3W0MA

Crystal structure of a thermostable mutant of aminoglycoside phosphotransferase aph(4)-ia, apo form
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
293
structure length
293
Chain Sequence
b'VEKFLIEKFGSVSDLMQLSEGEESRAFSFDVGGRGYVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLPETELPAVLQPVAEVMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMFGDPLYEVANIFFWRPWLACMEQQARYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSGAGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hygromycin-B 4-O-kinase
publication title Crystal structures of the ternary complex of APH(4)-Ia/Hph with hygromycin B and an ATP analog using a thermostable mutant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 92
structure length 293
sequence length 293
ec nomenclature ec 2.7.1.163: Hygromycin B 4-O-kinase.
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.150 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w0mA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3w0mA02
2OLCA 5BYLA 5FUTA 4DFBA 2PUIA 4DBXA 2Q83A 5EQYA 3W0OA 4DA5A 3SG8A 4H05A 2PYWA 5IQBA 4DE4A 3SG9A 4DT9A 5IQHA 3JR1A 2B0QA 3TDWA 3ZM9A 4PDYA 4R78A 3W0SA 4DT8A 5FTGA 4DFUA 3HAMA 5EQPA 3C5IA 4FEXA 4O7PA 4CGAA 4R77A 3W0QA 2I7QA 3FI8A 4BR3A 4DTBA 5C4KA 4N57A 3CSVA 4WZYA 1NW1A 2CKQA 5IQIA 4CG9A 3FEGA 3LQ3A 5IQFA 3Q2JA 4U98A 3HAVA 2PUPA 3TYKA 4FEVA 3DXPA 2CKOA 3ATTA 1J7UA 5IQEA 5IQAA 5C4LA 4U94A 4FEWA 2PPQA 4DCAA 3DXQA 2PUNA 5IQCA 5IQDA 4O7OA 2BKKA 3MESA 3N4TA 1ND4A 3TM0A 1J7IA 2PU8A 5EQEA 4CG8A 2PULA 5AFVA 4FEUA 2CKPA 3N4UA 4DTAA 3UZRA 5IQGA 3W0NA 3TDVA 4EJ7A 2IG7A 4GKIA 4ORKA 3W0MA 4GKHA 3F2RA 1L8TA 3N4VA 4R7BA 3W0PA 1J7LA 3W0RA 3SGCA 2QG7A 3ATSA 3G15A
chains in the Genus database with same CATH superfamily
5FBNC 3KB7A 3BI6A 4IBMA 4M8TA 1XH7A 3SD0A 3E92A 2CCHA 2VTMA 4FUXA 4D4VA 2VO0A 3W1FA 4FIHA 4JQ8A 3EQBA 2QURA 5KMNA 3MVLA 1FVTA 4DGNA 4O7ZA 4YJVA 3IW4A 4E5BA 4QMSA 3GCUA 2OFUA 4G3EA 5IQBA 3UQGA 5JFSA 3KK9A 3II5A 1P5EA 3CBLA 4WUAA 3ZCLA 2ONLC 3HLLA 3D2KA 3KKVA 5E8TA 3TDWA 2WGJA 2WFYA 4MF1A 3KREA 5AUZA 5E8ZA 3NNWA 4CEGA 5HNGA 4DEBA 4IVAA 5EK7A 3TKHA 4FIGA 3KU2A 3VJNA 4ENXA 4FV1A 1Q8WA 4O0TA 4QP3A 3FC2A 2R2PA 4M0YA 3OTUA 3FXZA 4YP8A 5KE0A 2JDVA 3RCJA 1H24A 1XJDA 3TMOA 3R1NA 4IEBA 4UWCA 3O8UA 4EHVA 4QYHA 5C9CA 4JAIA 3CSVA 4XMOA 3NCGA 4AN3A 1K9AA 3KVXA 2HWOA 1ZRZA 4DFYA 2ZM3A 3O0GA 1A9UA 4O86A 4AOJA 2XKEA 4E6QA 5JEBA 2VU3A 5DT3A 3OUKA 4I21A 4IAKA 2O0UA 3D94A 3NWWA 3A8XA 4K11A 4DH5A 1PMNA 3PUFC 4CTCA 1E9HA 1UU7A 3R21A 1YWVA 3LXLA 5A4EA 3WIKA 2NNWB 4XOZA 5K5XA 4E93A 3FPMA 1H26A 1K3AA 3E8CA 3LOKA 4UEUA 3G9NA 4EC9A 4D2RA 1OGUA 2PTKA 2W5HA 3R0TA 3A4OX 4IHPA 4CKIA 2WU7A 3IDPA 2QR7A 4WIHA 2IJMA 5M55A 4FK6A 3DY7A 2X6DA 3OXZA 3Q2MA 3KMUA 3VUIA 4NJDA 3VO3A 3E8NA 1M2QA 4LOOA 2VWYA 2J5EA 2JKOA 3PXYA 4MNEA 3SW4A 5CASA 3EL8A 3TACA 4L43A 2ZV7A 3EQFA 2NRYA 4IZ5A 3MFSA 2WNTA 2BUJA 3ZBXA 3N4TA 4YTHA 3ORXA 3S1HA 2HWPA 3ORPA 4RVLA 4AGUA 4QNAA 2R3JA 3FZ1A 4BCFA 1SVHA 3RP9A 5A4CA 1X8BA 5CF8A 2XJ0A 2UVXA 2R3NA 3DBFA 3Q96A 4PTGA 5A6OA 5J5SA 2W99B 3IOPA 5HICA 3ANRA 5AFVA 2RGPA 4KBCA 3FPQA 4DTAA 4HVSA 5FBOA 3VAPA 1VLRA 1XQZA 4UBAA 5IH6A 1Q61A 2OJ9A 4CVAA 4KS7A 4DLJA 3QX2A 2EU9A 3UPZA 4XRLA 4GKIA 4FIJA 2JAVA 3ORLA 3CY3A 1KV1A 4MWIA 4QP1A 4HOKA 3MDYA 1YXUA 2BALA 4Y95A 2Z02A 2BTSA 3OC1A 3DV3A 2YN8A 2W06A 1M7NA 1B38A 3FHRA 3Q04A 4N6ZA 4F64A 1WFCA 4D4RA 1KV2A 4YTFA 5JGDA 4YC6A 4UX9A 1XBCA 1G5SA 4FKVA 3FL5A 3KMMA 4G3CA 4G17A 3SQQA 3HV5A 4WOVA 3KRWA 5D9HA 4YBKA 3DQXA 3UNJA 4FICA 4V0GA 4QDEA 4R3CA 4GFOA 3WE4A 1PYXA 4UWYA 3FZTA 4PMPA 1VR2A 2Y6MA 3F2NA 3HA8A 3OWJA 3F5XA 4FGRA 4IWQA 3JR1A 4O7YA 3KRRA 4RBLA 5IMEA 4F1OA 2W1GA 4FC0A 3MSSA 3W0SA 2C1AA 2XYUA 4MXYA 4S31A 3FZPA 2C30A 3P5KA 3DKGA 3P78A 2YHVA 3FLYA 4GK2A 1Q3WA 5B2KA 3FZOA 5EQPA 2XKFA 3C5IA 3HMMA 4U42A 4YJUA 4QP8A 3S3IA 5JMSA 1MUOA 2GHMA 4JBPA 4L7FA 4C38A 4EL9A 3FMMA 1F3MC 3FBVA 5GJDA 3OBJA 3R02A 2OXXA 1UNGA 1YDRE 3NZ0A 4PP9A 5CZIA 4BICA 4KINA 3VS3A 4I93A 3MFUA 3MI9A 4LMNA 1OL2A 4FIIA 3NIZA 3OFMA 4U7ZA 5B2MA 1OPKA 4USFA 5AUTA 4QPSA 4IX4A 2YDIA 4FKGA 3C0HA 2HZ0A 5HLPA 1KE9A 1SVEA 3FLWA 4GT5A 4A9UA 4ZJVA 3NYXA 4IDTA 3QWKA 3TWJA 3Q4ZA 3CQUA 3TNQB 1YQJA 4MEDA 4DEEA 2PMLX 3QA0A 2XIXA 4LOQA 1J1CA 4BVUA 4Y5HA 4EOOA 3ITZA 4YJNA 2J5FA 3MH2A 3BPRA 4WD5A 4YC8A 3EOCA 2VTAA 1FPUA 5KMJA 1PHKA 3H4JA 5M06A 3PLSA 5EH0A 3D7ZA 1FGKA 4FTMA 5DOSA 1PKGA 2CSNA 4V05A 4F9WA 4WKQA 3WE8A 3E7OA 3LMGA 2JKQA 4ZY6A 4HGSA 1WBSA 3V04A 3BLHA 3COKA 1OKYA 2C5VA 5DN3A 2IN6A 2ZMDA 4O91A 4YZMA 4IWPA 3VW8A 3ORKA 5GIPE 5LQFA 2QD9A 1ZOHA 4PMMA 3ZYAA 4ZS4A 4C58A 1DAYA 5DH3A 4I23A 3BLRA 4TWCA 3FKNA 2WIPA 5F20A 3SX9A 2B54A 4IX3A 5EQEA 2Z7RA 3SXRA 4X2GA 3VRZA 1SNUA 2R3FA 1GIHA 2QG5A 3DDPA 5CLPA 4O7LA 4QMXA 2AC5A 4I24A 1YOJA 4FSQA 4D2SA 2WMBA 2GQGA 4J95A 5AA8A 4RLLA 4MD9E 2PVRA 3QRJA 1QPCA 5AADA 4NM0A 2CPKE 3TV7A 3OZ6A 5B2LA 2WXVA 2IG7A 2FSOX 1YI4A 1MQ4A 2R3MA 3DA6A 3PSCA 4CNHA 4TRLA 3HDNA 3EQRA 4LFIA 5IA3A 1OM1A 5LWMA 1XH6A 2ITPA 3C0GA 3GQLA 3UOJA 4FUYA 2OLCA 4EOMA 2JGZA 3B8QA 3I79A 1EH4A 1IRKA 2I0YA 2IZRA 3OVVA 3QA8A 4FZ6A 4LGHA 1TQIA 4CMTA 4TXCA 4YURA 4QMLA 3TEIA 3TT0A 2FSLX 2O8YA 1XH5A 4AFJA 5E90A 3ZRKA 4AZFA 3MFTA 4A4XA 4IZAA 4JX7A 4ZTNA 1H25A 3VS2A 3P1AA 2UW0A 4LV5A 3MN3A 3LVPA 3E8DA 4H05A 5F94A 1XR1A 3FMEA 1P14A 3UDZA 4XLVA 3UO6A 4HPUE 2J0IA 3F3ZA 3QQHA 3V5PA 2FSMX 4ALWA 3AGLA 2QOQA 3VS5A 3GC7A 4NKAA 4DH7A 4V04A 5ANKA 2WTIA 2PWLA 2ACXA 3BV2A 3KRJA 4I5PA 2J2IB 4HCUA 1CSNA 3AKJA 4TT7A 4ANQA 4U5JA 5HKMA 1IAHA 2BFXA 3Q9YA 3ORIA 4FEXA 2PZRA 4I0SA 3V8SA 3Q52A 5J87A 2C4GA 4C02A 4FGBA 2I7QA 3IS5A 5CTPA 5LARA 3BL9A 3UIBA 3TTIA 2C47A 2J9MA 5KO1A 4GVJA 2X39A 1NW1A 3NW5A 4ONAA 4QYEA 3FC1X 2GHGA 3TXOA 4FKSA 3R8MA 3UTOA 3ZC6A 4WRGA 3W2CA 3OW3A 4IVCA 4RMZA 1Q62A 5KMIA 4XHKB 4AW1A 1GZ8A 3PA3A 1BYGA 3BEAA 4GU6A 3TYKA 2GDOA 4EWQA 2HXLA 5AUVA 3R7OA 3VBYA 4ZLYA 3PYYA 4FNXA 2JD5A 4BTKA 2UZBA 5IQAA 5AV1A 2BDFA 4F6WA 1W0XC 3LCSA 5G1XA 4CFNA 4A4LA 3PSDA 4I5HA 2R64A 2FUMA 3JY9A 2QO9A 3CQWA 3DTWA 2ZB0A 4H3QA 4QQ5A 2XJ1A 1BL6A 3FV8A 3PJ2A 4O21A 3VBXA 4EZ5A 4GS6A 4QPAA 3LIJA 2C68A 2BDJA 4DHFA 4YR8A 4ANBA 5D12A 4YHTA 4XH6A 2R3GA 3R9NA 1J1BA 3TM0A 4R3PA 4ZZOA 2QLUA 1ZYDA 3QFVA 3GUBA 4XP2A 2JKKA 2J6MA 3AD6A 3OY1A 2EXMA 4ACMA 2XKDA 4EH9A 4ENYA 3EJ1A 4IC8A 4APCA 3F5GA 4DFXE 3KL8A 3RGFA 4AWIA 2IVTA 3QALE 4F9YA 2GSFA 2XF0A 4MKCA 4O0XA 1CKJA 3THBA 3GBZA 2YEXA 3CQEA 3IW7A 2C3LA 5DA3A 3RAIA 3U9CA 3V5QA 4NJ3A 4QP4A 3I4BA 5AX9A 2FGIA 4D0XA 1ZWSA 5CU4A 1H28A 2J90A 2W9FB 3FE3A 2JDOA 5DT4A 2ITZA 3E8EA 3ORZA 2QOHA 3EQPA 4PX6A 5JN2A 3KXMA 3NUNA 3R01A 3W0RA 2CNVA 4FV3A 4DEDA 2XK8A 3CLYA 4DG2E 4KB8A 3UYTA 2XIYA 5BYLA 3NSZA 5DIAA 1RQQA 4CFWA 4F08A 4YJQA 3A4PA 3TKIA 4F9AA 4MHAA 4QTEA 4NW5A 3ET7A 2XJ2A 4ZEGA 3SG8A 4D4SA 4DE4A 1OIUA 3PG3A 5EW8A 1KWPA 2PVKA 4XX9A 1WBTA 2WZJA 4HYIA 2AYPA 4KNBA 4WRSA 4JIAA 2E9OA 2XEYA 4FZDB 4OGRA 2A19B 4C2VA 4YSJA 3MTFA 4J8MA 4B8LA 3S0OA 4CRSA 1M52A 2C6TA 3GP0A 3W33A 4BTFA 1FQ1B 1XKKA 5EKNA 4F7JA 4O0SA 3RM6A 3O71A 4DH8A 4BI2A 2QOCA 1U4DA 4A4OA 4EUUA 2OJGA 4YNEA 4BR3A 4U79A 5C4KA 2V7OA 3QTRA 5A4QA 3LHJA 2ITOA 2W0JA 4Z7GA 4MBLA 3Q3BA 4YC3A 2O65A 4Y8DA 5BUJA 5C26A 4I6BA 5L2IA 2VTTA 5HCZA 4BI1A 5HO7A 1PMVA 4DGOA 1V0OA 3M2WA 3SVVA 2GPHA 2RFNA 4O6LA 3ZO3A 4GFGA 4PMSA 5JKGA 4YBJA 5T6KA 5EG3A 1KUTA 3Q4TA 2XCKA 2ZMCA 3ZZWA 4FVPA 3AC4A 1GJOA 4IM0A 4JJRA 1TQMA 2W4OA 3FQEA 4IM3A 3WF5A 1VYWA 4CKRA 2CNUA 4BCGA 3HV4A 5A54A 4W4YA 3PY1A 3ZBFA 4AACA 1ZZ2A 3A8WA 3CPCA 2XNEA 3RKBA 2VN9A 4FEWA 4QMWA 4MXXA 5HG8A 1APME 3R7VA 2YJRA 3V6SA 2HY81 3CPBA 4LL0A 4WUNA 2FO0A 4C61A 5CY3A 3R8UA 2RKUA 3VQHA 4O2PA 1OKWA 4BJJB 2BKKA 5CAQA 1BL7A 1XO2B 2WEIA 3CTQA 1XH8A 3HMIA 3ZONA 5AP2A 1GZKA 4HNFA 4CFXA 4AT5A 3P08A 2ITWA 1JSTA 1UWJA 4AAAA 4QQCA 2DWBA 5I9UA 3SRVA 1QPJA 4G9RA 1NVRA 1NY3A 4FG7A 2ZAZA 5E4HA 2E9UA 2I0VA 3RAWA 4I6FA 3W18A 4H1MA 3ZXTA 4AS0A 1Q8ZA 4PNKA 3RK7A 1I44A 3P79A 3QHRA 4ERWA 4L9IA 1XBBA 2X4ZA 4GUEA 2QU5A 1XMLA 2Y8OA 3UPXA 1LPUA 5KMMA 4DH1A 4EHGA 4HVGA 3M1SA 2GNJA 3F3WA 2XEZA 4NFNA 1UV5A 1M14A 3O96A 4G6LA 4WHZA 4U44A 4JRVA 4XV2A 3S00A 4GK3A 5AX3A 3C4EA 1JPAA 2C6IA 2UZNA 4RC2A 2YIXA 3Q9XA 5D7AA 5AP7A 4FNYA 3ZM4A 5IA1A 1MRUA 4S34A 3IW5A 3C4CA 4GCJA 4QP7A 5IMXA 2X2MA 4FSTA 4O7NA 3ATSA 4XG2A 3FMDA 3GC9A 4OTRA 2YZLA 4M14A 4EH5A 4FODA 3TUCA 3C50A 4O96A 3JXWA 4GUBA 5FM2A 5H8BA 4XBUA 5CSWA 1ZY4A 4S32A 5E9EA 5DR6A 5HD7A 3UG1A 4NW6A 2PSQA 1ST4A 4L44A 3UIMA 1SMHA 3IONA 4KRDA 4X21A 3R63A 4C3FA 3MY0A 3KCFA 5CXZA 4HYUA 3Q9ZA 5KBRA 5L6PA 4Y83A 3RPOA 4O27B 4EWHA 5CSPA 1YWRA 3WYXA 4DT9A 3POZA 3OG7A 3AC8A 2W1EA 3FLQA 5HIEA 4QQJA 4JT3A 4PRJA 2YFXA 4RZWA 3PTGA 4KIOA 2RL5A 3A99A 1UWHA 3TV6A 5I9YA 3DAKA 3ZSIA 2ONLA 3EN6A 2R7BA 3D5XA 4AA4A 4JNWA 5H2UA 3RK9A 3PFQA 3C1XA 3E87A 2PMOX 2HENA 4RJ7A 3OWKA 5AV3A 2A1AB 3E88A 4H39A 5DNRA 4W4WA 3U6JA 3PZHA 4DEAA 1G3NA 3LXNA 3P9JA 3W2SA 4RIWB 1FGIA 4I92A 3FY2A 2C6KA 5IDPA 5IEYA 3QTIA 2RFEA 1R0EA 2UW8A 3DJ7A 3OF0A 4HJOA 3PP0A 4KD1A 4KBKA 2HW6A 3BLAA 5AAFA 4XJ0A 5D11A 2CCIA 4XG6A 5CVFA 3CGOA 5D41A 3HYHA 3AG9A 1ZARA 2Y6OA 4W8EA 4ZAUA 3CS9A 4Y85A 4O7RA 4K9YA 5KMLA 2W4JA 3U4UA 3LJ1A 2CKOA 5AUYA 4IAAA 3TZ8A 2C3KA 3FLSA 2F2UA 4J7BA 5L8JA 4AT4A 1YVJA 3ELJA 4OW8A 4UZHA 2PZPA 5JRQA 3CP9A 2GQSA 4A9YA 2I1MA 3GU6A 4ASEA 3VUDA 4ITIA 4IH8A 4JX3A 4D5HA 4F6SA 1URCA 4G3GA 4QP9A 5FTOA 4LM5A 2PVMA 4EQCA 4L01A 5EW3A 3Q53A 4DYMA 5L3AA 1BLXA 1RJBA 4O7OA 4F7SA 4FBXA 5E92A 1CM8A 5L2WA 3IW8A 3K3JA 4DHZA 2GTMA 3UQCA 1ZMWA 2QOIA 4TNDA 4RJ8A 5F1ZA 2GFSA 5I5ZA 2Q0BA 1SVGA 1JLUE 4OTHA 5LMKA 2G2HA 3OEZA 1Y6BA 1BI7A 4F65A 3BGZA 4CG8A 4NK9A 3PVGA 1J3HA 5IA2A 2XNMA 5CZHA 3NW7A 4CTBA 3T9TA 4BDDA 1OITA 3BYMA 1PF8A 3KRLA 5HX8A 2W4KA 5KX8A 3AC5A 4MNFA 4F99A 5M08A 4BRXA 3D2IA 4EUTA 2JFMA 4C4GA 4PY1A 3FKLA 3W2QA 4U81A 4UWBA 3HP5A 4HYSA 3WYYA 4ORKA 3W0MA 3K3IA 3G33A 4MXAA 5CU3A 3DPKA 1L8TA 4BCPA 4RRVA 3DNEA 3UOLA 2QG7A 4TPTA 5CF6A 4FKLA 3RAHA 4E73A 3BE2A 3VJOA 3QLFA 2OIDA 2FVDA 3SKCA 4ACCA 2X7OA 4LDTA 3ULIA 2BRNA 3QYZA 4ZSAA 5HTCA 3E5AA 1H4LA 3OMVA 1OKZA 3QX4A 3W32A 5HNIX 4R1VA 4XG7A 5A14A 5K3YA 4R5SA 4RVKA 3VC4A 5GIOE 3TNPC 1YDSE 3W2PA 2IO6A 3E64A 3WZUA 2QOLA 2YIQA 4S30A 4C4HA 4EZ3A 3NCZA 3REPA 4A7CA 4IWOA 2O2UA 2RIOA 4DEGA 4RZVA 2V55A 2DUVA 3MBLA 3OOGA 2OZAA 2WO6A 1W7HA 4ASXA 2XYNA 1BX6A 4AZWA 4QYYA 4DFUA 2VWUA 3AKKA 4AZEA 4R77A 2GS6A 4FV7A 4EK8A 2UVYA 4NFMA 3O8TA 5E7RA 4ERKA 4F7LA 4U6RA 3HMPA 1QPEA 4FOCA 4FT5A 3VS6A 5M44A 2Q0NA 3EZVA 5FGKA 1R0PA 5J95A 3IDCA 3HL7A 1V0BA 4IADA 2XALA 4O0VA 5FQDC 4EOPA 3FEGA 3U8WA 1XH9A 4PNIA 1HCLA 1PKDA 3AKLA 2VTJA 3C4XA 3UBDA 4EZ7A 3NUXA 1MP8A 2QKWB 1GIIA 4LG4A 2VTLA 4R1YA 5ANGA 5G6VA 3CC6A 3HAVA 5ANOA 4EH6A 4USEA 4QMZA 4QP2A 4KBAA 4BCJA 5K4IA 3QXOA 2QI8A 4RC4A 3OT8A 3C9WA 2YABA 3ATTA 4YO4A 4UALA 3SOCA 2C0OA 3HV3A 4HPTE 3MFRA 4BDFA 3FMKA 3L8VA 1JKTA 2R9SA 3FI3A 3RI1A 3ANQA 2GNHA 4L42A 4A9RA 3D0EA 3AGMA 4FVRA 4GT4A 5AEPA 3LFFA 1U54A 2C6DA 2CGUA 2ZV9A 5BMMA 2ZDTA 3PJ8A 1P4FA 3T3UA 4EQUA 4X2FA 3TL8A 5CVHA 1WMKA 4AE9A 5HD4A 2R3IA 3DZOA 2VTSA 4K2RA 4ZTSA 3ZHPC 4BDIA 2E9PA 3OOMA 2AEGA 2X8EA 3FLNC 5IPJA 4MK0A 2BPMA 2ZM4A 3COIA 4BBFA 4A9TA 3NS9A 3ZO2A 4D55A 5C8NA 4FJVA 4FKIA 4RIYB 4EORA 3IPHA 4TY1A 3ZEWA 4BZOA 3NFFB 3R6XA 4RQKA 3VF9A 4S2ZA 2VX1A 3PVBA 5CS6A 3FXXA 1YXTA 3EN5A 2VTIA 3QF9A 4MD7E 2YITA 4F0FA 5TO8A 2YM8A 4FTRA 3ZSGA 4WSYA 3F7WA 3R9HA 3O7LB 2PULA 2VWIA 3HRBA 5HE0A 2HK5A 5DYJA 5CEIA 3S95A 4BBMA 1PXNA 2CKPA 3TZMA 1PRYA 1CTPE 5HO8A 2X8DA 3D5UA 2R7IA 2X0GA 2ZV8A 2PUUA 1K2PA 2CN5A 3MA3A 3NX8A 4ACDA 5IQGA 4BI0A 4LUDA 5LMKC 4TYHA 3TCPA 3VVHA 3DKFA 3PPZA 2C69A 4OUCA 5E1EA 2V62A 3KC3A 3ETAA 4FV2A 4RVTA 3TZ7A 5CANA 2BCJA 2YAKA 3CR0A 3QQJA 3QCXA 5D1JA 3A60A 3EFWA 2PE1A 4IX6A 4ALUA 4U97A 5J9LA 3D83A 3BU5A 1UU8A 1YHSA 4U3ZA 3BU3A 3MJ1A 5B0XA 1AQ1A 2XMYA 5DHJA 5IA0A 1UNLA 2EB3A 3CJFA 2XARA 5JT2A 4A07A 5CAOA 3LFAA 3QQGA 4AA5A 5KKRC 1W98A 3QTSA 1URWA 3AMYA 3VBQA 5BYZA 4DA5A 2F57A 4ZJJA 2ITUA 4BIEA 2C5NA 4GU9A 2O3PA 5IQHA 1BI8A 4O22A 3G2FA 2XNPA 4KIPA 2Z7QA 1CKIA 4PDYA 3BE9A 3PFYA 4QMOA 3Q5IA 4XUFA 3RHXA 2EUFB 4DT8A 3QRIA 4TWNA 3TUBA 4DTKA 3I1AA 4C37A 4EEVA 1A06A 3D7TB 2I40A 1IA9A 3D15A 3P5JC 4LQMA 4P2KA 3AMAA 4O7PA 3ZO1A 3Q6WA 3QZIA 5I9XA 2F7XE 4M67A 3DJ6A 4YZDA 4RIXB 2YA9A 4YGAA 3VW6A 2UZTA 3GEQA 4E8AA 3VS1A 3JY0A 4P5ZA 3OTVA 2GNLA 3FI2A 4UY9A 2BVAA 5IQIA 3OS3A 3R71A 5IZFA 3FHIA 3QKKA 2R3LA 4FTUA 1PXOA 4DC2A 4JMQA 3GOPA 5HEZA 5IF1A 2W1FA 4O7WA 3VBVA 3UC4A 4EJNA 3T3VA 2VX3A 4FYOA 5E91A 4F6UA 3QUEA 5E8UA 4AZSA 4CD0A 1REKA 4C59A 2ZB1A 3LLTA 4D1SA 4IB5A 4FX3A 2YCFA 1VZOA 3BYSA 4HGEA 4LI5A 3UGCA 2XKCA 3BYVA 5AP5A 5HQ0A 2VWWA 4DG0E 4DITA 4I94A 3QAME 4F0GA 1V0PA 3O23A 3QWJA 5CQWA 4BDCA 2OO8X 3FMHA 2WQOA 3B2WA 4GMYA 4K18A 4DFNA 3C4WA 4ZOGA 4CFFA 2E9VA 5EHYA 2PE2A 4C34A 5CEMA 3MW1A 3AT2A 2QU6A 1YI6A 2G15A 3MESA 4Y46A 4HVHA 4I0TA 4M13A 4YZ9A 2B9IA 5JZNA 4BHNA 4E6DA 2QOOA 2CKEA 2C0IA 4YLJA 4G9CA 4IFGA 2YCSA 2YDKA 3NEWA 2C5YA 3PJ1A 4P90A 1VJYA 2YAAA 4RGJA 3RPRA 3LM0A 2EB2A 3DLZA 5KZIA 3SHEA 2F7EE 5HLNA 3AXWA 5AP4A 3PP1A 3NW6A 5HG7A 4CCBA 2FYSA 1WBOA 1PXPA 2R3RA 4FL2A 4FVQA 2QC6A 3KA0A 3W55A 3DJ5A 5M51A 4IAZA 4FTJA 3BHTA 2R0IA 4L8MA 3RZBA 5DEWA 3HRFA 3PRFA 4LRJA 3EKNA 1H08A 2CGVA 2Z7LA 3UNZA 4EK3A 4TN6A 5DBXA 3F5PA 4JQEA 2WQMA 3F3VA 3ZFYA 2IWIA 3FMLA 3ZUVA 3AMBA 2W9ZB 5M07A 4R7BA 2J0MB 2XAMA 5J9YA 5CVGA 4GV1A 3UG2A 4UXLA 5KNJA 3KVWA 3ZLYA 3ZUTA 5CSHA 4KS8A 5H3QA 5AM6A 1ZYJA 3QTXA 5CU0A 1YKRA 2B9HA 5CI7A 5DT0A 3R9DA 2UZOA 4X2KA 4R3RA 3QQUA 3LCOA 4OTQA 2HZ4A 3EH9A 3R8PA 3UMXA 1R3CA 3CE3A 3POOA 4JR3A 1IR3A 3HV7A 4K33A 3VWAA 4U3YA 4FTTA 5BVKA 1E1VA 3WIGA 3NUAA 5C8MA 3PXZA 4KIQA 3VBWA 5AM7A 4QMQA 1Q3DA 3ML1A 3QD4A 4EK6A 3QXPA 5C03A 2C1BA 2GNFA 4BY9E 3MIYA 5HTBA 4CCUA 1PW2A 3BYOA 3CKWA 3LFEA 4PF4A 5AP1A 3FUPA 1WVYA 2ITXA 4ITJA 4KUJA 5CU6A 3MH0A 4IWDA 4IIRA 4L00A 5CNNA 3UO4A 3E3BX 3PIXA 4GRBA 4XBRA 4B99A 5CWZA 2VTHA 4C35A 4EOQA 4KAOA 3QL8A 2P55A 4I3ZA 5LMBA 2W96B 1FBNA 4MXOA 4FV9A 5F95A 1MRVA 1M17A 4CKJA 3VBTA 4N4SA 1FVVA 3P7AA 4BBEA 4CSVA 4ZP5A 3K54A 4NU1A 2WQBA 3CEKA 5IQFA 4D5KA 3MY5A 2ITQA 1MRYA 3L9NA 2G1TA 5JFXA 3A62A 2H34A 4FEVA 4E5AX 5AWMA 4AXFA 4CZUA 4QT1A 4BKJA 3VONA 5JH6A 3BQCA 2I6LA 4X2NA 5GJFA 4CT1A 4JRNA 3BIZA 3HV6A 5C4LA 3MVHA 2BZKB 3NNXA 3DS6A 5EI6A 4X6QC 5EOBA 4M3QA 2OJJA 4ZMEA 3QCQA 3A7FA 1YHVA 2ITTA 1Y8YA 3HECA 3QQKA 5EM5A 5H8GA 3QUDA 4JBVA 5JK3A 4FV5A 5HLWA 3FY0A 5IQCA 2WB8A 5IQDA 4BN1A 3UC3A 2UW7A 2WTKB 2Y0AA 4O7TA 1ZOEA 3NUSA 4BDJA 3LAUA 5AV2A 2XH5A 4BDHA 4RX5A 3VUGA 4FV0A 2QODA 3WF6A 2KULA 3V5JA 1G8JA 4NKSA 3O2MA 2ITVA 4JIKA 2Z2WA 1KOBA 3C13A 2Y4IB 3BRBA 3Q4UA 1O6YA 3FZSA 4G3DA 4FV4A 2XNNA 4B7TA 4EOJA 4FG9A 3HKOA 3ENMA 4P5QA 2YWVA 3F3TA 3WZEA 3L9MA 4GVAA 2YDJA 3GQIA 4ZTRA 1H07A 3PPKA 5HIBA 2V22A 3KN6A 1JKSA 4TYGA 5CEPA 1HOWA 4QTAA 3EYHA 2VZ6A 2X9EA 3FMJA 4FNZA 4PV0A 4TWOA 4HGLA 2UZUE 4BCNA 4DG3E 4JG8A 3EFKA 5GJGA 5IEVA 5DR9A 2G2IA 4FK3A 5DWRA 4B8MA 4L3PA 5LWNA 4EYJA 4KRCA 3IK3A 4JDJA 2XNBA 4P7EA 1HCKA 3N4VA 4UZDA 2BKZA 3GOKA 4X3JA 3EWHA 4C4JA 4XYFA 1REJA 1UA2A 3DTCA 4FKQA 2JAMA 3GC0A 3WF8A 4FIFA 5E8YA 3F82A 4J53A 4U9AA 2X7GA 5GHVA 4H3PA 4ZK5A 5LVPA 4I6LA 4QMPA 3Q9WA 2RG6A 4E6CA 3BHVA 2Y9QA 3L9PA 2OJIA 3PUPA 5EQYA 3QKLA 3HEGA 3MH3A 4ZSEA 5EOLA 5BVWA 3UVRA 3PRIA 5ETCA 4QMMA 1OB3A 2B4SB 3U51A 2PE0A 2CMWA 1TKIA 3ENHA 1W84A 2ESMA 4YPDA 5CEOA 3SXSA 4N6YA 4I5CA 4C62A 3UQFA 2JIVA 1QL6A 4HW7A 2QONA 3M11A 4FV6A 5FD2A 3TUDA 2ZYBA 5FTGA 2CGWA 2Y7JA 3HAMA 5FTQA 1O9UA 3DXNA 2OI4X 4R6VA 4S33A 3AOXA 3G6GA 3MYGA 3RHKA 1QCFA 3R83A 3QTUA 2HW7A 1ZMUA 3O17A 2W17A 4UB7A 3B8RA 3KQ7A 3UP2A 5IUIA 4E4NA 3NFGB 3BEGA 1VEBA 2XIRA 3JVSA 5LVMA 4JDHA 2JDRA 1WBWA 2VNYA 4IDVA 2CHLA 5EW9A 3IW6A 3PG1A 1S9JA 4OBPA 4FEQA 3EHAA 3GCQA 4FR4A 3V51A 2JKMA 2XK9A 2X4FA 3W2RA 1ZLTA 1GOLA 2OGVA 3O51A 2QKRA 5IEXA 4ASZA 2VO3A 4QMTA 3EQHA 1OIYA 1P2AA 3PXQA 4BCMA 1YDTE 3ZSHA 1PY5A 4W8DA 5AIKA 5F4NA 4RFYA 3TI1A 3CXWA 3Q60A 4LV7A 4U94A 2QO2A 2Z7SA 3AQVA 4WNKA 4AAYA 3F5UA 1WVXA 5LMAA 5L6WL 3VNTA 1XH4A 2JFLA 2JLDA 3Q32A 3Q4CA 3P4KA 4YHFA 4DF3A 2ZVAA 2UZEA 5KMOA 2YIYA 3KULB 1JAMA 3IGGA 4TTHB 4XV1A 3R8ZA 5M4UA 4RJ5A 3RNYA 3OWPA 4WNMA 4AE6A 1GY3A 3DBQA 5EDRA 5AIRA 4TNBA 1Y6AA 2ZOQA 4E20A 5JQ8A 3R7EA 5I0BA 2GHLA 1J7IA 2PVFA 1OGYA 4AW0A 3HMOA 4IACA 5CAPA 4YZBA 4AXDA 3U9NA 3HNGA 5EKOA 4GK4A 3UODA 3V8WA 4FZFB 3BV3A 1ZXEA 3AT3A 4MYGA 5HBEA 3EMGA 3KCKA 4QMVA 4FSZA 4QYFA 3LMHA 5EYMA 3PXRA 3N4UA 2WD1A 5M4FA 3RPYA 5FEQA 3QRKA 4WNOA 4GJ2A 2JBPA 3EQIA 2OU7A 3W8QA 4AGCA 3RJCA 1KSWA 3I6UA 3O50A 2OF4A 2XRUA 3O5AA 4FZAB 3F2RA 4IE9A 2QLQA 2BRGA 5I9VA 3O8PA 4X3FB 4ZTQA 3H3CA 2Z8CA 4I22A 4G2FA 3MS9A 4NM7A 3S4QA 2IW6A 4M15A 4AP7A 4FOBA 1GNGA 3VRYA 4CV9A 5F9EA 3JS2A 2RF9A 5HCXA 4EQMA 2A0CX 4USDA 3W8LA 5BX0A 3ERKA 1UKIA 3RVGA 4CXAA 2BIYA 2J0LA 2EXCX 2REIA 4ZLZA 5FDPA 3LFDA 3GU8A 1PXIA 3FWQA 4XP3A 5IA4A 5BVOA 4OTWA 4FA2A 3KXNA 4EK5A 3HDMA 2NO3A 4EBWA 1W82A 2NRUA 3BBWA 5ACKA 3VUKA 4C2WA 1IASA 2P2IA 4LL5A 3FQSA 1Q97A 4NL0A 2PMNX 2B0QA 3T8OA 3ZDIA 2W1DA 2OF2A 3NIEA 3DFAA 3R1QA 1JKLA 2WTJA 5AMNA 4R78A 5ETFA 4DDGA 3LFQA 4FTIA 3PE1A 2UVZA 3MJ2A 3LJ2A 4G3FA 3HZTA 5C27A 5BV3A 3DK6A 2J50A 2BFYA 4QRCA 4DINA 5EM8A 5CXHA 1JQHA 4IFCA 4FSYA 3UVPA 3GGFA 3H10A 4Q9ZA 3PVWA 4H3BA 4YU2A 1XHAA 1Q5KA 5DPVA 2PVYA 5BUIA 5AV0A 3D5WA 3MWUA 4E7WA 1GZNA 3EQCA 3RAKA 2HCKA 4HVDA 1Y91A 2WU6A 2WMSA 4BJJA 4R7IA 4LRMA 5FLFA 2ERKA 5CAVA 2XK4A 4BCOA 2CKQA 2ETRA 4JQ7A 3I81A 3WF9A 3WF7A 5BUEA 3EFJA 2RFDA 4YTCA 3U6IA 1DM2A 3DBDA 4OTFA 3WZDA 4JDIA 3A7JA 3ZO4A 2PMIA 1KOAA 4P4CA 3Q2JA 5E1SA 4KABA 4U98A 1R1WA 1JWHA 3QZHA 2UW9A 5A9UA 3D9VA 3V3VA 4YPSA 5CEKA 1YOMA 3I0QA 1Q8TA 3FQHA 5FEEA 4RSSA 4ZXTA 4D58A 4PL3A 3UP7A 1LR4A 2DS1A 1OPLA 5HBJA 1QMZA 2XB7A 4FTLA 3DXQA 3CTHA 4FTAA 1OBDA 3CY2A 1NT2A 3ODZX 3QU0A 3RPSA 3R1YA 4TZRA 3LE6A 3GCPA 5ITAA 2OW3A 4M7IA 3WBLA 1WAKA 2YIWA 4ZSGA 3MA6A 4O84A 4IX5A 2OSCA 3OUNB 4UYAA 4YLLA 2OK1A 3NNVA 2XK6A 5A4LA 3JVRA 4Z7HA 4HZSA 3V5LA 1RDQE 1RW8A 5EYKA 4GL9A 4AZTA 1AD5A 4AQCA 1IA8A 1OIRA 3ACJA 4GIHA 3TV4A 4AW2A 4EHZA 1OL7A 3LFBA 2GS7A 4CFUA 3R2YA 2YM6A 3QTQA 1OIQA 3OCGA 4GSBA 3P0MA 2LAVA 4XEYA 5CYIA 3UNKA 2E9NA 2R3PA 3BGPA 2YCQA 4RVMA 3TIYA 1M2PA 2C3JA 2XNGA 4RIOA 4FEUA 4G1WA 1SYKA 2VO7A 4QNYA 5KHWA 3NMUF 1OVEA 3LM5A 2F49A 4LRKA 4MTAA 4IJ9A 4RJ3A 4AN9A 5FXQA 5EHOA 4DFLA 3W0NA 4HVIA 3L1SA 5FP5A 3QD3A 1OL5A 2ETKA 2QHMA 3FDNA 2XP2A 3GU4A 3HP2A 4HZRA 4IVBA 4HCVA 3P23A 2NPQA 4N0SA 5CF4A 5AA9A 4J99A 4ACHA 4X0MA 5J9ZA 1J7LA 4UN0C 4GH2A 3CJGA 4JVGA 2CJMA 3TZ9A 3FSFA 2AC3A 3P7CA 2VO6A 3DKOA 3RK5A 2X2LA 4FKOA 1WVWA 5EDQA 1H00A 3BYUA 3EFLA 3AC1A 4UV0A 3C4ZA 3UO5A 4M69B 3D4QA 5HE3A 5IG1A 3MIAA 1Q8UA 3GU7A 4I0RA 3SXFA 2PL0A 3TNIA 5HU9A 2PYWA 2VX0A 5LVLA 4ZIMA 1U5QA 1Q41A 4FE2A 5ETIA 2OXYA 1Z9XA 1YXXA 2BHEA 2ZFYA 4FSUA 3ZH8A 3ZOSA 2X81A 3QRTA 3LXKA 5AP0A 5TOZA 1OL6A 3ZLXA 2B53A 3NLBA 2ITNA 4W4VA 4C36A 1UU3A 2XBAA 2W1IA 2C6LA 5FEDA 2J0JA 4NSTA 1G8AA 3NNUA 4BC6A 2NP8A 1U46A 4CGAA 4AT3A 4BCQA 3BL7A 2XS0A 3GC8A 3NYOA 3QD2B 3TJDA 4IAYA 2JIUA 1F5QA 3DK3A 2W5AA 4N57A 1PJKA 1ZMVA 2OZAB 3PZEA 3M42A 4JDKA 3R8VA 4C4FA 2UW5A 3KXHA 2AUHA 3MPTA 3N9XA 4U0IA 1GZOA 1H27A 4PDOA 4EOSA 3VS4A 4FYNA 3R9OA 4KWPA 4TYJA 2IZUA 4K8AA 3DOGA 4Q9SA 4A06A 1KE8A 3DT1A 1IEPA 5HG9A 4MAOA 4E4LA 1ATPE 3NYVA 3G51A 5HGIA 4Z3VA 4V01A 4FKRA 4CV8A 3F7ZA 2UW4A 3ALNA 4FTKA 3ZLWA 4I1ZA 2IW8A 3F3UA 3TTJA 3R73A 2C5XA 3G0EA 3U54A 1NVSA 3DKCA 4Q5EA 3OXTA 4F78A 2HAKA 1PMEA 5ANIA 2J4ZA 2W1ZA 3WZJA 1Y57A 4AUAA 3FYJX 3LCKA 5AAGA 4RX8A 2WQNA 3EQGA 4DCAA 5ACBC 2OFVA 4NT4A 1H0VA 2J51A 5I9WA 1YRPA 3EYGA 2WEVA 4FT7A 1DI9A 4AXAA 1OBGA 2YJSA 3VQUA 4O38A 3V8TA 1M7QA 2C0TA 3LXPA 4QYGA 2WQEA 1OPJA 4ASDA 3PJCA 1R39A 3UE4A 1ST0A 2YWPA 2WMVA 3LFCA 1FVRA 3TNWA 1IG1A 5CALA 1OZ1A 3OCBA 4G34A 4ZMFA 1Y8GA 3ORNA 3ZRLA 4RX7A 5CF5A 2JITA 2BTRA 3F6XA 4XG8A 4E26A 2YIRA 2OXDA 2UZWE 5AJQA 4K0YA 1YXSA 4M84A 3VHKA 2V7AA 3L9LA 4Q2AA 4EI4A 3ZFXA 4IAFA 3MVMA 3PWDA 1LEZA 2W05A 5CT0A 1DAWA 2BRHA 3I5NA 5CEQA 5FM3A 3L8XA 4QDVA 4F0IA 4XS2A 1WBNA 4EHEA 3GNIB 3H30A 3SDJA 2XANA 2R4BA 3W0PA 5A4TA 4WG5A 4WO5A 4AN2A 3FKOA 2VTNA 4MNEB 5IH5A 3V01A 4TYHB 3NPCA 3I5ZA 2CDZA 4JG7A 3LJ0A 1PXMA 1WBVA 4M68A 5CT7A 5D7VA 2GS2A 1JVPP 3ZXZA 4YLKA 3OP5A 4QQTA 4EH3A 3FXWA 3MVJA 3HMNA 3E93A 4YJRA 3PJ3A 4U43A 4XOYA 3Q5ZA 2NYAA 3F88A 2PY3A 3DBCA 4EYMA 4C3PA 2ETMA 3EL7A 4GFMA 5AP3A 5TR6A 4WBBB 3EKKA 3IOKA 3NGAA 4G16A 4B0GA 3R7YA 3ZM9A 1JOWB 1NA7A 4YUQA 3QCSA 4U45A 2GQRA 2JBOA 4YJOA 3HVCA 4PP7A 3KY2A 4L3JA 5EHLA 5E8VA 1Z5MA 3WARA 3BELA 2IPXA 3OD6X 3PY0A 4MUQA 3W0QA 4E6AA 3SA0A 4RFMA 1FOTA 1RE8A 4YMJA 4EOIA 2JDTA 4ALVA 2GCDA 3R30A 5GINE 1ERKA 4NH1A 4O81A 4QP6A 4RIYA 4WZYA 4PDSA 3FAAA 3JYAA 3U55A 4C3RA 2E2BA 3C0IA 3UOKA 4KA3A 4AF3A 4BGHA 4ITHA 4Z16A 3ROCA 3DGKA 3LQ3A 2OH4A 1Q4LA 4YNOA 4D1XA 1TFFA 2IZTA 2WMWA 3GU5A 3R00A 4NIFB 3R9RA 4V0GB 4OT5A 5JGBA 4JOAA 3COHA 5CAUA 1UNHA 4MH7A 1GIJA 1V1KA 4J97A 2VWXA 3QZGA 3RM7A 2PZYA 3JUHA 2F7ZE 4FG8A 3MY1A 4RQVA 3LPBA 1PMUA 2VAGA 2UZVA 1FMOE 4GT3A 2PPQA 5K9IA 5M4IA 3BHYA 2VWZA 4E4MA 4YZCA 4CMUA 3SW7A 2PUNA 3C7QA 1PXJA 3ORTA 4FIEA 4XCUA 4IZ7A 4CZTA 5CNOA 4FT9A 4UYNA 2G9XA 4M12A 1WZYA 2X9FA 3LMIA 4D1ZA 2BR1A 2WKMA 1PXKA 4PTEA 4IB3A 2EVAA 3OHTA 3D14A 2R3QA 2R5TA 4RJ4A 3OCTA 2BZJA 4F9CA 4ZY4A 5BVDA 5ANJA 3K5UA 3EZRA 3H9OA 1U59A 3QC9A 3R7IA 4DH3A 4AXEA 4NTTA 3CD8A 5E8SA 3U87A 5CSVA 4FT3A 4MQ2A 4R5YA 3W2OA 3ZTXA 3F9NA 3RMFA 2F4JA 2YZAA 3QQFA 2IZSA 4H1JA 5CI6A 2A2AA 5HE2A 4ZZMA 2F2CB 3KXXA 3COMA 3OXIA 2WOTA 3D7TA 4WA9A 4X7QA 3TDVA 2HZNA 2QQ7A 2W1HA 3DZQA 1LEWA 3G6HA 4ZTHA 4O0WA 4OTGA 4CT2A 3E63A 2PVLA 3CTJA 3H0ZA 4RIXA 4DFZE 4EKLA 4HNIA 4JI9A 2B55A 3UZPA 3CCNA 5AAEA 4QMNA 3P86A 3G90X 5L8KA 4L6QA 1XMMA 5HVJA 3ROYA 3A7IA 1YW2A 4MD8E 2I0EA 5HZNA 4XG3A 4FZ7A 5HORA 2PUIA 1ZYLA 3LQ8A 5BVEA 4BCHA 4BZNA 3KEXA 4I41A 1ZAOA 4AU8A 1LP4A 4Y5QA 1T45A 4L7SA 2FA2A 4CFVA 1KE7A 5A3XA 4RWLA 5LXMA 4WBOA 2B7AA 3KXGA 3VIDA 5BMSA 4JL9A 3OT3A 3W16A 5M4CA 3MB6A 4JBOA 3RNIA 2SRCA 3AT4A 2X2KA 1A48A 3CGFA 3EN4A 1YI3A 2CGXA 3ZEPA 4WT6A 5K5NA 3SAYA 1E1XA 4PWNA 4MVFA 3TKUA 3TNHA 2H8HA 5IUHA 4FTQA 4Y73A 3EN9A 3FI8A 5DR2A 3DB8A 3VF8A 2XAOA 3QLGA 1XWSA 5J1VA 4ZTMA 4M0ZA 4RFZA 3ZLSA 3A61A 2RG5A 4D0WA 4IB1A 3GCVA 2XK7A 3L8PA 2O63A 5LJJA 1AGWA 5ETAA 4XNEA 3ZU7A 1ZZLA 2QOKA 4L3LA 5DE2A 3IDBA 2IVSA 4OT6A 4EC8A 3GFWA 4O6EA 4XLIA 2GTNA 2CN8A 3H9FA 1KE6A 5T68A 5IUGA 4FI1A 3DXPA 2BRMA 5H8EA 4K77A 3LCTA 4YTIA 4EH8A 5AUUA 4FKUA 4FKTA 4BCIA 3UOHA 5HU3A 4DBNA 3DAJA 3QRUA 4IW0A 2G01A 2CLQA 3FYKX 4OR5A 2WTCA 4RLKA 1TVOA 1W8CA 3GFEA 4GG7A 2BAKA 4L45A 4RJ6A 3QGWA 2C6OA 3OY3A 4L68A 2HOGA 4I5MA 3QZFA 4G31A 2WAJA 4FV8A 1P4OA 2ZV2A 4GEOA 5IU2A 4EK4A 3BWJA 4RPVA 2W5BA 2C6MA 4I20A 4OLIA 3KFAA 3QTWA 1S9IA 1W83A 3WOWA 3L8SA 2IVUA 3SLSA 4BCKA 1IAJA 2YM3A 1JBPE 3H9RA 1T46A 4YZNA 2BIKB 4LGGA 4II5A 2PU8A 4NWMA 4OBQA 5FG8A 3A7HA 4FTCA 2XVDA 3ZRMA 3LCDA 1SNXA 3R8LA 3CD3A 2UZLA 2X8IA 4H58A 5LCKA 2ZJWA 2XK3A 3RCDA 2P2HA 5TF9A 1BUHA 4G6NA 1JSVA 3QGYA 4RC3A 4AOIA 3RWQA 3DLSA 4W4XA 3QKMA 4GW8A 4PL4A 1M2RA 5KCVA 3KRXA 4MWHA 3HRCA 4BTMA 2XZSA 4ZY5A 1FMKA 2B9JA 3MTLA 4FSMA 4EH2A 2X7FA 4GKHA 4APPA 2UW6A 2BDWA 4BYJA 2B1PA 3TJCA 5KMKA 1H1RA 1WCCA 2P33A 3UDBA 3FLZA 4L67A 4MXZA 4DGLC 2YM7A 2GMXA 2C6EA 4TW9A 4AGWA 3W10A 2P3GX 5IH4A 2JEDA 2WOUA 3EN7A 3GT8A 4NCTA 5FUTA 5CENA 4D9UA 3MV5A 4PDPA 2HY0A 1B6CB 4XV3A 1YOLA 5EFQA 4CMOA 4DN5A 4JXFA 4L52A 3UYSA 5BPYA 1J91A 5ICPA 5CU2A 3SG9A 3H0YA 4J71A 3AD5A 4PMTA 3GI3A 2A4LA 2F9GA 3UVQA 3KN5A 4RA4A 1BKXA 4IJPA 4XG4A 4XG9A 2JIIA 2O5KA 3MH1A 5DFPA 3I0OA 5HIDA 3ZDUA 4O0YA 4DHIB 1OUYA 4QEBA 3MGYA 4QMYA 2PZ5A 2VTOA 3B2TA 5DVRA 2BAJA 3UDTA 3U6HA 4GJ3A 2WTDA 3WI6A 4BDBA 4LYNA 3OW4A 4X2JA 2WMRA 4N70A 3WILA 1H1PA 3PA5A 5FXRA 5DI1A 1H0WA 5L2TA 3I7CA 4I6QA 4LMUA 3R22A 4A9SA 2XBJA 5CX9A 2PVNA 1CMKE 4FMQA 4TYIA 4AX8A 2DYLA 3HA6A 5J8IA 2X1NA 4GYIA 4F70A 2VTQA 1DS5A 5HVKA 4FKPA 3GVUA 4KSPA 4IC7A 3F66A 3QD0A 4KKEA 3R7UA 2ITYA 3PE2A 2PUPA 3FSKA 2H96A 1O6LA 2HYYA 3BKBA 1TQPA 4O82A 2OICA 2X6EA 5J7HA 3DCVA 4IANA 3U4WA 4C33A 4J52A 5HESA 4L53A 5C8KA 1ZY5A 2XIZA 4MBIA 4CLJA 2YACA 4FNWA 2WPAA 4FSWA 4AQKA 5JZJA 3HGKA 2VGPA 3NUPA 4DDIA 4F7NA 2BAQA 3MPAA 5HE1A 4YJSA 5DG5A 4C4IA 1OECA 2EWAA 2V0DA 2P0CA 3R2BA 4AW5A 3LQ5A 3PPJA 4JG6A 2QHNA 3NAYA 3F61A 4QO9A 4JAJA 5DGZA 3EQDA 3TN8A 4D9TA 4EONA 2IVVA 4EOKA 3TG1A 3DDQA 4GIIA 5JFVA 2CLXA 4FL1A 4G5JA 3ACKA 3RTPA 2R3HA 3UIUA 1U5RA 4AZVA 4KKHA 3R04A 4YO6A 3BX5A 3G9LX 3NDMA 4RX9A 3MPMA 3PWYA 5TKDA 3QYWA 3NRMA 4GG5A 4H36A 2BRBA 4MX9A 4ZTLA 4CRLA 3UZTA 4D4YA 2Y4PA 4BDKA 1SM2A 3BCEA 1OMWA 3PIYA 4FTNA 4QTDA 3NUYA 4C0TA 1R78A 2WMXA 4TWPA 2BZHB 3BHUA 2P4IA 4BZDA 4MQ1A 2VTPA 1JSUA 4ARKA 2H6DA 4KKGA 2QNJA 5JSMA 4E1ZA 3OROA 4JR7A 3RINA 2XM9A 2QOFA 3GCSA 4K6ZA 5HG5A 5C01A 3LKMA 3UDSA 4F9BA 5I4NA 4JBQA 4I4FA 4QTCA 5L6OA 5AP6A 4U40A 4F4PA 1NXKA 1Q24A 3KGAA 5H9BA 4ANMA 4ANLA 4RWKA 4OBOA 2PVHA 2QCSA 3I60A 1QPDA 4DFBA 4PQNA 4DEIA 2YERA 5JQ5A 1JKKA 3RPVA 1YHWA 3KF7A 3E3PA 3QCYA 5AUWA 1PXLA 1WBPA 3OEFX 2VD5A 1H8FA 3SRVB 3NVMB 5DEYA 4C7TA 3UIXA 1ZYCA 3QHWA 5BYYA 1H1WA 3FI4A 3PY3A 3AC3A 3EIDA 4FL3A 4GYGA 2QVSE 1DI8A 1ZYSA 4MXCA 2WELA 3JPVA 3BHHA 4FKJA 4DAWA 3V5TA 4AOTA 4ZSJA 2WHBA 4O83A 4IZYA 1SZMA 4O7SA 4KSQA 4NCTC 1OI9A 5JFWA 2WMUA 1PYEA 3CIKA 3SOAA 5KBQA 3S2PA 2BILB 3KULA 4FSNA 3DB6A 4OTIA 5CQUA 5I9ZA 3I7BA 3IKAA 4B6LA 1XBAA 4UXQA 1KE5A 1L3RE 4HYHA 3DK7A 2XNOA 2FB8A 4CLIA 4IB0A 5EI2A 5DLSA 2XCHA 1H01A 3C4FA 2HELA 5A6NA 4EH7A 4M97A 2WTWA 5A46A 3ZFMA 5HCYA 5EDPA 3O7LD 5IDNA 1G8SA 3KXZA 2GFCA 4E5WA 3FJQE 2WMTA 3ZUUA 4R7HA 4JS8A 3PVUA 5HNBA 5EYDA 3IGOA 4IM2A 4AA0A 1FINA 4NUSA 2WTKC 1J7UA 2O64A 2UUEA 3PDTA 3T9IA 4RT7A 2UZDA 4YSMA 2YISA 2YM5A 4PUZA 4DHJA 3PXKA 4OTDA 2R3OA 3OWLA 5HVYA 4DLIA 2J7TA 3K2LA 3OBGA 2VTRA 4DEHA 2VWBA 2Y4IC 3BBTB 4K1BA 2VNWA 2HIWA 1YXVA 2WMAA 4FKWA 1OL1A 4X3FA 4HCTA 5LCJA 5M56A 3AD4A 3KF4A 3BQRA 4D28A 2WIHA 5HX6A 1UVRA 3BWFA 3NUUA 1G8KA 1VYZA 5HHWA 2GNGA 3A2CA 3V5WA 3IQ7A 1UKHA 4JLCA 1ND4A 4YHJA 3F69A 2A27A 3TIZA 5GNKA 3HX4A 3VN9A 3VUHA 4DGMA 3DAEA 2XA4A 4ACGA 2B52A 2BMCA 3R1SA 5HI2A 4J8NA 4DGGA 4FT0A 5L2SA 3HUBA 4C4EA 2QO7A 2XUUA 2W7XA 2ERZE 5AV4A 3IO7A 4XV9A 3PXFA 4QMUA 3SC1A 2C5OA 4RA5A 2LGCA 2QR8A 4EKKA 3P7BA 4QTBA 5BVNA 5HBHA 4X6RA 2R3KA 3WZKA 5BQ0A 5DRBA 3ZMMA 5AUXA 2JDSA 5EM7A 1UU9A 5J1WA 2IW9A 2VRXA 2H9VA 4F1TA 3FL4A 2GNIA 2XIKA 3F2AA 3DQWA 2RFSA 3LZBA 4MBJA 4ZZNA 4J1RA 2OJFE 4I4EA 4O7VA 4Z9LA 1NVQA 1O6KA 1STCE 2BHHA 4EH4A 4Z55A 5JGAA 2JC6A 2J0KA 4WNPA 1H1SA 2G2FA 3PIZA 4HGTA 5KUPA 4AG8A 5LVNA 3KK8A 2VV9A 4O0UA 4ZSLA 4CFMA 4B4LA 4PTCA 1OKVA 3VULA 1YWNA 2V5QA 4DBXA 3E7VA 2Q83A 4RG0A 2DQ7X 3CKXA 4G5PA 5E8WA 1Z57A 4YJPA 4G6OA 3W0OA 4AFEA 3LFSA 4BGQA 4NM5A 4IQ6A 4WG4A 3LW0A 3R28A 5TT7A 5E8XA 2QOBA 2C3IB 1BMKA 3FZRA 3Q6UA 4TYEA 5EI8A 4ANSA 3BZ3A 4FTOA 4L46A 4BIDA 1ZOGA 4YJTA 2OWBA 2W1CA 4F63A 2UV2A 3DNDA 5EM6A 3IG7A 4AGDA 2B9FA 5KKRB 3ODYX 3A7GA 5M53A 2Z60A 3KIOC 4QOXA 5ANDA 1I09A 3C51A 4RIWA 3ZZEA 4BDEA 5BVFA 4BGGA 4EBVA 5FRIA 3SV0A 3DFCB 5C1QB 3G0FA 3ID6C 4BIBA 2ZDUA 2YM4A 3QBNA 4Q5HA 4ZLOA 3VS7A 5KHXA 3V6RA 4DTBA 5KZ0A 3MB7A 5K4JA 3PLAE 4XRJA 4DCEA 4BYIA 5T3QA 3GENA 2OKRA 3PSBA 4U80A 4CG9A 4J98A 4U41A 4BDAA 2KTYA 4TL0A 3KMWA 3N51A 5ANEA 2HXQA 4IAIA 4J96A 3PA4A 2OH0E 4Y72A 3EB0A 2BROA 3UJGA 3ALOA 3I6WA 3BU6A 4TKSA 1H1QA 3FMNA 3ORMA 5CSXA 5D10A 1GAGA 3ULZA 3DBEA 5IQEA 1LUFA 3RWPA 1OUKA 4PL5A 2CNQA 1Q8YA 5BNJA 4AXCA 2PZIA 4CQEA 5IA5A 4ID7A 2OBJA 5M09A 5JRSA 4I6HA 4F09A 5EYCA 4XP0A 4E4XA 1CKPA 4B9DA 5L8LA 2OIBA 4RWJA 4BF2A 5FDXA 2VWVA 2HZIA 4U8ZA 2OZOA 2R0UA 3ZC5A 4BDGA 3C5UA 3QC4A 4IVDA 5IISA 3VHEA 2XM8A 5LVOA 3GB2A 3HUCA 2PK9A 4IMYA 4NZWB 4ZS0A 4BTJA 3NVKI 3E62A 4WG3A 5DRDA 4LOPA 3AC2A 5LOHA 3D5VA 3VUMA 4LV8A 3K5VA 4NYEA 1B39A 3IECA 3NYNA 4O2ZA 2GU8A 4F1MA 3BLQA 3G5DA 3NAXA 2OG8A 2WTVA 3QUPA 1MQBA 4LUEA 5FP6A 3UMWA 4X3FC 2OIQA 1JNKA 2ZM1A 4NM3A 3NR9A 4NTSA 2FH9A 5FXSA 4BB4A 3QTZA 3DU8A 2PHKA 2PVJA 3OCSA 3LFNA 2BZIB 2UW3A 3GXLA 3QQLA 3UZRA 2I0HA 3VS0A 4EJ7A 2YCRA 4BHZA 5B7VA 1U54B 2WMQA 3ZS5A 5M57A 1CDKA 4O0RA 2FSTX 4EOLA 2VUWA 4RWIA 2VGOA 1Q99A 3BGQA 3LLAA 4FSRA 4MCVA 4ZJIA 3SGCA 1F0QA 3RALA 2XRWA 3G15A
chains in the Genus database with same CATH topology
5FBNC 3KB7A 3BI6A 4IBMA 4M8TA 1XH7A 3SD0A 3E92A 2CCHA 2VTMA 4FUXA 4D4VA 2VO0A 3W1FA 4FIHA 4JQ8A 3EQBA 2QURA 5KMNA 3MVLA 1FVTA 4DGNA 4O7ZA 4YJVA 3IW4A 4E5BA 4QMSA 3GCUA 2OFUA 4G3EA 5IQBA 3UQGA 5JFSA 3KK9A 3II5A 1P5EA 3CBLA 4WUAA 3ZCLA 2ONLC 3HLLA 3D2KA 3KKVA 5E8TA 3TDWA 2WGJA 2WFYA 4MF1A 3KREA 5AUZA 5E8ZA 3NNWA 4CEGA 5HNGA 4DEBA 4IVAA 5EK7A 3TKHA 4FIGA 3KU2A 3VJNA 4ENXA 4FV1A 1Q8WA 4O0TA 4QP3A 3FC2A 2R2PA 4M0YA 3OTUA 3FXZA 4YP8A 5KE0A 2JDVA 3RCJA 1H24A 1XJDA 3TMOA 3R1NA 4IEBA 4UWCA 3O8UA 4EHVA 4QYHA 5C9CA 4JAIA 3CSVA 4XMOA 3NCGA 4AN3A 1K9AA 3KVXA 2HWOA 1ZRZA 4DFYA 2ZM3A 3O0GA 1A9UA 4O86A 4AOJA 2XKEA 4E6QA 5JEBA 2VU3A 5DT3A 3OUKA 4I21A 4IAKA 2O0UA 3D94A 3NWWA 3A8XA 4K11A 4DH5A 1PMNA 3PUFC 4CTCA 1E9HA 1UU7A 3R21A 1YWVA 3LXLA 5A4EA 3WIKA 2NNWB 4XOZA 5K5XA 4E93A 3FPMA 1H26A 1K3AA 3E8CA 3LOKA 4UEUA 3G9NA 4EC9A 4D2RA 1OGUA 2PTKA 2W5HA 3R0TA 3A4OX 4IHPA 4CKIA 2WU7A 3IDPA 2QR7A 4WIHA 2IJMA 5M55A 4FK6A 3DY7A 2X6DA 3OXZA 3Q2MA 3KMUA 3VUIA 4NJDA 3VO3A 3E8NA 1M2QA 4LOOA 2VWYA 2J5EA 2JKOA 3PXYA 4MNEA 3SW4A 5CASA 3EL8A 3TACA 4L43A 2ZV7A 3EQFA 2NRYA 4IZ5A 3MFSA 2WNTA 2BUJA 3ZBXA 3N4TA 4YTHA 3ORXA 3S1HA 2HWPA 3ORPA 4RVLA 4AGUA 4QNAA 2R3JA 3FZ1A 4BCFA 1SVHA 3RP9A 5A4CA 1X8BA 5CF8A 2XJ0A 2UVXA 2R3NA 3DBFA 3Q96A 4PTGA 5A6OA 5J5SA 2W99B 3IOPA 5HICA 3ANRA 5AFVA 2RGPA 4KBCA 3FPQA 4DTAA 4HVSA 5FBOA 3VAPA 1VLRA 1XQZA 4UBAA 5IH6A 1Q61A 2OJ9A 4CVAA 4KS7A 4DLJA 3QX2A 2EU9A 3UPZA 4XRLA 4GKIA 4FIJA 2JAVA 3ORLA 3CY3A 1KV1A 4MWIA 4QP1A 4HOKA 3MDYA 1YXUA 2BALA 4Y95A 2Z02A 2BTSA 3OC1A 3DV3A 2YN8A 2W06A 1M7NA 1B38A 3FHRA 3Q04A 4N6ZA 4F64A 1WFCA 4D4RA 1KV2A 4YTFA 5JGDA 4YC6A 4UX9A 1XBCA 1G5SA 4FKVA 3FL5A 3KMMA 4G3CA 4G17A 3SQQA 3HV5A 4WOVA 3KRWA 5D9HA 4YBKA 3DQXA 3UNJA 4FICA 4V0GA 4QDEA 4R3CA 4GFOA 3WE4A 1PYXA 4UWYA 3FZTA 4PMPA 1VR2A 2Y6MA 3F2NA 3HA8A 3OWJA 3F5XA 4FGRA 4IWQA 3JR1A 4O7YA 3KRRA 4RBLA 5IMEA 4F1OA 2W1GA 4FC0A 3MSSA 3W0SA 2C1AA 2XYUA 4MXYA 4S31A 3FZPA 2C30A 3P5KA 3DKGA 3P78A 2YHVA 3FLYA 4GK2A 1Q3WA 5B2KA 3FZOA 5EQPA 2XKFA 3C5IA 3HMMA 4U42A 4YJUA 4QP8A 3S3IA 5JMSA 1MUOA 2GHMA 4JBPA 4L7FA 4C38A 4EL9A 3FMMA 1F3MC 3FBVA 5GJDA 3OBJA 3R02A 2OXXA 1UNGA 1YDRE 3NZ0A 4PP9A 5CZIA 4BICA 4KINA 3VS3A 4I93A 3MFUA 3MI9A 4LMNA 1OL2A 4FIIA 3NIZA 3OFMA 4U7ZA 5B2MA 1OPKA 4USFA 5AUTA 4QPSA 4IX4A 2YDIA 4FKGA 3C0HA 2HZ0A 5HLPA 1KE9A 1SVEA 3FLWA 4GT5A 4A9UA 4ZJVA 3NYXA 4IDTA 3QWKA 3TWJA 3Q4ZA 3CQUA 3TNQB 1YQJA 4MEDA 4DEEA 2PMLX 3QA0A 2XIXA 4LOQA 1J1CA 4BVUA 4Y5HA 4EOOA 3ITZA 4YJNA 2J5FA 3MH2A 3BPRA 4WD5A 4YC8A 3EOCA 2VTAA 1FPUA 5KMJA 1PHKA 3H4JA 5M06A 3PLSA 5EH0A 3D7ZA 1FGKA 4FTMA 5DOSA 1PKGA 2CSNA 4V05A 4F9WA 4WKQA 3WE8A 3E7OA 3LMGA 2JKQA 4ZY6A 4HGSA 1WBSA 3V04A 3BLHA 3COKA 1OKYA 2C5VA 5DN3A 2IN6A 2ZMDA 4O91A 4YZMA 4IWPA 3VW8A 3ORKA 5GIPE 5LQFA 2QD9A 1ZOHA 4PMMA 3ZYAA 4ZS4A 4C58A 1DAYA 5DH3A 4I23A 3BLRA 4TWCA 3FKNA 2WIPA 5F20A 3SX9A 2B54A 4IX3A 5EQEA 2Z7RA 3SXRA 4X2GA 3VRZA 1SNUA 2R3FA 1GIHA 2QG5A 3DDPA 5CLPA 4O7LA 4QMXA 2AC5A 4I24A 1YOJA 4FSQA 4D2SA 2WMBA 2GQGA 4J95A 5AA8A 4RLLA 4MD9E 2PVRA 3QRJA 1QPCA 5AADA 4NM0A 2CPKE 3TV7A 3OZ6A 5B2LA 2WXVA 2IG7A 2FSOX 1YI4A 1MQ4A 2R3MA 3DA6A 3PSCA 4CNHA 4TRLA 3HDNA 3EQRA 4LFIA 5IA3A 1OM1A 5LWMA 1XH6A 2ITPA 3C0GA 3GQLA 3UOJA 4FUYA 2OLCA 4EOMA 2JGZA 3B8QA 3I79A 1EH4A 1IRKA 2I0YA 2IZRA 3OVVA 3QA8A 4FZ6A 4LGHA 1TQIA 4CMTA 4TXCA 4YURA 4QMLA 3TEIA 3TT0A 2FSLX 2O8YA 1XH5A 4AFJA 5E90A 3ZRKA 4AZFA 3MFTA 4A4XA 4IZAA 4JX7A 4ZTNA 1H25A 3VS2A 3P1AA 2UW0A 4LV5A 3MN3A 3LVPA 3E8DA 4H05A 5F94A 1XR1A 3FMEA 1P14A 3UDZA 4XLVA 3UO6A 4HPUE 2J0IA 3F3ZA 3QQHA 3V5PA 2FSMX 4ALWA 3AGLA 2QOQA 3VS5A 3GC7A 4NKAA 4DH7A 4V04A 5ANKA 2WTIA 2PWLA 2ACXA 3BV2A 3KRJA 4I5PA 2J2IB 4HCUA 1CSNA 3AKJA 4TT7A 4ANQA 4U5JA 5HKMA 1IAHA 2BFXA 3Q9YA 3ORIA 4FEXA 2PZRA 4I0SA 3V8SA 3Q52A 5J87A 2C4GA 4C02A 4FGBA 2I7QA 3IS5A 5CTPA 5LARA 3BL9A 3UIBA 3TTIA 2C47A 2J9MA 5KO1A 4GVJA 2X39A 1NW1A 3NW5A 4ONAA 4QYEA 3FC1X 2GHGA 3TXOA 4FKSA 3R8MA 3UTOA 3ZC6A 4WRGA 3W2CA 3OW3A 4IVCA 4RMZA 1Q62A 5KMIA 4XHKB 4AW1A 1GZ8A 3PA3A 1BYGA 3BEAA 4GU6A 3TYKA 2GDOA 4EWQA 2HXLA 5AUVA 3R7OA 3VBYA 4ZLYA 3PYYA 4FNXA 2JD5A 4BTKA 2UZBA 5IQAA 5AV1A 2BDFA 4F6WA 1W0XC 3LCSA 5G1XA 4CFNA 4A4LA 3PSDA 4I5HA 2R64A 2FUMA 3JY9A 2QO9A 3CQWA 3DTWA 2ZB0A 4H3QA 4QQ5A 2XJ1A 1BL6A 3FV8A 3PJ2A 4O21A 3VBXA 4EZ5A 4GS6A 4QPAA 3LIJA 2C68A 2BDJA 4DHFA 4YR8A 4ANBA 5D12A 4YHTA 4XH6A 2R3GA 3R9NA 1J1BA 3TM0A 4R3PA 4ZZOA 2QLUA 1ZYDA 3QFVA 3GUBA 4XP2A 2JKKA 2J6MA 3AD6A 3OY1A 2EXMA 4ACMA 2XKDA 4EH9A 4ENYA 3EJ1A 4IC8A 4APCA 3F5GA 4DFXE 3KL8A 3RGFA 4AWIA 2IVTA 3QALE 4F9YA 2GSFA 2XF0A 4MKCA 4O0XA 1CKJA 3THBA 3GBZA 2YEXA 3CQEA 3IW7A 2C3LA 5DA3A 3RAIA 3U9CA 3V5QA 4NJ3A 4QP4A 3I4BA 5AX9A 2FGIA 4D0XA 1ZWSA 5CU4A 1H28A 2J90A 2W9FB 3FE3A 2JDOA 5DT4A 2ITZA 3E8EA 3ORZA 2QOHA 3EQPA 4PX6A 5JN2A 3KXMA 3NUNA 3R01A 3W0RA 2CNVA 4FV3A 4DEDA 2XK8A 3CLYA 4DG2E 4KB8A 3UYTA 2XIYA 5BYLA 3NSZA 5DIAA 1RQQA 4CFWA 4F08A 4YJQA 3A4PA 3TKIA 4F9AA 4MHAA 4QTEA 4NW5A 3ET7A 2XJ2A 4ZEGA 3SG8A 4D4SA 4DE4A 1OIUA 3PG3A 5EW8A 1KWPA 2PVKA 4XX9A 1WBTA 2WZJA 4HYIA 2AYPA 4KNBA 4WRSA 4JIAA 2E9OA 2XEYA 4FZDB 4OGRA 2A19B 4C2VA 4YSJA 3MTFA 4J8MA 4B8LA 3S0OA 4CRSA 1M52A 2C6TA 3GP0A 3W33A 4BTFA 1FQ1B 1XKKA 5EKNA 4F7JA 4O0SA 3RM6A 3O71A 4DH8A 4BI2A 2QOCA 1U4DA 4A4OA 4EUUA 2OJGA 4YNEA 4BR3A 4U79A 5C4KA 2V7OA 3QTRA 5A4QA 3LHJA 2ITOA 2W0JA 4Z7GA 4MBLA 3Q3BA 4YC3A 2O65A 4Y8DA 5BUJA 5C26A 4I6BA 5L2IA 2VTTA 5HCZA 4BI1A 5HO7A 1PMVA 4DGOA 1V0OA 3M2WA 3SVVA 2GPHA 2RFNA 4O6LA 3ZO3A 4GFGA 4PMSA 5JKGA 4YBJA 5T6KA 5EG3A 1KUTA 3Q4TA 2XCKA 2ZMCA 3ZZWA 4FVPA 3AC4A 1GJOA 4IM0A 4JJRA 1TQMA 2W4OA 3FQEA 4IM3A 3WF5A 1VYWA 4CKRA 2CNUA 4BCGA 3HV4A 5A54A 4W4YA 3PY1A 3ZBFA 4AACA 1ZZ2A 3A8WA 3CPCA 2XNEA 3RKBA 2VN9A 4FEWA 4QMWA 4MXXA 5HG8A 1APME 3R7VA 2YJRA 3V6SA 2HY81 3CPBA 4LL0A 4WUNA 2FO0A 4C61A 5CY3A 3R8UA 2RKUA 3VQHA 4O2PA 1OKWA 4BJJB 2BKKA 5CAQA 1BL7A 1XO2B 2WEIA 3CTQA 1XH8A 3HMIA 3ZONA 5AP2A 1GZKA 4HNFA 4CFXA 4AT5A 3P08A 2ITWA 1JSTA 1UWJA 4AAAA 4QQCA 2DWBA 5I9UA 3SRVA 1QPJA 4G9RA 1NVRA 1NY3A 4FG7A 2ZAZA 5E4HA 2E9UA 2I0VA 3RAWA 4I6FA 3W18A 4H1MA 3ZXTA 4AS0A 1Q8ZA 4PNKA 3RK7A 1I44A 3P79A 3QHRA 4ERWA 4L9IA 1XBBA 2X4ZA 4GUEA 2QU5A 1XMLA 2Y8OA 3UPXA 1LPUA 5KMMA 4DH1A 4EHGA 4HVGA 3M1SA 2GNJA 3F3WA 2XEZA 4NFNA 1UV5A 1M14A 3O96A 4G6LA 4WHZA 4U44A 4JRVA 4XV2A 3S00A 4GK3A 5AX3A 3C4EA 1JPAA 2C6IA 2UZNA 4RC2A 2YIXA 3Q9XA 5D7AA 5AP7A 4FNYA 3ZM4A 5IA1A 1MRUA 4S34A 3IW5A 3C4CA 4GCJA 4QP7A 5IMXA 2X2MA 4FSTA 4O7NA 3ATSA 4XG2A 3FMDA 3GC9A 4OTRA 2YZLA 4M14A 4EH5A 4FODA 3TUCA 3C50A 4O96A 3JXWA 4GUBA 5FM2A 5H8BA 4XBUA 5CSWA 1ZY4A 4S32A 5E9EA 5DR6A 5HD7A 3UG1A 4NW6A 2PSQA 1ST4A 4L44A 3UIMA 1SMHA 3IONA 4KRDA 4X21A 3R63A 4C3FA 3MY0A 3KCFA 5CXZA 4HYUA 3Q9ZA 5KBRA 5L6PA 4Y83A 3RPOA 4O27B 4EWHA 5CSPA 1YWRA 3WYXA 4DT9A 3POZA 3OG7A 3AC8A 2W1EA 3FLQA 5HIEA 4QQJA 4JT3A 4PRJA 2YFXA 4RZWA 3PTGA 4KIOA 2RL5A 3A99A 1UWHA 3TV6A 5I9YA 3DAKA 3ZSIA 2ONLA 3EN6A 2R7BA 3D5XA 4AA4A 4JNWA 5H2UA 3RK9A 3PFQA 3C1XA 3E87A 2PMOX 2HENA 4RJ7A 3OWKA 5AV3A 2A1AB 3E88A 4H39A 5DNRA 4W4WA 3U6JA 3PZHA 4DEAA 1G3NA 3LXNA 3P9JA 3W2SA 4RIWB 1FGIA 4I92A 3FY2A 2C6KA 5IDPA 5IEYA 3QTIA 2RFEA 1R0EA 2UW8A 3DJ7A 3OF0A 4HJOA 3PP0A 4KD1A 4KBKA 2HW6A 3BLAA 5AAFA 4XJ0A 5D11A 2CCIA 4XG6A 5CVFA 3CGOA 5D41A 3HYHA 3AG9A 1ZARA 2Y6OA 4W8EA 4ZAUA 3CS9A 4Y85A 4O7RA 4K9YA 5KMLA 2W4JA 3U4UA 3LJ1A 2CKOA 5AUYA 4IAAA 3TZ8A 2C3KA 3FLSA 2F2UA 4J7BA 5L8JA 4AT4A 1YVJA 3ELJA 4OW8A 4UZHA 2PZPA 5JRQA 3CP9A 2GQSA 4A9YA 2I1MA 3GU6A 4ASEA 3VUDA 4ITIA 4IH8A 4JX3A 4D5HA 4F6SA 1URCA 4G3GA 4QP9A 5FTOA 4LM5A 2PVMA 4EQCA 4L01A 5EW3A 3Q53A 4DYMA 5L3AA 1BLXA 1RJBA 4O7OA 4F7SA 4FBXA 5E92A 1CM8A 5L2WA 3IW8A 3K3JA 4DHZA 2GTMA 3UQCA 1ZMWA 2QOIA 4TNDA 4RJ8A 5F1ZA 2GFSA 5I5ZA 2Q0BA 1SVGA 1JLUE 4OTHA 5LMKA 2G2HA 3OEZA 1Y6BA 1BI7A 4F65A 3BGZA 4CG8A 4NK9A 3PVGA 1J3HA 5IA2A 2XNMA 5CZHA 3NW7A 4CTBA 3T9TA 4BDDA 1OITA 3BYMA 1PF8A 3KRLA 5HX8A 2W4KA 5KX8A 3AC5A 4MNFA 4F99A 5M08A 4BRXA 3D2IA 4EUTA 2JFMA 4C4GA 4PY1A 3FKLA 3W2QA 4U81A 4UWBA 3HP5A 4HYSA 3WYYA 4ORKA 3W0MA 3K3IA 3G33A 4MXAA 5CU3A 3DPKA 1L8TA 4BCPA 4RRVA 3DNEA 3UOLA 2QG7A 4TPTA 5CF6A 4FKLA 3RAHA 4E73A 3BE2A 3VJOA 3QLFA 2OIDA 2FVDA 3SKCA 4ACCA 2X7OA 4LDTA 3ULIA 2BRNA 3QYZA 4ZSAA 5HTCA 3E5AA 1H4LA 3OMVA 1OKZA 3QX4A 3W32A 5HNIX 4R1VA 4XG7A 5A14A 5K3YA 4R5SA 4RVKA 3VC4A 5GIOE 3TNPC 1YDSE 3W2PA 2IO6A 3E64A 3WZUA 2QOLA 2YIQA 4S30A 4C4HA 4EZ3A 3NCZA 3REPA 4A7CA 4IWOA 2O2UA 2RIOA 4DEGA 4RZVA 2V55A 2DUVA 3MBLA 3OOGA 2OZAA 2WO6A 1W7HA 4ASXA 2XYNA 1BX6A 4AZWA 4QYYA 4DFUA 2VWUA 3AKKA 4AZEA 4R77A 2GS6A 4FV7A 4EK8A 2UVYA 4NFMA 3O8TA 5E7RA 4ERKA 4F7LA 4U6RA 3HMPA 1QPEA 4FOCA 4FT5A 3VS6A 5M44A 2Q0NA 3EZVA 5FGKA 1R0PA 5J95A 3IDCA 3HL7A 1V0BA 4IADA 2XALA 4O0VA 5FQDC 4EOPA 3FEGA 3U8WA 1XH9A 4PNIA 1HCLA 1PKDA 3AKLA 2VTJA 3C4XA 3UBDA 4EZ7A 3NUXA 1MP8A 2QKWB 1GIIA 4LG4A 2VTLA 4R1YA 5ANGA 5G6VA 3CC6A 3HAVA 5ANOA 4EH6A 4USEA 4QMZA 4QP2A 4KBAA 4BCJA 5K4IA 3QXOA 2QI8A 4RC4A 3OT8A 3C9WA 2YABA 3ATTA 4YO4A 4UALA 3SOCA 2C0OA 3HV3A 4HPTE 3MFRA 4BDFA 3FMKA 3L8VA 1JKTA 2R9SA 3FI3A 3RI1A 3ANQA 2GNHA 4L42A 4A9RA 3D0EA 3AGMA 4FVRA 4GT4A 5AEPA 3LFFA 1U54A 2C6DA 2CGUA 2ZV9A 5BMMA 2ZDTA 3PJ8A 1P4FA 3T3UA 4EQUA 4X2FA 3TL8A 5CVHA 1WMKA 4AE9A 5HD4A 2R3IA 3DZOA 2VTSA 4K2RA 4ZTSA 3ZHPC 4BDIA 2E9PA 3OOMA 2AEGA 2X8EA 3FLNC 5IPJA 4MK0A 2BPMA 2ZM4A 3COIA 4BBFA 4A9TA 3NS9A 3ZO2A 4D55A 5C8NA 4FJVA 4FKIA 4RIYB 4EORA 3IPHA 4TY1A 3ZEWA 4BZOA 3NFFB 3R6XA 4RQKA 3VF9A 4S2ZA 2VX1A 3PVBA 5CS6A 3FXXA 1YXTA 3EN5A 2VTIA 3QF9A 4MD7E 2YITA 4F0FA 5TO8A 2YM8A 4FTRA 3ZSGA 4WSYA 3F7WA 3R9HA 3O7LB 2PULA 2VWIA 3HRBA 5HE0A 2HK5A 5DYJA 5CEIA 3S95A 4BBMA 1PXNA 2CKPA 3TZMA 1PRYA 1CTPE 5HO8A 2X8DA 3D5UA 2R7IA 2X0GA 2ZV8A 2PUUA 1K2PA 2CN5A 3MA3A 3NX8A 4ACDA 5IQGA 4BI0A 4LUDA 5LMKC 4TYHA 3TCPA 3VVHA 3DKFA 3PPZA 2C69A 4OUCA 5E1EA 2V62A 3KC3A 3ETAA 4FV2A 4RVTA 3TZ7A 5CANA 2BCJA 2YAKA 3CR0A 3QQJA 3QCXA 5D1JA 3A60A 3EFWA 2PE1A 4IX6A 4ALUA 4U97A 5J9LA 3D83A 3BU5A 1UU8A 1YHSA 4U3ZA 3BU3A 3MJ1A 5B0XA 1AQ1A 2XMYA 5DHJA 5IA0A 1UNLA 2EB3A 3CJFA 2XARA 5JT2A 4A07A 5CAOA 3LFAA 3QQGA 4AA5A 5KKRC 1W98A 3QTSA 1URWA 3AMYA 3VBQA 5BYZA 4DA5A 2F57A 4ZJJA 2ITUA 4BIEA 2C5NA 4GU9A 2O3PA 5IQHA 1BI8A 4O22A 3G2FA 2XNPA 4KIPA 2Z7QA 1CKIA 4PDYA 3BE9A 3PFYA 4QMOA 3Q5IA 4XUFA 3RHXA 2EUFB 4DT8A 3QRIA 4TWNA 3TUBA 4DTKA 3I1AA 4C37A 4EEVA 1A06A 3D7TB 2I40A 1IA9A 3D15A 3P5JC 4LQMA 4P2KA 3AMAA 4O7PA 3ZO1A 3Q6WA 3QZIA 5I9XA 2F7XE 4M67A 3DJ6A 4YZDA 4RIXB 2YA9A 4YGAA 3VW6A 2UZTA 3GEQA 4E8AA 3VS1A 3JY0A 4P5ZA 3OTVA 2GNLA 3FI2A 4UY9A 2BVAA 5IQIA 3OS3A 3R71A 5IZFA 3FHIA 3QKKA 2R3LA 4FTUA 1PXOA 4DC2A 4JMQA 3GOPA 5HEZA 5IF1A 2W1FA 4O7WA 3VBVA 3UC4A 4EJNA 3T3VA 2VX3A 4FYOA 5E91A 4F6UA 3QUEA 5E8UA 4AZSA 4CD0A 1REKA 4C59A 2ZB1A 3LLTA 4D1SA 4IB5A 4FX3A 2YCFA 1VZOA 3BYSA 4HGEA 4LI5A 3UGCA 2XKCA 3BYVA 5AP5A 5HQ0A 2VWWA 4DG0E 4DITA 4I94A 3QAME 4F0GA 1V0PA 3O23A 3QWJA 5CQWA 4BDCA 2OO8X 3FMHA 2WQOA 3B2WA 4GMYA 4K18A 4DFNA 3C4WA 4ZOGA 4CFFA 2E9VA 5EHYA 2PE2A 4C34A 5CEMA 3MW1A 3AT2A 2QU6A 1YI6A 2G15A 3MESA 4Y46A 4HVHA 4I0TA 4M13A 4YZ9A 2B9IA 5JZNA 4BHNA 4E6DA 2QOOA 2CKEA 2C0IA 4YLJA 4G9CA 4IFGA 2YCSA 2YDKA 3NEWA 2C5YA 3PJ1A 4P90A 1VJYA 2YAAA 4RGJA 3RPRA 3LM0A 2EB2A 3DLZA 5KZIA 3SHEA 2F7EE 5HLNA 3AXWA 5AP4A 3PP1A 3NW6A 5HG7A 4CCBA 2FYSA 1WBOA 1PXPA 2R3RA 4FL2A 4FVQA 2QC6A 3KA0A 3W55A 3DJ5A 5M51A 4IAZA 4FTJA 3BHTA 2R0IA 4L8MA 3RZBA 5DEWA 3HRFA 3PRFA 4LRJA 3EKNA 1H08A 2CGVA 2Z7LA 3UNZA 4EK3A 4TN6A 5DBXA 3F5PA 4JQEA 2WQMA 3F3VA 3ZFYA 2IWIA 3FMLA 3ZUVA 3AMBA 2W9ZB 5M07A 4R7BA 2J0MB 2XAMA 5J9YA 5CVGA 4GV1A 3UG2A 4UXLA 5KNJA 3KVWA 3ZLYA 3ZUTA 5CSHA 4KS8A 5H3QA 5AM6A 1ZYJA 3QTXA 5CU0A 1YKRA 2B9HA 5CI7A 5DT0A 3R9DA 2UZOA 4X2KA 4R3RA 3QQUA 3LCOA 4OTQA 2HZ4A 3EH9A 3R8PA 3UMXA 1R3CA 3CE3A 3POOA 4JR3A 1IR3A 3HV7A 4K33A 3VWAA 4U3YA 4FTTA 5BVKA 1E1VA 3WIGA 3NUAA 5C8MA 3PXZA 4KIQA 3VBWA 5AM7A 4QMQA 1Q3DA 3ML1A 3QD4A 4EK6A 3QXPA 5C03A 2C1BA 2GNFA 4BY9E 3MIYA 5HTBA 4CCUA 1PW2A 3BYOA 3CKWA 3LFEA 4PF4A 5AP1A 3FUPA 1WVYA 2ITXA 4ITJA 4KUJA 5CU6A 3MH0A 4IWDA 4IIRA 4L00A 5CNNA 3UO4A 3E3BX 3PIXA 4GRBA 4XBRA 4B99A 5CWZA 2VTHA 4C35A 4EOQA 4KAOA 3QL8A 2P55A 4I3ZA 5LMBA 2W96B 1FBNA 4MXOA 4FV9A 5F95A 1MRVA 1M17A 4CKJA 3VBTA 4N4SA 1FVVA 3P7AA 4BBEA 4CSVA 4ZP5A 3K54A 4NU1A 2WQBA 3CEKA 5IQFA 4D5KA 3MY5A 2ITQA 1MRYA 3L9NA 2G1TA 5JFXA 3A62A 2H34A 4FEVA 4E5AX 5AWMA 4AXFA 4CZUA 4QT1A 4BKJA 3VONA 5JH6A 3BQCA 2I6LA 4X2NA 5GJFA 4CT1A 4JRNA 3BIZA 3HV6A 5C4LA 3MVHA 2BZKB 3NNXA 3DS6A 5EI6A 4X6QC 5EOBA 4M3QA 2OJJA 4ZMEA 3QCQA 3A7FA 1YHVA 2ITTA 1Y8YA 3HECA 3QQKA 5EM5A 5H8GA 3QUDA 4JBVA 5JK3A 4FV5A 5HLWA 3FY0A 5IQCA 2WB8A 5IQDA 4BN1A 3UC3A 2UW7A 2WTKB 2Y0AA 4O7TA 1ZOEA 3NUSA 4BDJA 3LAUA 5AV2A 2XH5A 4BDHA 4RX5A 3VUGA 4FV0A 2QODA 3WF6A 2KULA 3V5JA 1G8JA 4NKSA 3O2MA 2ITVA 4JIKA 2Z2WA 1KOBA 3C13A 2Y4IB 3BRBA 3Q4UA 1O6YA 3FZSA 4G3DA 4FV4A 2XNNA 4B7TA 4EOJA 4FG9A 3HKOA 3ENMA 4P5QA 2YWVA 3F3TA 3WZEA 3L9MA 4GVAA 2YDJA 3GQIA 4ZTRA 1H07A 3PPKA 5HIBA 2V22A 3KN6A 1JKSA 4TYGA 5CEPA 1HOWA 4QTAA 3EYHA 2VZ6A 2X9EA 3FMJA 4FNZA 4PV0A 4TWOA 4HGLA