3W0KA

Crystal structure of a glycoside hydrolase
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
330
structure length
330
Chain Sequence
MKKYGFNFQWMYVWEEGREPEPPDKKALDFLAETGFNFVRIPVDYRFWTRNFDYFNPDKKVFEYIDLYLRECSARNIHMCLNLHRAPGYCINRNDIERDNLWLDKRAQDGFVYQWELFAKRYKGVSSKFLSFDLVNEPPNIGQYGLTRENHASLIIRTVEAIRKIDPDREIVIDGLGGGNIAMPELAHLGVVHSGRGYQPMALTHYQASWWDGHKGLPEPYYPDLLWQGKVWNKDTLREYYKPWRDLQQKGVNVHIGEFGCFNKTSNDVAIRWFEDVLSLYKEFEWGYSLWNFKGPFGIVEHGRPGAKYEYYRGFKVDRELLDLLVENRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a glycoside hydrolase
rcsb
source organism Caldanaerobius polysaccharolyticus
molecule tags Hydrolase
molecule keywords Bifunctional endomannanase/endoglucanase
total genus 125
structure length 330
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3w0kA00
4TOQA 1XSJA 4AYSA 1M04A 1JDDA 5CPSA 2DH2A 1E73M 1XRVA 1CGTA 3JUGA 2VNCA 4L4PA 1C7TA 4AZCB 3F5JA 1UKSA 3W82A 5A1AA 3GDBA 2Z1KA 1VEMA 2XVGA 4CUCA 3VD9A 1C8YA 1WDRA 3VD3A 2XIBA 1JF5A 5CSYA 4JFTA 3CUJA 1LL6A 4MAZA 2CCRA 3CPUA 2VRKA 4PCSA 1B3XA 1Q6DA 4OUEA 4DM1A 1W9UA 1KBKA 3PZTA 3WQ5A 2YIHA 2VL4A 2QV4A 2WW5A 4ACZB 5A6JA 4OBSA 3POHA 3QHMA 3SUTA 2WSKA 2JIWA 3AS1A 5A6MA 4M24A 1JAKA 3WDQA 4W88A 1W2VA 3IJ7A 3T0AA 4OOUA 4LXFA 3B9EA 5CPQA 1GPFA 2CBVA 5DT5A 3MUZ1 4XZWA 1XGZA 3WENA 7CGTA 1VFUA 3UEQA 4CN4A 5GQBA 3EBVA 3LMYA 4UFIA 4UTFA 2TAAA 2VRJA 2WZEA 3A4WA 3CHFA 1VJZA 3VIPA 1B1YA 2GSJA 2XJ7A 4PMUA 4CCEA 2A3CA 1GQKA 1C90A 4ATLA 3ZQ9A 4JFUA 2J47A 4KRTA 4XUYA 1GONA 1HP5A 4K68A 2G8ZA 4H8VA 4YPJA 3T0BA 2E9MA 1EOMA 5DFAA 4M80A 4AXNA 3VTRA 1VJSA 1E0WA 4TVCA 4ZXOA 3WEZA 3VMNA 3U5YA 1FH7A 2DSZA 4V27A 2XVKA 2YLAA 2WXDM 4P8WA 1V3HA 1E6NA 2BXYA 3DYMA 2FGLA 4WKFA 1H2JA 4GIAA 1NOWA 3A4AA 3EDDA 4DM2A 1ISVA 4BF7A 4H8UA 3AIQA 5A6LA 1GQLA 5A6AA 3LPPA 1WNOA 2WMIB 3UR8A 1PX8A 3F4VA 1CLVA 1ODUA 3CGTA 4B3KA 1GJUA 2DGAA 3NSNA 1JAEA 2WLZA 4NSBA 1ODZA 4JCMA 1XCWA 4J27A 3B8SA 3AHTA 1KR0A 1WPCA 3CTTA 3WF3A 2YL5A 4EANA 1MXDA 1X1NA 4DWSC 1VFFA 2XYLA 3OLGA 3VIMA 1IT0A 3QOKA 2WAGA 2VT0A 1C8XA 3MUY1 4JFVA 5IHSA 2YDQA 2WKLA 3K8KA 4NZCA 2XHYA 2WVSA 4GZJA 3OLEA 3PTMA 4ML4A 2WC4A 3W29A 1W91A 5DO8A 2OWWA 5I0DA 2C8NA 4Z2JA 4EE9A 5BROA 1E43A 3CZKA 3PZ9A 3DC0A 2NW0A 2E8YA 1HIZA 1HJXA 5M3WA 4FMVA 1JZ4A 4JHOA 3W4RA 5JIWA 3OIHA 4TVDA 4AZGA 3GM8A 1JGIA 1UWUA 3TA9A 1CECA 3B9AA 2B31A 3N13A 3KL5A 1KFWA 1W3LA 1B90A 3W28A 5EB8A 4W8LA 4AZIA 1WB0A 2IUZA 5I78A 5JBDA 2ZUUA 3K8LA 4X0VA 3U7BA 4CCCA 1V0MA 2XGBA 1FHLA 1GOQA 1VEPA 1QPKA 3GXIA 3RDKA 1OD0A 2YA1A 5TD4A 3VINA 1FH9A 1MQQA 5I5RA 1CXKA 4BCEA 1E6SM 2J74A 2ZUSA 5I79A 3L4TA 4GO8A 4C7FA 3AXIA 3A4XA 4UFLA 5EMYA 8A3HA 5JBEA 1UKPA 3WNMA 4MNJA 1WP6A 3NJ3A 2GJRA 2WMKA 1EHNA 1GCYA 1TUXA 2VZUA 2F2HA 4D6CA 2EO7A 4M81A 3S6TA 2ZX7A 3LPFA 3N18A 1RP8A 4E8DA 3CMGA 3VDAA 4W84A 1WKYA 1UR2A 4UFKA 1UYQA 2VTFA 4XV0A 3GH7A 1ZBKA 1CTNA 1H11A 1QI2A 2EPKX 4CD4A 1KR1A 2WCGA 1MW2A 3VKKA 3ARYA 1GQIA 3E1F1 1OIFA 4FLSA 3DECA 3GBEA 1BPLB 1PAMA 1JXJA 3WFZA 3W27A 4CCDA 3WH9A 1WDSA 2VURA 1OWQA 2DSVA 2D2OA 1E4IA 4Z2KA 3AIUA 1OSEA 2PB1A 2QPUA 1AVAA 1CGVA 1YHTA 3TOPA 1V3KA 1WZMA 1UQZA 3SIMA 4MADA 1UQYA 1XSIA 2D0HA 3TTSA 3VIIA 1Q6CA 1ZBCA 5IHRA 4NI3A 2XGIA 2J7HA 2JF7A 4WSJA 3WSUA 2EQDA 4FLQA 4JL2A 5JIPA 2J78A 3MMUA 2DT1A 3ZJ6A 2WYSA 4M29A 1J0KA 3RJXA 1ZU8A 1DTUA 4HTYA 3WDPP 4HMEA 1E3ZA 4QDMA 3WNPA 4AISA 1ZJBA 4MAVA 4PN2A 3AI0A 2ZE0A 1PPIA 1BQCA 5ECUA 2WCSA 4YHGA 4JL1A 1J0HA 3NSXA 1ZBVA 3NDYA 1UUQA 3OZOA 4XX6A 4J3WA 5LYRA 3IJ9A 3N1AA 5BXPA 3ZJ7A 1NP0A 1Y7VA 1E6QM 4CD7A 4WF7A 3AOFA 3VPLA 1CBGA 1OT1A 1WDQA 2X8RA 4CD5A 3AZRA 1XH2A 1V6YA 2X0YA 4Z2HA 4R27A 2OSYA 4PUDA 4P8UA 1OBAA 1VRXA 1NOFA 2YL8A 5CG0A 3CUGA 2AMGA 2O9RA 2D3NA 5BWFA 4HU8A 1GNXA 3QGVA 1HNYA 4C7GA 1CXFA 4UFHA 4MNKA 1OT2A 2GDVA 5GNXA 3VD7A 1PEZA 1Q6FA 3ALFA 2DSUA 1H09A 2J25A 4ZENA 3L4YA 2A3BA 5BRPA 2EXOA 3WMCA 3AXXA 5A2AA 2WC7A 1B0IA 3U57A 4E8CA 5E6ZA 4AD0A 3ARTA 1BHGA 3FY1A 3MANA 4PSPA 4QFUA 2Y5EA 2ZXQA 2O9PA 1BF2A 4ACZA 3BC9A 5A8OA 2GJXB 4KGLA 6A3HA 4HU0A 4GZEA 4AMCA 2VQTA 2PC8A 1D3CA 2CKRA 5I6SA 2DDXA 1H1NA 1U33A 2CERA 1V03A 1CGYA 4XB3A 1E9LA 1MVYA 6TAAA 1JIBA 3PZVA 4UFMA 5HDRA 1CENA 4MJ4A 4CKQA 5I2UA 2EBNA 1EO7A 1PZ3A 1XH1A 2VQUA 1K9DA 4BQ2A 4E4PA 4IM4A 3QOMA 2E9LA 1V6WA 3CHEA 3AMLA 3WN6A 5CZKA 2ZUTA 2JF6A 3AYSA 2ZUMA 1GJWA 4D6DA 2UY5A 1E56A 1SR0A 3W0KA 1FA2A 2VMFA 4MB3A 5BRQA 4ATDA 1GVIA 1R86A 3CZJA 4HOXA 5GPRA 4H41A 1FOBA 1G01A 3WD0A 4ACYA 2DEPA 1PX4A 1QHOA 3FHQA 1C93A 1SMAA 3FW6A 3PN8A 1W3HA 5CLTA 3VIOA 4TUFA 3BSGA 4W93A 1XD0A 3OGRA 3BCDA 3CZLA 1UR9A 4U2ZA 2VX4A 3MMDA 2WHJA 4B15A 4W85A 3VX1A 6CGTA 7TAAA 1OM0A 2HVMA 3IJ8A 2ZUNA 4ZEPA 1JYWA 2W91A 3ZOAA 4D6FA 3WH7A 3WQ4A 3TONA 1BTCA 5HXMA 2BXZA 2PBGA 3VVGA 3WDHA 1CIUA 2VX7A 3RPMA 1E72M 2D0FA 2WHMA 1MW1A 1B3WA 1EIBA 1LG1A 2XSAA 4DUVA 4KRUA 1GQJA 4TX6A 1QW8A 4FF5A 3N11A 1IZJA 2NSXA 1UZ4A 2W4XA 4HMCA 2VVNA 5A8QA 3GBDA 4D1JA 1UR4A 4BS0A 4D6JA 3DHUA 2GK1B 3NDZA 4PMVA 3WNOA 1KXQA 3GTNA 3EDEA 1DWGM 3RM4A 1L8NA 4WJXA 1A3HA 3ARWA 4W7VA 2J7FA 1VEOA 4LQ1A 3EMQA 3U5UA 2F8QA 3N17A 2PWDA 3FXYA 1UD2A 4S3KA 3VNZA 4AD5A 1AQ0A 1E4LA 1OD8A 3VD4A 2XFFA 3KE0A 3SEPA 1H0GA 1UWSA 1KWGA 3W26A 1Q6GA 1TA3A 3WFLA 2DQXA 2C0HA 4U5IA 5D4YA 3WD3A 4UQAA 1R7AA 4MDOA 3GNRA 1HF6A 1V6VA 2JE8A 4GPNA 1E6PA 2FGZA 3L4VA 3VM5A 1W9XA 2WNWA 5HOSA 2GVYA 3EDKA 2ZX6A 4U5KA 4N42A 5FOOA 2ZOXA 1JZ5A 1EH9A 3W6LA 4BZYA 3W38A 2VX6A 3SCQA 3NCOA 3OZPA 1JZ6A 1QHPA 1MQPA 4WKAA 3VGFA 1KWKA 1TE1A 4AEEA 3FHAA 3M7SA 4OOZA 3M07A 1NP2A 3MV11 2WZIA 5JUVA 4J7RA 5I23A 2ZWYA 2CNCA 3D5HA 1V08A 1MYRA 4MPKA 4PMOA 3VO0A 5A6BD 2G3IA 4HOZA 4W5UA 4AWEA 4PMNA 4OKDA 1NWTA 5EFFA 1VIWA 3QHOA 2PWGA 4W8AA 4PMRA 5CSUA 4X9YA 1UWRA 3UG3A 4PCTA 3AZSA 1WDPA 3U7VA 3NSMA 1KCLA 2A3HA 1E15A 3IK2A 4V2XA 9CGTA 1I1XA 1V3MA 1MXGA 2W5FA 5LA2A 2E9BA 3CIVA 4HP5A 3W53A 1DWAM 1HX0A 4HA1A 4DWSB 1CZ1A 1RPKA 4UZSA 1BVZA 2VVSA 1F4HA 4EKJA 2CBJA 1K9TA 3WDJA 1E55A 3WL0A 3VUPA 4MDPA 3GYCA 3AQUA 2E40A 3VGGA 1QI5A 1LJYA 1PZ2A 3ZT7A 5DEZA 3MS8A 2BHUA 5LA1A 1EDTA 4FK9A 4PTVA 4F9JA 3UG5A 4QLKA 2UY2A 2QMJA 2EJ1A 3BLPX 3L2MA 4P7LA 1KQZA 3TP4A 1AQMA 3F5KA 1L0PA 3GH4A 1OIMA 1JG9A 2J7CA 1C8QA 1UG6A 1MW3A 4AIEA 1M53A 1E0XA 1B9ZA 1P6WA 1S46A 3OGVA 4PUEA 2OYMA 3UCQA 1EDGA 1H5VA 2FH8A 2WWDA 1DP0A 3OBAA 1GHSA 1K9FA 2CYGA 4B9ZA 2EEXA 3A47A 1HJWA 4GXPA 1JD7A 2CPUA 1GUVA 2PWEA 3BCFA 2D3LA 4CVUA 2Q8XA 3A6OA 5FKYA 3PZIA 1GVYA 1QNOA 1LG2A 1D2KA 2XM1A 3VGEA 1MWOA 4W89A 3N12A 1CEOA 1MFVA 3N15A 4M56A 3VGHA 3WUEA 2FHBA 4KMQA 3DYPA 4EAMA 4D1IA 1ISZA 1UWTA 2PWHA 1V02E 2UY4A 3VIJA 4HZ6A 1B31A 3RILA 3NYDA 4QLJA 5A95A 1HP4A 3AIVA 3MO4A 1TG7A 2DT0A 3FN9A 1G94A 4Z2GA 3PZUA 4JHZA 4PTXA 3THDA 3APGA 3ARXA 2E3ZA 3BAKA 1JI1A 3WNLA 1M03A 1MFUA 3EDFA 3GZAA 4F66A 1E70M 3D3AA 4UQBA 3OGSA 2YDRA 3AROA 3KEHA 4HA4A 2CBIA 5D8ZA 1B3VA 4PTMA 2VCCA 1J9YA 1BYDA 4YHEA 1HKMA 2DIEA 5C71A 3GH5A 1H49A 1A47A 1FFRA 3LPGA 1OGBA 3TTYA 2Y8KA 1N82A 2GDUA 1CGXA 4UOQA 4JKKA 3BMWA 1W1TA 3CO4A 3MU7A 5ABFA 1SFSA 4PMYA 1OCQA 3W37A 1NARA 4UCFA 1HJVA 2ZUVA 3CUIA 4LX4A 2E8ZA 4CD6A 1GOKA 4J3UA 5KZ6A 1JZ7A 2WVTA 1XSKA 1U2YA 1J0YA 1VFOA 2QHAA 3G6LA 3N9KA 1E6RA 5HPOA 3SCVA 1WCGA 1ZJAA 4HPGA 2IXVA 1HKIA 1BYBA 2G3MA 1ZB5A 2J7EA 5ABGA 1OGGA 4R5EA 5I3DA 1SMDA 3BLKA 3GXMA 3T0DA 2BV9A 4J28A 2BHZA 1UH4A 3SCOA 2WANA 1WAWA 4IPLA 4MB4A 1GOWA 1JFXA 2D23A 3DYOA 4NRSA 2RGLA 3ZJ8A 5BXSA 2YJQA 3WF4A 2JALA 3OLIA 1UHVA 5E70A 5HPCA 3BXWA 3WEMA 1BGGA 1M7XA 1LL7A 3WUBA 1W2PA 2CXGA 4RL3A 1PBGA 2X09A 1XC6A 2WMHA 2QLYA 2VX5A 4AD3A 4DUXA 1DWHM 2J7DA 3RCNA 5A8PA 3EMZA 4M82A 2YDSA 1VBUA 2A3AA 4JFWA 2OSXA 1IZKA 2C7FA 3HU7A 2DSKA 4Z2IA 4Y7EA 4QLLA 3SUVA 1QOXA 2OWXA 4FLOA 3WF2A 4WK9A 4JIEA 2VZOA 1CXEA 2NT0A 2WZHA 5FL1A 5DF0A 2EPNA 1US3A 2OYLA 1JYVA 5E0FA 2WK2A 4WLCA 1V3IA 1NOUA 1H41A 1V3JA 1BG9A 4F8XA 2VCBA 1WZLA 4H8HA 1NQ6A 4AZ5A 5M17A 1J0IA 2VR5A 1G0CA 2WKGA 3PZNA 1W9BM 1C3FA 3WQ8A 1TFVA 2RGMA 3OB8A 2XVNA 5CGTA 4F79A 1AMYA 4AD2A 5I77A 3FAWA 4P7OA 4C7DA 3QR3A 4KH2A 1W1YA 1BYAA 2WMFA 1K9EA 4AW7A 4CD8A 3I3DA 4W8BA 2XWDA 2VO5A 3ZSSA 3AJ7A 4M8UA 4U3CA 1EXPA 1JDAA 1UR1A 5AC4A 4UQDA 1C7SA 2UY3A 1EA9C 3AS3A 1RP9A 4KGJA 3O9NA 3ZT6A 1TVNA 5D9NA 1TZ7A 2VZTA 1UD6A 3ZSTA 1JDCA 4GQQA 5F7UA 3VIGA 4D6EA 2CESA 2EPOA 4OBRA 4YN5A 4HPHA 2HISA 1HN1A 4IUGA 5AC5A 1EHAA 4UNIA 1JYNA 1E6XM 4A3YA 2YOCA 3AMCA 2V38A 3AISA 3ARQA 5FIPA 1HJSA 2WCAA 3WKZA 2CITA 3L4ZA 2WHKA 1PJ9A 1J01A 1UD5A 2D20A 5A6KA 2WPGA 2ZX5A 3WF0A 5CLWA 4L4OA 1QNRA 1E0VA 2E0PA 5E6YA 3WQVA 2D24A 3AIRA 5IDIA 1KB3A 2VZSA 4J3VA 2XFRA 3N04A 2D22A 1PIGA 2CBUA 4H04A 2WMIA 5A69A 4MNLA 3IAPA 1K6AA 4LGXA 4UQCA 1CGWA 4GI6A 3K1DA 4X0NA 3VGDA 1CWYA 1KGUA 4P7QA 1V0NA 1LLOA 4HZ8A 4PMQA 1LL4A 1SYTA 3CHDA 2J8FA 7A3HA 2BY3A 3OG2A 2CHOA 1R8LA 4BQ5A 4MTVA 1DWFM 1BVNP 5ABHA 5CGMA 2XVLA 1TVPA 2G41A 3WD4A 2BFGA 4CU7A 8CGTA 3AS2A 1GOOA 1WO2A 2ZICA 3VGBA 1LWHA 3VM7A 5GNZA 1QHZA 3ARPA 4A3HA 1PIFA 3GXDA 1EO5A 1UZ1A 1HKKA 5M5DA 1ZL1A 3CUHA 2VC9A 4OZOA 3VIHA 3CZGA 5A8MA 4CN1A 3AZTA 3AHVA 2WVVB 4HZ7A 4GINA 2JFEX 4PMXA 3WL1A 1UKQA 3S2CA 3ZMRA 3WD1A 1R85A 4TVUA 3WMBA 1UD3A 5IXEA 3ALGA 3FNDA 3ARUA 3AMDA 1YQ2A 3DHPA 5HNNA 2OSWA 2JEQA 2GUYA 4AZHA 2CIPA 3EMCA 3SURA 4FLRA 3QHNA 4BA0A 3MUIA 1F4AA 3BAIA 3OA5A 2DT2A 3UERA 4H7VA 4ATWA 1XV8A 1GOIA 2A3EA 4W86A 1W32A 1WZAA 4WIWA 1J18A 2J79A 2V3DA 1E4MM 1QVBA 2QMKA 4W5ZA 2WMGA 1R7OA 4WKHA 4PYSA 2E4TA 2GFTA 2J4GA 3AMKA 1O6IA 2QF8A 3T09A 1KCKA 4N0RA 3WIJA 2X2YA 1J0JA 2WLYA 1ESWA 1EQPA 1NWRA 3AHXA 4U3AA 1JXKA 1JZ3A 1UA7A 4CN6A 5A8NA 2J8GA 4E2OA 5FL0A 1QI4A 1JNDA 4CU8A 4GKLA 2Y4SA 4GZIA 3RJYA 3AIWA 1Z32X 1ZS2A 3VNYA 1R87A 3NUKA 3RM8A 2D1ZA 3UESA 1I75A 5BXTA 1UH3A 2XIIA 3FAXA 3WH8A 5D8WA 4JZ5A 1ZBWA 3AMGA 3PZGA 1PX3A 4AZCA 2X0HA 2WB5A 2EPMX 4PSRA 3KWXA 3VMPA 1D7FA 4D6IA 1FHDA 2DPEA 3VIFA 3POCA 1RD6A 3T2QA 5GNYA 1E1EA 3T2PA 2ZWZA 2OYKA 1XD1A 4GQRA 1UWIA 5IFPA 2BVDA 1QNQA 3L4UA 3AHYA 4QP0A 4LYRA 1W9VA 2O9OA 3VOCA 2EPLX 3K8MA 3EYPA 3SUWA 4PMZA 2GJXA 1JI2A 1E1FA 4J3XA 2AAAA 1UOKA 4P7NA 1MW0A 2XTKA 2BY1A 2FHCA 5CXPA 5E09A 3SUUA 5JBFA 4DUWA 1W3KA 3M46A 4H2CA 3KZSA 3UG4A 1TR1A 2VJXA 2PF0A 2VZVA 1DWJM 4P7RA 4D71A 3ARZA 3SCTA 5A2CA 3HMCA 2O92A 5CQ1A 1B3YA 3AIEA 1FFQA 1UKOA 1LWJA 4IPNB 5BXRA 2CHNA 3CUFA 1BSIA 2J77A 2Y8VA 5DT7A 5FCZA 4D6GA 3RIKA 5E9AA 3CHCA 1B3ZA 4Q22A 2J7GA 3BAWA 3WF1A 1HJUA 2G3NA 2W61A 3AHZA 5BCAA 3VX0A 1CYGA 3AIBA 4JCLA 3WD2A 2W63A 1UH2A 2QPSA 4A4AA 4AIOA 4UFJA 3A3HA 2PWFA 2Z1SA 3PZOA 3VILA 2WBGA 3W6MA 2XUCA 4UOJA 1DWIM 3RM9A 1QBAA 4W7UA 3L4WA 3SCSA 2V5DA 5A6SA 1C91A 4JAWA 2CEQA 1RH9A 3ARRA 5KEZA 3BMVA 2D0GA 4ZE4A 2ZXAA 3VD5A 1V0KA 3WH6A 1HVXA 2XFYA 3MSDA 4AZBA 5CJ5A 1V0LA 5C8BB 4B9YA 1BAGA 4UR9A 2FHFA 3BAYA 3BSHA 2YKKA 1BGAA 2VRQA 4J3TA 3VIKA 4BQ4A 2V3EA 5A6BA 1HJQA 4MJ2A 2YBUA 2DH3A 2G4FA 1QBBA 1W9PA 4EK7A 3MV01 1CGUA 1UD4A 1JF6A 4P8XA 3L2LA 5AY7A 2VR4A 2BVTA 2VUYA 4B16A 1VB9A 2PBOA 1GOMA 1WE5A 2BVYA 4AY1A 2WVVA 4GI9A 4AZ6A 5CPTA 3WBEA 2J62A 4CVWA 1ITXA 3WEOA 3WUGA 1H3GA 2ESCA 3GNPA 3GNOA 5D9OA 2WMJA 3VDBA 5I24A 5EBAA 4U2YA 4HA3A 5A94A 2ZX9A 3KL3A 4UQEA 1ISYA 3K4DA 5FD0A 2OWCA 5C70A 2WHLA 5AYIA 1TA3B 3ZR6A 1KQYA 3AXHA 1GORA 3ARVA 3OLDA 4PRWA 5IFTA 4QCFA 1KXTA 2CKSA 4JKMA 2JEPA 3BAJA 4RE4A 3J7HA 1W1VA 1E4NA 3WNKA 3ZT5A 1OGSA 4LPCA 3F5LA 2BY2A 5AYBA 1VFMA 1UKTA 1EQCA 2WVUA 2VCAA 5HBFA 2ZUWA 4TTGA 4PEEA 4CU6A 1QNSA 5EFDA 2J7BA 3THCA 4UOZA 3IAQA 1EDQA 2YBTA 4W7WA 5DMYA 1W9DM 4PMDA 4TTUA 1UR8A 3VMOA 4D72A 3II1A 1H0IA 4ZXLA 3WBAA 1FP8A 4IISA 1VAHA 2AOSA 3CZEA 3WDRA 4V28A 1J12A 2VI0A 3CZ8A 1FH8A 5D9MA 4MNMA 4AD4A 1V3LA 1JNEA 4S3JA 4AZ7A 2WC3A 2G3JA 1JZ2A 3SCUA 1QNPA 2WWCA 1NWUA 1E40A 4QCEA 1OB0A 3MMWA 2XPKA 4OJYA 1MQRA 3KL0A 3TTQA 3TTOA 1J0ZA 1LQ0A 2ZIDA 1CXLA 5LA0A 3SCWA 1H4PA 2ZXBA 4ZE5A 2DIJA 1CNVA 1CXHA 4MB1A 1US2A 4DWSA 3VDHA 3K4AA 2X05A 1UWQA 4F9DA 2NT1A 3SCRA 1JFHA 1XH0A 1KXVA 2DSWA 1V02A 1GHRA 2JIEA 1UD8A 2FDMA 1E3XA 3PHAA 3W24A 4AEFA 3BAXA 4WSKA 5ABEA 2W67A 4Q7NA 3RMEA 2V3FA 3VDCA 1QI0A 2IXUA 1M01A 4M1RA 3WNNA 2PI6A 1KGWA 3ECQA 4RE2A 2W66A 3MKKA 3I3BA 1ECEA 3ZO9A 1HXJA 4ZFMA 1ISXA 2ZX8A 4LYPA 1HL8A 1CPUA 1JZ8A 1ITCA 1NWSA 1VF8A 4LYQA 3HJEA 5A2BA 2VOTA 2BHYA 3VU2A 4PBGA 1BG4A 4Z2LA 3B9DA 3AFBA 1G5AA 1NH6A 3WH5A 2F61A 4RE3A 1UA3A 4MB5A 1I1WA 3ZJKA 2J75A 2BY0A 3CLWA 1U30A 1B30A 1QW9A 3T08A 3CH9A 4UZUA 1BLIA 1O7AA 1GZJA 4JFSA 1KXHA 2YL9A 2MANA 1HVQA 2DT3A 2YA2A 2BS9A 1XYZA 5E0CA 2Y24A 1EGZA 4GI8A 1G9HA 3W81A 2WM0A 4AIUA 1OINA 3SCNA 3ZM8A 1VENA 4P8VA 1CLXA 2BNJA 4DWSD 1E6ZA 1FP9A 5M03A 4TXEA 4JKLA 4J3SA 2XSBA 3WMSA 1IV8A 2W62A 5BYWA 3SUSA 1LF1A 3AYRA 1EOKA 1W1PA 1V6UA 1WZKA 3SCPA 3AS0A 5D9PA 3IANA 3NIYA 1X6NA 4U33A 4W87A 1V6XA 2XVPA 3ZR5A 2ZXDA 1NM9A 1DEDA 1J11A 2YL6A 1BYCA 1JYXA 3WQ6A 2GK1A 3MSGA 3GXFA 2OLHA 1Q6EA 4PTWA 1KGXA 1AQHA 3PZQA 1TMQA 2XM2A 4TX8A 3PTQA 3W25A 2WSPA 3ARSA 2V5CA 3MUAA 1HL9A 4HOWA 1XYFA 1ISWA 4D6HA 1DHKA 3PTKA 4U31A 3RO8A 1XCXA 2O9TA 5ABFB 3EDJA 4NRRA 1KBBA 2YLLA 4XZBA 3ZIZA 3WQWA 4B3LA 4AC1X 1GW1A 3L4XA 2XWEA 3T2OA 3UETA 4OIFA 1HKJA 1X6LA 1E71M 4BQ3A 2FH6A 3LPOA 2W92A 2WBKA 1JD9A 4UQ9A 3PZMA 2XG9A 1E5NA 3AICA 1VBRA 2Y2WA 3CBWA 2V3GA 3WELA 4NF7A 5A3HA 2CETA 1J10A 1BFNA 2X1IA 3WY1A 4CGTA 2YA0A 3PBGA 1XHGA 1QI3A 1Q4NX 1B2YA 3K46A 4AD1A 3BGAA 1E5JA 4QAWA 3I3EA 3BH4A 1TCMA 2GJPA 1W3JA 3WDIA 1C92A 1CDGA 3CMJA 2UWFA 4URIA 1UR0A 3O2LA 4GO9A 1CXIA 3G6MA 3UR7A 4KWUA 3M6DA 3WUFA 3O6AA 4HMDA 3HN3A 1JL8A 1HT6A 1G1YA
chains in the Genus database with same CATH superfamily
2Z2UA 4AUBA 4AYSA 1BSLA 1JDDA 3KVJA 3V35A 3H2OA 4IP5A 4OBTA 3OZMA 3E0IA 3GXPA 2VNCA 5AC7A 4MKVA 3FX4A 2NQZA 3SQSA 1JDFA 3W82A 3GDBA 1LRTA 1VEMA 2XVGA 3STFA 1ONRA 5KETA 1UBPC 3VD3A 4QXIA 3NQDA 1A3XA 1XIIA 2YW3A 5CSYA 2VXNA 2OGJA 4IPPA 2CCRA 2VRKA 2PDHA 1B3XA 3Q94A 4CLMA 3BLDA 3T40A 2YIHA 2VL4A 1DIOA 3LLXA 2ZYFA 2QV4A 1GG0A 1KTBA 3POHA 2WSKA 4MOZA 2IW0A 3AS1A 5A6MA 3WDQA 6XIMA 3MI6A 4OOUA 1XFCA 2HWGA 5CPQA 2CBVA 5KZEA 4MIMA 3MUZ1 5CGQA 3WENA 5HQLA 2G4JA 2B7OA 4F48A 1VJZA 3VIPA 1FCQA 4IMGA 3NGJA 3TYDA 4RLIA 3AWOA 1C90A 3PB0A 3W1RA 1S5NA 1GONA 4RV3A 1HP5A 3I65A 4ADSA 4IJCA 2PCEA 3MWAA 3T0BA 2WSYA 3KVLA 4LU0A 2ZA3A 4GUHA 1AA1B 4TMBA 3VTRA 4AXNA 5AFDA 3RO6A 4TVCA 3MHFA 2DSZA 3S8HA 2XVKA 5F2LA 4UNLA 1J6PA 1U5HA 1KKRA 1OFBA 2NLIA 4DO4A 3ZFHA 1JVNA 3P8IA 3R79A 4NAFB 4B2DD 4GIAA 1NOWA 7XIMA 2J13A 3EDDA 4DM2A 4BF7A 2WZMA 3HF3A 3U4FA 1REQA 5A6AA 5HWNA 2WMIB 4O19A 1PX8A 3HPZA 4DJDA 2DGAA 3HFYA 3NSNA 1JAEA 3RNDA 4XTDA 4JCMA 3O0KA 1D7KA 1XCWA 3FJLA 4B5UA 3VFCA 3R4IA 3I68A 4EANA 1FCBA 1F07A 4R88A 2BXVA 2VEGA 3OLGA 5CJMA 1Z42A 4UMAA 2H6RA 1OCNA 3KRZA 2CLPA 4YTTA 3NQ6A 2WAGA 4HHLA 1EP1A 1C8XA 5IHSA 1W17A 3W85A 1DIDA 1QAPA 4GZJA 3OLEA 3TFXA 1FY6A 4Z2JA 3TROA 2RH9A 1X97A 3DC0A 2E8YA 2OX4A 1U22A 3JS3A 5M3WA 3QGKC 4UR8A 3GXTA 5FF0A 1UWUA 2ZE3A 3KFTA 2X1RA 1W3LA 1KFJA 1OFQA 3A4JA 5EB8A 2F6KA 1TWDA 3DBPA 1CT5A 1HO4A 1WDDA 1MXSA 1FHLA 1G6CA 1GOQA 1ZZMA 3UXAA 2EGZA 1YEYA 3L5LA 3RDKA 2ZC8A 1A3WA 1FH9A 5I5RA 1CXKA 1E6SM 2JK2A 4BF5A 5I79A 3L4TA 1TJ1A 2A79A 4FR6A 4ADTA 3R0UA 3QMTA 1K77A 3NJ3A 4K37A 4LNCA 3HQNA 5CSRA 4E6MA 3S0CA 3W73A 1TPEA 4M81A 3S6TA 1RP8A 2IKJA 3NVDA 5EYWA 4Y9NA 1XLDA 3TSMA 4DBWA 4RE0A 1GKQA 2PTDA 4JTAA 2VDGA 3I4KA 5HR7A 1WKYA 1R9XA 1UOZA 4Z1BA 1DJYA 5CKSA 3LHUA 3GH7A 1SFLA 1C29A 4FS9A 1VD6A 2WCGA 3E1F1 1XM3A 1OIFA 3VCCA 3CNYA 1Q2RA 3M44A 2TODA 5SWUA 4GKTA 2QCHA 2EHHA 4XVDA 2PB1A 2QPUA 1CGVA 9XIMA 2BGSA 2F38A 2WM1A 1YTDA 3SIMA 3TEVA 1UQYA 2D0HA 1WBHA 1QRQA 3UJSA 5IHRA 2CLKA 4O14A 4NI3A 2XGIA 4O4VA 2J7HA 3N6QA 2Z7GA 3CPGA 1LDCA 4P61A 3DFHA 5JIPA 3H4XA 2DT1A 5IM51 3G1HA 3ZJ6A 3VNKA 4MFEA 4OVXA 2ABAA 3UPBA 1ZU8A 3C3NA 3IGHX 3UWQA 4HTBA 3OYXA 3ENLA 1KNWA 4HPXA 5ECUA 1J0HA 3V3WA 3RXZA 4J3WA 2BWGA 1I4NA 3TE9A 3ZJ7A 4HYVA 1Y7VA 4CD7A 3AOFA 3QM3A 3VPLA 1OT1A 1T0OA 4CD5A 3T4WA 5DQPA 3AZRA 1V6YA 3S2NA 1E1CA 2XFWA 7ENLA 4ZO6A 1N8WA 2OQHA 3HG2A 1QOPA 1TWIA 1YIXA 4EACA 1S1RA 4IMDA 2D3NA 3N19B 4HU8A 3O8AA 4O57A 1CXFA 1G69A 5GNXA 4TQTA 1BWKA 3M5XA 4IJBA 1H09A 4K8GA 4RDWA 3LUTA 2EXOA 4IZGA 2MUCA 3FOKA 1XRTA 4RZ5A 2Y7DA 1E9IA 1W3TA 3EGJA 1W31A 1BHGA 3MANA 4QEHA 3DZ1A 2CLHA 2Y5EA 4KKXA 2H3BA 4ACZA 3BC9A 4QS5A 5A8OA 2GJXB 4MWAD 4HU0A 3LHWA 2POTA 2VQTA 2PC8A 1G4EA 5I6SA 2DDXA 2Y61A 4GH3A 1YLVA 3CMFA 3TK7A 1GVRA 4XB3A 3L5MA 6TAAA 4S3AA 4ADUA 2GWNA 4CKQA 4LF2A 3L5AA 2EBNA 1EO7A 1KTNA 1Q85A 3IGSA 2C19A 2V67A 2E9LA 4GVHA 4AWTA 4D8ZA 3WN6A 5T26A 4ZTXA 1XIMA 1GGOA 5TBOA 1YPXA 4XO7A 3RPDA 2BDQA 1E56A 1W5QA 2BZNA 3VE9A 5AHIA 4WRHA 2QUTA 5BRQA 4ATDA 4DHGA 3M0LA 4H1ZA 1R86A 5LKYA 4HOXA 4LVGA 4H41A 1FOBA 5HINA 4ZO8A 1W3HA 4W93A 2RUSA 1XD0A 3CZLA 3OJGA 1TELA 2WHJA 4DJED 3EAUA 4W85A 3XISA 2CWXA 6CGTA 7TAAA 5I3GA 1OM0A 2HVMA 2ZUNA 2W91A 1TWZA 3WH7A 3KVKA 4E3TA 2PLKA 1IZCA 4MFDA 4GRSA 4IPJA 3RPMA 4A05A 2OFJA 2WHMA 4QJ5B 2PDCA 1NU5A 4A29A 4REQA 4H00A 2JKAA 3HQOA 1LG1A 2W0UA 4RDZA 4UCGA 3GVRA 4HJWA 4TX6A 2IKIA 3BG5A 1UZ4A 3GR7A 3GHTA 3GBDA 4D1JA 1R3WA 5BOOA 1UR4A 4Z1YA 4WY0B 3NDZA 4M6PA 4PUWA 4ZOAA 3HGJA 3UY8A 4Z1CA 1DWGM 1H5YA 2IQDA 1XX1A 1O1ZA 1FDZA 1DE6A 4RZBA 1SZFA 2F8QA 4S3KA 3VNZA 5E9XA 1SO6A 3OVPA 4K8EA 4R3UA 3GIYA 1Q6GA 3LRMA 4DB7A 3GUWA 2TYSA 4HNCA 5A5WA 1JR1A 4GYFA 1R7AA 3M16A 3GNRA 4G1NA 1J2WA 3E2QA 5LIKX 2I57A 3FLUA 3GAKA 2FGZA 4QR6A 3S6OA 3KWSA 2X7WA 2EG8A 4JEQA 2ZOXA 1JZ5A 1EH9A 3W6LA 1EBGA 1B5TA 2Q8ZA 1VKFA 1QHPA 1MQPA 3KLLA 1KWKA 4IP7A 4QDWA 3E96A 4PUJA 4YVPA 4C91A 3VZYA 3RITA 4OOZA 1JEZA 3M07A 3CQHA 1VYRA 2WZIA 4R85A 1Z6KA 4XZNX 1M9HA 4JTIA 5A6BD 4RNJA 4W5UA 1NWTA 5REQB 1TQJA 3I6RA 2AL1A 1UWRA 3B0XA 3UG3A 1UCWA 1UW9A 3SI9A 3G5EA 1WDPA 3CL7A 2Z2AA 3C0QA 3S6DA 1XYBA 9CGTA 1I1XA 3FA4A 4HP5A 3IJ6A 1TPFA 4DWSB 2VVSA 1K3UA 4AYGA 3WL0A 2ANUA 1EUNA 1XWYA 5LGXA 3NXLA 3VGGA 3LNMA 1H60A 1PZ2A 3ZT7A 4Q8NA 3EA3A 4IWWA 5DEZA 4DJFC 2HPMA 4O0QA 5LA1A 3H54A 1FWCC 4FK9A 4PTVA 3W7DA 4AY7A 2EJ1A 4HB7A 4A3UA 4KWWA 1IXNA 4O1EA 1LBFA 1X98A 2Q3OA 4DN1A 4F4RA 2WNZA 1KLYA 2OLAA 3B97A 3QTGA 3QLDA 5LNSA 4NI8A 1M53A 4LY4A 1FWHC 3ANUA 3GUGA 2ALDA 1DP0A 3G24A 3EOUA 4JIPA 4HHHA 5CC6A 2QDHA 3D6NA 1GUVA 3WQDA 4LY8A 5FKYA 3CAQA 1QNOA 3EWUA 1MWOA 2PUZA 1CEOA 1MFVA 4M56A 3R43A 4GJJA 1ECQA 3IIXA 3XINA 2B81A 1B31A 3U2ZA 1XLBA 9RUBA 3W84A 3NPXA 4MMWA 1GW9A 3EPMA 3V0TA 3FN9A 3QMSA 2LLEA 4B2DA 5JMUA 1DL3A 4LBRA 2HV5A 2HXUA 4OT7A 1DJZA 3P2VA 3DU0A 2A21A 4IGMA 4MVAA 3BAKA 2FZ9A 1M03A 2QZRA 3TCEA 3GZAA 4I5UA 4JNMA 4UQBA 3RN6A 2YX0A 1AMKA 3SO7A 2YDRA 3WLPA 5D09A 5D2YA 3AROA 4IMCA 4IT1A 4MLJA 5CZJA 3UWWA 2CBIA 1JPIA 5D8ZA 2VCCA 4OE7A 2XIOA 2R9RA 4PFHA 5C71A 1W5OA 3GK0A 3PBWA 1C9DA 2DQWA 3CV2A 4F40A 6ALDA 1G7VA 3DH7A 4S23A 1OX4B 3EXTA 3B0PA 2GDUA 3NWRA 4JKKA 4LSBA 1A5NC 4Q7BA 2PGFA 1SFSA 3KW3A 5BOEA 3N29A 3PNZA 1NARA 3LM3A 3BG3A 2X0SA 1R5YA 4E8GA 1GOKA 4J3UA 3UZJA 1JZ7A 1YDOA 1ME7A 4KESA 1U2YA 5C9WA 2OOFA 2QHAA 4ZQNA 3IPWA 3M0JA 1WCGA 2IXVA 1TJ2A 1DXFA 2CLEA 5FJJA 1HKIA 1ME9A 1BYBA 2G3MA 2F84A 5ABGA 1OGGA 1PTDA 3UJRA 1W8SA 3BLKA 2NXGA 1UH4A 1H51A 5M2FX 4X2PA 1WAWA 5DX7A 3VUSA 4MB4A 1GOWA 1JFXA 3RR4A 3NQBA 2RGLA 2X1UA 3ZJ8A 1O68A 5BXSA 4L4MA 3NQ2A 4K7YA 2JALA 1UHVA 5HPCA 4Q4SA 2EAWA 4RL3A 3OVRA 2YXOA 1GWJA 1PBGA 1IXQA 4AU0A 1XC6A 5FACA 2WMHA 2QLYA 1AH4A 2VX5A 1DWHM 1Q7ZA 2Z29A 2A3AA 3N4AA 2OSXA 3G0UA 2OEJA 4PL2A 1XBXA 1TMLA 3H2EA 1QOXA 1BWLA 3WF2A 4WK9A 3ABZA 2E5CA 4FOKA 5K3VA 2Z26A 5ECVA 1CXEA 2NT0A 2WZHA 4LCRA 1OX6A 5DF0A 5EKYA 2EPNA 3MB9A 4N4QA 2PDFA 1O5RA 5E0FA 2WK2A 1P1MA 2GWGA 3INPA 5BZAA 1OEPA 1AZ1A 1EC7A 2YZ5A 4F8XA 2VDHA 1OX4A 1J0IA 2VR5A 5I09A 4PTNA 1G0CA 2WKGA 1VYPX 3OIXA 2P0IA 3WQ8A 3UCDA 3OB8A 5G2IA 1T8XA 2XU2A 4PUNA 3BLFA 4HCHA 5I77A 4P7OA 3QZEA 3QR3A 3IARA 2ZA2A 2C1HA 4AC7C 4E3VA 1BYAA 4EVZA 2A6LA 3NDOA 4CD8A 5CZSA 1V7YA 4CQ9A 4Q32A 2X42A 3HV9A 4LAZA 3V7PA 3QV6A 4M5PA 4P2VA 3KHJA 3I7SA 2V6AA 1GZGA 4KBXA 1JDCA 2XH4A 2P53A 4D6EA 1S3TC 1I2OA 2INFA 4E5TA 5AHMA 1YE4A 1CB2A 2HISA 3MP4A 5DCEA 4UNIA 2V38A 3EB4A 3STEA 5FIPA 2WCAA 3WKZA 4IIHA 5C7VA 5BU6A 5K9XA 1WOAA 1EXBA 1Q8JA 1JCMP 5KZDA 4K6AA 3L9CA 3W70A 3TJLA 3A22A 3CB8A 2FFCA 1XIGA 4S3CA 3WF0A 5DRIA 1QNRA 2VFDA 2C13A 4LEQA 3F2CA 1KB3A 2WSRA 4J3VA 1QK0A 3N04A 2D22A 1PIGA 4H04A 4H6QA 1DYSA 5AVHA 2VFFA 3H2CA 1ZAHA 1CGWA 4REQB 3K1DA 4X0NA 2DJLA 1QO2A 1V0NA 4JS3A 3UZZA 4PMQA 4Q4KA 1PO9A 4I6KA 2X2GA 1AQFA 1BRLB 3WLMA 3GX9A 4JDYA 3SRHA 3TQKA 1TVPA 3WD4A 1U83A 4JIRA 5CBJA 3VM7A 4LS1A 4A3HA 1WA3A 1QFEA 3GXDA 1MUWA 3L23A 5F2GA 4JN7A 4OZOA 3UT0A 3CZGA 4CN1A 4Z0JA 2J88A 4KIEA 3AHVA 3P80A 2WVVB 4HZ7A 4LTSA 3VYLA 2W79A 3UP8A 3S2CA 2Q3RA 4QG9A 4QQUA 3WMBA 2D2HA 4DJDC 3ARUA 4K2SA 1EIXA 3PJXA 1TV7A 3M1ZA 2JEQA 3L0KA 3GIQA 3H2MA 3W7IA 3FV9A 3SY1A 5JH2A 3AALA 3QHNA 1U1UA 3TSDA 4BA0A 3OVQA 5HJLA 3BAIA 4QS6A 4Q4QA 3GO2A 4F0KA 1XV8A 3FDGA 4KWOA 1VJIA 4WIWA 2J79A 4XVEA 2V3DA 3B8TA 1E4MM 1UC5A 3FS2A 1MO0A 2WMGA 1SZEA 1HO1A 2GFTA 2QF8A 3WLLA 2XH0A 1TX0A 3STCA 1T99A 2QJNA 4N0RA 3SFWA 3BLLA 2WLYA 1ESWA 1NWRA 3AHXA 3LOTA 1JZ3A 3D46A 2FVKA 4X61A 2GGEA 5A8NA 3TQVA 4JTGA 2A2IA 1UUOA 1EP2A 1VR6A 5FL0A 1YXDA 3LENA 2Y4SA 2NQJA 1AUSL 1XLHA 1MMFA 5JXQA 1XINA 2D1ZA 4H9VA 1XKYA 1G4SA 3RLVA 4HYRA 5D8WA 2YFNA 3UPMA 1KFEA 4E0CA 4WXZA 3KCJA 4AZCA 3MPGA 2X0HA 2WB5A 4RR4A 3IVTA 2ZZ2A 3R13A 3BLIA 4NZ5A 2CHRA 3LB0A 4BI6A 4HA0A 3GSMA 3IRDA 1D9EA 2JGYA 2OKTA 5GNYA 4CCZA 1E1EA 2RJHA 4JTTA 1US0A 3TX9A 1QNQA 2Z7KA 3LCHA 4LYRA 1R30A 5KZMA 2GJXA 1E1FA 3G1DA 2FHCA 3ABXA 4HK5A 2EF9A 2GJNA 4UTLA 3M46A 3KZSA 4MF4A 4PODA 2PF0A 2VZVA 1DWJM 1TRDA 1W1B1 1TIWA 1Q7QA 4IQLA 4LANA 3SCTA 4ASTA 3HMCA 5CQ1A 1B3YA 3AIEA 4AX7A 1FFQA 3EA2A 1ONWA 3WLNA 1UKOA 4QSHA 3VOJA 4IPNB 3RLGA 1F76A 5AHLA 3CUFA 4Y9PA 3F4CA 1EFZA 3KDNA 1IEVA 3BO9A 3RUBL 4D6GA 3R0DA 4S3DA 3RIKA 1B3ZA 4Q22A 3BZGA 4C1NA 1HJUA 2W61A 4MWAE 2FFIA 3AIBA 4PULA 4DJEA 1LWIA 2QPSA 4I8YA 3PZOA 2AAMA 2QCFA 4N9BA 2XUCA 1DWIM 3RM9A 3EEGA 1S5TA 4IL0A 2I9EA 3P0XA 3HG5A 3SCSA 1C91A 1RH9A 3ARRA 3GHSA 4ZL1A 5KEZA 3CYVA 3G18A 3NQ8A 3WH6A 2QDGA 3I10A 1DIKA 4UR9A 2YKKA 3PK7A 1BGAA 1SSGA 2XSXA 4FR1A 1Q4WA 2TRSA 4BQ4A 5A6BA 2D69A 1FXPA 4DBSA 5DBTA 1TPWA 3RLHA 3MV01 3TUUA 4Q8OA 1CGUA 3EWXA 4BKNA 3LCGA 1Q65A 3R6IA 5CPTA 4CVWA 3DHFA 3DIPA 3WEOA 1H3GA 1AH3A 2XGZA 1ZFJA 2QCMA 4QNEA 5A94A 4O15A 4JOMA 1I2QA 4EWJA 3HJZA 4UQEA 5BU9A 1YYAA 5AYIA 1OFOA 1GORA 3MMTA 2H9AA 3PB2A 5IFTA 3LU2A 4QCFA 4JKMA 4M7SA 4RE4A 1E0UA 4IIBA 3WNKA 1FWJC 1GK8A 2BY2A 1UKTA 2QYGA 4CU6A 1EDQA 3NEHA 4OFCA 1TV4A 4PMDA 1UR8A 1UPMB 3G1RA 1JUEA 4D72A 1FP8A 3EZ4A 3CZEA 4HKPA 4YVXA 3TOYA 5CBIA 5FESA 1J12A 2X40A 1PYFA 1FH8A 5EBUA 3OZYA 2DZBA 2PEVA 4AD4A 4DBDA 2YB4A 1TV8A 3UZ5A 2OJPA 3MKVA 3MMWA 4JTDA 3TJXA 3U3HA 2R1NA 2GVLA 1WX0A 1UP2A 3EX1A 2XDFA 2CU0A 2O55A 1CXLA 2ZXBA 4ZE5A 2DIJA 3K2GA 1US2A 3K4AA 2Q01A 4FXJA 1UWQA 4F9DA 2NT1A 5DCBA 1A5CA 3QJAA 3RX4A 1KXVA 2DSWA 4LB4A 5HMEA 1GHRA 1OF8A 1TWWA 4E2DA 3JRKA 3W24A 3PHAA 4H4IA 4H7ZA 5BRBA 2W67A 4US6A 3TC6A 2ZZ5A 2PPGA 2CZFA 2GQ9A 2IXUA 1M01A 3CV1A 3DFNA 4XZHA 3BCJA 4RE2A 4PBEA 3MA8A 3I3BA 1DV7A 1IIHA 3LCFA 1JPMA 4CQBA 1HXJA 4ZFMA 1WXYA 1ISXA 2O4QA 1HL8A 2PFHA 1UBSA 1ITCA 4O1BA 4LRTA 3MCMA 2ATMA 2B4GA 2F6UA 2RHGA 3R2GA 5H91A 5LHFA 4UIOA 4RE3A 3MBFA 4K3ZA 3GHRA 3TYZA 5CJNA 1TR9A 1RUSA 3B8UA 5FEPA 4F0HA 2J9ZA 3CLWA 1B30A 1QW9A 3CH9A 1O7AA 4JQAA 2DT3A 1PVNA 2YA2A 2BS9A 1EGZA 3EXSA 1NDWA 3Q2DA 1REQB 3M5YA 2WM0A 2PA6A 2OXNA 2BNJA 4DLFA 4YYFA 4Q8MA 3V4BA 5C5YA 3C2OA 4E4UA 4J3SA 1O60A 4H9XA 1ITQA 3LNPA 3IANA 1O5QA 1X6NA 4W87A 1V6XA 3EX4A 3VNIA 4S39A 4MPQA 2YW4A 3MUCA 4I9AA 1BYCA 3PZQA 1K7FA 2XM2A 2XN0A 3ELFA 1W1ZA 2V5CA 1HL9A 3EWZA 3VKAA 4QM1A 4UBPC 1DHKA 1CI1A 1EJSC 3EDJA 1P6BA 5B7YA 1YMYA 5AHNA 4XZBA 1G7UA 4I7UA 4B3LA 3S9ZA 1XIBA 3L4XA 3T2OA 4JEJA 1FWAC 5MHBA 1XF0A 3G77A 2QJJA 4OIFA 3UETA 4GUIA 4EXAA 3TV8A 1KV5A 1JD9A 2W27A 4UQ9A 3PZMA 3ITTA 2XG9A 3AICA 2GYIA 2VELA 3CBWA 3GDTA 1J5SA 2PU1A 3W2LA 3JZUA 5IBXC 3TQ0A 2X1IA 3WY1A 3IUDA 3W07A 3VA8A 1HKVA 4EPDC 3GWQA 1Q4NX 3WK1A 4XAPA 4AD1A 1RCXB 2HNHA 1S39A 1PL9A 2EKGA 3IV3A 2QJHA 4QJ3B 1TCMA 3LMZA 3H24A 1UR0A 4KEVA 3CT2A 4IF2A 4Q8QA 3M6DA 3V16A 3QRHA 2ZC1A 1HT6A 3UVAA 3STGA 1IT7A 1EZ2A 5DN1A 1S2TA 3ZWTA 3ZXWA 5CPSA 2DH2A 1E73M 1CGTA 2BGQA 2Z0IA 3NM1A 3PJUA 3T07A 3BE7A 3MYPA 3ERPA 5FJIA 3CC1A 1RK6A 2Z1KA 3ZLGA 2YGYA 3H70A 1ZJIA 1C8YA 2R82A 4OHQA 4V1YA 3NA8A 3CV7A 1YPIA 3QFWA 1LL6A 3CPUA 1GPWA 3V5FA 4JGDA 1Q6DA 5EMMA 4O11A 4AF0A 3PZTA 1FHVA 3TN4A 3NZPA 2QAPA 4NP7A 2QCDA 5A6JA 5K9DA 2NQ5A 3QHMA 1I0DA 4OTKA 4JTLA 1DJGA 1BEUA 3OBEA 4GI4A 3UYCA 1GPFA 2VD8A 4ALDA 5DT5A 2FVLA 4G9PA 4XZWA 3VC5A 4XIAA 1JPKA 3EKGA 3EBVA 1TV2A 4UFIA 4JTUA 3PR2A 4EXQA 2TAAA 4DBUA 4ZQOA 2WZEA 3A4WA 2YCEA 2NVDA 5DELA 1V4YA 3LQLA 4H01A 1QO5A 2PZNA 4ATLA 1FWFC 3N9RA 4AVOA 4JFUA 4KRTA 2G8ZA 4H8VA 3U48A 1YPFA 5F4SA 1R2RA 2PLMA 4PA8A 4ZVJA 2V5BA 2GQ8A 3BPWA 3U5YA 1OYBA 1YNPA 1AL8A 4J40A 4I7VA 1V3HA 2INZA 1E6NA 2ZTKA 4RW5A 3QGAC 2CLLA 1RAKA 3H2AA 2IMRA 2X1TA 4WKFA 4D9PA 3B03A 4RK8A 3A4AA 3NOYA 2CW6A 4H8UA 3AIQA 2EKCA 3BGGA 1WNOA 1WKDA 3UR8A 4NNCA 2PDPA 3F4VA 3CGTA 3UWVA 1GJUA 1VCFA 4JTFA 1JGMA 3CEUA 1U1HA 1VRDA 3R8RA 3B8SA 4CEXC 3UZWA 3AXKA 3CTTA 1XKJA 1VFFA 4DWSC 4C6EA 1POJA 4UTIA 1UJPA 1XDJA 4E4FA 4A8IA 1YDYA 4F0LA 3WZ0E 3V1HA 2FZDA 4L65A 3IEBA 4JFVA 3NL5A 3URQA 3K8KA 2XHYA 2FYMA 2WC4A 4R7OA 1W91A 5DO8A 5G1YA 4EE9A 3CZKA 5KMYA 4HN4A 3WLHA 3NVTA 1HTIA 4GUJA 4FMVA 1JZ4A 4JHOA 2GSEA 1PIIA 4LWWA 1GVOA 3EPOA 4Q4OA 3W4RA 3W1MA 4AZGA 1JGIA 3TA9A 1F6KA 2B7QA 3RYSA 2NQLA 3UWZA 3W28A 3HMJG 4QGCA 2ZUUA 1V0MA 2XGBA 4FP1A 3VABA 4LEFA 4NG3A 3A5FA 1WKFA 1OD0A 2YA1A 5TD4A 3VINA 1OX5A 5G4WA 4YS1A 1BVWA 1T7LA 3ZLFA 4IQDA 2J74A 4WX2A 4EPKA 4GYJA 4GWEA 3A4XA 1JDEA 4TO8A 5JBEA 3WNMA 2DZSA 1EHNA 1GCYA 2GUUA 3V5OA 2ZBTA 2F2HA 4D6CA 3NO5A 4Z1AA 3NZ1A 3QY7A 5CPOA 3N18A 4RKAA 3LEPA 2ISWA 4TR9A 4XBSA 3C56A 5IOBA 4FNRA 4W84A 3GNDA 1A80A 4A3RA 3QF0A 2VTFA 4XV0A 1ZHAA 3K30A 4HHMA 4DIAA 2BBFA 1QI2A 1LM1A 2EPKX 1Q5MA 1VLWA 3N9SA 2V81A 5LXEA 3PBVA 3VKKA 1NTHA 3ARYA 1GQIA 1AH0A 5T8GA 3ZR4A 3RX3A 4YNGA 2E6AA 3QY8A 3WFZA 3SGUA 3WH9A 1WDSA 1AFSA 2DSVA 3OU8A 5J5RA 5FSEC 4XBKA 1XLJA 4Z2KA 4QAIA 1AVAA 1RZMA 3DHDA 2VEIA 4IIEA 4AQLA 1R3YA 1IHIA 2YCKX 4KEUA 1Q6CA 5HULA 1UIOA 4X60A 2JF7A 2R94A 4S3FA 4WSJA 3WSUA 3M9YA 4JL2A 4QTGA 5AVNA 3EWCA 4NZFA 1YX1A 1V8EA 1J0KA 4ZQPA 2HVNA 3RJXA 3TR9A 4QDMA 1ZJBA 2JQXA 4O4WA 4PN2A 3UR5A 2ZE0A 1PPIA 1BQCA 1XQKA 3NDYA 5AC8A 3OZOA 1V5XA 5LYRA 2HK1A 1GZ1A 1MI3A 3G8EA 3IJ9A 3SSZA 1QW7A 5BMXA 1NP0A 1E6QM 4XZ9A 1CBGA 1WDQA 3E5BA 1XH2A 2HZGA 4Z2HA 2P3EA 3LD5A 1H7RA 1TO3A 1MNZA 1OFAA 4PUDA 1OBAA 1J93A 1JCLA 4UTWA 1VP5A 3MVTA 5D04C 5CG0A 1NEYA 3CUGA 2AMGA 3TN3A 3THAA 5BWFA 3QGVA 4Z1DA 3SIZA 4C7GA 4DO6A 4HD5A 1B9BA 2YYTA 3H4WA 3MZ2A 3UXLA 4DI8A 1Q6FA 3SECA 3ALFA 1OG6A 3WJWA 2W3ZA 3OYZA 2D2GA 4DZIA 4ZENA 2A3BA 5BRPA 2POZA 2WC7A 4DF0A 1B0IA 1R46A 5I00A 3H23A 1RVKA 3FY1A 2VWSA 4PSPA 4OGZA 4KEMA 4QFUA 2CZ5A 4DI9A 1K4HA 4O8AA 2O9PA 3N2TA 1BF2A 2ONEA 4RNFA 3W7OA 3FGCA 2CERA 3LGDA 2V0TA 1V03A 1E9LA 5D2VA 1JIBA 3PZVA 4JICA 1SO3A 2J9YA 3H53A 1CENA 1ONEA 1PZ3A 1XH1A 2VQUA 2G37A 4E4PA 4AWUA 3HGRA 4M19A 3AMLA 1RCQA 5CZKA 4Y8EA 1YRRA 2PTXA 2A5HA 3GU9A 3CIXA 3NFUA 4FXRA 2ZUMA 1PDZA 4D6DA 3R12A 3KLKA 5F2IA 4JQ1A 1SR0A 3W0KA 4UWMA 2O7QA 2FPTA 3M0IA 3DFSA 1AW2A 5GPRA 1GVFA 3PAOA 4ACYA 4LUSA 1QHOA 3BVJA 1C93A 3FW6A 1A5BA 3PN8A 5CLTA 3PBMA 4TUFA 3OGRA 3BCDA 4R34A 2VX4A 3MMDA 1IEQA 2ABBA 2NLYA 3VX1A 3IVSA 4JY8A 3ICJA 2WOQA 4YTUA 3ZOAA 4D6FA 4PCFA 3MJMA 1BTCA 4NJIA 1SJBA 3WDHA 1E72M 3RRXA 2QCEA 4KRUA 3UNDA 4GACA 3E0VA 3N11A 1WAUA 1C9WA 1XYMA 4QG8A 2NSXA 3LRLA 2P5NA 4HMCA 4OWGA 3S5ZA 4BS0A 3N2BA 3TYEA 1KLZA 1U5JA 3L2IA 4PMVA 1KXQA 4H83A 3GTNA 3GG0A 2G95A 1L8NA 4DELA 4GJIA 3PWAA 1A3HA 3K13A 3ARWA 4LFYA 2PRMA 2J7FA 4M51A 4TV5A 3N17A 1PKYA 1TYGA 3BGJA 1L6FA 1V51A 1O5XA 3VD4A 2AKZA 2XFFA 3KE0A 3NZQA 1T6MA 1IYXA 3W26A 3NQGA 2HBVA 3WFLA 3FXGA 2C0HA 4XAZA 1Y5WA 2BODX 5D4YA 4UQAA 3SBFA 1UIPA 4MDOA 1S5MA 2YZRA 3EWBX 3WLJA 3H26A 3L4VA 1W9XA 2WNWA 1HFBA 4C6OA 2GVYA 4XZIA 1D3GA 4U5KA 1QPRA 5FOOA 5I3HA 3GVQA 5AYYA 1IXOA 2V2DA 4Y9OA 4MG4A 3W86A 4RZ6A 3Q45A 4G7FA 2DUAA 2DZVA 2V68A 4IJRA 4B91A 5LIXX 3EOSA 1SSDA 3BURA 1TE1A 5FJOA 2ZA1A 1SJDA 4NIRA 4FXFA 1W1IE 1NFPA 4L1GA 4J7RA 3FYOA 3HM7A 4LVFA 4C90A 5FAGA 3MQTA 3D5HA 4QROA 4PMOA 4HT3A 3FJNA 3NR0A 4AWEA 2DUXA 3FSUA 1VIWA 3QHOA 2PWGA 1V77A 2G50A 3IJDA 4KF1A 3GC4A 5CSUA 4C1KA 1KCLA 1NQKA 1E15A 3IK2A 2OELA 5G4HC 2QQ6A 1V3MA 5HJXA 4N6EA 3MP3A 3VOGA 5D2XA 2FTWA 4GY1A 1F4HA 4S3GA 2CBJA 3NOEA 5LNUA 2OPJA 3ABSA 2IS7A 3VUPA 3GYCA 2P3ZA 1P1XA 3AQUA 3O6DA 3CWNA 5TNVA 3O05A 1LJYA 3W02A 3MS8A 1HL2A 3E74A 2UY2A 2QMJA 1TPC1 4LUYA 3L2MA 3CAWA 3OP2A 3IRSA 5LHEA 4P7LA 1RVGA 2ZKMX 3F5KA 1L0PA 2ZADA 1OIMA 1F61A 3TZFA 3KBNA 1XUUA 1E0XA 1B9ZA 1S46A 4PUEA 1EDGA 2OEKA 2FH8A 1V7AA 2DVUA 1K9FA 4HK6A 4EWND 3A47A 3CXOA 3CB3A 1JD7A 5C6MA 2D3LA 3A6OA 1LG2A 1IXPA 3W71A 4W89A 3N15A 3SM0A 3S3GA 4RXGA 4I3GA 4D1IA 3EWYA 4KCTA 4Q33A 1EF2A 1UWTA 2PWHA 4BWLA 1QCWA 3R11A 4C6KA 3E2VA 2UY4A 3KBMA 3TYAA 1HP4A 4DVOA 3AIVA 1PKNA 4MY8A 5FEXA 3G1FA 1G94A 5I3IA 4JHZA 2ACUA 1SGJA 5IDZA 2GGIA 1MFUA 1PCKA 4F66A 2PDGA 3D3AA 1U5VA 3L7RA 3NQFA 3LBCA 3KEHA 4HA4A 3GKAA 1C8VA 2WV8A 3L66A 5LZLA 2PD9A 3LK6A 1J9YA 3I4EA 2DIEA 3B05A 1A47A 3ZVIA 2BVWA 1DVJA 4Z0SA 5T91A 2Y62A 3EOLA 1CGXA 2HCVA 1DKWA 1W1TA 2RJGA 1JPDX 4PMYA 3FKRA 1NAL1 3F4NA 1HJVA 2REQA 3WK2A 4QE4A 4LX4A 4AG0A 2E8ZA 3EX2A 2HK0A 1DJWA 2WVTA 1J0YA 1TREA 3G6LA 4JTSA 3SCVA 1YADA 3IIVA 3GVWA 1TTQA 2B0MA 4O13A 4C5YA 1TZZA 4R5EA 3H2FA 1AJZA 2AMXA 3WLSA 4XD4A 1IEWA 3T0DA 4J28A 1W54A 4DJEC 7REQB 4ZFCA 2WANA 1SW3A 1MEIA 3C8FA 2D23A 2Q8LA 2IPWA 3QQ1A 2QAFA 2YJQA 3WF4A 4X9SA 1ICSA 3BXWA 1A50A 2ALRA 4LH8A 3WUBA 3GG8A 4B3ZA 4ZB2A 3GZ3A 3QC3A 3L0NA 1EJRC 2Q09A 1H1ZA 3KBWA 4O1DA 5D38A 2JKEA 2YDSA 4AIBA 1ZENA 3AU2A 4QLLA 3SUVA 3O1NA 2OWXA 4FLOA 2F9RA 5F4XA 1XYCA 2VZOA 3ZLHA 5E93A 4DJFA 3VDGA 4YMZA 3GW0A 1VIZA 3SZ8A 3WCZA 4WLCA 1V3IA 3QC0A 4LVBA 4NASA 1XIFA 2CZEA 2VD9A 1BG9A 1WZLA 1NQ6A 5M17A 3PZNA 1W9BM 3PPHA 2FJKA 1TFVA 1QTWA 2RGMA 1W1A1 2XVNA 3ANVA 2QCCA 4NJKA 4UR7A 2ZQ0A 4A21A 3KCOA 2XZ9A 1IR2A 4AD2A 2H90A 7PTDA 1EUAA 2XH7A 3FAWA 2A7RA 1VCVA 4C7DA 1J2BA 1Z48A 2WMFA 1K9EA 4AW7A 4W8BA 1H63A 2VO5A 4UTTA 3WO8A 2HMCA 5BOFA 1EXPA 1VPYA 5AC4A 1EA9C 1VHCA 3GB6A 1JJKA 3O9NA 3ITYA 4MZ8A 3VIGA 1ADSA 1XIEA 1KKOA 4L6HA 2CESA 2QVHA 2FVMA 3UGVA 3IJLA 5AYZA 3U2CA 4IUGA 1EHAA 2DZWA 1HJSA 5HMFA 1OC6A 3H22A 1R3QA 1SU5A 1UD5A 2D20A 3KP1A 1YBQA 2C0AA 2WPGA 5A8GA 3PPFA 1EX5A 2D24A 2VZSA 3UVIA 2CBUA 2WMIA 4Y6GA 4DRSA 3IAPA 1UMYA 4FB7A 4NAEA 5B7ZA 4FOUA 4HCDA 3FJ4A 3RG6A 4GI6A 3KP0A 2DZTA 5HQEA 2GVEA 1KM4A 4FAMA 1CWYA 1ZUAX 3U0HA 1KGUA 1LLOA 4HZ8A 2FMOA 1LL4A 2PDYA 1SYTA 3W9ZA 4LW7A 3KRBA 3RCYA 7A3HA 3ATYA 3OG2A 1R8LA 4MTVA 1DWFM 3ID7A 2XVLA 4CNUA 1KBLA 1GOOA 3TYCA 1TX2A 2ZICA 3H12A 2CLMA 1PIFA 3LTPA 1EO5A 1EEXA 3UR2A 3HPAA 1XICA 4QNWA 1HKKA 5LNRA 2Y0FA 3BARA 3LGEA 3FYYA 2ZTJA 3TQPA 2HS6A 1GVEA 3T7VA 3UA3A 4AVNA 3B8VA 3GAYA 4GINA 3AO0A 4OV4A 4GA8A 1Q6OA 1FWSA 2VC6A 4DPQA 1XI3A 3N2CA 3ZMRA 3W01A 3WQOA 1VS1A 5IXEA 3FNDA 4WJ8A 4HNUA 2PODA 3C86A 4LRSA 3M64A 3VE7A 2GUYA 5XINA 3P5YA 2GOKA 4HNTA 3MW7A 2ZRXA 3LI1A 1PHWA 3K5XA 1XYLA 5FA5A 3MUIA 5H8UA 1F4AA 1F8MA 6TIMA 2DT2A 2FTYA 4H2HA 2HTMA 4ZOCA 4ATWA 1GOIA 2A3EA 1J18A 1I2NA 3E0WA 4NXSA 2NV2A 2OQLA 3QQ0A 1R7OA 4WKHA 1R6WA 4PYSA 2J4GA 3TJIA 3U4AA 5D37A 4MHBA 2O56A 3WIJA 4PRRA 3PG8A 1J0JA 5K9CA 3A9IA 2FTPA 4U3AA 1UA7A 4WQ6A 4Y96A 3SDOA 2VENA 2J8GA 5FF4A 4O8RA 3TSBA 1KBJA 3AXMA 3MDWA 3O06A 4JTKA 4CU8A 1R47A 4PMJA 4W9TA 1IQ8A 3AIWA 3PTDA 1ZS2A 3VNYA 1EJUC 3QSRA 2XIIA 2IPFA 3TTEA 4J3ZA 4KS0A 4JZ5A 1EJXC 4UUIA 1P5BA 3PZGA 1PX3A 4C6FA 2EPMX 2KX9A 3LM7A 4J9JA 1UP0A 3ANYA 1ZALA 3NQVA 2RDUA 1RD6A 1YNQA 3T2PA 4ROPA 2ZWZA 2OYKA 1DQUA 5D2TA 4GQRA 3M43A 5IFPA 3AHYA 4YTSA 3MZNA 1W9VA 4RX0A 3S46A 2PWUA 4LUJA 3K8MA 2PGWA 3EYPA 3T8QA 1JI2A 2AAAA 4AFYA 1W37A 4P7NA 2KAUC 5AC6A 2XTKA 1MDLA 4KCVA 1FBAA 2P76A 4XAGA 3SUUA 5JBFA 1W3KA 2PGRA 4MYXA 2PP1A 2VJXA 1H50A 1QR7A 3ES8A 4D71A 1OFPA 4K39A 1HKWA 1M3UA 2A4AA 4GBDA 3NPUA 2Y7EA 3WLRA 1QASA 4YL2A 4WSHA 3RFAA 4K1GA 1LWJA 2OT1A 1BSIA 1PTGA 4MJZA 4NHVA 1K70A 3UD6A 4EOUA 3DGRA 5E9AA 1L6GA 1X1ZA 1GJPA 4YWSA 2G3NA 3MI2A 1QPQA 3N3MA 3VX0A 1CYGA 1T41A 3BOLA 3C2FA 4JCLA 3WD2A 4TMCA 4Y9AA 3ZYZA 2ZDRA 4A4AA 4AIOA 1EPVA 2PWVA 1UROA 1K1DA 3P60A 5AZ1A 2QV5A 3VKDA 4MGGA 4ERAA 1W3NA 4M6VA 4JAWA 4KWSA 4ML9A 3BMVA 4UTUA 3B0VC 2PTWA 3BV7A 4AZBA 4GC3A 1ADDA 2E7FA 2XINA 1POKA 2PRHA 3IJQA 3K1GA 4LUIA 2V3EA 4MJ2A 4C65A 2F6XA 2DH3A 1P0NA 1W9PA 3P67A 4TU1A 4H9YA 5FJPA 4XO6A 1GVSA 1AODA 5CAKA 2BVTA 4Q4PA 4YLWA 1VB9A 2PBOA 1P43A 4JIHA 2WSQA 2BVYA 4FNQA 4AY1A 2GVGA 1Q2SA 3A9BA 4GI9A 4AZ6A 3E9AA 1TQXA 3HB9A 4XKYA 4FHAA 3GNPA 3JVAA 3QZ6A 1RQBA 5D9OA 2CWNA 2WMJA 3VDBA 1TJPA 4HA3A 2ZX9A 4ZGYA 1GTEA 3MHUA 4IICA 4WJEA 4R7JA 3URNA 1ZY9A 1ZGDA 2WHLA 4R9OA 2QULA 1TA3B 1R3VA 1XLFA 3ARVA 3UXDA 3S1GA 4JX5A 1VFTA 1SFJA 2RFGA 2PZ0A 4O28A 2CKSA 2JEPA 1UASA 5CEWA 1ZQ5A 1E4NA 3ZT5A 3ZZ1A 4LPCA 3F5LA 5AYBA 1VFMA 4O1FA 1EQCA 2RDTA 2WVUA 1Q63A 2VCAA 1SW0A 1QNSA 2J7BA 4ERIA 2B7NA 1BXBA 2PTYA 3U2OA 1GKPA 5DMYA 1JRCA 1HG3A 4BI7A 1IE7C 5J04A 2GL5A 4WUIA 1H0IA 1DJQA 3N4EA 3WBAA 4PUMA 3TU9A 1FWDC 4V28A 4GYKA 2H8ZA 4EPBC 4Y90A 3W2NA 3LBOA 3SR7A 5D9MA 1A5KC 1JNEA 2E5BA 3E12A 2WC3A 3IWPA 4HJFA 2WWCA 1NWUA 1E40A 3TC3A 4IIFA 1DXEA 2FZBA 1J0ZA 3PC0A 2AKMA 2WKJA 3BZJA 5LA0A 3ATZA 4JYDA 1G67A 3M0VA 3DG6A 1JCXA 1L6SA 1RCOB 4MB1A 4FNSA 3DAQA 2X05A 1OADA 2FZMA 4J2PA 1XRSA 3GHUA 1I0BA 2NXIA 3H8AA 1KV8A 2OQYA 5A6TC 3SGGA 4GX9A 1UD8A 1E3XA 5HATA 2QJGA 5FJTA 5I3KA 1MZHA 3ZVHA 1DE5A 3VDCA 2BP1A 1EPXA 3N2XA 1YDNA 2AL2A 2R1LA 4DAFA 2I5GA 5MKGA 2W66A 2YDAA 3NZRA 3T4CA 3ZO9A 3JZEA 1OZMA 4LYPA 4K7VA 1FHUA 2C1IA 2I5IA 2J27A 2VOTA 2BHYA 4PBGA 2J8TA 4XKMA 4LAKA 1LORA 3B9DA 3SFKA 1G5AA 1NH6A 1P0EA 3WH5A 1F74A 1X39A 5ENLA 2F61A 5B80A 4L6DA 2V30A 1UA3A 4MB5A 3B0UX 1TMHA 3ZJKA 1N7KA 4AEOA 3LY0A 2VM8A 3URBA 3MSRA 2BY0A 2WNQA 1U30A 2OLSA 5LIYX 1RV8A 3VZXA 1BLIA 1KXHA 1HVQA 1IR1A 2Z00A 4RCXA 3KBVA 5AYXA 4NZ3A 3ZM8A 4DZHA 1VENA 4P8VA 3NQCA 4DWSD 3GD6A 4CNSA 4LB3A 4P5UA 1E6ZA 1ONXA 1AG1O 1RALA 4NU7A 4HPNA 1JCJA 3JU2A 1FWWA 3H6OA 2W62A 3PFRA 4XAFA 3PPGA 5BYWA 5D32A 1LF1A 1EOKA 1W1PA 3UZXA 5DRCA 1V6UA 3SCPA 3T44A 3AS0A 1DOSA 5FJUA 4U33A 1Y8BA 3GU1A 1R2TA 3ZR5A 2ZXDA 3NURA 4L4LA 4UNKA 3KS5A 1A5AA 5DMNA 5F4WA 1J11A 3CQIA 1JYXA 2GK1A 3GXFA 2OLHA 1TMQA 1W8GA 4TX8A 3PTQA 3ARSA 1ISWA 2NVCA 4D6HA 1PE1A 4U31A 1KTCA 1XCXA 5ABFB 3BQ5A 3EX6A 3UFYA 2YCIX 3B3DA 4OECA 1W3IA 1KBBA 4PB5A 2WPBA 2YLLA 3ZIZA 2I9UA 1X7IA 2FLIA 5E0KA 1D8CA 2E5DA 2EJAA 4O16A 1YKWA 4AHPA 2WBKA 4IIDA 1DJIA 3M47A 1E5NA 3IJIA 1VBRA 3WELA 2H9AB 3NQEA 4F2TA 5A3HA 5T9CE 3BLEA 3GTFA 1QI3A 3GXNA 3SY8A 1E5JA 4IG2B 3QZAA 2OODA 1C92A 4URIA 3G6MA 2FDSA 4NAEB 4KWUA 4IGHA 3W1LA 2ON3A 3OEXA 1JL8A 1QWKA 1QPNA 4TOQA 1XSJA 1M04A 4GABA 1TPDA 1XRVA 3B8IA 1J5TA 4IMFA 3O15A 1ZCCA 3F5JA 2YBVA 5REQA 5A1AA 4IMAA 4Q8TA 1UUMA 4FPSA 4PTDA 3W7CA 2ACQA 2XIBA 3DXIA 2PDWA 3CUJA 5CPMA 4MAZA 1RD5A 2YB1A 1XL9A 3N14A 1KBKA 2FB3A 4KCWA 3WQ5A 3P93A 3UF9A 4IH3A 1QXLA 4OBSA 3CS2A 3SUTA 2NVAA 2E6DA 3C2RA 1Z3NA 1M5WA 1JAKA 4W88A 1W2VA 3IJ7A 3QR1A 2QUVA 4LXFA 3CAVA 2YFOA 1FUYA 7CGTA 1AZ2A 4GD0A 1VFUA 3CM4A 2DIKA 2OTDA 4O0KA 2VRJA 4PFMA 2UV8G 3CHFA 4QX4A 3TYUA 1B1YA 3GU2A 4PMUA 4CCEA 5H8PA 1UPPA 3ZQ9A 2NWSA 4XUYA 4HNVA 4K68A 2WQDA 2QIWA 3B9OA 4UTJA 1QJWA 3LQGA 1EOMA 4C6CA 4MZ1A 1LT7A 1VJSA 1P7TB 4ZXOA 1XXXA 3VMNA 1OC7A 5FEZA 4GFSA 4DWDA 4V27A 1DJXA 1F9CA 2OGYA 4TIMA 2YLAA 2WXDM 1QPOA 4P8WA 1AW1A 2BXYA 1K8YA 3DYMA 3C3UA 4L9ZA 2FGLA 1IEXA 1OK6A 5HMSA 1RBLA 1ISVA 2NQ9A 3DKLA 2FIQA 3BOFA 1DTNA 2C71A 5CAHA 4CNTA 2R6OA 5G4EA 1ODUA 1S2VA 1VQTA 3UNTA 4FO4A 1ELSA 4J27A 3T42A 3MTWA 1KR0A 4MWAA 1Z41A 3WF3A 2YL5A 3REQB 2GDQA 2NXHA 3VK5A 1MEWA 2OOGA 1IT0A 4AY8A 3G2GA 1KM2A 3CUZA 3GYEA 3LYEA 3QOKA 4NXKA 3QH2A 2VT0A 1LRNA 3MVIA 4FX6M 1R3RA 4O53A 4NQ1A 2PAJA 3MI3A 2WKLA 4JTRA 1JQVA 3DFOA 4LAUA 2V5LA 4NZCA 4BJHA 3PTMA 4ML4A 2V2HA 3PWGA 2WNNA 3SRKA 1E43A 3PZ9A 2NW0A 4ILSA 3EWWA 3QW4B 4HSHA 5LNVA 1P0DA 3OIHA 2J9XA 4C1LA 2PU0A 3CU2A 1CECA 2B31A 1KM5A 3KL5A 3RU6A 1B90A 3KTXA 1WB0A 4S1FA 2IUZA 5CC3A 1KFLA 5I78A 3K8LA 4X0VA 3U7BA 1OFDA 4Q7IA 2AQWA 1F3EA 3QR0A 1F2JA 2PS2A 1QPKA 1FKXA 5TF0A 3UJEA 4ZO9A 2E1DA 2TSYA 3DFQA 1MQQA 1LOLA 1OABA 1IEIA 1XP3A 4NJGA 4GO8A 4AXKA 3AXIA 4C6MA 4UFLA 5EMYA 1X96A 2Y6ZA 3HURA 1WP6A 5LIUX 2GJRA 2WMKA 2HVOA 1I60A 2QGHA 3E5PA 3U2EA 3D0CA 1SPQA 1R2SA 1GYLA 2X1SA 4L7ZA 5L6UA 4E8DA 3CMGA 3VDAA 1BWVA 5DMMA 1RBAA 5BNKA 2OO6A 3PM6A 3OHMB 1UR2A 5H1WA 1UYQA 2VR2A 2HROA 5KTLA 3W7LA 1EC9A 3KDOA 5XIAA 1GTHA 1WQ5A 4CD4A 1KR1A 1O5KA 4H6RA 3RPTA 1ZP3A 3DECA 3GBEA 3WLOA 1JXJA 4C6BA 1OWQA 5KSWA 3R89A 6XIAA 1KCXA 1E4IA 3SQLA 3CV6A 1OSEA 2QCDB 3N2MA 3TOPA 1V3KA 3E3HA 1WZMA 1UQZA 1RK5A 1VHNA 4MADA 3RU8X 4PB4A 1M7PA 1ZBCA 3G3DA 1FCUA 2OCZA 2DY3A 3DKJA 1Q66A 4Y8FA 4PRTA 2J78A 3MMUA 5K4ZA 3G1SA 2WYSA 4M29A 1RSCA 4IUOA 4QE1A 1DTUA 1YNYA 4HTYA 3WDPP 2GGHA 4HMEA 1E3ZA 4CNNA 5AZ0A 4AISA 2TMDA 3AI0A 4B5WA 4YHGA 4JL1A 5I3JA 1ZBVA 2WJEA 1ADOA 4XX6A 4NL1A 1R9YA 3M0MA 4PB3A 5BXPA 4IFRA 4GFIA 4M6UA 4WF7A 4B5SA 2X8RA 2X0YA 2VEMA 4R27A 2DVXA 1R9ZA 1Z9AA 8TIMA 3PY2A 1PHQA 4WOQA 3HOJA 1VRXA 1NOFA 1UP3A 4Z42C 2O9RA 2PD5A 3BL3A 1HNYA 1WUEA 1XLMA 2FZ8A 2GDVA 3WLIA 3VD7A 3W72A 2WJDA 3TKFA 1EGMA 4LF1A 1LCOA 3UZYA 5CBBA 2YCLA 5C0QA 3GVVA 5C2XA 3LCWA 4Z08A 3JR2A 5CC5A 4ENLA 3L4YA 3HQPA 3FA3A 2I1OA 5A2AA 1H7NA 2I56A 4WR3A 1A0DA 3GKFA 3ME3A 4FX7A 2XIJA 5E6ZA 4JYEA 5HWJA 1VGAA 3BSMA 5HJYA 2GZXA 4EX4A 3EX3A 4MM1A 4IIGA 3DFPA 3CQJA 3VAVA 1PKLA 3LXBA 1KW1A 2BSLA 4KGLA 1GQNA 1LT8A 3GS6A 1D3CA 3OTRA 4LALA 3ZVHB 4GVGA 1H1NA 1I2PA 3HPXA 3S4TA 4HSOA 2VGGA 1CGYA 4V33A 1MVYA 3M5VA 4FIRA 3BQ6A 4UFMA 5HDRA 1HUVA 2Z6IA 4MJ4A 4FF7A 1FRBA 3P61A 1K9DA 1ZCOA 4IM4A 1T96A 3QOMA 4XKYB 3LV5A 2P1FA 3CHEA 3EA1A 4O18A 1S38A 1ZSXA 4LV9A 2G3FA 1GJWA 1F3WA 3PF3A 1CLKA 2JGQA 2FPYA 2V5KA 1EYWA 2L5HA 1OZQA 1FA2A 2VMFA 4MB3A 1R3SA 1RPXA 3N25A 1DORA 4KQNA 2E09A 1G01A 2GSHA 3OG3A 2DEPA 3H7RA 4O50A 3DGBA 3FHQA 1DJNA 4HBKA 3BK0A 1UZHA 2Z1BA 3FIGA 3VXGA 2QVNA 4U2ZA 6PTDA 2Z2BA 3EEZA 3O6YX 1VFSA 3BW3A 3ITXA 1AD1A 4NZJA 1JYWA 3G22A 1WXJA 4YTQA 3WBXA 3WQ4A 4M6QA 3TONA 4Q6XA 3CJPA 5HXMA 2PBGA 2QNEA 3VVGA 1RLCL 3DC8A 1B3WA 1EIBA 4DUVA 4Q8WA 1PS9A 4N4PA 3HV8A 1QW8A 1YXCA 4O17A 5TIMA 1YTEA 2BGNE 2W4XA 2QCLA 4QJ1A 2YCJA 2GK1B 4LBSA 3WNOA 1GT8A 3EDEA 1KRMA 3TJ4A 4FI4A 4ZODA 4WXYA 4RNHA 4ZZ9A 4LQ1A 4XK2A 3EMQA 3U5UA 2AGKA 2PWDA 1AQ0A 1E4LA 3HPFA 1XDMA 1I45A 3SEPA 1H0GA 1KWGA 2OB3A 1FDJA 4NNAA 4JX6A 3QLLA 4DEFA 4KW2A 1DBTA 3LHTA 4U5IA 3WD3A 5AKQA 1O95A 3ONCA 3T0TA 4ZSUA 4I7WA 2VOMA 2H3DA 3NEVA 3MUXA 1E6PA 5HOSA 4C6QA 2ZX6A 2GOUA 4N42A 2ZFAA 3PPCA 3LTYA 1P7TA 3NPVA 3W38A 2VX6A 3DESA 4LJ3A 2I5QA 3NCOA 2DZUA 1JZ6A 1A4MA 5HA7A 4HNNA 4AEEA 1PZ1A 2ZZ4A 1AK5A 1BKSA 1LZOA 3OVGA 4JIIX 1LOQA 3UG8A 4GIRA 3MV11 5JUVA 1BKHA 5I23A 2ZWYA 4MPKA 4GH1A 4WDTA 4GX8A 3VO0A 2G3IA 3G1AA 1DQXA 4PMNA 2PF8A 1MNSA 1YXYA 3TCSA 4W8AA 1XGEA 4PMRA 4KFNA 4DZ5A 1LYXA 4PCTA 3LA4A 3NSMA 2A3HA 3NL6A 3APTA 4V2XA 4XQ6A 2NWRA 1MXGA 5LA2A 2E9BA 3CIVA 3W53A 3ES7A 1DWAM 1HX0A 4HA1A 4AWSA 1CZ1A 1RPKA 4UZSA 1BVZA 1K8ZA 4DO5A 4G6CA 1OYCA 3OQEA 4HYWA 4IOTA 2ZDSA 1E55A 3WDJA 1PUDA 3FGCB 3HFTA 2E40A 3ITVA 3GQYA 1OFEA 2DU2A 3UG5A 3I7QA 5AHFA 2YXXA 2OKOA 1H61A 3N4FA 2PMQA 4GE8A 4F2UA 3TP4A 1AQMA 5FF7A 3BDKA 1XCFA 1C8QA 1UG6A 1K02A 4Y9MA 1ICQA 2QR6A 3ABOA 3OGVA 3BG9A 1H5VA 4V15A 1QWGA 2WWDA 3GTHA 3OBAA 1F3XA 1GHSA 4S38A 2CYGA 1XLKA 4B9ZA 4F3HA 2Z1VA 2CPUA 4GXPA 2PWEA 1SW7A 3PZIA 1GVYA 1D2KA 1MZRA 2XM1A 1KBIA 3N12A 3VGHA 1QK2A 2FGBA 3IIZA 3R8GA 4AH7A 1XDLA 4IL2A 4DJDD 4BK9A 4C1NB 1JCTA 4Q8PA 2I14A 3RILA 1W5PA 3NYDA 5A95A 1LUCA 1AD4A 3P5ZA 3R25A 1TG7A 3EOOA 2Y8UA 4I9TA 2ADAA 4JXCA 3PZUA 4PTXA 4F2BA 4QHRA 4NZ1A 3WNLA 1JI1A 4YIWA 1EYEA 4YJ5A 3EDFA 1E70M 4H19A 1SO4A 5HUPA 4GG9A 3B04A 1UZDA 3OGSA 4ZO7A 1IGSA 3WQGA 2C15A 1JCNA 3TN5A 1B3VA 3SN4A 3TDFA 3U9IA 4IXXA 4B4FA 1P0KA 3C0SA 4GVIA 4YHEA 1HKMA 3GG7A 3OHIA 2DZXA 3GH5A 4HVXA 3LPGA 1OGBA 3TTYA 1QMLA 2Y8KA 3SJ3A 4DX3A 1N82A 3N34A 1TPVA 4LAOA 3T8LA 3W23A 3BMWA 4GBUA 3MU7A 4OU1A 1GEQA 3GR4A 1AJ0A 2PDKA 1W5NA 1M7OA 4QEEA 3GVGA 4OV9A 4UCFA 3F4DA 3CUIA 5RUBA 4CD6A 4GGHA 5KZ6A 1XSKA 3N9KA 1E6RA 2EG6A 3GNNA 2ZZ1A 4U4MA 4H3DA 4N7QA 4X2RA 4BY3A 3LGGA 3MBDA 1LQ2A 4JN6A 1ZB5A 2J7EA 3SGZA 4WZHA 4A35A 4DLMA 3M0KA 3TH6A 2P0OA 4GCAA 1KM6A 2BHZA 1J96A 3UWEA 2ZVIA 1QOQA 1KCZA 3DYOA 4NRSA 2PDBA 5EGRA 5JU6A 3HG3A 3TA6A 4WCJA 1VBJA 1BGGA 2R8WA 1M7XA 1LL7A 2CXGA 4AX6A 3A64A 4NYYA 4JY9A 4R9XA 3VKBA 4AD3A 4DUXA 3CT7A 2J7DA 3ORWA 2FKPA 4GJ1A 3EMZA 4M82A 4GQGA 2E67A 2VUNA 4JFWA 4C6DA 2RKXA 1YE6A 2C7FA 2GJLA 3HU7A 2Q71A 4Z2IA 1U1JA 2FJUB 4JQ3A 4Y7EA 2YCLB 2Z1WA 3FVMA 4CNPA 2XIQA 1KM3A 1RA5A 4JIEA 5FL1A 3QW3A 4POCA 1US3A 1SZGA 4R33A 2OYLA 1JYVA 3MYOA 3ITGA 4D2JA 3O63A 1NOUA 3N6JA 4XD6A 1V3JA 2VCBA 4H8HA 5K4XA 4AZ5A 4Y2WA 4S3BA 1L6WA 2VHLA 1EP3A 3T1GA 2BOGX 5CGTA 1EJ7L 2BOEX 4F79A 4LOCA 1O94A 1K4GA 3W7RA 2G97A 3KBSA 4KH2A 3PAJA 3DG3A 5XIMA 1TPB1 2CXEA 2XWDA 5EL1A 3CYJA 3ZSSA 3W1Q