A 3QPAA 3D7RA 4OCZA 3ESCA 1KU6A 1UT6A 3WKAA 3DYVA 4AZ3A 2WFMA 1GQRA 3E4DA 4UFOA 1LBTA 2X5XA 3H04A 3X3HA 5HQ3A 4C4XA 1CEXA 1JKMA 2V97A 1FFDA 4KEAA 4HVTA 4GW3A 3IUNA 5JD4A 1XKTA 2JIDA 5LZ7A 2JEZA 3C70A 2XQKA 2ZYHA 2X76A 5E4YA 2WILA 5K3FA 3W9UA 3WL6A 3TJMA 2NW6A 4GHWA 4Y2XA 3WJ1A 5I9IA 4K6KA 3AZQA 4CG3A 4V2IA 4DYHA 1MX1A 5IVDA 1J07A 1SC9A 5JZ9A 2OAGA 3ZLUA 4UUQA 3V1KA 2WUDA 4HAIA 5EHQA 4P93A 3WWOA 4XIIA 4FOLA 4D9JA 1XZGA 3DKKA 2VJBA 2JBWA 3I6ZA 1XZAA 4AZ0A 3I2KA 4Y9SA 1XLUA 1ZI6A 1ZIYA 3RARA 2JGLA 4EY4A 5K3AA 4Y2UA 1R9MA 1CUEA 1CUJA 1TAHA 1JJFA 3H19A 4BCCA 1XZDA 1G66A 4FDMA 1RWQA 1UOQA 2WUGA 4DIUA 2QUBA 2PBLA 1E89A 3FVTA 2HADA 2EDCA 3YASA 2G63A 1ZGBA 2EEPA 1OCEA 2WJ4A 1CR6A 2B20A 1YA8A 1G42A 5AIBA 4B85A 4PSCA 4P9NA 4M0FA 4LHEA 4C89A 1CV2A 4B6GA 4BC0A 3WL7A 3KOOA 3T4UA 4B81A 4MYSA 4TPKA 5CURA 4BAGA 4FBMA 3BDIA 2B9VA 3IULA 3I2IA 4C4YA 4GLBA 1P0PA 3G0BA 3IB3A 3M81A 3QMMA 4OYLA 1CFJA 4K2AA 4HXEB 5A6VA 3TGLA 3V48A 1ZD5A 5LKAA 3GELA 3RKSA 2FJ0A 2XI4A 3HZOA 3R3UA 4WFIA 1XQYA 5CBKA 4MQLA 4PSDA 4FWBA 2YASA 2WHPA 1NU8A 1RYYA 2Z8XA 1M33A 2QRUA 3AILA 4UPDA 3DYIA 5EFZA 4IH1A 3GZJA 1VLQA 4U2BA 3M83A 1QFMA 3V1NA 4I4CA 2X8BA 4OU5A 4JNCA 1BEEA 4QEKA 2QVBA 2VJAA 2PVSA 4QDZA 1JJIA 5DNUA 2AJ8A 3H1BA 4C4ZA 2EDAA 4G4IA 4UBLA 1KU0A 3RM3A 1XFDA 1XQXA 4E46A 4PO3X 4AO7A 4BZZA 4UHDA 3AIKA 5HF6A 3OM8A 1WB6A 5AKXA 3D2AA 3STXA 1IMJA 3EF3A 5AO9A 2JGMA 1GPLA 4BTVA 2DCMA 5FDFA 4E14A 4KRXA 1EVEA 2C58A 4G9EA 2VATA 3H2KA 5AI6A 2PU5A 4DMKA 1DTEA 3HACA 4X71A 2XUJA 5I7UA 5JD5A 2PPLA 1CUSA 3IDAA 5DLPA 4WJLA 3I2JA 1WB4A 3EQ7A 1H2ZA 4DLNA 3PFBA 1Y37A 1WHTA 3KDAA 4G4JA 3STUA 5AOBA 5ALJA 3PDCA 4EA6A 3GBSA 4A5SA 1VA5A 3FSGA 1S8OA 4OUKX 1QIDA 3LLCA 4J7AA 2BGRA 4PV7A 3I2FA 2QXUA 1W52X 4ZI5A 1MJ5A 5DYYA 5SYMA 5A62A 4OU4A 3W2TA 4HRXA 4W1SA 4CI9A 3FCYA 4DNPA 5EHZA 1ORVA 4G8DA 4AXBA 3ZWQA 2HIHA 1XRNA 3BF7A 4LXHA 4G8BA 3C43A 5E4JA 3C8DA 2AJLI 1EINA 2AJBA 4B82A 2ES4A 1TCAA 3MUOA 2XT0A 4KRYA 4ARAA 4UHFA 4KJXA 1N5RA 5HK9A 3ESDA 3STVA 1A88A 3H18A 5ALDA 3H2JA 5J3JA 4OPMA 5A7FA 2Y1KA 3SK0A 4RNCA 3DOHA 3BWXA 2QS9A 3G9TA 2XUGA 3QMWA 4RE6A 1K8QA 2ORYA 3PF8A 1ZD2P 3FOBA 3IURA 4PSUA 4JYPA 5ALEA 2ZJ6A 1QLWA 2ACEA 3BJMA
chains in the Genus database with same CATH superfamily
4UCFA 1KJZA 5LWHA 2FRDA 3LNCA 5EXTA 3SYTA 3V55A 3FLBA 1SB9A 2XZLA 4NZPA 5JARA 1XZFA 1ANKA 3VAYA 3VJLA 2NYUA 2YRFA 3BVPA 3QHPA 3QUCA 2HF7A 5DLQC 3TBHA 3SR3A 1H05A 3GQVA 2IRWA 1UZLA 4NZOA 2IH5A 1FDWA 1KIAA 2XWJI 3OU7A 3UMYA 1IZZA 1E2JA 2NSLA 3KYDB 2MSWA 1I5OA 2RG1A 4E51A 4A2PA 2A88A 4I1PA 3NO4A 3EGXA 3T95A 3V97A 5C4IA 1P3JA 2RBGA 3PDIB 3AU8A 3IHKA 3KALA 3PC3A 3CX3A 4G5SA 4CU2A 4EX6A 1BU8A 2H52A 1R0KA 2VJCA 2JCGA 4ZHQA 3AX6A 1NJ6A 4TMYA 1E5QA 4DIBA 2XPCA 1JSZA 2B34A 4FWIB 5KPJA 1C8VB 2H7CA 1AKTA 1SA0B 1H2BA 3WL8A 2Y76A 5GINE 4A6PA 3QVUA 1K63A 2J48A 3KXLA 3WWZA 4ADSG 5K3OA 3PUYA 4WXRA 3PNVA 4XD7A 1QRRA 2WT8A 3NHZA 1H6DA 2CCGA 5JQGB 3G0IA 2Z4SA 2C3PA 2HMAA 1YA4A 4P98A 5T4FA 3F73A 5F9MA 3CW2A 3BZBA 1V2GA 2JLSA 1K3FA 4KUGA 5HEKA 1G3MA 2I4RA 1DMRA 3TUIC 1P9OA 1XPOA 5JISA 3DVSX 1WVIA 3DFZA 2A0WA 3W7BA 3QLUC 3SC2A 2EKQA 4YMVA 2NV6A 1PJCA 4YJHB 3U3JA 4CLDA 1M1YE 2X6RA 1E7RA 4CMKA 1WR8A 2XQVA 4OYHA 5JMPA 2EQ5A 4JBGA 2FQ1A 4AJ9A 4ENSA 5SV2A 3TZCA 5C35A 4FX5A 3H99A 2AOWA 2QPAA 3L9WA 3EZYA 4I14A 1LBQA 4UHEA 4OB8A 4DBLC 1XCOA 4P92A 1JMVA 4BZXA 4TM8A 1EHCA 1PBTA 1GPAA 2O2XA 3IJRA 1F06A 5HTKA 1K66A 1LQTA 1RQGA 1Z8FA 2A33A 2NYAA 3WGQA 4AF8A 2R8YA 4D6XA 3WRXC 2PWAA 1E8MA 1XIVA 3L8DA 1NR1A 4FYPA 4FQ5A 2JAQA 4KQKA 3I72A 2C2HA 1E62A 4G1UC 4LSZA 3C6KA 4EMBA 2G5GX 3GA5A 3GEMA 2H7YA 3VAAA 4BE4A 1E99A 3KYBA 3O4HA 4M8NE 3DZBA 3JQQA 1DJPA 4N03A 4W9NA 3STWA 1UK7A 3WIVA 4CFSA 4C7OB 2BJWA 4XM1A 3KR1A 3UC5A 2H08A 3AI2A 1ZNQO 1DT3A 3HJFA 1WX1A 4Y6RA 4LMBA 4BRZA 4EHHA 1NT4A 2HLHA 2IXGA 4CM1A 2VAMA 4DDUA 2H9YA 2AQ8A 5EESA 2IHNA 3ZHXA 2Q0HA 3ENKA 1JT9A 3TNFA 3R24A 3ILSA 3TIIA 1GSHA 1LPOA 1P1CA 1YQXA 3GZTB 4ZO4A 2CSXA 1PG5A 4I0WB 4XGNA 4DUGD 4RU1A 2RGCA 4F71A 2F64A 2O5VA 4B6EA 3B8EA 1L0BA 3DDOA 3M6IA 2LXNA 3BMCA 4OIFA 5T41A 4LFAB 1QVWA 1XRSB 2FETA 4BLOA 4LA4A 4TMTA 2BEWB 2EJWA 5K3DA 2XOEA 5BNZA 2VTVA 3BD7A 1ABBA 1U65A 3UXYA 1COWD 1KI1A 1MA0A 1N2ZA 2B3DA 1QHIA 1XXHA 4MNTA 1J9ZA 1B1CA 1K4YA 1X1AA 2BCGY 2HTEA 3P8ZA 1GTVA 3UWMA 1MV8A 1Z33A 3INYA 4FMPA 4CT0A 2ZT7A 3IJEB 3C7TA 4X8HA 2ZS9A 3P71T 2NUTA 4DABA 3VJMA 1MAHA 1LLFA 5EMJA 4D6PA 1RAHA 2WPNA 4BNKA 1B42A 4BZWA 5IZCC 5FFMA 4BVAA 1Y3CE 3PPYA 1Z29A 2QTWB 2YVUA 1WBDA 2QX7A 2O9JA 2H7VA 4BQRA 2NIPA 1BEUB 4Q3KA 4E3WA 1WUIS 4BO4A 2IHYA 5JEDA 4FMBB 3O31A 3CE9A 5LQAA 3QVTA 1H2HA 3OKCA 2MSEB 1ZHHA 3MSXA 1F2TA 4XCVA 4LXIA 3OP4A 4L51A 4E21A 1DINA 3O21A 1FX0B 4LXUA 3STTA 3H4VA 3RK4A 2XWQA 2ZITA 1OLXB 1E2KA 1UK9A 1VMEA 1OFTA 2GZHA 3FHOA 4E5DA 4BKUA 3ZHVA 1Y6FA 2XMCA 4ETIA 4EYSA 3DDNA 4U3JA 4HPXB 3WNBA 2JVKA 2BDEA 2DHDA 4ZO6A 2FXVA 4M0MA 4I5GA 1NWCA 1AUXA 3E2MA 5FBWB 1Z25A 4I5FA 5HX7A 4MVWA 1XMQB 1OR8A 1SRRA 1HT1E 1JHQA 3EZXA 2JDIA 2RHWA 3FBWA 2B92A 3L0YA 3GLHE 2IYLD 1H2EA 2PK3A 5EN4A 2W71A 4HEQA 3DV2A 1CC1S 2J08A 4Y9RA 4CMHA 4C22A 4IY1A 3WJ2A 4F4UA 1OKKD 2ATIA 3E3AA 4H7DA 1CS4C 1N1DA 2QGZA 4R81A 3T3GA 1J39A 3H5VA 3ZNPA 1ISSA 2MYTA 5I7EA 3OCYA 1YB1A 4XFKA 2ATCA 3MB5A 2OK7A 2D3WA 4O4HF 2ZYWX 4NXNB 2XSZA 2YYSA 3GPIA 5CB4A 3NH6A 2ICAA 1UJ5A 5JW6A 1MX9A 1NBMD 1ZUIA 5TPWA 5LP6B 1A7UA 1PR6A 1AV6A 3VX3A 2I6SA 3GJRA 1CWUA 3I64A 3T3NA 2E6KA 3QSYA 3C5EA 4W8HA 3T3HA 4EKGA 4JKOA 1X8KA 1H4TA 3RRZA 1MIOA 3SVZA 5IFLA 1DO8A 1EZ1A 1XK7A 2F17A 1IWPB 4MZXA 4E13A 3JPYA 1LPSA 5IKXA 3PXXA 1QTIA 4PO9A 1H4QA 4S1TA 1GITA 1ADJA 1M2WA 4AWBA 1ID8A 3ER6A 3ZWOA 2Q62A 3CM0A 2PIDA 1QF6A 3NAQA 4M8LA 1UDXA 3TEJA 2DRIA 4ALIA 4MITA 5EPEA 2XNDD 5EE3A 4UTZA 3MQFA 1CVLA 3OMXA 2BMEA 1EPUA 2EGHA 1Q0QA 3FWNA 3KKQA 4FS3A 2FOIA 3S1AB 4GZ3A 1WMDA 4OA8A 4RMNA 4WHMA 3RYFB 1DT5A 1EVIA 1NASA 3R9KA 4F04A 3RFFA 1RWOA 5E8JA 2ZB2A 4Z9FA 1P4JA 5AW8A 2DFKB 2NZUG 4B3DA 3NBUA 1SFRA 4LRQA 1X8XA 3W8NA 2H1SA 2X15A 3A1CA 1CJBA 3GLTA 4PYQA 2BN4A 3DB1A 4PNHA 1S1CA 2Y9MB 4NCXA 4G0VA 4P4SB 2GYUA 1ZITA 3KEQA 1GG5A 3W4JA 2P8JA 4A82A 2WHRA 2JLWA 3GLIE 2WJ3A 3B12A 2Q4RA 4KXVA 2D2FA 4HVAA 1OASA 2KSQA 3EFOB 5FWYB 3IKLA 4GYWA 2H00A 3HP4A 4WA8A 4NAHA 1BH6A 1PGPA 1A9XA 2HAEA 4MI6A 4DARA 2WMNB 4LJYA 4X00A 3L4JA 1SVWA 2O1EA 1IIRA 5CLJA 1G8AA 2BONA 4D4IA 5JJIA 3VV2A 2V7WA 3F4LA 3VZSA 2OHVA 1RJ9A 4QEZA 3TLMA 4CLHA 3I1IA 3WK8A 2ZCVA 2YFYA 5IXSA 4PLPA 4R84A 4V0RA 1FY2A 2E48A 2YFHA 3MD9A 4QFCA 3H87A 1T8UA 3HR8A 4XW2A 4F46A 3F9RA 3H9CA 4BFVA 1TUIA 2C4KA 4YXWD 4XIJA 1O89A 3I1FA 3ZKWA 3ICOA 3LDGA 1CKEA 3GUZA 5FEMA 4GT1A 3SDZA 4LOLA 1JGTA 1H0KA 1GL3A 2CFRA 2YHUA 3LVBA 2W9XA 3FIJA 4HLNA 3WS7A 2NQ2C 4PN3A 2OECA 1LS6A 3A3KA 5PGMA 1E2NA 1SC1A 1VP3A 2BH9A 1KBQA 1KC3A 4HRVA 4OQMA 1SD2A 2HMWA 3QG1A 5B6IA 3OF3A 4I1VA 2WG1A 3TQHA 1Q92A 3TSCA 4BB0A 1F6WA 1IIBA 3PNBA 5E9QA 2F8TA 3PP8A 1DKMA 1OBCA 4MJ3A 4OSEA 3ZGLA 2PT6A 4PAQA 1RXCA 3QTBA 1SC3A 3AKDA 5JWHA 1E2FA 5CNMA 1BW9A 1RXEA 2WG0A 3JD3A 2YV1A 4NENA 1ESNA 2WNSA 3DZIA 1ETHA 4EVQA 3LKDA 1RLMA 2IXAA 5FPPA 4A6DA 2BJHA 1FTQA 1YDGA 1Q19A 1T9CA 4WKOA 3MTIA 5BQXA 1TZCA 2J5BA 5BY2A 5DK6A 1L3IA 3TMYA 1BE0A 4QFBA 3PNYA 4HRYA 4MMYB 3SICE 4QC2A 5E7MA 1ZUNA 4Z5XA 3DT8A 1LKZA 3WQRA 4X93A 3FNQA 4TLEA 2OBYA 1J1IA 1F5NA 1JSXA 2YWBA 2MIIA 3DE6X 3PNSA 4OM7A 4EDFA 5B6JA 5HQTA 1GAEO 3CR8A 1HYQA 5AVUA 1HZZA 4DY6A 3E27A 2AC7A 2AI3A 1XLTC 1M83A 2II6A 4L3VA 5FI1B 4ZJYA 1QHHA 2V74B 2Y2VA 4G1MB 1OJ7A 4RPKA 3RS2A 2E85A 4ISCA 5C3UA 3SJZA 1TL7C 4BO8A 1XHFA 2XGGA 3H5RA 3EWSA 3K0CC 3H05A 1B76A 1DV2A 3F96A 4G6ZA 4RXTA 4M99A 1B8NA 1PUIA 1QQ6A 3K9QO 3QEMB 3TNJA 3WHLA 4DNQA 5IM4A 1OVMA 3Q4GA 3IE0A 5KVSA 1W35A 2DFTA 4HNQA 4UASA 1DADA 3QSGA 1PLKA 3MS4A 2VNSA 3CPSA 5DRYA 5K0NA 3Q11A 1KF0A 4EO7A 1EB9A 1W96A 1T9AA 2IL1A 4HWGA 5DP1A 2WAOA 5JCJD 1CS0B 2X0KA 4OJTA 4RPHA 4K6HA 2X19A 2O8DB 1HH4A 3IUYA 4JQSA 2NAPA 3FUTA 3KP1A 1ZC4A 3DZKA 3FUUA 4KOEC 3FDZB 1LK7A 1OILA 4U9IS 2OCIA 2JCVA 1CUHA 3LW7A 4NJOA 5DYTA 5LBUA 1GXSA 1A3CA 3JQ7A 5BSMA 5JI3E 1EWTA 3F5QA 3KQOA 4YDSA 3E9NA 1AU9A 5AW3A 3EEFA 1N5IA 3VR4D 4C6HA 3GWZA 5BVHA 3EIWA 2TRSB 1NYLA 2G80A 3UXEA 3QWIA 3ERCA 3VR1A 1M6NA 4HNRA 1XMXA 1HORA 2EFEB 3G23A 4S0XA 1U7HA 5CM2Z 2KM1A 4QE3A 1E8DA 3UW1A 2WZBA 5FPHA 3AUAA 3ZE8A 4BLSA 3KZNA 4DHWA 2FP3A 2W6MA 3ZHBA 3K70D 3MJCA 3O9ZA 1K4KA 3IV6A 2PEYA 1J23A 2C96A 4Q1VA 2OHGA 1DAPA 3ZNOA 2C3UA 4FNMA 4PXAA 5E1BA 2FUKA 2GAOA 3HXLA 3M70A 2BMJA 1TCVA 3V1LA 4E07A 4CIYA 2BI7A 1P61B 3H1FA 1B93A 1FJ2A 1QOZA 1U8CB 2FZLA 3NAGA 1C3LA 3H9UA 4I6JA 4J94A 1EFUA 1OUMA 4G0PA 1HO3A 1UXIA 1WZNA 5ESRA 1EVYA 4M1QA 5F9FA 2HRBA 3RT9A 5BXYA 1NMSA 4X66B 4IDQA 1EWKA 3JQ6A 3RB8A 4XX0B 3BGOS 5CT9A 3DAHA 5ILGA 5B3LA 5JSQA 3OQNA 1UBMS 1NMEA 2PO7A 1DKOA 3UMFA 4TWJA 4D9MA 1JIXA 1JKIA 3KYDA 1NDQA 3SEAA 3GGOA 1Z6XA 3IRUA 3OFVA 2P2SA 3HR7A 2WMDA 4H1HA 4M0CA 4POAA 4YJ3B 4N6GA 1QCCA 1D7OA 3PDIA 1W581 2PX3A 3D0KA 4FSDA 4IL5A 4EX7A 2WFAA 5AW4A 1QOPB 4G9BA 2IDMA 2C84A 4WV3A 3RO7A 3TRKA 5CFPA 1UJ4A 4JR1A 1NN0A 1DC5A 1SA0A 4I5EA 4DLVA 4AKGA 3N05A 4HWSA 1P5ZB 4S1WA 2VWQA 4MUJA 1XTVA 3LY7A 5JQGA 1V3UA 3CEHA 4O4HB 5JWRA 5GM1A 4KHZA 4EPRA 3IH5A 4DV0B 1A1VA 1VE3A 4PGMA 2CXRA 3C5VA 5J9FA 4BGUA 1D4ZA 1JEAA 2C4HA 4Y0VA 2E1PA 4MEBA 3WNVA 5LUAA 4DKXA 1E3LA 4IS2A 4AW9A 4W1RA 5FPTA 4J90A 2Y1CA 1WV1A 2CD9A 2ZU6A 2ANCA 5BNFA 5JDCA 4DSTA 5T64A 4JIMA 4YJHA 1HG1A 3IBYA 5KU1A 5HKLA 3ACBA 1J0AA 5HCIA 1OZFA 1L9XA 2EQAA 3HMKA 5AHXA 4KAXA 5EXXA 3W2FA 2RK6A 2P41A 3WIUA 4RF5A 2HWUA 4QNRA 2ZXEA 3CONA 5K03A 1X14A 2NM0A 2QP3A 2TECE 1R4AA 2AFIB 1K8XB 3FE2A 1BO6A 3N2ZB 3QNWA 1CUBA 5FULA 2H8KA 3FG9A 1KXZA 3Q3EA 4H7KA 2ATXA 4LMAA 1R37A 2WP8J 3ZK9A 5C81A 5FTKA 4J6EA 4PX2A 3QHAA 2GS9A 4C05A 3DTVD 4MV0A 3EDYA 4N8EA 3UXMA 1SJ9A 2VYND 2PBRA 3ZV4A 1JEJA 3LVRE 4D96A 1HT2E 2ZI3A 3GI1A 3KWMA 4HC4A 2DQZA 1T6XA 5CLHA 1RFGE 3GCZA 2W2LA 1YSCA 4TV9F 2PCLA 4QQFA 1BDHA 4UHBA 4FFPA 1VPEA 4TL6A 3AJ8A 3ZCUA 4OHXA 4F11A 2G17A 2QAGB 3IALA 4LFBB 1DELA 1W5TA 4RIHA 1VHLA 5LA6B 3ZVKA 2KBEA 2DHRA 2IHUA 3S29A 1DBSA 4P2GA 2CVQA 1P75A 1SOUA 2F3PA 2QNRA 3E6AA 3KZ1E 5DF1A 3MAAC 2G7ZA 1G5HA 1VE5A 4CTJA 4G5OA 3UM9A 1QIEA 4YMTA 2BEWA 1IVYA 5KEIA 5AHOA 1ZC3A 5F2NA 3A11A 3PEEA 2HT1A 4OYYA 1RW4A 4GPD1 4P36A 4CLEA 4OEHA 5E9WA 2P77A 4GVXA 3SLGA 3VKHA 1C14A 1TECE 2O57A 5AJHA 3U09A 3PFIA 4RPGA 4TROA 3T34A 2QZJA 1T3ZA 4PX3A 2P3SA 1DGQA 3WMFA 2H57A 3R0JA 3PJEA 3U3ZA 1E60A 4MO2A 4H0NA 1EM6A 1I6MA 4BQFA 1T0HB 1G6HA 1QVRA 4IYRA 2OBMA 1H1TA 3TOCA 3RG2A 2IPOA 3V32A 1I4DD 1HBJA 2WB2A 1Y3DE 1YJQA 3I0NA 1IY8A 2NXEA 5K8CA 2RD2A 1YR1A 1DAFA 3IOMA 3A1UA 1EDBA 1D2HA 2E4XA 1JXAA 1CUXA 1MOPA 3KZCA 3ZHYA 4B87A 2ZJ5A 2WHXA 4NULA 1OE0A 1J2EA 1NQOA 1Z75A 2WV7A 2ZI4A 2F7SA 2GVDC 3IVMA 2W2TA 3K0BA 2FZGA 3PEUA 4IM7A 3RAJA 1TQ2A 1L7QA 1FX0A 5THQA 3ZHRA 5AFSA 5AUPB 1JMYA 3IO5A 3JVUA 4PPQA 3VPSA 1VPLA 2YN2A 3IILA 1H6CA 3CH7A 3L9XA 4CZ2A 1NRWA 3HNOA 2ETVA 1MB3A 1D03A 2QD3A 3CZAA 4GI7A 4L16A 1GZUA 5HILA 4OLFA 2WQ6A 2L17A 2JD0A 3PWSA 4GPZA 3V7NA 4B76A 1AS0A 1YNOA 4AC9A 4CEIB 1C29B 1UWVA 2WTNA 4LGCA 3ZZNA 4B1FA 2V96A 2VNIA 1ZJYA 3EF1A 1JHDA 2HRCA 1NVGA 3O94A 4D4LA 3I2GA 1CJMA 4L3WA 1T0UA 3F1KA 4DDKA 4DA7A 3O4IA 4Q6BA 2UV8A 3HBJA 4YMIA 3BE5A 4FE4A 2HPHA 3G2NA 3STYA 3C97A 4HX2A 3UO8B 3PQ2A 3N0TA 4UNNA 3DL0A 3CXRA 4GVPA 3HSSA 3TNLA 5DO9A 3FJOA 3VZCA 2ZDGA 2HM7A 1RBMA 1JDJA 2UDPA 5KYXB 1I1QB 2YY7A 1OZGA 4QVIA 5LP6A 4IVPA 1TTHA 2PLWA 2CZCA 2OG1A 1EXWA 1QF9A 1SQ0A 4N76A 2J6HA 3HMQA 3K7EA 5DYWA 2K2WA 4M9SA 4UXHA 1V8BA 4BNMA 2XD9A 1K7CA 2D8AA 3KSDO 3QU4A 1JLMA 4IOLA 2CFOA 4OGGA 1E96A 3ZDRA 2F4VB 4WBSA 4WXHA 3RD5A 4A0GA 4EKDA 2EIXA 2Y92A 2QJFA 1Q0SA 5ELXA 4O1IA 3TO5A 3WMEA 1Q6ZA 4CF6A 5B5SA 1E0JA 3L8HA 5CPFA 3QHQA 2EBUA 1BTOA 3FPKA 1ZFNA 2RH8A 3DDWA 3GT0A 3S1AA 5ALKA 1SBYA 3RYFA 2JI6A 4CF7A 4CQJA 3T15A 3KXPA 3JYLA 1KKMA 1PQWA 4PEVA 2Q7XA 3B6JA 1J5PA 2YRWA 1RWWA 4RKWA 3KHSA 3K9CA 1LJLA 3PF9A 3AIMA 5J63A 5IMSA 3A2LA 2DWPA 3G0GA 1VYTA 4BKRA 3RRBA 4P4SA 5EHXA 3I6QA 2OXTA 5F7OA 4NBVA 4IVNA 1E1YA 4PY2A 2X0IA 2AZDA 4YASA 4UOZA 3SKYA 4DQUA 3EFOA 5FWYA 1D2CA 2B37A 4U2GA 4AN1A 4E4YA 3A14A 3D2LA 4ZXFA 4RTQA 1EVLA 1JZTA 3HDYA 4ZVRA 5EIOA 4BP3A 4KQ6A 1VSUA 2XZOA 3D0OA 1OV6A 5HXAA 3IE1A 3IQGX 5BV0A 4EP1A 2YIVX 3AY6A 3MJSA 3F3SA 4DJEC 5ITZB 3TBFA 2FHSA 1YTUA 3T3MB 1KEWA 3IMFA 3WGNA 1NMXA 4G9GA 3O3NB 1JR3A 4NPCA 1MPTA 3H3FA 2UXDB 1O9GA 1PS0A 3CEAA 2JCBA 4DANA 4GUAA 2BM8A 1OAOA 1BN6A 4ZDKA 3BXPA 3D9QX 1CSEE 5JZOA 1GN8A 5CFQA 2XBMA 5DX1A 1ISGA 5TMEA 4JELA 5IC5A 5BR7A 3SD7A 3VU3A 1T6YA 2AN5A 1I2AA 4WTOA 4H9GA 1FSSA 3PXCX 3KT6A 3AK4A 4K26A 3ZV7A 1IRIA 3CKMA 3H7IA 3NM4A 3CKYA 2IVFA 1ZBQA 3N53A 1A9SA 1HDCA 1IEVA 1RR6A 2D4HA 2QRKA 3ZBUA 3UOAB 1QV7A 4C0JA 3V5NA 1KZ7B 2AMJA 2ODQA 1FNSA 4KPGA 4Q93A 1DEOA 4GX1A 4L6CA 2XYRA 5HE9A 1FYEA 5K09A 1FFGA 4MB2A 4QU0A 3KYJB 1X7GA 1ML3A 3CSSA 2VYVD 5JAUA 3EVEA 4PLVA 4LOJA 4B71A 3TUZC 2XCRB 3OM9A 1ONSA 3MOIA 4BQQA 3DAPA 3F7TA 4OQPA 4P31A 4EPTA 4ZHSA 3RQIA 3N7UA 4FLFA 3MTJA 4R5HA 3I04M 2RGEA 1E63A 2ZSBA 4P7BA 1AMUA 4BTEA 3AVYA 1RE0A 3N39C 4KQ2A 2JCXA 4MHTA 5AVVA 3DWEX 2B4TO 1JNYA 4TS9A 4M1ZA 2Z58A 2W00A 2HD4A 3CBQA 1XTPA 2AEMA 3OQHA 3RU2A 4KVFA 1P31A 3TINA 1F5SA 4FCVA 4R1NA 5F12A 3W5CA 4IUDS 1YQ9A 3Q1KA 1KOFA 3U37A 4DV2B 1A4XA 5EVJA 3QEMA 5KQPA 4MZDA 1E79D 1ENZA 4BNIA 3ASZA 4NCKA 3PIRA 4QOIA 1QRUA 1E2GA 3O8NA 2FFJA 1C7RA 1S8FA 4MUHA 2X0FA 2FW9A 3GAFA 3R0ZA 4XYGA 1VRCA 4OMDA 3K4HA 4I81A 1ETUA 4IDAA 4AYWA 6NULA 5FORA 1CUWA 4D56A 3RHZA 1G9XA 1X87A 1MA3A 3VFDA 4BFWA 1RAEA 4KWHA 3SYLA 1A97A 1CS0A 2JGNA 3QEBZ 4G23A 3RYTC 5KPDA 3ER8A 1QV6A 5LMZA 2O8DA 5G41A 1U9IC 1Z28A 4DLKA 4DQXA 3P9ZA 1RKQA 3FDZA 5DN6D 1G291 1BVUA 4GRDA 4Y6GB 3BKWA 5E4FA 4C1BA 4TX1A 5C9ZA 4RD1A 1LZLA 4L6IA 2D06A 1L8AA 2ODWA 2QZPA 3WMWA 4N48A 3S8EA 4TZTA 2J6BA 3FDFA 3VOBA 3O9MA 1OSNA 4EI7A 1K8ZB 4NMWA 2AG6A 4P5DA 2FQYA 4K28A 4BATA 2X9VA 4MICA 5D3QA 3W8DA 3I09A 2DYKA 2JAHA 3WK7A 2R5FA 3WLRA 1W7AA 1EFVB 2BT4A 4IDPA 4BLVA 3DG9A 2YVKA 1Z39A 3OTGA 4B84A 3M2PA 4M1MA 1MEJA 2CYCA 3A27A 3DOJA 1ZESA 2QX6A 4EFLA 4IHQA 3V7FA 1GNLA 3ZD8A 2GCNA 1THMA 4YEDA 3DJYA 3R3HA 2Z08A 2MU1A 1XR3A 3HDQA 3IQFA 5LL6P 1C1XB 1T2UA 4UXIA 1RXWA 1TLFA 4WKPA 2GM9A 4BMYA 3L05A 1OGJA 1RZUA 4PQEA 4RVFA 3ADPA 1NUHA 4N65A 1PGNA 3MD0A 1R64A 3Q12A 4QLBA 2J7PA 2WICA 1JAZA 2B94A 2DQSA 1H66A 1YDFA 5JHHB 1UKCA 3WMGA 2J31A 2O7SA 4XX0A 5IN4A 1J09A 2WF7A 4TTIA 5CTJA 5HNKA 2AV6A 4YPVA 3HGMA 1D0SA 1GFIA 1GN9A 3TAHA 1MVOA 2A14A 2P4HX 2WHQA 1Z12A 3WRYC 2WD8A 3D4NA 4HDKB 3GEGA 2GCIA 3BICA 5FBLB 4P33A 1QIIA 2OP1A 5HW0A 3IESA 4URHA 4YJ3A 5GMOA 4EHJA 4YC7A 2I2CA 3R0IA 4N5HX 1H8EA 1R0YA 1REQB 1L7RA 1UJ6A 1PV1A 3EY9A 2ZJFA 3OMLA 4PQRA 3CRNA 2MSCB 4BNVA 2A35A 2R44A 3SHVA 4NATA 1XVVA 2OBFA 3QXSA 3RVMA 2R65A 4N5NA 2JGFA 2W6IA 5FOXA 5IEBA 1TMKA 3CBGA 2NGRA 5IT4A 1WO8A 3EZFA 4LISA 4YN3A 3P5SA 4G07A 3L4BC 4O4HA 1QK3A 4V0OA 4D8VA 2VSFA 1LLUA 1OGYA 4NICA 4ZXPA 1WXWA 4QA9A 4U7PB 2GXQA 4BCDA 1VLHA 2I2BA 4LECA 2EJTA 2HSJA 5BSEA 3L84A 1JYEA 1RM0A 2DFPA 1PT7A 2QU8A 1H8HA 4XIFA 2QIPA 4IQ8A 1O2DA 3C41J 5D7BA 1HEUA 2IOQA 2FMXA 2D54A 4OK6A 5F5LA 5CMLA 1HETA 1RBQA 3SHQA 1EHYA 2CE7A 3HKDB 2UXBB 5BPHA 2ZSFA 4DEVA 4R68A 1FYDA 1PFWA 1DIHA 1PT8A 2GBLC 2I4TA 4DC9A 4ND6A 1L7NA 2VJDA 3ZDFA 3RC7A 4ZAFA 2QYHA 2QYTA 5DULA 3JZIA 2AFIA 4S3MA 3BTOA 3V33A 1E1LA 3W5BA 1JKXA 2FDRA 4AMYA 3DFFA 5BV1A 3GNSA 3JV7A 5D87A 4Y3UA 4B33A 3NATA 3ZVRA 1GUDA 4EZEA 3C8MA 4EW2A 3RFTA 4YGXB 1MDBA 1K88A 4CI0B 2A5FA 4L28A 1EK2A 3DYBA 5CAEB 1J5XA 4AG3A 4B3GA 1AQIA 1Z16A 1H1LB 2W48A 2B0JA 2YCLA 3VSBA 2LR0A 3EF0A 3A2NA 3L7IA 1FU7A 3NOOA 4GP6A 1OYOA 2R8ZA 4RQAA 1XQVA 4DA4A 1GGEA 1KJ8A 1RAGA 4KMMA 1TAGA 4WLVA 3NORA 1F6DA 4B3TB 4C0AC 2EJBA 4XLZA 5EP1A 2VKQA 3KR9A 1IXRC 2QAGA 1J4AA 4ZTZB 1KI8A 4YFVA 5LA6A 4LG1A 2CHEA 3D3NA 1SG0A 2GCPA 1USWA 1KJJA 2WFZA 2W6ZA 3DA8A 4X7PA 5ALLA 2ETXA 1MV5A 2Q5EA 2QX9A 2WIDA 3D7KA 3K8ZA 4ML3A 1KJYA 2J32A 5I7RA 1ZJWA 1RI1A 2OSBA 3HYSA 4CV2A 2DUWA 2C1ZA 1VZ3A 3GXOA 3I4FA 2P2ZA 4F1WA 2GMWA 2XH8A 3ABIA 1OZ0A 4UU0A 1MJNA 3AKCA 3QBDA 1ADGA 1XWFA 4LYDA 4ZQCB 4CL2A 3RADC 4P3XA 2FPRA 4AO6A 3WWDA 5F35A 4URXR 2OBLA 1O1YA 2Q6IA 3CKKA 3AOGA 3CA8A 3DC7A 2VJQA 4F0JA 4F1JA 4NLLA 3HCPA 4JI5B 4YUXA 2FMIA 1R6DA 2CEKA 4NOMA 2DAPA 1KI6B 1YCGA 4TYMA 3CRMA 4QOJA 4ZVTA 1LWOA 1NZDA 5IJWA 3VUEA 1MU0A 5K6TA 3OKAA 1KMCA 4EW1A 4FR2A 3AHEA 3VX4A 4YCAA 5E2BA 2YINC 1MRSA 5D3KA 4AJOA 4RCZA 3CWQA 5EZQA 2PUEA 3IVXA 1IBSA 1A04A 1NURA 3OPXA 3ZD7A 3DE7X 3EGDB 5EQJB 1N1EA 2M1XA 2QQGA 3TIVA 1CY6A 1NQWA 3U3RA 3MQ4A 1DX9A 2GTHA 1Y1TA 3KU1A 3O3OB 4CEIA 3GK3A 3TYXA 4NCJA 1L4GA 1TEHA 1WU8A 4KQWA 4NQRA 5AJYA 5TF0A 3T7AA 4Q34A 1D07A 4AROA 4MGZR 3LT5A 5T3UA 5IP5A 2ZT6A 2Q6KA 3ZWXA 1QKIA 1GAXA 1WXDA 3F49S 4J4TA 3U4GA 1XU9A 1U8FO 3PHBE 4OQEA 4BEVA 4EQZA 1VBNA 2AE2A 1SCDA 3GFOA 3B9BA 3ZV3A 1Z2CA 2HV9A 3KJGA 1U1IA 1DB3A 1OHHA 2MSLA 4C29A 4RHCA 4GWLA 5KU7A 3HG7A 2AC2A 2IXDA 2F9MA 1NW4A 2VWHA 2XWPA 2R0QC 4F4CA 5I9LA 1D1PA 1PAUA 4EG1A 4EY5A 1HNWB 2B4YA 2QLJA 4MV1A 5KYXA 1LQUA 3SG0A 1F9AA 4OHZA 1ORRA 1TZKA 1BGVA 1CQJB 1P7YA 3PPIA 5KTYA 5CCXA 3B82A 1L7OA 1N3IA 5CB6A 1E1RA 5CA0B 1IATA 2C31A 2V7TA 4JDUA 4O3MA 3GP3A 3GLUA 1HURA 3W3AH 1HOTA 1DS6A 5B4VA 4MYDA 1M2KA 2R5WA 3HM2A 4TWAA 3I0ZA 1GYPA 1ONPA 3KB2A 2GKSA 4AZWA 2R7MA 4B6RA 3VC3A 3NM5A 4PRZA 3GCWA 3X2FA 3OO1A 2ZP1A 3G89A 4IUBS 3AEZA 5IC6A 5AVJA 5JCOA 4E6EA 3EVCA 1V25A 1D1TA 1T2CA 3TLJA 4PZUA 1XEXB 2SNIE 1NW7A 2VT7A 2VZ0A 1Y8RB 3E15A 4PU0A 4R2LA 4BJ3A 3BKXA 3IV9A 3VNQA 4Z4GA 1U8EA 1UXHA 2UYYA 1M2HA 5AKKA 4PGAA 5DNEA 2R1TB 3HLKA 4LPSA 2OCLA 4D8WA 4RJLA 3OJEA 5FO0A 1PJAA 2FGJA 4EKNB 2QW1A 1TM3E 4RXMA 4F9FA 3V4LA 1C9MA 1VJGA 4FXPA 4BVJA 3FIUA 5LYYA 3I01M 1JIVA 3GLQA 3W5HA 4MQMA 4UBJA 3MCAA 1V45E 3V3TA 3NDJA 1ML4A 3BF8A 4FC6A 3R7LA 1E3SA 4X65B 5T4BA 2BUCA 3BTUA 2JIMA 1ZCFA 5EJ7A 3B2EA 3RRFA 3ODGA 2JHPA 1IN6A 3NC0C 4TXJA 3LUFA 1Y4SA 2PRZA 3TI9A 1A2KC 4R01A 1GPUA 4BRSA 1G18A 2C0CA 3MOGA 4M0EA 4DMHA 4OYRA 4HAVA 1CJCA 4Z9YA 3TOSA 3W79A 1J49A 1VP9A 4DPLA 4H18A 3CCFA 3ILXA 3S2GA 3VHQA 1URPA 3NNDA 1HQDA 4HDRB 4MQFB 5DW3A 1I5EA 5ITZA 1R1DA 1KVRA 1DKLA 3C98A 5HF9A 2H1HA 2R85A 3NRJA 2DBRA 3WVNA 3ZLBA 3A3OA 4EYKA 4IIEA 1LDNA 4JLKA 2BIFA 4GE0A 1E3QA 3WYDA 1FNCA 4OQ4A 5C8VA 1LUAA 2PPVA 2VPIA 1PJZA 4G86A 1SKMA 4YLYA 3KAQA 1N2EA 4KUEA 4H4CA 4IKOA 4NCAA 4DB2A 1BGXT 1N9KA 2X6QA 2Z3VA 3FZGA 3Q6NA 4LV5B 3UJAA 5KNDH 2WR8A 4QGFA 2NU8B 3UHOA 1BAPA 2AI2A 4XVCA 3QLVC 4IMJB 4KREA 3AG5A 1YZHA 1Z0UA 3MJDA 3OWXA 3LI2A 3PNMA 4G85A 1XLWA 4Z0PA 4LGYA 3L6DA 1S2NA 1MO5A 1BMQA 1XRPA 2I34A 4MJ7A 4AUKA 4O3FA 1E2EA 2XJ4A 3O2SB 3ZJYA 4BE7B 1TMOA 1NQUA 3BE8A 4UHJA 3II6X 2IV2X 1NONA 4X20B 2ZYUX 4JNKA 2IBSA 3O8OB 2FF5A 3HJNA 4I4TB 2FV8A 4QXMA 3MUNA 1Y9JA 1NOJA 1YJAA 1M1UA 2IZZA 3U17A 4RHYA 1NI4B 3O4JA 4DHEA 1X39A 1EAYA 3PC6A 1NY5A 4UMDA 2P79A 1RHUA 1ZYUA 5EY5B 3OC6A 4G97A 3SYMA 1NP7A 2BKLA 4ASUA 3OWHA 2HDWA 4ZAVA 4RDHA 4O63O 4OM8A 4AJ2A 4MDFA 1VECA 1VC2A 2AD5A 2FPPB 2C3OA 4WSOA 2BR5A 3GNLA 2D7JA 1QKKA 4MKGA 2G83A 5BR8B 3JAMA 1Q84A 3E7PA 2FN3A 1Z5ZA 4H4DA 1M2NA 3ER9A 1GKLA 2HNBA 2W43A 5DT9A 5EL0A 2QYOA 1JTVA 1DEKA 1CJKC 4G4SP 3REQB 5JCPA 2O7VA 3DOEA 3HKBB 3ROEA 4FYIA 3TW6A 1LGYA 5ICGA 1FEZA 3BJRA 1U8AA 2JGJA 2P40A 1PR9A 3RJMA 4NCNA 3Q9NA 5ALOA 1E9EA 2Y4OA 3EIFA 1OI4A 2ZRKA 2ZGVA 3VYWA 2ZW9A 2CNBA 4Y2SA 2J3KA 5FIUA 2VAWA 1CPYA 5L8VA 3OQMA 1DOZA 1SWWA 2C8VA 3UPTA 1MR3F 1FUUA 1MMFB 2R00C 3GAMA 2VCYA 2E6UX 1E9FA 1U0RA 1YRWA 4HKTA 3GG9A 4QJ3A 3HJRA 3GLIB 1MNQA 4U2EA 2BL4A 3LQ1A 4JT4A 4Q4HB 2B78A 3CRRA 5EQTA 3I9MA 5T6BA 3KKZA 3WIBA 5JHGB 3FKQA 5CNJA 2P7IA 5IBPA 3ZCQA 4GSYA 1VLMA 4RJ2A 3MLEA 1JHPA 3DV9A 3L2OB 1YAJA 3UV3A 2XXAB 1WQ4A 2P9CA 2XVZA 4PG4A 3IEUA 3FCAA 2X8WA 1W44A 4N3AA 5JYEA 1F8FA 1G21B 3KD2A 3Q5DA 3KQVA 4I50F 4R41A 3ZHTA 4LZOA 4M76B 1J0XO 4PLYA 1RC8A 2F1JA 1TYAE 1XZHA 2Z04A 4LJ9A 1VI6A 4KPUB 3SOPA 3NUQA 4YYZA 1ZY2A 2FZVA 4A27A 1ZHOA 3BBPA 1I32A 3IERA 2HFJA 4KN5A 3JS5A 5AI5A 4Y9TA 2AFHB 1T4BA 1I10A 1QAMA 3AUKA 4DMMA 2QD1A 4ZAWA 1VSTA 1MO2A 1CHDA 3SC6A 2PN1A 2ZUCA 4R2WA 1EFVA 1SMKA 1T4CB 5FI5A 1OYWA 1VCNA 2FGKA 2RJNA 4FJ1A 4JODA 2CL5A 4DIOA 1FE8A 5CRIA 1AKVA 1CX9B 1M5TA 3EIUA 5CH8A 1NW9B 2NAFA 3T5DA 2OG2A 1TRHA 3ZHZA 1C1XA 2OEPA 4XVRA 1DQYA 4U7DA 1DQPA 2Q28A 2GH1A 3GAAA 4BBPA 3FR8A 3HUEA 2HO5A 4NS4A 5AUQA 1I33A 5GJCA 1H3FA 1KDTA 2GILA 2O0JA 4KQIA 4Q82A 5AKZA 3USCS 3ZD9A 3CN7A 1IN5A 2JCYA 2OFXA 1FYWA 1AY0A 1J06A 3QA3E 3TW8B 2W37A 2GN4A 4DLLA 3OOSA 2OCXA 1S8NA 1J8MF 1LZKA 1Q0HA 4HFMA 4RKEA 5HQ3B 5C5IA 2XMZA 2ZUSA 1WJGA 1PSDA 1ECJA 2F9FA 4AJEA 2Z83A 4IJKA 4NYJR 1XYYA 3X43A 1I7SB 1P19A 3RSLA 1DJMA 2B4RO 3KVVA 4C4XA 4HDKA 2P6NA 2EL9A 4BO9A 4DJJA 4E6PA 1EXDA 4NE7A 1J8VA 4JZKA 2GK4A 2XMPA 3SZLA 3P2YA 3KC2A 4YV7A 1REQA 2FFAA 3G1UA 2GCGA 1TGYA 2X5OA 3IKJA 4IV8A 2RGNC 3VSDA 1C3JA 2P2CA 4NNOA 3KVOA 3I6BA 3OZFA 3P19A 1MGOA 1W1UA 3DMTA 2CLHB 3JWEA 3G6WA 3K35A 3WGHA 4HYYA 1EBFA 4JXKA 4OI4A 1II0A 3KQWA 2I6QA 2ZULA 3AZPA 2DFNA 3LSTA 3N8KA 5CXQA 4MQ4A 2VZLA 4XA8A 1QHEA 1WIWA 2AL7A 5EMHA 4BLQA 3GDWA 3U4QB 1GTZA 2Z8ZA 2ZYRA 3DLHA 4Y67A 4JP2A 1OX4B 2PVCA 5EQFA 3QZUA 1T3TA 5TGTA 5MGNA 2E5LB 1ECGA 3I37X 3EG9B 5EAIA 3DAFA 5D6OA 3NBZC 5GV8A 4CKEB 4YCCA 3D8UA 3BL5A 4I3HA 1K6EA 2MWMA 3HKDA 3ACDA 4LDZA 3IAAA 2IXFA 1DE0A 4UCXA 4AY6A 2GJAA 1AE1A 1CRPA 4Q7EA 2YW9A 2G77B 5TMBA 3WA7A 3BHJA 3PS9A 5IVPA 3VR4H 5CDSA 3TXXA 4CEHB 4RS4A 2Z1DA 4RGYA 4TZKA 5THKA 4K9PA 4Q02A 1M6YA 4WZBB 3VXKA 3ZS8A 4FB5A 2HCFA 2Y66A 3FWHA 1GRNA 3VR6D 3PT9A 5D5HA 3T5TA 5A06A 4DC1A 4KO2S 2AJCA 2P2NA 4HGYA 3VDNB 721PA 4FSHA 3K70C 4HPJB 4JYBA 4K46A 5AUOB 3PX2A 5CAEA 4UOQA 2XB6A 5A1JA 2ZSJA 3F6BX 3PEYA 1H1LA 3K4QA 3DOUA 3LPAA 4L0QA 4JLUA 5DM0A 2X77A 3I9FA 3MRTA 2CB9A 5LQRA 1R4MB 1HNXB 3TTTA 4D98A 1GG2A 3PHJA 2P62A 5IVKA 1NFRA 4HMOA 3UJHA 1M2OB 3DC2A 1XAGA 5ULLA 3GG2A 3Q87B 1U3UA 1VHDA 2FUG6 1P1RA 3GFTA 4ZRNA 1WUTA 1IVSA 3KJHA 2QRVB 2D2XA 3E1GA 4LYAA 2DSTA 4V0MA 1XMSA 3JYNA 2A5YB 3P32A 4EJ6A 1XEWX 2I3BA 2IU0A 3GROA 1LBHA 1MW9X 4HDSB 4D0LB 2HPZA 3AR5A 4XVUA 1FUIA 4LRYA 1WVGA 4CG1A 3H3JA 4OAOA 4WINA 1OC4A 1PYGA 4PYMA 2QJTA 2IUSA 1OLUB 1LC0A 4WECA 4YYEA 3D6FA 1QZTA 5E1MA 3A4NA 4NBKA 3EPJA 2EW2A 2VHZA 3WV4A 1UFRA 4Y2PA 1TD9A 4EHAA 3M1IA 1L5VA 1W36B 1OBFO 2VJKA 5JWOA 5IU6A 1BOOA 4R8VA 4E08A 2IEYA 2QMZA 3S6JA 3B13B 1QO0D 3U6KA 3PQCA 3AQIA 1OXTA 1T9BA 3F5MA 5H9WA 5JZBA 3D6TB 1Z82A 4ZCQA 2QUHA 1KI6A 1HKHA 3GJ3A 1PKXA 1IHDA 4N3NA 3X1XA 1NM5A 4C0KA 5IABA 1P8AA 1WXEA 1L4LA 1M75A 3H1GA 1DWPA 2DGDA 4UKDA 1MC5A 1Z8HA 4S05A 4RELA 3LWDA 1VTKA 2UZAA 1QMPA 3PQ3A 3EMKA 4WBXC 4EJSC 2XW6A 1M73E 4W5QA 4OL0A 1NNEA 3C3PA 3BMQB 5B7QA 3A1TA 2YV2A 5D7NA 1L4NA 3E7FA 2V3CC 2O2IA 1YGPA 1IQPA 2LW7A 1FRNA 1NX9A 1SXJE 4FUQA 4WGGA 4X8OA 1O97D 4PNZA 1ZI9A 3W8FA 3EGDA 2X86A 4OLHA 1GQSA 2PGLA 4ZKEA 4KO4S 4YRTA 4GGMX 4F4FA 3MELA 5KTNA 5HE8A 5LQMA 9LDTA 2D7DA 1GRCA 3WTCA 1F14A 3OKPA 4BVLA 621PA 2ZXUA 4Q3DA 2ZQ5A 1ACLA 3NCTA 1RRCA 3ITEA 5A1TA 1E2BA 2JA2A 4XGQA 4BNYA 2Z2IA 1V8PA 4I08A 3B60A 4L5BA 4M21A 1W85B 3T3OA 4JI0B 4R1LA 3TQIA 1C4KA 3M1AA 1OH6A 5B55A 2RAVA 1CZUA 5A9RA 1JG6A 3EASA 1TEZA 5B1SA 5DNAA 5DX0A 4G09A 2B2CA 3VTFA 4R2MA 2QR3A 1L5KA 4RMHA 2GHQA 3QBVA 3PHCA 3KHUA 4MR8B 1AUOA 3UYLA 3W6UA 1FIUA 3A6EA 4QUDA 4X3CA 4HX9A 3GFQA 2DBVO 5SY6A 3G0DA 2FMTA 4C4AA 1Z06A 3NJ4A 4AU1A 4AM8A 4TWRA 4MKZA 3D1VA 2LRHA 4GXRA 2ZYDA 4LDPA 1Z37A 3NWEA 4D02A 3ICPA 1CQJA 4UAVA 2FEAA 2QV7A 5DWDA 3D3KA 1XMPA 4GF5A 2J9RA 4GSKA 5CA0A 4DBVO 1R9JA 3ENZA 4UE2A 4N5IX 4CKCB 5F98A 2ZYSA 3R23A 1ODKA 4UM5A 3RGWS 3X2SA 2ZR7A 3IR7A 4TS3A 4PW0A 4XUCA 5F5XA 4PN7A 2GJSA 5JSHA 4BX0A 4O08A 3A6JA 3O7MA 4ALKA 1NDHA 2R68A 5CJJA 1AUPA 4J0CA 4CMIB 3B36A 4RGBA 2B9EA 3NT2A 2XOKD 3N2YA 5DASA 1XEXA 5KYNA 1W6RA 3R3WA 3GGJA 1Y8RA 3BGWA 5GP1A 3TH5A 3TX2A 3WLTA 2OKGA 4B4WA 1NQVA 5AJVB 5ICCA 9MHTA 1CU1A 1HFKA 1Z4OA 2QQ5A 2R1TA 5IDQA 1YULA 1GD1O 5KCZA 1DPGA 2GCOB 3DHEA 3EOAI 5EIAA 3IQZA 1I7PA 2FUEA 2X1HA 5BUQA 4RH1A 4Q4LA 2RGRA 2GD2A 1KK3A 2NT4A 3GT4A 4GKAA 2Q8PA 1AGPA 1PWZA 4PBRA 3ZCSA 3QLEA 4MVCA 3WL5A 1JRLA 5ESWA 3TB6A 1QUFA 5DFAA 1FS5A 2OGTA 2QLMA 4XWAA 1NVVQ 4H7EA 3RYCB 4GZLA 2CLFB 3ZW8A 1R8YA 1KWGA 1YZYA 5CG1A 2C54A 4WOCA 2HHJA 1G98A 3E1KA 3HWWA 4LVOA 4U00A 2Q4EA 3KFLA 5HJEA 2SHKA 3RC2A 2AK2A 4EB0A 3ELUA 5AK5A 4QGSA 3L49A 1A8HA 4HADA 1HL3A 3QITA 2V9PA 2XMRA 2A3NA 4IO1A 4MXDA 5L6LB 3PL5A 1H4SA 4HDRA 4MQFA 2FEMA 2ID7A 3NAMA 3ELDA 3L0CA 3WQHA 2CBXA 4Y98A 3WR5A 1OXVA 2F6RA 5E3HA 4DLRA 3VZRA 4WBNB 3H5OA 2I9KA 1NIJA 4KE6A 3CVUA 3D2CA 3ISVA 1OXMA 3V4ZA 1YS1X 3SM9A 4M9UA 5M2QA 3LJKA 5T4EA 3GRKA 4NR0A 1PNRA 2ZLBA 2D5LA 3DMNA 2OYSA 1XA3A 2C2ZA 2H7XA 2W6PA 1R7RA 3PA8A 4Q3OA 2NU8A 4MQ6A 3GNTA 4EY7A 1GNSA 3TSYA 1F4VA 3ONEA 5K99A 3LO8A 1EP2B 1X9IA 5EGSA 2NTJA 5TJ9A 3F97A 2O2GA 4ITUA 3TUJC 4M1SA 1E61A 3JTMA 2Q0XA 4GLJA 4Z7JA 3DBHB 3SS9X 2ATEA 1Q1BA 2BFMA 2NO0A 3NR2A 1VBKA 2ZTMA 4X20A 2JEYA 1DL5A 3O8OA 2PUVA 1RZ3A 4I4TA 5FNVB 2RE8A 4K0KB 2QG4A 2XUOA 1TIPA 4G1BA 4KXNA 4AN0A 1XZJA 2QR5A 3KJXA 1NI4A 3BHNA 3MWFA 1R00A 1KZ1A 3OQOA 3OOHA 1HDOA 4AURA 2Q1TA 1XDGA 3D4PA 3PIDA 1Q20A 2GN8A 5JLAA 3TM5A 1Z4NA 4EFMA 1AKEA 1NW5A 2P78A 3ZCTA 5JSFA 4AKIA 2J46A 2FPPA 5ECYA 5CUQA 3R7DA 3HI4A 4WNIA 3ZBQA 5K4GA 1RPAA 3R75A 2JGDB 1KOJA 1ULZA 3DB2A 2J0SA 2H4JA 3HXPA 1IZ0A 3DOCA 1P1JA 1VG9B 2V5AA 3TPFA 3REQA 3TRJA 3ZWDA 1VFNA 3HKBA 2R1VB 2BEUB 2VC2B 3TJZA 2FK7A 4U39A 4JJZA 2HU7A 3L8ZA 5HGXA 1WXIA 3KJFA 3OHMA 3ZGNA 4E11A 3I61A 3UFXB 4U7JA 3JALB 4GPAA 2B8NA 4D5GA 4MQ5A 1SQSA 4LXGA 3FMVA 5J4LA 3HNPA 3UKDA 3P96A 3VBEA 4IIBA 2Q3HA 2ZUUA 4LHWA 1SZCA 5TEWA 4A0QA 1U2GA 4IXNA 2VQ3A 4DJFC 4R3UC 4ZDJA 5LKRA 2FG6C 4UBIA 5SYAA 1MT0A 3UAVA 1YO6A 1AT1A 1CR1A 5DGHA 4Q39A 3K5IA 4JOSA 1A2OA 4Q4HA 4XQCA 4C2AA 3GLIA 3KTOA 4DL9A 4LGMA 1H42A 2DPXA 2PGXA 2IYAA 3HI6A 5ALTA 5KVAA 3ZOZA 1D2MA 1FP2A 4BKOA 4E4RA 1KAOA 1H22A 1NYQA 3MF4A 3FOEC 3MMXA 3O6VA 1Y5NA 3BRWA 4GD3Q 4WJZA 2XXAA 2V1XA 3QRWA 1Z8NA 3BQMB 4JWKA 4MWTA 2INGX 4ENVA 4YRKA 2PX2A 1G21A 3EPHA 3G2PA 3JU3A 1RYEA 3QEOA 3EOZA 2DWQA 5JT1A 1NBME 2JLQA 3QMVA 3HEBA 3SZGA 4IH9A 4KPUA 2HWWA 3PXAA 1G5RA 1F3OA 1N2XA 3VTAA 4YP9A 4PS0A 1Y1PA 4H59A 4FC7A 2D74A 2CHFA 4JVLA 4MP8A 4ND8B 2X4IA 3LPMA 4UD2A 5DU2A 3FWZA 2AFHA 1KEPA 3KEGA 3Q7RA 4KNWA 3RQSA 4GPTA 5EEGA 4EMTA 3C7CB 4ZYZA 2A9FA 4MVYA 4O2RA 2P1DA 1KOGA 1J21A 4AG5A 1T4CA 1E6LA 4D74A 3CCCA 2BLLA 4TV8F 2FG7C 2QM3A 1I4OA 1PX2A 4E7PA 5K0SA 1U11A 2I7DA 4UTVA 3F0TA 1C80A 4JLDA 2ORIA 1PWHA 1ZM3A 3DXZA 2G72A 2NYVA 3QPAA 2JFGA 1RJGA 3MWDB 5IFKA 3FWPA 4IDNA 4ZT4A 4B2IA 5HJ5A 4YBRA 3IIMA 3LVFO 4F93B 2CFTA 3NYRA 1SUIA 4NMXB 3TW8A 2X9NA 1LBTA 3P0JA 5GADl 3V4RA 1TVCA 2P11A 4YRSA 2BFPA 1HE1C 5HQ3A 4XVQA 5HS4A 4JYZA 4RL4A 1I3OA 4MGYR 4WE3A 2V97A 1O95D 1H9AA 3KB8A 1ID1A 2DLDA 1FFDA 3PJGA 5B2EA 2A67A 2I2DA 3PPXA 4GW3A 1I4EB 4UU7A 1NTOA 2AWOA 5L7YA 3V7WA 2FFRA 1E5XA 4EHKA 5JBQA 2O8CB 2R6DA 2MOKA 2A84A 4D9FA 3JQCA 4MV5A 3DLIA 5B58T 2ZWOA 1WQ3A 1U4SA 2IDJA 3PUKA 5CK5A 4DAOA 2EL7A 1OB2A 3C70A 4P7KA 1EE1A 2XY4A 5E4YA 3GFSA 3PXGA 4EAQA 2N46A 3WYGA 2IYPA 3ZHOA 5ITVA 2WILA 1RWPA 2FR1A 4NH0A 1T5OA 4IEEA 4LPKA 2WF9A 2X5NA 3DCIA 3DEYX 2WYOA 2Z5LA 3O0TA 2WTBA 4LDQA 1OX4A 2ZYGA 2DWUA 2R751 2EVWX 1NPTO 3W9UA 5B58C 5DNYB 1OA1A 3EG9A 1F51E 4ODIA 4YT4A 2FW6A 4JC4A 2VDMB 1K8YB 4CKEA 3SSMA 4TTVA 5CD9A 4D0SA 5I9IA 2IX3A 3M49A 2R60A 3IQXA 3AZQA 3VMFA 1PNTA 3PBKA 1PO7A 4DN6A 4C4PA 1N9ZA 1EFRA 2XV1A 3VI3B 2VF4X 5F2OA 1RJFA 1A8IA 3U56A 4LF6B 2HUPA 2FXIA 4YRNA 2VO1A 3B53X 3ZGYA 1NZFA 1SC9A 4CEHA 1C7ZA 2GEUA 4TTRA 5DSZA 3KRTA 4NPAA 3DM9B 4KK3A 4WZBA 4EGCB 4DUZB 1L1RA 3ILHA 2ZAIA 5HOQA 1KJQA 3MJRA 4HAIA 1DPFA 1RC1A 5BN3B 1NBOA 1U9CA 4XIIA 4D9JA 1XZGA 2H6EA 3DKKA 4NBRA 3CE6A 4OQDA 4OK3A 3BDAA 3EPPA 1VYVA 4HATA 4D1YA 1JFTA 5JTTA 2DWCA 2AKEA 1XCPA 3IV7A 3TOVA 4Y9SA 3PFNA 4JX8A 1XLUA 1ZI6A 3BWCA 3IELA 3LYUA 4KIFA 3RUEA 3SR0A 1R4MA 1WUJS 4FJ2A 3BRQA 3RIXA 4M46A 3FA2A 4HB4A 3BWDD 4OBXA 2PQ2A 1M2OA 3WYEA 5AMXA 4D92A 1N5OX 1TYEB 4EB6B 4L7QA 4FYVA 4B8YA 4CYMA 3WO0A 4ZYXA 4AD8A 1JDPA 2QRVA 2I67A 3IDSA 4TMWA 1TAHA 3KVNA 2AS0A 3LL4A 2JKZA 4WPGA 1R2QA 1FJGB 1UZMA 1ZVQA 2CZGA 1X9HA 3BL6A 3H9BA 4HD8A 3R6GA 3I04A 5TSDA 3VVCA 2Y27A 2GARA 3CHYA 2DPMA 2YVLA 4HDSA 4ND2A 4YI3A 2E4UA 3E3LA 4BCCA 1ECPA 4FFMA 3D54D 1MKYA 2C2KA 2ZJ1A 1G66A 1OLUA 2FE1A 5DXJA 2UYQA 2ECKA 1Z5UA 6PFKA 1RWQA 2X6TA 1PWXA 4ABYA 3TD6A 1JB9A 3K9HA 4TL7A 3IKMB 2AUMA 1RT9A 3JCZA 5FNZA 1UDCA 2LE0A 5EYPB 4ZO7A 1E89A 2HADA 2EDCA 2HSZA 2DXIA 1ZD9A 3YASA 3KJIA 1ZGBA 3Q3VA 2E21A 3D6NB 4JLSA 4KQ9A 5LQDA 3H1TA 3IMKA 1OCEA 1N34B 4MW5A 2XE7A 2A8YA 3TD9A 4KITB 2B20A 3A05A 4TMVA 1LV7A 4RORA 1U8UA 2PS3A 3R4CA 2R86A 3KUXA 2C5AA 3BGVA 3ASVA 4GG1A 2FJUA 4BB5A 1CIVA 1JPJA 3PDWA 1HK7A 4LHEA 2C2OA 2FSIA 1P4GA 1YFZA 3AHDA 4KLRA 3RSZA 1ODFA 1CV2A 3KK0A 3P0RA 5FWDA 3BMQA 3RYIB 4ETNA 1UMCB 3TW0A 1VJCA 3AB7A 3BX1A 2QORA 3WL7A 4DG8A 3KOOA 1QWSA 4B81A 2G6BA 2P2LA 4HSGA 4U7GA 3I58A 4MWCA 3C1UA 3SIXA 4MYSA 3GPBA 3TECE 4L76A 5CURA 2QE6A 2V7QD 3SVLA 3DMDA 2I7CA 3N7AA 1N3BA 4GU5A 4CM4B 3AXTA 3JQRA 2BGUA 1MLDA 3MYRA 3N2IA 4O2BB 3IB3A 4U0JA 3LH5A 3QMMA 4WY2A 4DPMA 3LY5A 3V48A 3VH3A 3O91A 5LYJF 4BNUA 1KO5A 2BGWA 3C3WA 4F4DA 1W85A 5BN5B 1W5EA 1Z2DA 1MO3A 1ZK4A 3FF4A 3R3UA 4WFIA 3N6VA 3GBVA 1PRYA 5CBKA 2OQ2A 3LE8A 1FF9A 3WDSA 5CXSA 1QRAA 4L08A 3DVQX 1GZ6A 4MR8A 5KQGA 4HVCA 3B2NA 1PFGA 5C18A 2YASA 4ZVQA 5C32A 1GPJA 1S96A 2QVCA 3HRKA 4D9CA 3IP3A 4ENUA 1EIWA 1L2TA 5H9VA 2PGDA 5ICMA 4I4LA 2QRUA 1I0ZA 2CMHA 3ZDBA 5H7XA 4UPDA 1GWNA 3K6SB 3B51X 3T9DA 1X3LA 1NRXA 4NYIQ 4CKCA 1C9EA 4ZA2A 4WZAE 3ROPA 1SWVA 4GBJA 4JL6A 4U2BA 4X0EA 2Y0EA 3AVOA 3AEXA 5E7IA 5ECDA 5GY7A 4A15A 1QFMA 2ZJYA 5HR5A 1HRKA 1X7XB 4HCJA 5AW6A 5DLYA 4CMIA 1KFBB 1H3NA 5EJ2A 1JUDA 3HUUA 4JNCA 5B1EA 4R1PA 3TXAA 1K9SA 1ELOA 3TZQA 5BSFA 2VJAA 2HGZA 1W0KA 2ZIVB 1DDGA 4HUJA 4A03A 2ZM5A 4PVCA 2AJ8A 4C4RA 1PQ4A 3J7TA 5EZYF 2EDAA 2GCOA 3V2UA 4G4IA 3IAS1 4M87A 5DBEX 1Z0DA 2SICE 1NT2A 2Q6VA 3Q3JB 3R3JA 3QLUA 1TM2A 1XFDA 3HXQA 2V6MA 2WYVA 4LXYA 4MARA 3OICA 6AT1A 1UBOS 3RS9A 1XQXA 2EZ8A 4WK4B 3FXAA 4KPYA 2HMUA 1VQ1A 2QPOA 2GR9A 5CEJA 3RYCA 4UHDA 3SSAA 2YQZA 1TO2E 3K9GA 3NBXX 3ONFA 3GCGA 3RBZA 3I1JA 4RQTA 3PV0A 1FSPA 5AKXA 3EZNA 3G9QA 3UBMA 2G28A 5F51A 2W90A 1QG6A 2QZZA 2BHTA 4RVNA 2IYXA 3BK2A 3PUWA 2CL7X 4FZ5A 4YCMA 1GSAA 3MCWA 1OT5A 1Q1GA 2ZWIA 3BFJA 3F5SA 3OCCA 4CQNA 3AR9A 1Z7GA 4TM7A 3L8GA 4Q3EA 2Q7DA 1SBZA 1EVEA 2BEJA 3FNGA 2C58A 3L6UA 2VATA 1XYVA 1QPZA 3H13A 4FR5A 2I6GA 4DBLE 5ICEA 1RXSA 4A2CA 5AI6A 4HLDA 5G1NA 2PU5A 4DMKA 1KEVA 4HR7A 3S2FA 1CYDA 3DV0B 2IUTA 3FZNA 4FHDA 4PGHA 1H69A 5I7UA 2OCAA 3EXFA 2QI9C 1KPGA 3OQBA 2HEIA 1JEOA 2HSGA 2AF4C 2RK4A 1Z4JA 3IDAA 4R1OA 1K97A 2CKDA 4QUBA 5HQJA 3TR0A 4UNRA 3OAAD 4IDBA 3TMAA 1QM5A 1YE8A 2CL0X 5EJIA 1H2ZA 4NWIA 2WE7A 3D3QA 5C34B 4CXMA 1Y37A 3N28A 1E5DA 3NNNA 2QZ9A 4IHKA 4HWPA 4MUKA 4E3ZA 4JP1A 1WSBA 4LRTB 4F84A 4V1CB 3MJFA 3DBHA 3W5DA 3ZVMA 3ANNA 5ALJA 3TZ6A 2VWPA 3PDCA 5BNTA 1JKJB 1Z88A 3QXJA 5G53C 3TIGA 4NCIA 2HDHA 4ZEWA 1NFFA 4FQ7A 3B3JA 3FI0A 4RPLA 4EA6A 3LQ2A 3ZY5A 2C5SA 1M3SA 3H75A 1XNQB 4LGVA 4M88A 4L4XA 2IPAB 3ESQA 3BCUA 1ZP6A 4P22A 4C0BA 2I71A 1RXIA 2XR1A 1S8OA 1JA1A 1QIDA 2OC9A 1QTNA 1QHXA 3CJTA 2BGRA 3KEOA 4IOKA 4OHWA 4RZIA 2JGDA 2OC4A 3BEOA 2AQKA 2PDAA 1NXXA 3GLVA 1ZA1A 2R1VA 2BEUA 4NJEB 5HIAA 3VYRB 3MHPA 1ABFA 5BYJA 4NHOA 3UWDA 3PRHA 1L4HA 2CLKB 4PFSA 4BRUA 3ONWA 5KYVA 3JALA 4QL3A 1SKYB 2VPQA 4ZTBA 1BQ3A 3RFXA 4B73A 2WHYA 4OU4A 1OH5A 1ZH0A 2IPLA 5J23A 3R6LA 1ILWA 2BMAA 2VF8A 4KVGA 5BSRA 3WAGA 2I1VB 2O50A 3PGLA 2WOOA 2M98A 4X44A 3MTBA 1G7RA 3EFBA 4JLNA 1NVUQ 3IQHX 2R2AA 3OSZA 4GZMA 1EX6A 1V43A 1NLMA 2NXWA 2C8KA 2HREA 4RD4A 4D0NA 3A6LA 3G7UA 4M83A 2IEGA 3GHYA 4HH3C 4G1VA 1L4FA 5JJCA 1Q14A 4GOMD 1FDSA 4DIFA 5TT0A 4JENA 3BZUA 1MB4A 2DTXA 2CB0A 3CSDA 4INJA 4LXHA 5KS2A 3CLVA 2RK3A 4IGIA 2B2NA 5E4JA 2X8LA 3GRCA 4IJMA 1ND5A 3EIQA 2X41A 4FOTA 2AJBA 2IBMA 5C7OO 1Y80A 3EDQA 1N6HA 4LE1A 1OFVA 5AKJA 1PWEA 1TCAA 3MUOA 1EJ6A 2XT0A 3N3AC