3W0MA

Crystal structure of a thermostable mutant of aminoglycoside phosphotransferase aph(4)-ia, apo form
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
293
structure length
293
Chain Sequence
VEKFLIEKFGSVSDLMQLSEGEESRAFSFDVGGRGYVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLPETELPAVLQPVAEVMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMFGDPLYEVANIFFWRPWLACMEQQARYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSGAGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the ternary complex of APH(4)-Ia/Hph with hygromycin B and an ATP analog using a thermostable mutant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Hygromycin-B 4-O-kinase
total genus 92
structure length 293
sequence length 293
ec nomenclature ec 2.7.1.163: Hygromycin B 4-O-kinase.
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.150 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w0mA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3w0mA02
2PUPA 5IQBA 3UZRA 4GKHA 5EQEA 3ZM9A 2OLCA 4CGAA 4DTAA 4U94A 2I7QA 4DA5A 4PDYA 4FEVA 4R78A 2CKPA 1L8TA 2Q83A 3W0MA 3TDVA 3G15A 1J7IA 4WZYA 4CG9A 5FUTA 5IQFA 3W0QA 5AFVA 1NW1A 4ORKA 4FEUA 4CG8A 3DXPA 5IQIA 2QG7A 2PUNA 3N4UA 2PUIA 4DBXA 2CKQA 4R77A 1J7UA 4FEWA 3TM0A 4DFBA 4H05A 2PU8A 2PPQA 3Q2JA 3FI8A 4DCAA 4O7PA 5EQYA 3F2RA 5BYLA 1ND4A 3TDWA 4R7BA 5EQPA 3TYKA 2CKOA 4DT9A 2PULA 3DXQA 3MESA 4U98A 3CSVA 4O7OA 5IQGA 4EJ7A 1J7LA 4DTBA 4FEXA 4DE4A 5IQEA 3HAVA 4GKIA 3W0RA 5IQAA 5C4KA 2B0QA 3SGCA 4DT8A 3W0OA 4DFUA 2IG7A 5IQHA 3W0NA 3N4VA 3C5IA 3ATTA 2PYWA 3FEGA 3W0SA 5IQDA 5FTGA 5IQCA 4N57A 3ATSA 2BKKA 3SG9A 3HAMA 3LQ3A 5C4LA 4BR3A 3JR1A 3W0PA 3N4TA 3SG8A
chains in the Genus database with same CATH superfamily
3V01A 1S9JA 1ZYJA 1J3HA 4BTMA 3POZA 4UBAA 2VAGA 3B8RA 3H3CA 3BU6A 4M7IA 1G8JA 2F9GA 3BE2A 1TQMA 5L3AA 5AP1A 2DYLA 4G5PA 4IFCA 1PF8A 3SW7A 4TNBA 2XEYA 2EVAA 4CRLA 5K4IA 3ZRMA 3BU5A 1OL5A 1H25A 3CR0A 3P79A 4FEVA 5FDXA 4RIOA 4PL4A 5G1XA 1V1KA 4EEVA 2CCHA 3QQGA 1J1BA 3LKMA 5M06A 4Y83A 2C6MA 4ZJIA 3G15A 2OFUA 4EOPA 4NCTC 2LGCA 2ONLA 1EH4A 3T9IA 4NFMA 3SV0A 4YTCA 2BIKB 5AJQA 4HYHA 4QYEA 3GU8A 2WMWA 3ORPA 4FTKA 3Q53A 3AGLA 3FMLA 5FXQA 4EK4A 4TL0A 3HMPA 4NZWB 2ZV7A 3OWLA 4FSWA 3DS6A 3UZTA 2E9UA 4BCHA 4RJ8A 5FEDA 3TI1A 2PUIA 2F7ZE 4BCKA 3LIJA 4DBXA 3KFAA 3NYVA 4QDVA 1UNHA 1SZMA 3CPCA 2OXXA 1FBNA 2BAKA 4XP0A 2XCKA 3COHA 5TOZA 1BI7A 3JXWA 4TKSA 3BLAA 4Q5HA 2ZOQA 2A27A 3QUEA 2X0GA 3HRCA 4B8LA 3NUNA 5B2LA 5KKRB 5GIOE 3CPBA 4F9WA 4MKCA 3RHKA 4DDIA 5M4FA 4O0SA 4RBLA 3NYOA 4IVDA 4O0WA 4Q2AA 3VJNA 3B2WA 4DEGA 1UKHA 2B9HA 2CKOA 4QP4A 1WBSA 4D0XA 2IJMA 5FM2A 3I79A 5C26A 1R78A 5I9YA 3BYMA 3S95A 2HXQA 3ZUUA 3CSVA 4TWOA 2VTLA 3R7UA 4I0TA 5JRSA 4F6WA 5JSMA 1WVXA 3D7TA 3JY0A 3PUFC 3BL9A 3IOPA 3ORTA 4HZSA 4XJ0A 5AV1A 4AXAA 4DH7A 4AG8A 5TT7A 4C4JA 5I9VA 3FI4A 4EH2A 2BMCA 3V51A 3EFLA 3QKLA 5A4CA 2R3NA 3ZMMA 4BCJA 3MWUA 3OC1A 2LAVA 2H34A 2YACA 3A62A 3ORNA 5B2MA 1YQJA 4O91A 4L9IA 1MQ4A 2E9PA 2P55A 3K3IA 4OTRA 2QO2A 2WPAA 4YBKA 4ZEGA 3GC0A 3ZEWA 3V5LA 2XKDA 4U44A 3BBTB 2VTMA 4TYEA 4GSBA 3W0OA 4NH1A 4E4NA 3U6HA 1HCKA 3HUCA 4A07A 4KBKA 3BIZA 3QWJA 2W4OA 3FBVA 4WG3A 3EN5A 5T3QA 3TG1A 5CZHA 4W4XA 1OI9A 2XM8A 3V5JA 4XV9A 2VWWA 3VAPA 5T68A 4RWJA 2W1IA 3AD6A 3AXWA 3OT3A 3KN6A 4X2KA 4X6RA 3PXKA 2XJ2A 1W7HA 3DAKA 2VWXA 3OTVA 1VJYA 3QKMA 2E2BA 3SXRA 4YUQA 2ERKA 4YURA 3WE8A 5CAPA 3S0OA 4G3DA 3E8NA 1JKKA 3DB8A 3EZRA 2VO6A 2CJMA 3BQRA 3GC7A 3NGAA 4L45A 4QMYA 5IISA 1OPJA 5M56A 4EYMA 4EYJA 1Q41A 3IS5A 2R3PA 3A7IA 4EH8A 3JR1A 2VO3A 1R39A 4PP7A 2VTIA 4FKGA 3W2SA 1YWNA 3I5ZA 5LWMA 4FZFB 3BX5A 3DBDA 3I7CA 5BVKA 4M84A 3R2YA 3R30A 3NYXA 1Q62A 3OY3A 4PDSA 3Q4UA 4IIRA 1L3RE 5HG7A 3MIYA 3F82A 4AOIA 4C4GA 2J4ZA 3R9RA 4RGJA 1OKWA 2B9FA 4IWOA 2Y6MA 2WOTA 3NCZA 1VZOA 4XOYA 3VW6A 4QNAA 4ENYA 2BPMA 5B7VA 1GY3A 2JKQA 2YDJA 3TKUA 3KXXA 1KV1A 3DK3A 1WBNA 4GT3A 1FMOE 4YJUA 3VVHA 4Z55A 2JAVA 3BV2A 1YWVA 5JZNA 4QOXA 2XNGA 3LMIA 3W0QA 4C3RA 1NW1A 4G3CA 4FVRA 4EOLA 5DR2A 2QOCA 1E1VA 3ML1A 5AUYA 4FV5A 1KE6A 4NJ3A 3HVCA 4BHNA 2XS0A 5DHJA 1UNGA 2C6KA 4PDPA 3I0OA 2XZSA 3BYVA 4G9RA 1M7NA 3E7OA 4YLKA 4AOTA 2FA2A 3KRXA 2ZM1A 3FE3A 4LMNA 2J9MA 1WBTA 2VWUA 3HA6A 3OXIA 4M97A 3V5WA 2Q0BA 3LHJA 4FSYA 3AC8A 4DEHA 2CCIA 1KOAA 3QWKA 3TTIA 3FC2A 3MVJA 1V0PA 2WMVA 2YM4A 4O6EA 4QYYA 4RC3A 2YWPA 1YHWA 2VGOA 2X7GA 2AEGA 4PMMA 4BGHA 2GTMA 2PVRA 3UBDA 1ST0A 3QZHA 5EQPA 5CX9A 4FV0A 5E8XA 5EFQA 3SDJA 2YISA 3UTOA 3NVMB 3QKKA 4YGAA 3SOCA 3PWYA 3PRFA 3KN5A 4QYFA 2GDOA 2QO7A 4FT9A 4QP6A 3DPKA 2FSLX 4MYGA 4ALVA 3EQIA 4L43A 1YXSA 2ZFYA 2G2HA 4NW5A 4KAOA 4UXLA 1YXTA 3LPBA 1QMZA 2BDJA 4FKSA 2ZAZA 3DQWA 4MXOA 3UQCA 4JR7A 3QD0A 2NP8A 4RVLA 4YSMA 1H0VA 3R22A 5KX8A 3DZOA 5DRBA 3DJ6A 3I4BA 2ITVA 3UDTA 4NKAA 1W82A 5DBXA 2XRWA 4YHJA 3BHVA 4BZOA 3LFCA 4MH7A 3NUPA 4EH4A 3KRLA 4RLKA 4E6CA 4FKWA 5I0BA 3JPVA 3I1AA 4AZFA 2QKWB 1ZY4A 4L44A 4AZSA 2F49A 3IW8A 3KMUA 5B2KA 2R0UA 1Y6BA 3PP1A 3POOA 2UZWE 3ULIA 4GK2A 4D2SA 3BI6A 4KSQA 3R8UA 4RLLA 4I4FA 5LARA 2I1MA 2ZMDA 2JDRA 2JC6A 2R3RA 2GNIA 3C4WA 4CCUA 5DWRA 4AP7A 4CMOA 4XBRA 3EQGA 4R3RA 3ZBXA 3K5VA 3D0EA 3GENA 3GU6A 3EN7A 2GCDA 3O0GA 2CSNA 3HV3A 4O21A 3TNQB 3FHRA 5KMJA 5DN3A 3RM6A 5L2TA 5M51A 3BHUA 3E5AA 4L52A 3PWDA 2BZJA 1G8KA 3I0QA 4Y73A 3P7CA 1OGYA 2PUPA 4QMMA 3UDBA 1XH9A 4QTDA 2G01A 4CV9A 4U41A 5L6WL 4CLIA 2XM9A 5HORA 3DJ7A 2ITWA 5A4TA 1ZARA 2GTNA 3LMHA 4M0ZA 5F94A 3LFDA 5L8JA 4A4LA 4C36A 2I7QA 3A4PA 4UB7A 2R3HA 3QZIA 3KXZA 4P2KA 3WBLA 4PNKA 1K2PA 1M14A 3NW7A 5IMEA 4ZZMA 4RIXB 3O2MA 4K18A 4YTIA 3F66A 2BCJA 4MAOA 5J7HA 2Q83A 4ACHA 3LJ1A 2R3KA 3FI2A 2XK9A 4DGOA 1LPUA 1J7IA 3RAHA 1IASA 5AFVA 2WMUA 3FL4A 4EONA 4QMOA 3NIEA 4I92A 2BILB 3LMGA 1W84A 4CTBA 4IWQA 3SX9A 5BX0A 4HNIA 3PA5A 4DG2E 4XG6A 2GS2A 3TJCA 1H27A 2W17A 4USFA 2BTRA 2HZ4A 5I9UA 3DK7A 4GG5A 4J53A 4O0VA 2Q0NA 1WBPA 5EKOA 4B8MA 5HO7A 1A06A 4NTTA 4D5HA 5CF8A 4V04A 4DFBA 1XH7A 2UZNA 5DR6A 4YJPA 4LYNA 2O65A 5HEZA 4IJPA 4U3YA 3MVHA 3QAME 3ID6C 4O81A 3ZSGA 2WQMA 4EQUA 4YJQA 2W06A 2XBAA 3U55A 3EH9A 5BYLA 5BVFA 3CGFA 3RI1A 2WTJA 3RJCA 4L67A 3H30A 4GU9A 5IUGA 3VUHA 4RPVA 5DE2A 5IZFA 5EH0A 3TYKA 4UYNA 2EB2A 4WBOA 4P5QA 3U9CA 5AADA 4O22A 2IO6A 3NNUA 2VWYA 5CEKA 4EC9A 1PMUA 2C5VA 1JQHA 3V8WA 1VLRA 4Y5HA 3UDZA 3QRTA 3WOWA 4FV4A 4K33A 3GQLA 5ETAA 4ERKA 1O6YA 3IGOA 3RHXA 4OLIA 3COMA 3HMOA 3OTUA 4IZ5A 5IDPA 5CTPA 3OBGA 1RQQA 4LQMA 4A06A 3ORKA 3FLWA 3NEWA 2H6DA 2IW9A 3V8TA 2W9FB 3RPYA 2Y8OA 2WKMA 1PKGA 3WZUA 3QZFA 3TEIA 3S1HA 5CS6A 4JQ8A 4KS7A 1AQ1A 1F0QA 3HMNA 3N4VA 4OUCA 4S2ZA 3PZEA 4CKIA 4IVAA 3FEGA 5BUJA 1OMWA 1LEZA 5JQ5A 3G0FA 4MNEB 5CEMA 4G6OA 3TZ7A 3ROCA 1Q8YA 5HNIX 3TNPC 4FV6A 1KE8A 2YJRA 1Z5MA 4RX8A 4DBNA 4JDJA 2NO3A 3QQFA 2XIRA 3DLZA 4GK4A 5AP4A 2WTIA 4OTDA 3PXQA 4ASZA 4GVJA 4JI9A 2W1HA 3ZO3A 4D58A 5LXMA 4RJ3A 2X2KA 4ITJA 5J1WA 5EM7A 4RMZA 4NM5A 4P90A 2GHGA 1Q61A 4HGLA 4PY1A 3O8UA 4O2PA 1H0WA 3VS2A 1Q8UA 2BZIB 3LXPA 2R3IA 2PVYA 5EYMA 5M4UA 3OXZA 2OLCA 4O38A 4QYHA 1YDRE 2UW0A 2VWBA 3E92A 4KUJA 4JJRA 3ITZA 4FG7A 4KKGA 3V5TA 2R3QA 3R1QA 4AW1A 2NYAA 4JVGA 4Z7GA 3UJGA 4WZYA 4JDHA 1UKIA 4GUEA 3KA0A 4U43A 3CCNA 5E8YA 3FQHA 4CQEA 4AXDA 4CZTA 1SVEA 3PY3A 1GJOA 2X8IA 4FEUA 2W9ZB 4OBQA 1CKIA 3PXZA 5HTCA 3C0GA 3JVSA 3DXPA 4FC0A 4QTBA 2C3KA 4DEIA 3VONA 3O50A 4G16A 3U8WA 5CYIA 4CFVA 2C6LA 5KMMA 4IJ9A 3FXZA 1FINA 1QPCA 2WD1A 3DB6A 2B52A 2WEVA 3EB0A 3GFWA 1XH4A 4NL0A 2SRCA 2YIXA 3BLRA 5D7AA 4MCVA 4H1JA 4FI1A 2JITA 2HAKA 2PL0A 4QP1A 4X6QC 3UC3A 2OBJA 3PVBA 1IEPA 4DN5A 4MBJA 1DM2A 1PXJA 4I4EA 3FMKA 2J0LA 3QQLA 3MH3A 4GCJA 4FTRA 4ZZNA 5C8KA 4RRVA 4XV2A 2YJSA 1OL7A 2FYSA 3WZKA 3BYOA 3K3JA 4AW0A 3KXNA 3ZXZA 1VEBA 3NUXA 3OS3A 4IAKA 4AXEA 4UN0C 5ANKA 3VBYA 5FDPA 5J9ZA 4PQNA 2YITA 4C7TA 4B9DA 3ZLWA 5BVWA 4Z3VA 3KQ7A 3VS7A 5K4JA 3Q3BA 4GK3A 4IAYA 1XO2B 2WMSA 4WNMA 3ZO2A 3PJ8A 4J97A 3NFGB 4RJ7A 3QTRA 3CTJA 2R3MA 3BGPA 4LGHA 2FB8A 2WTKC 4TN6A 3KREA 4LRJA 3F3TA 3QLFA 4XUFA 3GBZA 4U79A 2B0QA 1BMKA 4BCFA 4NKSA 2QLUA 4LMUA 3OVVA 4AGCA 2A4LA 3L8SA 3PIYA 2XK3A 2OGVA 2X7OA 3I60A 4X2NA 2QHMA 3RK9A 3M11A 4QP3A 5EDRA 3DV3A 1FMKA 4D1XA 2C30A 1JVPP 3D83A 4FGBA 3R9OA 3E64A 3CS9A 4LOQA 4CMTA 3BHTA 3G9NA 4O0TA 4OTIA 3DFAA 3IGGA 3QQJA 2F2UA 3EYGA 5DOSA 4HPUE 4YTFA 4WBBB 3HA8A 4KB8A 3MFTA 4S30A 5C1QB 1G8SA 4EZ5A 4HVHA 1XR1A 2F7EE 1PY5A 2XYUA 3GVUA 4J8NA 3ORIA 5HE1A 4KS8A 3N4TA 3GU5A 2W99B 2IN6A 3ZFYA 3EL7A 2HELA 4YZCA 4AN9A 3IPHA 4AW2A 4YR8A 3GNIB 4YC6A 3VBVA 3UZRA 1OKVA 3TUBA 3PVGA 3AD5A 2JIVA 3RPRA 3C4XA 5HVKA 5CEOA 5M08A 3RINA 3R8MA 2W1DA 2ITQA 2YCSA 5F95A 1NY3A 3VHEA 4E7WA 3OCTA 5LWNA 4AAAA 4F63A 2HZIA 1OL6A 2ETRA 1NVSA 3E93A 2OXDA 1IR3A 4K0YA 2PTKA 4JG8A 3NVKI 2OZOA 4WG4A 3HGKA 1MQBA 4DH5A 4U81A 3W16A 4ANBA 4D9TA 1CSNA 2ITTA 2PVNA 2FVDA 4JDKA 2WTCA 2DWBA 1PXLA 4FK6A 4JQEA 4ORKA 3H9OA 4L3PA 3R8ZA 4I21A 3IECA 2X9FA 5KCVA 4JIAA 2V22A 5KMIA 5DR9A 4FVPA 5DLSA 5AUVA 5HIEA 4EL9A 3HV6A 3FAAA 2V5QA 4NUSA 4I23A 4WUNA 4BDEA 2UW3A 3QL8A 3QX4A 5B0XA 4RJ5A 4E5WA 5L2WA 4BIBA 2IZRA 2GSFA 2HK5A 5G6VA 2VTAA 4N6YA 3U4WA 3EQHA 4OTWA 1H1PA 4A9TA 5A4QA 4EK6A 2BFYA 2CLQA 1PXPA 2G9XA 2PU8A 2ZM4A 4FT3A 4G31A 2HYYA 4QRCA 3ZBFA 4BI2A 4EH5A 3AC4A 5A54A 4EI4A 4D2RA 4AOJA 5CALA 3KXHA 3KGAA 5DNRA 3Q4CA 1ND4A 4J95A 4WSYA 2YWVA 2X6EA 5AMNA 3W8QA 3KY2A 3G6GA 4AZVA 3OROA 4YJOA 3UG1A 3UPZA 3LJ0A 4U6RA 3ETAA 3L8XA 1PMNA 2WTDA 4AF3A 1ZZ2A 4LFIA 3R8LA 2Z2WA 5C01A 4HGEA 1UU8A 1QPEA 2B9JA 2Y4PA 5AV0A 3VS1A 1WMKA 1QPDA 3P86A 3R63A 3TKIA 3AKJA 4Y95A 4O7OA 3R1YA 3FXWA 4BTJA 4G1WA 5HCZA 3SKCA 1R0EA 2XP2A 3P23A 4W8DA 4GKIA 2Z7LA 3FMNA 3NNWA 3BE9A 3EWHA 5KMLA 5CEQA 3BEAA 3VS6A 2OJJA 3KF4A 1IAHA 1OVEA 1CKJA 2CHLA 3RAWA 3P08A 3VUKA 4RC2A 5M44A 4ZSJA 4QP2A 1MRYA 3GEQA 4RT7A 3S2PA 3SGCA 1KE5A 1PJKA 1YOLA 4PUZA 5KKRC 3GU7A 3SC1A 4LUEA 3RVGA 3G5DA 3R73A 4EHZA 2VX0A 3C5IA 3ORMA 4AN3A 3HECA 4FOCA 4KINA 5H2UA 3VS3A 2UZVA 3BWJA 1M2PA 4FTLA 4FV9A 4O84A 1Q3WA 4D9UA 4TT7A 5CAOA 4ANQA 1P4FA 3BLQA 3QCSA 3OEFX 4G3EA 4R6VA 5HE2A 3BV3A 2UW9A 3ORLA 4RSSA 1VR2A 2J0KA 5E8TA 2C5NA 3WIGA 4AACA 2C4GA 5FP5A 3QA8A 2BUJA 2ZMCA 3QFVA 3KK8A 4A4OA 4A9YA 2YZAA 4YNOA 5HHWA 2XIZA 3AQVA 4ZSEA 3P5JC 3Q4TA 5IG1A 1LEWA 2OJFE 5JFSA 1XMLA 3IW6A 2QOFA 4R78A 4RWLA 3NUYA 2CNQA 4RZWA 3QYZA 4WIHA 3FDNA 5IH4A 3O17A 5FTQA 4OTQA 5F1ZA 5IDNA 4F9BA 3DA6A 2A0CX 2NRUA 3MH1A 4YC3A 4RA5A 4BKJA 3D7ZA 2YIQA 4TYJA 3QD3A 3RCJA 4LGGA 4WG5A 2I6LA 3CE3A 4BDGA 4ZS4A 4F1MA 4ASXA 4GJ2A 3UP2A 2RKUA 4WT6A 3E87A 2EB3A 3QHRA 5HBEA 2ITNA 1OECA 4HCVA 1YW2A 3VHKA 3ROYA 3A8XA 2C5YA 2YM8A 3FLSA 2HXLA 2FSTX 2JDOA 2WELA 3CD8A 3PA3A 4LL0A 1BL6A 1Q4LA 4TRLA 1Z9XA 4G6LA 5HX8A 5JN2A 4CFNA 4RIXA 4DEEA 2R3OA 5AUWA 4EC8A 4FEWA 2ESMA 2ETKA 4M67A 2YERA 4CFXA 3R7OA 4XV3A 2VD5A 2OWBA 5L2IA 3AC3A 1YXUA 5CU6A 4FTAA 3O23A 4O7PA 5CXZA 3GCSA 4E26A 1GZOA 2IWIA 3UQFA 3DKOA 1XBCA 3UVPA 4O7LA 4R7BA 3ZSHA 4CFMA 4EORA 4EOIA 2PZYA 3GC8A 4G3GA 5HLWA 2OW3A 3D5WA 1WVYA 2PULA 3O7LB 4MWHA 5E9EA 4ANMA 2XAMA 4FNWA 5AV3A 1U59A 2ERZE 4PTCA 3SRVB 4EQCA 1REJA 1MP8A 2XIKA 5L6OA 2VTSA 3JS2A 5CVFA 2OIDA 4ERWA 4FV7A 2DS1A 3DTCA 3EKKA 5IQEA 5LCJA 4W4VA 3A61A 2WB8A 3RPSA 3VS4A 4I0RA 3DDPA 2UVYA 1R0PA 3UP7A 4FL2A 3P78A 5C27A 2XKEA 4QP7A 5CANA 4KSPA 2OJIA 5A9UA 2AC5A 1URWA 4BCQA 4R3PA 4QMPA 1B39A 4M8TA 3PG3A 4MQ2A 3PPZA 2WIPA 4XX9A 1GNGA 3FMDA 2WXVA 4I5HA 2QLQA 4N70A 5IQDA 4QQJA 2YM6A 4AGUA 3LCDA 5J5SA 5JMSA 2GHMA 4IACA 4IM2A 2BRBA 3FC1X 1YXVA 4M68A 4E73A 2J0MB 4AA4A 3LXNA 3LCKA 5DRDA 3PXRA 4KNBA 4UX9A 2FH9A 5J9YA 3NDMA 3OOMA 4R5SA 4H58A 4DHZA 4DHIB 2ZV2A 3HV4A 3QRIA 3W0PA 2GNJA 2XNPA 3V6SA 1F3MC 1G3NA 3AMAA 4FTNA 3Q04A 2GPHA 2R3JA 3JY9A 4U9AA 3UIMA 4H3QA 3W18A 3CGOA 5DT3A 5LMKA 4BDFA 2WMBA 4I6QA 3H0YA 4KABA 4CMUA 3UE4A 4FICA 4FNZA 3UIUA 4FIGA 2P2HA 4XP2A 4C0TA 1W98A 3D9VA 4L8MA 4X7QA 2QOLA 4XRLA 4DA5A 1X8BA 2QKRA 1G8AA 3F7WA 4JG6A 4O83A 5FTOA 3ZDUA 5E8SA 4I22A 4IQ6A 2JFLA 3FXXA 4XG3A 4BGGA 4DGLC 5J9LA 3OW3A 2W1EA 4C4FA 3A2CA 3LLTA 3AMYA 1CKPA 4GT5A 5TF9A 2YABA 4JT3A 3CQUA 4E4XA 2QVSE 4TW9A 2JBPA 3SVVA 2OH4A 4XS2A 1XBAA 3F6XA 1PW2A 3LZBA 3OUNB 2X4FA 4PF4A 1PXMA 3B2TA 2QOBA 3EZVA 1OL1A 4ZTSA 1KE7A 3CIKA 3ZLXA 2CLXA 3DKFA 4XBUA 5DI1A 2WIHA 3IQ7A 2R5TA 4YU2A 2BVAA 1JKLA 2V7AA 4FSMA 2HWOA 4AFJA 4V0GB 4QMTA 4BDHA 3W33A 4FOBA 2QONA 3TM0A 4F9AA 3GB2A 3PLAE 2FUMA 1ZMVA 4C2WA 4QTAA 2W1CA 4E5BA 1XKKA 2WOUA 4ID7A 4TYGA 4WRSA 4B99A 1H1WA 2W1ZA 4EOMA 2XKCA 5HE0A 4IHPA 3IW4A 4RFYA 2Z7SA 3ALOA 3Q60A 4DFYA 1PMVA 5IUHA 2WMXA 1OUKA 2X81A 5EW3A 4O7YA 2CGWA 4FKQA 3DKGA 2XRUA 4ITIA 5JGAA 3SXFA 4C59A 5HBJA 3E62A 4Z9LA 5LMAA 3L9LA 4IAIA 4AZEA 2OZAB 4O0XA 1OGUA 4ZY5A 3R02A 4HCTA 5BNJA 3C7QA 3K5UA 4AXCA 3TUCA 3CY2A 3OHTA 1U54B 3MFRA 3L9NA 2OIBA 3O5AA 4CFUA 4DE4A 3OWJA 2OI4X 4FNXA 5J87A 3HAVA 4OTFA 1AGWA 5E91A 3VF9A 4FG9A 5HU3A 3IO7A 2ITZA 4JLCA 4F08A 3TL8A 4DCEA 1A48A 2KULA 4U5JA 4RIYB 5HLPA 1XQZA 3QCYA 3F3ZA 3HNGA 1PHKA 4ARKA 2Y0AA 3Q6UA 5HG9A 4J7BA 4OT6A 3LAUA 3MVLA 4LUDA 3MTFA 4YZBA 1JAMA 5E8ZA 3DGKA 3FMMA 4AU8A 3ATTA 4II5A 5AUTA 4YPDA 1DAYA 3QF9A 4YNEA 3E8DA 4EHVA 3CP9A 2I0YA 3GFEA 4MNFA 4FMQA 3IONA 4IAFA 4OT5A 1UV5A 4FKRA 2WGJA 3FMHA 5KZ0A 4FKIA 5AV2A 2VTOA 3LXLA 5ACKA 4FKVA 3U4UA 2CN8A 4PV0A 3QYWA 4NK9A 3FZTA 2QURA 2XAOA 5L6PA 3KCKA 3PY1A 3DCVA 3H9FA 2WQNA 1E9HA 3PJ2A 3QQHA 4FTOA 3NW5A 4FTTA 4ZLOA 4BC6A 2P33A 4IANA 3W55A 1M2RA 4F6UA 4JAIA 4WRGA 5KNJA 3F3VA 2X7FA 2V7OA 1OM1A 1JSTA 3TTJA 4PDOA 4AFEA 3VWAA 1GAGA 3ZM9A 3AT2A 4GV1A 4YJVA 5KMKA 4AS0A 1H01A 1U5QA 1XH5A 3OT8A 5LJJA 2XNBA 4OBOA 4YLJA 1FPUA 2CKPA 5CVHA 5D41A 1YVJA 1M7QA 3PPJA 4IX4A 4X21A 4G5JA 5AEPA 4QMVA 4JDIA 4J98A 3SRVA 3F7ZA 1HCLA 5FUTA 4E8AA 2GU8A 5IQFA 1Q24A 4QMZA 3TNHA 3C13A 1KV2A 2VTPA 4HPTE 4I0SA 5CU3A 3COIA 4NW6A 4NM7A 1GIIA 4CXAA 3Q96A 4FIFA 5CF4A 1H4LA 2CPKE 2AYPA 3MA3A 3MPTA 5AUZA 3Q32A 2BAQA 1AD5A 3A8WA 5DT0A 2O0UA 3N4UA 1OPKA 4IDTA 4JX7A 3VRZA 4JRNA 4TXCA 3VUMA 2VTJA 3V6RA 5AUXA 4F09A 2UW5A 4JQ7A 1UNLA 3MW1A 3OCGA 2PPQA 3Q2JA 1U4DA 3FI8A 3ET7A 3GXLA 2R3GA 5HKMA 1O6LA 4PX6A 1OIRA 1T46A 2IPXA 3PIZA 4JBPA 4O7NA 4QEBA 5E7RA 3ZYAA 4TYIA 1ZAOA 1KWPA 5HNBA 1JKSA 4RVKA 1OL2A 3RGFA 3HLLA 4Q9SA 4DT9A 5JK3A 4BGQA 4J96A 5LCKA 3UOJA 4C02A 4I24A 5CAQA 2YCQA 2UW6A 3PDTA 5DA3A 5A14A 3G2FA 2IVTA 2UZBA 3MN3A 3RWPA 4E5AX 3VQHA 5CVGA 2VNYA 2VX3A 3LOKA 4BDCA 4C4HA 2QOQA 5I9XA 3FL5A 4FV3A 3HX4A 1FVVA 4GYGA 4BYJA 2ITOA 4G3FA 2GQSA 3NNVA 3QHWA 4XNEA 1H8FA 4IWDA 4NM0A 1SM2A 2H9VA 4W8EA 1Y8YA 3AKLA 1PYXA 5HBHA 4DFZE 4EHGA 4F9YA 3C9WA 1ST4A 3R1NA 4QNYA 2CN5A 3FZRA 2WMTA 3TV6A 4GIHA 4K77A 3Q9WA 2X6DA 3JUHA 3W2CA 4DT8A 3RNIA 3ORZA 3V8SA 1H07A 4YPSA 5ICPA 2PZPA 4K1BA 2VTRA 3BCEA 4D4YA 5IEVA 1UVRA 4HYIA 2BKZA 4I1ZA 2W5BA 4GG7A 4RFZA 5DVRA 1OIYA 4E4MA 2ZDTA 4KIPA 4ZXTA 4TYHA 3IDCA 3O7LD 5EM6A 3R8PA 4OGRA 2R7IA 3IW7A 3PFYA 3HV5A 5IF1A 2BRHA 4N57A 5F9EA 1Q3DA 3LFQA 2WMRA 5DG5A 3RTPA 3WZEA 4BCNA 4I94A 5FQDC 2ZB1A 3NFFB 3EL8A 2O2UA 1GZKA 2IW8A 2J0IA 3ERKA 3P7AA 4HYUA 3ZDIA 2WQOA 2KTYA 5AP2A 3KULB 3NAYA 4D1ZA 3L9MA 3TIZA 2BR1A 3QX2A 2Y7JA 5H3QA 4D4RA 2Y4IB 2CNVA 4MHAA 2WTKB 5HO8A 1PRYA 3FMJA 5EI6A 1LUFA 3ZFMA 2FGIA 2PY3A 3WF5A 3LFBA 4LG4A 4DINA 4F99A 5M53A 3H10A 4M69B 3PPKA 3BQCA 3M1SA 2QOIA 4FSTA 5BYZA 5CI6A 4YZMA 4E4LA 5CSPA 3QUPA 4F0IA 3LVPA 4L3LA 1CDKA 2QU5A 3KU2A 3BBWA 3EN4A 5E4HA 4G17A 5HQ0A 2VWZA 3H4JA 2J0JA 4E20A 5KHWA 2OIQA 3OG7A 1FGIA 2J6MA 4J8MA 5ETIA 5CASA 4MXXA 4U45A 4ZSGA 3F9NA 3R04A 3QTUA 2P0CA 4S31A 5HIDA 5I9ZA 4BIEA 4D1SA 4F64A 3GCVA 4BCGA 4EOSA 3N51A 4B6LA 4ZJJA 3ZS5A 3ZSIA 4CG8A 4EZ3A 2JIUA 3LFNA 4MD7E 5D12A 5EI2A 1ZOHA 2QG7A 1YI4A 2PZRA 4BBFA 3MB7A 2X2LA 2VO0A 4CD0A 4LI5A 4L7FA 3PP0A 4UWYA 1J1CA 3MFUA 3RZBA 1J7UA 2XJ1A 5JEBA 4RVTA 3RCDA 2WTVA 4O7VA 4GJ3A 3Q9YA 3ENHA 4EK5A 2JKMA 4PL3A 3QD2B 1Z57A 5FRIA 3G33A 4MK0A 1GZNA 4C62A 2HY81 3VBXA 2HOGA 4N6ZA 3WYXA 3F69A 5JRQA 5EI8A 3GCPA 4NT4A 5BYYA 4DITA 1YDTE 3FI3A 5HICA 5E90A 1XMMA 4EQMA 1P5EA 3QALE 2OU7A 3EQCA 4HVDA 3C4EA 4KD1A 5DGZA 4BCPA 3R01A 3UYSA 1OIQA 2W05A 2W5HA 4FE2A 4YMJA 2PE0A 3SW4A 4WKQA 4IBMA 2EXMA 3WF6A 4E1ZA 4XRJA 3TUDA 3BU3A 3CEKA 3C50A 3LXKA 4FEXA 5EM5A 2O63A 3UPXA 3D15A 5AP3A 5LVPA 3PA4A 4USEA 2OFVA 4GRBA 3N9XA 4KKHA 2JDVA 4W4WA 5AM6A 2FSMX 2VUWA 4GFOA 2BROA 3A4OX 3OMVA 4JBVA 3WF7A 5HX6A 1O6KA 3OWKA 5AP7A 4MXZA 5HD7A 3QTZA 4EBWA 4QMUA 3W10A 3C4FA 1LR4A 2BALA 4H1MA 3F5PA 4IVBA 5DT4A 3U6JA 4FTMA 4CKJA 3FKLA 5EYDA 4BICA 3SLSA 3AT3A 4EHEA 1W0XC 4L7SA 4QTCA 4H39A 4IADA 3PJCA 4JS8A 4Z16A 5IA5A 3SHEA 3CY3A 3WYYA 2F4JA 3QTXA 2HWPA 5FTGA 2YA9A 4QPSA 4FV8A 5J8IA 3MPMA 2HCKA 2Y4IC 1WAKA 3GT8A 2Z7QA 3RP9A 3FKOA 4PNIA 2NRYA 4NIFB 4LV5A 1P2AA 4CTCA 4XG4A 4ZOGA 2WQBA 4XG2A 3LQ3A 5CT0A 5HVYA 3RALA 4ZTLA 3OCBA 2YIRA 5A4EA 2YAKA 4NJDA 3ZRKA 2PVJA 2WTWA 4OTGA 4UWCA 1STCE 4UWBA 2OF4A 5CQUA 3FQEA 2IVVA 3R71A 4N0SA 4RWIA 1Y6AA 2O5KA 4ZSAA 2W0JA 4C2VA 2PMNX 5CENA 2HW6A 2ONLC 2OF2A 3OZ6A 5EQEA 3TACA 4Y8DA 3R6XA 4DFXE 4IM0A 4JX3A 3GOPA 4TPTA 4YC8A 5CSWA 2ITYA 4U8ZA 2YCFA 4BTKA 2X39A 2WFYA 4FT5A 4MVFA 2G2FA 5IUIA 2V62A 4G9CA 4F78A 4XG9A 1PXOA 1M2QA 2CNUA 3OOGA 5FBOA 5DEYA 3VIDA 4HGTA 3IDBA 1TQPA 3A60A 4FIIA 4K9YA 3FLQA 4MXYA 5CT7A 4IZAA 4U0IA 3IOKA 5HGIA 3R9HA 2QHNA 5KZIA 5J95A 3RK7A 1B6CB 2ITXA 3E7VA 4J99A 4QYGA 4EJNA 4I6HA 1YI3A 2OG8A 2PMOX 4J1RA 4F1OA 3ANRA 3GCUA 4U97A 5TR6A 5HCXA 4ZK5A 1WBWA 1P14A 4X2JA 2ZV8A 3C4ZA 5IQIA 1KUTA 4AT3A 2XYNA 3FWQA 4YJNA 3R9NA 3ZEPA 5I5ZA 4X3FC 3UODA 4OR5A 1H28A 4XP3A 5HLNA 3PG1A 4DC2A 1V0BA 3KIOC 4FT0A 3D4QA 2B54A 3V5QA 3NLBA 4EWHA 3D2KA 4IX6A 3NNXA 5EK7A 3VS5A 4CNHA 2XK8A 3HUBA 3QBNA 5EQYA 5F20A 3SQQA 3T3VA 2J50A 4AAYA 4GEOA 3AT4A 4JG7A 4TTHB 4NTSA 1OBGA 3QQUA 4B4LA 4D55A 5BVOA 4BZDA 3KRJA 3MY0A 3P9JA 4MTAA 3HMIA 4FX3A 2YN8A 1XWSA 2REIA 1CM8A 3BPRA 2VWIA 1R3CA 5J1VA 2NNWB 4E93A 2RGPA 2VRXA 3RPVA 1YXXA 3UVQA 3EQDA 4DLIA 3QC4A 3BHYA 4DTKA 4QMWA 4S33A 4ONAA 5H9BA 2CDZA 5HE3A 3KCFA 1W8CA 4FUYA 5FLFA 2GS7A 3DLSA 2YDKA 3MSSA 4FKPA 4FTQA 2GQGA 3MB6A 2C0TA 4A4XA 4L01A 1GZ8A 1YOJA 3O96A 3AGMA 3S3IA 1QL6A 3RMFA 3LCSA 3IDPA 4Y5QA 3ZZEA 3PSCA 4R3CA 3NWWA 3I5NA 2RL5A 4O0YA 2C3JA 1QPJA 3W0NA 3WF8A 4F7LA 3KK9A 3UIBA 3PE1A 2R7BA 4FKJA 3RNYA 3W0SA 2V55A 4C33A 3DTWA 4L46A 4KIOA 3UQGA 4ZZOA 4AQKA 1H26A 1KE9A 3PTGA 5M4CA 3EIDA 5AAEA 3MH2A 2GFSA 3B8QA 2YZLA 5AAGA 5IH6A 1JOWB 2B1PA 5D7VA 2BRMA 4ASDA 3KXMA 4P4CA 3DK6A 1RE8A 3VUIA 3UO4A 4O2ZA 2GFCA 3ODYX 2B9IA 4QP9A 5A6NA 1UWJA 1ZY5A 4QMSA 3E3PA 3EKNA 3L8VA 3UO5A 5FG8A 5GHVA 3K54A 5IQBA 1OITA 2VTTA 3BGQA 3FKNA 2XJ0A 4EUTA 4YJSA 2VGPA 4IMYA 3ZUTA 4BCMA 3AKKA 2DUVA 1BYGA 3R00A 4GKHA 4XHKB 3NAXA 4FKTA 5KMNA 3H9RA 4GU6A 4CGAA 4LDTA 5I4NA 3U6IA 1FGKA 4YJRA 2GNFA 1ATPE 2HW7A 3ZLYA 4C38A 3EN6A 5HIBA 3WZDA 4DG0E 4OTHA 3LCTA 2OSCA 4LOPA 2UZLA 4IEBA 3QCQA 3SA0A 1OUYA 2I40A 4MD8E 3FUPA 4TNDA 4CT1A 3PRIA 4EOOA 4DEBA 5DIAA 2BIYA 4DGGA 3G9LX 3FYKX 3OWPA 3KL8A 2A2AA 3TZMA 1W83A 2ZV9A 3ULZA 3CLYA 3EQFA 5HESA 5M57A 5H8EA 2J7TA 5D9HA 3O8PA 4EOJA 1DI8A 3HEGA 4MBIA 4EK8A 2Z7RA 4ZTRA 2B7AA 4A9UA 2JIIA 4NFNA 3CKWA 3Q9ZA 1RW8A 5FM3A 4KKEA 5CAUA 3O71A 4HCUA 2UZOA 3LCOA 3NSZA 1WBOA 3LQ5A 2FSOX 3RK5A 2YCRA 4BY9E 3PIXA 2CKQA 5ANOA 4A9RA 1E1XA 4APPA 3D5VA 3KMWA 4FG8A 2AUHA 2C6TA 3CTQA 1SVHA 3F61A 3BL7A 3ZO4A 4FKOA 1H08A 3DDQA 5CQWA 2VNWA 4EOKA 4MUQA 4RQVA 3QRKA 3R7IA 3F2RA 3DOGA 3R28A 4ZY4A 1I44A 2R2PA 2QR7A 3DBEA 4Y72A 3QTSA 4RJ6A 2RFEA 4IDVA 3D7TB 3AMBA 4FJVA 4JMQA 3T3UA 3UG2A 4WO5A 4M12A 2CMWA 2OKRA 4DH3A 3DXQA 3PXYA 4TWCA 5C8NA 4U98A 1UA2A 2XARA 3COKA 4WHZA 3LFSA 3NUUA 4GMYA 1J7LA 4ACGA 2RFDA 2BHEA 3CTHA 3WI6A 5LQFA 3PJ3A 4V01A 5M09A 4YTHA 3UNKA 4MNEA 5CU0A 5E8WA 3PUPA 4AE6A 3VW8A 2XNMA 4JAJA 4MEDA 4X0MA 3ALNA 3TN8A 2ETMA 2Y6OA 4DHFA 5C4KA 5C03A 4FL1A 4BVUA 3LFEA 4YZDA 3Q9XA 2IVUA 3DZQA 4IX5A 5K9IA 4CSVA 4G34A 3IG7A 4BDBA 3L1SA 5HNGA 4QMQA 4X3JA 3NW6A 5IQHA 2P4IA 3I6WA 1OZ1A 4MF1A 3PY0A 4TWPA 1BLXA 3R7VA 2PYWA 2JGZA 4DLJA 4KIQA 3UC4A 1IG1A 1ZLTA 2ZJWA 4F9CA 1PXIA 3Q52A 1GIHA 2ITUA 3CJGA 3FSFA 5JKGA 3R0TA 1JNKA 3NS9A 3E8EA 4G2FA 4RIWA 2EXCX 2XF0A 4YO6A 3SG9A 4DFLA 4XG7A 2C6OA 3P5KA 2JDTA 3D5XA 3HAMA 4EUUA 1Q97A 2WZJA 4I6FA 4WNOA 4CLJA 3HV7A 2J2IB 5CEIA 5CF6A 3VBTA 4BR3A 3WE4A 3D5UA 4EOQA 3ZXTA 2YFXA 4HVIA 2WU6A 3D2IA 3NYNA 4IE9A 3GI3A 4C4IA 4QDEA 3HKOA 3SD0A 3WILA 3ZH8A 3F5XA 3BEGA 4F6SA 3CC6A 3OF0A 1Q5KA 4GL9A 4I3ZA 4U94A 1IRKA 1CTPE 5A6OA 4F1TA 1R1WA 4ITHA 3PLSA 3QZGA 2R4BA 2O64A 2DQ7X 2OZAA 1A9UA 3DXNA 1XH6A 3EFKA 4JRVA 4LV8A 4FNYA 4UZHA 5IH5A 2OH0E 4FIHA 5CNNA 4AZTA 2W1GA 5ETCA 4EK3A 3PSBA 4PMSA 2X8EA 5CSXA 4BIDA 5AA8A 2XNNA 4IW0A 4X2GA 2C47A 2G1TA 3FLNC 1VYZA 4HNFA 4UY9A 4RX7A 3TKHA 3PJ1A 4C35A 3E88A 3NZ0A 1ZMWA 2CGUA 4FEQA 2PHKA 4K8AA 5BVEA 1KOBA 3VN9A 5K5NA 3TJDA 2WEIA 4F7SA 5GINE 3QU0A 3W8LA 4IH8A 4M13A 4RC4A 2R64A 4NCTA 3NMUF 1H1QA 5JFXA 1OBDA 2ZVAA 5HZNA 2I0VA 1GIJA 1M52A 3UOLA 1BUHA 1URCA 3DNEA 3QTQA 3ZO1A 3MV5A 3IK3A 4JBOA 4IC8A 2PVMA 3F5UA 4XH6A 3FLZA 5ETFA 4O7RA 5HI2A 1S9IA 4DGMA 5BMSA 4DG3E 2QI8A 4FSNA 4Q5EA 2PZIA 3PSDA 5CLPA 3CBLA 4FZAB 4U42A 2I0EA 4Z7HA 3QGYA 3TDWA 4XG8A 3MIAA 2HZNA 3DT1A 3L9PA 4YJTA 3VS0A 1U46A 2YDIA 1JKTA 3R83A 2E9VA 1JWHA 4ZJVA 5KUPA 4AA5A 5FXRA 3P7BA 1NA7A 1NVRA 3SXSA 4FUXA 4HGSA 4P7EA 5T6KA 4C34A 4MXCA 3E3BX 3W2OA 4BBEA 5IA2A 4F7NA 4O86A 5LVNA 1H24A 4GFGA 5CSVA 3W2PA 4BB4A 5H8BA 3OUKA 3W0RA 4C3PA 2OICA 4BN1A 3ELJA 3QC9A 4AE9A 2W4JA 5E92A 3LM5A 1B38A 2JD5A 4XV1A 3ZUVA 2O8YA 3LW0A 3A7FA 5E1SA 1YWRA 3BLHA 3HDNA 3OEZA 2ZDUA 2QODA 4I20A 2WU7A 4WA9A 4ZY6A 2OXYA 3RAKA 3E63A 3UDSA 2ZM3A 1YRPA 4Y85A 1ZZLA 3FJQE 4TWNA 3VC4A 3CXWA 4AN2A 4QMXA 2JKKA 3JYAA 4YHTA 4BJJB 1SNXA 2J90A 2UZDA 3EQRA 4I6LA 3WIKA 4M14A 2QOOA 2JKOA 4EZ7A 2YM7A 4O82A 5K5XA 1OKYA 4I5PA 2GMXA 4IX3A 3DAJA 1SVGA 3UMWA 4B7TA 4KWPA 3UOKA 4F70A 3F2NA 5AA9A 2CGVA 3ZFXA 4YLLA 5ANGA 2QU6A 4FVQA 3U87A 3VNTA 3ATSA 4O7SA 2PE1A 2JEDA 1Y57A 2X1NA 3O51A 3FPMA 2PZ5A 4L6QA 2C6DA 2GNLA 4O7WA 5AX3A 1OKZA 3F5GA 4CCBA 1PXNA 3PZHA 5LMKC 1ZMUA 4RQKA 1UU9A 3QCXA 4FYNA 2UUEA 5ANDA 5EYKA 3QUDA 2B55A 4PWNA 4XCUA 3TZ8A 3ZU7A 4WNPA 4BDKA 5AIKA 3NRMA 4FSQA 3BGZA 1BI8A 4NSTA 3UVRA 4BDIA 4DDGA 5DH3A 3TNIA 2J5EA 2RG5A 4E6AA 4IAAA 3CD3A 2XMYA 3R9DA 5E8UA 3ZM4A 3MDYA 4O0UA 5KBQA 4D4VA 3T9TA 1MUOA 2QNJA 3U51A 3TDVA 2VZ6A 5AV4A 2VO7A 5FBNC 3UYTA 1V0OA 1JSVA 2X4ZA 4PTEA 4CG9A 2YHVA 4IZYA 4MBLA 5IEXA 5BMMA 3ANQA 4FYOA 4RX9A 2W4KA 3DU8A 3OCSA 5A4LA 4BCOA 1TKIA 4NWMA 3QRUA 5EHLA 1XBBA 3TV7A 4U80A 5IA1A 1WZYA 5CXHA 3JVRA 4I5MA 2IZUA 4UZDA 4RZVA 4UYAA 4E6QA 1REKA 2PUNA 3LE6A 2XCHA 4I5CA 4C58A 4JNWA 4UEUA 1YHSA 2XH5A 1DI9A 4N4SA 1JPAA 4H05A 4D28A 4IB1A 4CT2A 2J5FA 3ODZX 2XA4A 2AC3A 3KB7A 4ZTQA 4DCAA 1BX6A 2XKFA 2Y9QA 5CEPA 3LFAA 2F7XE 4ANSA 4B0GA 4F65A 4XEYA 3PXFA 4GIIA 5ANJA 3V5PA 5EYCA 3UO6A 3QRJA 4FIJA 5CWZA 3TCPA 2ACXA 4CZUA 2H96A 2QOHA 2VX1A 3IKAA 5GJDA 2W1FA 1MRVA 4GT4A 4JIKA 5TO8A 2HENA 5AX9A 1JLUE 5AAFA 3T8OA 1XH8A 3MY5A 3GUBA 4CVAA 2VU3A 2C3IB 4QP8A 5IQGA 4EJ7A 4FKUA 5IU2A 5L8KA 3EJ1A 2EWAA 2GNHA 4YHFA 4ZTNA 4BI0A 5EDQA 2C69A 3F3WA 4V05A 2B4SB 5D1JA 4L3JA 4EH3A 2F57A 3PYYA 4BZNA 2OK1A 3NIZA 4QMNA 4H3BA 3C51A 4FK3A 4O6LA 3ZOSA 5CNOA 2PUUA 5BV3A 4DFUA 3Q4ZA 2IG7A 4D4SA 3QA0A 2XANA 3CQWA 4LOOA 4HYSA 2JAMA 4L42A 2G2IA 3C0IA 2HY0A 4EBVA 3FZ1A 4L00A 3NUSA 3W1FA 5DFPA 4R1YA 4O7ZA 1JSUA 5EG3A 3VULA 2VV9A 4IWPA 3DNDA 2PVLA 5FD2A 2BKKA 3ZRLA 5JT2A 2R3FA 3KKVA 5AM7A 1DS5A 2Z02A 3W2RA 3A99A 5EHYA 5KHXA 4A7CA 5HD4A 3R7EA 4CFWA 1F5QA 4BTFA 3SG8A 3KF7A 3MPAA 2PSQA 2UZEA 5KO1A 1T45A 3KXGA 4DEDA 4ACMA 4WD5A 3MI9A 2O3PA 3KEXA 5AUUA 3HYHA 3NCGA 4O27B 4GYIA 5GJFA 1IAJA 4AUAA 4DTAA 2XVDA 3ZZWA 2GNGA 5ITAA 2BRNA 4QPAA 4XLIA 4PDYA 2Z8CA 4FBXA 3QTIA 4LRKA 3QTWA 2A19B 4EH7A 4XYFA 3MJ2A 5FGKA 3D14A 3QGWA 1PMEA 4F0FA 5ACBC 4XMOA 1ZXEA 4QQ5A 1YHVA 2W5AA 3GU4A 4J52A 3HP5A 4YZNA 4EH6A 5JGDA 3DFCB 2R9SA 3Q5ZA 4R7HA 4O96A 3EYHA 2RF9A 4CFFA 3MYGA 5ANEA 2XNEA 2HIWA 3LLAA 4V0GA 4L53A 4BYIA 4RIYA 3UGCA 2RFNA 3C4CA 3UZPA 4M0YA 1Y8GA 2FO0A 2C5XA 4R77A 5JQ8A 3M42A 3TZ9A 5EDPA 3KRRA 4HVGA 2BDFA 3G51A 4ACCA 1ZYLA 2PK9A 5CSHA 4FSUA 1OIUA 4O0RA 2C3LA 2EU9A 3KRWA 3OW4A 5CY3A 2XIYA 2UW7A 4OW8A 4CKRA 3I6UA 2XUUA 3R21A 3AC2A 4ZMEA 2XK7A 2ZYBA 2IZTA 3WZJA 2E9OA 2UVZA 5HVJA 3EFJA 4HVSA 1WBVA 5JFVA 3U54A 3W32A 4CRSA 3A7GA 3QLGA 5FEEA 3ACKA 5EW9A 1MRUA 3RWQA 2YIYA 3AD4A 3R8VA 4NU1A 5AIRA 2R0IA 4P5ZA 3MA6A 4DTBA 3MBLA 3R2BA 4YZ9A 1Q8TA 4QMLA 4RJ4A 5HG5A 1PYEA 2OJ9A 1NVQA 2PVHA 4LM5A 5JZJA 3QXPA 4M3QA 4U7ZA 5C8MA 2XK6A 3VF8A 3Q6WA 2UZUE 3DBFA 4ZIMA 5IEYA 1Q99A 5EHOA 4HZRA 4ZAUA 4M15A 5BVDA 1H1RA 4QT1A 3K2LA 3TXOA 2BHHA 3QXOA 5E8VA 2WMQA 2UW8A 3GC9A 4RA4A 3S00A 2WQEA 4BI1A 3FV8A 4DYMA 3C5UA 4QTEA 4IB5A 3BWFA 4MXAA 1FQ1B 4QO9A 4AQCA 1KSWA 5AP6A 3REPA 1LP4A 3FLYA 3RAIA 2XB7A 2IW6A 3HMMA 4FTUA 5KE0A 5L2SA 5DYJA 2PVKA 5HG8A 4D0WA 3AC5A 1YI6A 5IQCA 1XJDA 3TV4A 1Q8WA 2CGXA 3EQPA 2BAJA 5HTBA 4C37A 3VBWA 4FTJA 5TKDA 3FYJX 2C6EA 3L8PA 3Q2MA 4J71A 3WF9A 4I93A 1Q8ZA 2XBJA 2VN9A 4FGRA 4Y46A 5CF5A 3ORXA 3FSKA 4DH1A 4FV1A 4K11A 5F4NA 5BPYA 5C4LA 4JL9A 4NYEA 3UMXA 2QC6A 4F0GA 2QO9A 3DAEA 3E8CA 5A46A 5DEWA 5IA0A 3P4KA 3FZSA 1NXKA 2PVFA 3LQ8A 4OBPA 4S32A 1SYKA 4X3FB 2X8DA 3VUGA 3ZC6A 4CEGA 3WARA 4DAWA 4BJJA 4DH8A 4U40A 4EWQA 4IZ7A 3F2AA 5AP0A 3O8TA 4KA3A 2XEZA 1PKDA 2A1AB 1L8TA 2IVSA 2X9EA 3GQIA 3P1AA 3DQXA 2C0OA 3VO3A 5IA3A 1ZRZA 3CKXA 4RG0A 2WAJA 3AC1A 3EN9A 4FA2A 2GQRA 2C5OA 4IB3A 5GNKA 3UNZA 4ENXA 1K9AA 4FIEA 3TWJA 1ERKA 2WMAA 5EKNA 2Z60A 1Y91A 4FZ7A 4BDJA 2JLDA 4GFMA 3TNWA 2C1AA 4AA0A 3LM0A 3FZOA 5M55A 3HL7A 3I81A 4YBJA 5EOBA 5KBRA 4QQTA 4KRCA 3TIYA 1FVRA 5GIPE 4IB0A 3HP2A 3RM7A 5IA4A 2XALA 3Q5IA 4U3ZA 2C6IA 3UOHA 2JFMA 1ZYSA 4BBMA 3BRBA 4FTIA 4AX8A 5FP6A 2XNOA 2NPQA 2V0DA 5D10A 4EKKA 2XIXA 3EQBA 4DEAA 3V04A 3OY1A 4PP9A 3CJFA 3NPCA 3NX8A 2PWLA 4ZP5A 1ZYDA 3OP5A 4S34A 4E6DA 4EKLA 1TQIA 2BZKB 5LVLA 4L68A 1YKRA 2J51A 3SAYA 3AOXA 4C3FA 2YEXA 2EUFB 2H8HA 1U5RA 1H00A 2B53A 1FVTA 5CAVA 3G0EA 3R1SA 3FMEA 3P0MA 3KMMA 1BL7A 3S4QA 3II5A 2C1BA 3MESA 4AGWA 1IA9A 1PXKA 3VQUA 5EM8A 1SNUA 4UALA 5LVMA 4HW7A 3OBJA 2VTHA 5I9WA 1O9UA 4ZS0A 3D94A 3TMOA 3VUDA 4RWKA 4YP8A 4R5YA 3FY2A 4FODA 4DHJA 4APCA 3MJ1A 1BKXA 1YOMA 4C4EA 1U54A 4FZDB 3MH0A 3CQEA 4JOAA 1GOLA 4Q9ZA 5C9CA 4YSJA 2CKEA 4ANLA 4TYHB 1WCCA 2QQ7A 3C0HA 4BDAA 3ACJA 4R1VA 4HOKA 4JR3A 5FXSA 4D5KA 2QOKA 2UVXA 3EMGA 3MFSA 1ZOGA 4PMTA 2WNTA 5M4IA 1ZYCA 4AT4A 2UZTA 4ZTHA 3KVWA 1M17A 2UW4A 2YM5A 1SMHA 1WFCA 1FOTA 2PMIA 5JH6A 3FHIA 4GH2A 3MTLA 4BF2A 4KRDA 4HJOA 4ZMFA 3TT0A 3VRYA 2WHBA 4RIWB 4USDA 4AXFA 5KMOA 2JBOA 2QG5A 3R7YA 3A7JA 4ZTMA 3SOAA 1I09A 5LOHA 3GGFA 3GCQA 3PVUA 4MX9A 4TZRA 4F4PA 3G6HA 4ALWA 3DBCA 4G6NA 4I6BA 1K3AA 5LMBA 3HRFA 4FV2A 4KBAA 4IAZA 4LV7A 4TY1A 3EHAA 4W4YA 5CU2A 4WUAA 1TFFA 2C0IA 3LJ2A 4PTGA 4PMPA 5BUIA 5L8LA 3OD6X 4FSZA 4X2FA 4ZLYA 5HCYA 4A9SA 4PRJA 2PE2A 4DF3A 5CU4A 4ZSLA 3OFMA 1OB3A 3BHHA 5EW8A 1RDQE 4FL3A 5FEQA 3PFQA 4WNKA 3W0MA 3A7HA 3FQSA 4F7JA 1DAWA 3ENMA 3H0ZA 1NT2A 3ZCLA 1OPLA 2W7XA 3MGYA 3HDMA 1VYWA 2X2MA 3C1XA 4FR4A 2YM3A 4GS6A 4C61A 3U9NA 4QQCA 3ZTXA 3DBQA 2HZ0A 2R3LA 5H8GA 5BQ0A 3BELA 2W96B 1RJBA 3AG9A 1J91A 2G15A 4JXFA 3EFWA 4LRMA 5CI7A 2BRGA 2WO6A 2BTSA 3FZPA 3LFFA 3DJ5A 5D11A 4FTCA 4XLVA 3MY1A 3RPOA 3DKCA 3UIXA 2XK4A 5EOLA 3PVWA 5AWMA 3BKBA 4FZ6A 3V3VA 3VBQA 4IFGA 1WVWA 2UV2A 4MWIA 5A3XA 4BCIA 1QCFA 3MVMA 5E1EA 4O7TA 2BFXA 3THBA 3KC3A 3ZLSA 4X3FA 5BUEA 1XHAA 2OJGA 4GW8A 4FKLA 4BDDA 3IW5A 3GOKA 1ZWSA 4I41A 3BYUA 3UNJA 4R7IA 5M07A 3QD4A 2JDSA 5LVOA 4H3PA 1YDSE 4LL5A 1TVOA 2IZSA 4DGNA 2ITPA 3F3UA 2QCSA 2RG6A 3FY0A 4MD9E 1H1SA 2F2CB 1ZOEA 2VWVA 4FSRA 4H36A 4IC7A 3HZTA 2GHLA 4AT5A 2YIWA 5JGBA 4WOVA 2ZB0A 3OXTA 4XOZA 3ZC5A 2PMLX 4AW5A 2BZHB 4AGDA 3PE2A 1JBPE 1UU7A 3RKBA 3BZ3A 4IM3A 3NR9A 1HOWA 3NUAA 4FT7A 1G5SA 3ZONA 5K3YA 2YAAA 1APME 5BVNA 4K6ZA 1CMKE 1UU3A 3KULA 3W2QA 4YO4A 2C68A 4NM3A 5IQAA 4ZLZA 4JBQA 2RIOA 3F88A 4BHZA 5HU9A 1IA8A 2VTQA 3KVXA 3FPQA 4CV8A 4UV0A 3EOCA 3DY7A 5IPJA 2RFSA 2QD9A 3I7BA 2BDWA 4RFMA 3GP0A 5AP5A 4ACDA 4ALUA 5ANIA 3VJOA 3QQKA 5DPVA 2E9NA 4ASEA 4AZWA 4AWIA 5CZIA 2QR8A 2P3GX 4IVCA 4RVMA 4BRXA 4K2RA 4RX5A 5JFWA 2VTNA 3M2WA 2P2IA 5GJGA 3BYSA 4UXQA 2I0HA 3HRBA 3G90X 3MS9A 4PL5A 4EH9A 4GUBA 4GVAA 2OO8X 4MQ1A 5IMXA 4DFNA 2GS6A 1P4OA 3ZHPC 4KBCA 1UWHA
chains in the Genus database with same CATH topology
3V01A 1S9JA 1ZYJA 1J3HA 4BTMA 3POZA 4UBAA 2VAGA 3B8RA 3H3CA 3BU6A 4M7IA 1G8JA 2F9GA 3BE2A 1TQMA 5L3AA 5AP1A 2DYLA 4G5PA 4IFCA 1PF8A 3SW7A 4TNBA 2XEYA 2EVAA 4CRLA 5K4IA 3ZRMA 3BU5A 1OL5A 1H25A 3CR0A 3P79A 4FEVA 5FDXA 4RIOA 4PL4A 5G1XA 1V1KA 4EEVA 2CCHA 3QQGA 1J1BA 3LKMA 5M06A 4Y83A 2C6MA 4ZJIA 3G15A 2OFUA 4EOPA 4NCTC 2LGCA 2ONLA 1EH4A 3T9IA 4NFMA 3SV0A 4YTCA 2BIKB 5AJQA 4HYHA 4QYEA 3GU8A 2WMWA 3ORPA 4FTKA 3Q53A 3AGLA 3FMLA 5FXQA 4EK4A 4TL0A 3HMPA 4NZWB 2ZV7A 3OWLA 4FSWA 3DS6A 3UZTA 2E9UA 4BCHA 4RJ8A 5FEDA 3TI1A 2PUIA 2F7ZE 4BCKA 3LIJA 4DBXA 3KFAA 3NYVA 4QDVA 1UNHA 1SZMA 3CPCA 2OXXA 1FBNA 2BAKA 4XP0A 2XCKA 3COHA 5TOZA 1BI7A 3JXWA 4TKSA 3BLAA 4Q5HA 2ZOQA 2A27A 3QUEA 2X0GA 3HRCA 4B8LA 3NUNA 5B2LA 5KKRB 5GIOE 3CPBA 4F9WA 4MKCA 3RHKA 4DDIA 5M4FA 4O0SA 4RBLA 3NYOA 4IVDA 4O0WA 4Q2AA 3VJNA 3B2WA 4DEGA 1UKHA 2B9HA 2CKOA 4QP4A 1WBSA 4D0XA 2IJMA 5FM2A 3I79A 5C26A 1R78A 5I9YA 3BYMA 3S95A 2HXQA 3ZUUA 3CSVA 4TWOA 2VTLA 3R7UA 4I0TA 5JRSA 4F6WA 5JSMA 1WVXA 3D7TA 3JY0A 3PUFC 3BL9A 3IOPA 3ORTA 4HZSA 4XJ0A 5AV1A 4AXAA 4DH7A 4AG8A 5TT7A 4C4JA 5I9VA 3FI4A 4EH2A 2BMCA 3V51A 3EFLA 3QKLA 5A4CA 2R3NA 3ZMMA 4BCJA 3MWUA 3OC1A 2LAVA 2H34A 2YACA 3A62A 3ORNA 5B2MA 1YQJA 4O91A 4L9IA 1MQ4A 2E9PA 2P55A 3K3IA 4OTRA 2QO2A 2WPAA 4YBKA 4ZEGA 3GC0A 3ZEWA 3V5LA 2XKDA 4U44A 3BBTB 2VTMA 4TYEA 4GSBA 3W0OA 4NH1A 4E4NA 3U6HA 1HCKA 3HUCA 4A07A 4KBKA 3BIZA 3QWJA 2W4OA 3FBVA 4WG3A 3EN5A 5T3QA 3TG1A 5CZHA 4W4XA 1OI9A 2XM8A 3V5JA 4XV9A 2VWWA 3VAPA 5T68A 4RWJA 2W1IA 3AD6A 3AXWA 3OT3A 3KN6A 4X2KA 4X6RA 3PXKA 2XJ2A 1W7HA 3DAKA 2VWXA 3OTVA 1VJYA 3QKMA 2E2BA 3SXRA 4YUQA 2ERKA 4YURA 3WE8A 5CAPA 3S0OA 4G3DA 3E8NA 1JKKA 3DB8A 3EZRA 2VO6A 2CJMA 3BQRA 3GC7A 3NGAA 4L45A 4QMYA 5IISA 1OPJA 5M56A 4EYMA 4EYJA 1Q41A 3IS5A 2R3PA 3A7IA 4EH8A 3JR1A 2VO3A 1R39A 4PP7A 2VTIA 4FKGA 3W2SA 1YWNA 3I5ZA 5LWMA 4FZFB 3BX5A 3DBDA 3I7CA 5BVKA 4M84A 3R2YA 3R30A 3NYXA 1Q62A 3OY3A 4PDSA 3Q4UA 4IIRA 1L3RE 5HG7A 3MIYA 3F82A 4AOIA 4C4GA 2J4ZA 3R9RA 4RGJA 1OKWA 2B9FA 4IWOA 2Y6MA 2WOTA 3NCZA 1VZOA 4XOYA 3VW6A 4QNAA 4ENYA 2BPMA 5B7VA 1GY3A 2JKQA 2YDJA 3TKUA 3KXXA 1KV1A 3DK3A 1WBNA 4GT3A 1FMOE 4YJUA 3VVHA 4Z55A 2JAVA 3BV2A 1YWVA 5JZNA 4QOXA 2XNGA 3LMIA 3W0QA 4C3RA 1NW1A 4G3CA 4FVRA 4EOLA 5DR2A 2QOCA 1E1VA 3ML1A 5AUYA 4FV5A 1KE6A 4NJ3A 3HVCA 4BHNA 2XS0A 5DHJA 1UNGA 2C6KA 4PDPA 3I0OA 2XZSA 3BYVA 4G9RA 1M7NA 3E7OA 4YLKA 4AOTA 2FA2A 3KRXA 2ZM1A 3FE3A 4LMNA 2J9MA 1WBTA 2VWUA 3HA6A 3OXIA 4M97A 3V5WA 2Q0BA 3LHJA 4FSYA 3AC8A 4DEHA 2CCIA 1KOAA 3QWKA 3TTIA 3FC2A 3MVJA 1V0PA 2WMVA 2YM4A 4O6EA 4QYYA 4RC3A 2YWPA 1YHWA 2VGOA 2X7GA 2AEGA 4PMMA 4BGHA 2GTMA 2PVRA 3UBDA 1ST0A 3QZHA 5EQPA 5CX9A 4FV0A 5E8XA 5EFQA 3SDJA 2YISA 3UTOA 3NVMB 3QKKA 4YGAA 3SOCA 3PWYA 3PRFA 3KN5A 4QYFA 2GDOA 2QO7A 4FT9A 4QP6A 3DPKA 2FSLX 4MYGA 4ALVA 3EQIA 4L43A 1YXSA 2ZFYA 2G2HA 4NW5A 4KAOA 4UXLA 1YXTA 3LPBA 1QMZA 2BDJA 4FKSA 2ZAZA 3DQWA 4MXOA 3UQCA 4JR7A 3QD0A 2NP8A 4RVLA 4YSMA 1H0VA 3R22A 5KX8A 3DZOA 5DRBA 3DJ6A 3I4BA 2ITVA 3UDTA 4NKAA 1W82A 5DBXA 2XRWA 4YHJA 3BHVA 4BZOA 3LFCA 4MH7A 3NUPA 4EH4A 3KRLA 4RLKA 4E6CA 4FKWA 5I0BA 3JPVA 3I1AA 4AZFA 2QKWB 1ZY4A 4L44A 4AZSA 2F49A 3IW8A 3KMUA 5B2KA 2R0UA 1Y6BA 3PP1A 3POOA 2UZWE 3ULIA 4GK2A 4D2SA 3BI6A 4KSQA 3R8UA 4RLLA 4I4FA 5LARA 2I1MA 2ZMDA 2JDRA 2JC6A 2R3RA 2GNIA 3C4WA 4CCUA 5DWRA 4AP7A 4CMOA 4XBRA 3EQGA 4R3RA 3ZBXA 3K5VA 3D0EA 3GENA 3GU6A 3EN7A 2GCDA 3O0GA 2CSNA 3HV3A 4O21A 3TNQB 3FHRA 5KMJA 5DN3A 3RM6A 5L2TA 5M51A 3BHUA 3E5AA 4L52A 3PWDA 2BZJA 1G8KA 3I0QA 4Y73A 3P7CA 1OGYA 2PUPA 4QMMA 3UDBA 1XH9A 4QTDA 2G01A 4CV9A 4U41A 5L6WL 4CLIA 2XM9A 5HORA 3DJ7A 2ITWA 5A4TA 1ZARA 2GTNA 3LMHA 4M0ZA 5F94A 3LFDA 5L8JA 4A4LA 4C36A 2I7QA 3A4PA 4UB7A 2R3HA 3QZIA 3KXZA 4P2KA 3WBLA 4PNKA 1K2PA 1M14A 3NW7A 5IMEA 4ZZMA 4RIXB 3O2MA 4K18A 4YTIA 3F66A 2BCJA 4MAOA 5J7HA 2Q83A 4ACHA 3LJ1A 2R3KA 3FI2A 2XK9A 4DGOA 1LPUA 1J7IA 3RAHA 1IASA 5AFVA 2WMUA 3FL4A 4EONA 4QMOA 3NIEA 4I92A 2BILB 3LMGA 1W84A 4CTBA 4IWQA 3SX9A 5BX0A 4HNIA 3PA5A 4DG2E 4XG6A 2GS2A 3TJCA 1H27A 2W17A 4USFA 2BTRA 2HZ4A 5I9UA 3DK7A 4GG5A 4J53A 4O0VA 2Q0NA 1WBPA 5EKOA 4B8MA 5HO7A 1A06A 4NTTA 4D5HA 5CF8A 4V04A 4DFBA 1XH7A 2UZNA 5DR6A 4YJPA 4LYNA 2O65A 5HEZA 4IJPA 4U3YA 3MVHA 3QAME 3ID6C 4O81A 3ZSGA 2WQMA 4EQUA 4YJQA 2W06A 2XBAA 3U55A 3EH9A 5BYLA 5BVFA 3CGFA 3RI1A 2WTJA 3RJCA 4L67A 3H30A 4GU9A 5IUGA 3VUHA 4RPVA 5DE2A 5IZFA 5EH0A 3TYKA 4UYNA 2EB2A 4WBOA 4P5QA 3U9CA 5AADA 4O22A 2IO6A 3NNUA 2VWYA 5CEKA 4EC9A 1PMUA 2C5VA 1JQHA 3V8WA 1VLRA 4Y5HA 3UDZA 3QRTA 3WOWA 4FV4A 4K33A 3GQLA 5ETAA 4ERKA 1O6YA 3IGOA 3RHXA 4OLIA 3COMA 3HMOA 3OTUA 4IZ5A 5IDPA 5CTPA 3OBGA 1RQQA 4LQMA 4A06A 3ORKA 3FLWA 3NEWA 2H6DA 2IW9A 3V8TA 2W9FB 3RPYA 2Y8OA 2WKMA 1PKGA 3WZUA 3QZFA 3TEIA 3S1HA 5CS6A 4JQ8A 4KS7A 1AQ1A 1F0QA 3HMNA 3N4VA 4OUCA 4S2ZA 3PZEA 4CKIA 4IVAA 3FEGA 5BUJA 1OMWA 1LEZA 5JQ5A 3G0FA 4MNEB 5CEMA 4G6OA 3TZ7A 3ROCA 1Q8YA 5HNIX 3TNPC 4FV6A 1KE8A 2YJRA 1Z5MA 4RX8A 4DBNA 4JDJA 2NO3A 3QQFA 2XIRA 3DLZA 4GK4A 5AP4A 2WTIA 4OTDA 3PXQA 4ASZA 4GVJA 4JI9A 2W1HA 3ZO3A 4D58A 5LXMA 4RJ3A 2X2KA 4ITJA 5J1WA 5EM7A 4RMZA 4NM5A 4P90A 2GHGA 1Q61A 4HGLA 4PY1A 3O8UA 4O2PA 1H0WA 3VS2A 1Q8UA 2BZIB 3LXPA 2R3IA 2PVYA 5EYMA 5M4UA 3OXZA 2OLCA 4O38A 4QYHA 1YDRE 2UW0A 2VWBA 3E92A 4KUJA 4JJRA 3ITZA 4FG7A 4KKGA 3V5TA 2R3QA 3R1QA 4AW1A 2NYAA 4JVGA 4Z7GA 3UJGA 4WZYA 4JDHA 1UKIA 4GUEA 3KA0A 4U43A 3CCNA 5E8YA 3FQHA 4CQEA 4AXDA 4CZTA 1SVEA 3PY3A 1GJOA 2X8IA 4FEUA 2W9ZB 4OBQA 1CKIA 3PXZA 5HTCA 3C0GA 3JVSA 3DXPA 4FC0A 4QTBA 2C3KA 4DEIA 3VONA 3O50A 4G16A 3U8WA 5CYIA 4CFVA 2C6LA 5KMMA 4IJ9A 3FXZA 1FINA 1QPCA 2WD1A 3DB6A 2B52A 2WEVA 3EB0A 3GFWA 1XH4A 4NL0A 2SRCA 2YIXA 3BLRA 5D7AA 4MCVA 4H1JA 4FI1A 2JITA 2HAKA 2PL0A 4QP1A 4X6QC 3UC3A 2OBJA 3PVBA 1IEPA 4DN5A 4MBJA 1DM2A 1PXJA 4I4EA 3FMKA 2J0LA 3QQLA 3MH3A 4GCJA 4FTRA 4ZZNA 5C8KA 4RRVA 4XV2A 2YJSA 1OL7A 2FYSA 3WZKA 3BYOA 3K3JA 4AW0A 3KXNA 3ZXZA 1VEBA 3NUXA 3OS3A 4IAKA 4AXEA 4UN0C 5ANKA 3VBYA 5FDPA 5J9ZA 4PQNA 2YITA 4C7TA 4B9DA 3ZLWA 5BVWA 4Z3VA 3KQ7A 3VS7A 5K4JA 3Q3BA 4GK3A 4IAYA 1XO2B 2WMSA 4WNMA 3ZO2A 3PJ8A 4J97A 3NFGB 4RJ7A 3QTRA 3CTJA 2R3MA 3BGPA 4LGHA 2FB8A 2WTKC 4TN6A 3KREA 4LRJA 3F3TA 3QLFA 4XUFA 3GBZA 4U79A 2B0QA 1BMKA 4BCFA 4NKSA 2QLUA 4LMUA 3OVVA 4AGCA 2A4LA 3L8SA 3PIYA 2XK3A 2OGVA 2X7OA 3I60A 4X2NA 2QHMA 3RK9A 3M11A 4QP3A 5EDRA 3DV3A 1FMKA 4D1XA 2C30A 1JVPP 3D83A 4FGBA 3R9OA 3E64A 3CS9A 4LOQA 4CMTA 3BHTA 3G9NA 4O0TA 4OTIA 3DFAA 3IGGA 3QQJA 2F2UA 3EYGA 5DOSA 4HPUE 4YTFA 4WBBB 3HA8A 4KB8A 3MFTA 4S30A 5C1QB 1G8SA 4EZ5A 4HVHA 1XR1A 2F7EE 1PY5A 2XYUA 3GVUA 4J8NA 3ORIA 5HE1A 4KS8A 3N4TA 3GU5A 2W99B 2IN6A 3ZFYA 3EL7A 2HELA 4YZCA 4AN9A 3IPHA 4AW2A 4YR8A 3GNIB 4YC6A 3VBVA 3UZRA 1OKVA 3TUBA 3PVGA 3AD5A 2JIVA 3RPRA 3C4XA 5HVKA 5CEOA 5M08A 3RINA 3R8MA 2W1DA 2ITQA 2YCSA 5F95A 1NY3A 3VHEA 4E7WA 3OCTA 5LWNA 4AAAA 4F63A 2HZIA 1OL6A 2ETRA 1NVSA 3E93A 2OXDA 1IR3A 4K0YA 2PTKA 4JG8A 3NVKI 2OZOA 4WG4A 3HGKA 1MQBA 4DH5A 4U81A 3W16A 4ANBA 4D9TA 1CSNA 2ITTA 2PVNA 2FVDA 4JDKA 2WTCA 2DWBA 1PXLA 4FK6A 4JQEA 4ORKA 3H9OA 4L3PA 3R8ZA 4I21A 3IECA 2X9FA 5KCVA 4JIAA 2V22A 5KMIA 5DR9A 4FVPA 5DLSA 5AUVA 5HIEA 4EL9A 3HV6A 3FAAA 2V5QA 4NUSA 4I23A 4WUNA 4BDEA 2UW3A 3QL8A 3QX4A 5B0XA 4RJ5A 4E5WA 5L2WA 4BIBA 2IZRA 2GSFA 2HK5A 5G6VA 2VTAA 4N6YA 3U4WA 3EQHA 4OTWA 1H1PA 4A9TA 5A4QA 4EK6A 2BFYA 2CLQA 1PXPA 2G9XA 2PU8A 2ZM4A 4FT3A 4G31A 2HYYA 4QRCA 3ZBFA 4BI2A 4EH5A 3AC4A 5A54A 4EI4A 4D2RA 4AOJA 5CALA 3KXHA 3KGAA 5DNRA 3Q4CA 1ND4A 4J95A 4WSYA 2YWVA 2X6EA 5AMNA 3W8QA 3KY2A 3G6GA 4AZVA 3OROA 4YJOA 3UG1A 3UPZA 3LJ0A 4U6RA 3ETAA 3L8XA 1PMNA 2WTDA 4AF3A 1ZZ2A 4LFIA 3R8LA 2Z2WA 5C01A 4HGEA 1UU8A 1QPEA 2B9JA 2Y4PA 5AV0A 3VS1A 1WMKA 1QPDA 3P86A 3R63A 3TKIA 3AKJA 4Y95A 4O7OA 3R1YA 3FXWA 4BTJA 4G1WA 5HCZA 3SKCA 1R0EA 2XP2A 3P23A 4W8DA 4GKIA 2Z7LA 3FMNA 3NNWA 3BE9A 3EWHA 5KMLA 5CEQA 3BEAA 3VS6A 2OJJA 3KF4A 1IAHA 1OVEA 1CKJA 2CHLA 3RAWA 3P08A 3VUKA 4RC2A 5M44A 4ZSJA 4QP2A 1MRYA 3GEQA 4RT7A 3S2PA 3SGCA 1KE5A 1PJKA 1YOLA 4PUZA 5KKRC 3GU7A 3SC1A 4LUEA 3RVGA 3G5DA 3R73A 4EHZA 2VX0A 3C5IA 3ORMA 4AN3A 3HECA 4FOCA 4KINA 5H2UA 3VS3A 2UZVA 3BWJA 1M2PA 4FTLA 4FV9A 4O84A 1Q3WA 4D9UA 4TT7A 5CAOA 4ANQA 1P4FA 3BLQA 3QCSA 3OEFX 4G3EA 4R6VA 5HE2A 3BV3A 2UW9A 3ORLA 4RSSA 1VR2A 2J0KA 5E8TA 2C5NA 3WIGA 4AACA 2C4GA 5FP5A 3QA8A 2BUJA 2ZMCA 3QFVA 3KK8A 4A4OA 4A9YA 2YZAA 4YNOA 5HHWA 2XIZA 3AQVA 4ZSEA 3P5JC 3Q4TA 5IG1A 1LEWA 2OJFE 5JFSA 1XMLA 3IW6A 2QOFA 4R78A 4RWLA 3NUYA 2CNQA 4RZWA 3QYZA 4WIHA 3FDNA 5IH4A 3O17A 5FTQA 4OTQA 5F1ZA 5IDNA 4F9BA 3DA6A 2A0CX 2NRUA 3MH1A 4YC3A 4RA5A 4BKJA 3D7ZA 2YIQA 4TYJA 3QD3A 3RCJA 4LGGA 4WG5A 2I6LA 3CE3A 4BDGA 4ZS4A 4F1MA 4ASXA 4GJ2A 3UP2A 2RKUA 4WT6A 3E87A 2EB3A 3QHRA 5HBEA 2ITNA 1OECA 4HCVA 1YW2A 3VHKA 3ROYA 3A8XA 2C5YA 2YM8A 3FLSA 2HXLA 2FSTX 2JDOA 2WELA 3CD8A 3PA3A 4LL0A 1BL6A 1Q4LA 4TRLA 1Z9XA 4G6LA 5HX8A 5JN2A 4CFNA 4RIXA 4DEEA 2R3OA 5AUWA 4EC8A 4FEWA 2ESMA 2ETKA 4M67A 2YERA 4CFXA 3R7OA 4XV3A 2VD5A 2OWBA 5L2IA 3AC3A 1YXUA 5CU6A 4FTAA 3O23A 4O7PA 5CXZA 3GCSA 4E26A 1GZOA 2IWIA 3UQFA 3DKOA 1XBCA 3UVPA 4O7LA 4R7BA 3ZSHA 4CFMA 4EORA 4EOIA 2PZYA 3GC8A 4G3GA 5HLWA 2OW3A 3D5WA 1WVYA 2PULA 3O7LB 4MWHA 5E9EA 4ANMA 2XAMA 4FNWA 5AV3A 1U59A 2ERZE 4PTCA 3SRVB 4EQCA 1REJA 1MP8A 2XIKA 5L6OA 2VTSA 3JS2A 5CVFA 2OIDA 4ERWA 4FV7A 2DS1A 3DTCA 3EKKA 5IQEA 5LCJA 4W4VA 3A61A 2WB8A 3RPSA 3VS4A 4I0RA 3DDPA 2UVYA 1R0PA 3UP7A 4FL2A 3P78A 5C27A 2XKEA 4QP7A 5CANA 4KSPA 2OJIA 5A9UA 2AC5A 1URWA 4BCQA 4R3PA 4QMPA 1B39A 4M8TA 3PG3A 4MQ2A 3PPZA 2WIPA 4XX9A 1GNGA 3FMDA 2WXVA 4I5HA 2QLQA 4N70A 5IQDA 4QQJA 2YM6A 4AGUA 3LCDA 5J5SA 5JMSA 2GHMA 4IACA 4IM2A 2BRBA 3FC1X 1YXVA 4M68A 4E73A 2J0MB 4AA4A 3LXNA 3LCKA 5DRDA 3PXRA 4KNBA 4UX9A 2FH9A 5J9YA 3NDMA 3OOMA 4R5SA 4H58A 4DHZA 4DHIB 2ZV2A 3HV4A 3QRIA 3W0PA 2GNJA 2XNPA 3V6SA 1F3MC 1G3NA 3AMAA 4FTNA 3Q04A 2GPHA 2R3JA 3JY9A 4U9AA 3UIMA 4H3QA 3W18A 3CGOA 5DT3A 5LMKA 4BDFA 2WMBA 4I6QA 3H0YA 4KABA 4CMUA 3UE4A 4FICA 4FNZA 3UIUA 4FIGA 2P2HA 4XP2A 4C0TA 1W98A 3D9VA 4L8MA 4X7QA 2QOLA 4XRLA 4DA5A 1X8BA 2QKRA 1G8AA 3F7WA 4JG6A 4O83A 5FTOA 3ZDUA 5E8SA 4I22A 4IQ6A 2JFLA 3FXXA 4XG3A 4BGGA 4DGLC 5J9LA 3OW3A 2W1EA 4C4FA 3A2CA 3LLTA 3AMYA 1CKPA 4GT5A 5TF9A 2YABA 4JT3A 3CQUA 4E4XA 2QVSE 4TW9A 2JBPA 3SVVA 2OH4A 4XS2A 1XBAA 3F6XA 1PW2A 3LZBA 3OUNB 2X4FA 4PF4A 1PXMA 3B2TA 2QOBA 3EZVA 1OL1A 4ZTSA 1KE7A 3CIKA 3ZLXA 2CLXA 3DKFA 4XBUA 5DI1A 2WIHA 3IQ7A 2R5TA 4YU2A 2BVAA 1JKLA 2V7AA 4FSMA 2HWOA 4AFJA 4V0GB 4QMTA 4BDHA 3W33A 4FOBA 2QONA 3TM0A 4F9AA 3GB2A 3PLAE 2FUMA 1ZMVA 4C2WA 4QTAA 2W1CA 4E5BA 1XKKA 2WOUA 4ID7A 4TYGA 4WRSA 4B99A 1H1WA 2W1ZA 4EOMA 2XKCA 5HE0A 4IHPA 3IW4A 4RFYA 2Z7SA 3ALOA 3Q60A 4DFYA 1PMVA 5IUHA 2WMXA 1OUKA 2X81A 5EW3A 4O7YA 2CGWA 4FKQA 3DKGA 2XRUA 4ITIA 5JGAA 3SXFA 4C59A 5HBJA 3E62A 4Z9LA 5LMAA 3L9LA 4IAIA 4AZEA 2OZAB 4O0XA 1OGUA 4ZY5A 3R02A 4HCTA 5BNJA 3C7QA 3K5UA 4AXCA 3TUCA 3CY2A 3OHTA 1U54B 3MFRA 3L9NA 2OIBA 3O5AA 4CFUA 4DE4A 3OWJA 2OI4X 4FNXA 5J87A 3HAVA 4OTFA 1AGWA 5E91A 3VF9A 4FG9A 5HU3A 3IO7A 2ITZA 4JLCA 4F08A 3TL8A 4DCEA 1A48A 2KULA 4U5JA 4RIYB 5HLPA 1XQZA 3QCYA 3F3ZA 3HNGA 1PHKA 4ARKA 2Y0AA 3Q6UA 5HG9A 4J7BA 4OT6A 3LAUA 3MVLA 4LUDA 3MTFA 4YZBA 1JAMA 5E8ZA 3DGKA 3FMMA 4AU8A 3ATTA 4II5A 5AUTA 4YPDA 1DAYA 3QF9A 4YNEA 3E8DA 4EHVA 3CP9A 2I0YA 3GFEA 4MNFA 4FMQA 3IONA 4IAFA 4OT5A 1UV5A 4FKRA 2WGJA 3FMHA 5KZ0A 4FKIA 5AV2A 2VTOA 3LXLA 5ACKA 4FKVA 3U4UA 2CN8A 4PV0A 3QYWA 4NK9A 3FZTA 2QURA 2XAOA 5L6PA 3KCKA 3PY1A 3DCVA 3H9FA 2WQNA 1E9HA 3PJ2A 3QQHA 4FTOA 3NW5A 4FTTA 4ZLOA 4BC6A 2P33A 4IANA 3W55A 1M2RA 4F6UA 4JAIA 4WRGA 5KNJA 3F3VA 2X7FA 2V7OA 1OM1A 1JSTA 3TTJA 4PDOA 4AFEA 3VWAA 1GAGA 3ZM9A 3AT2A 4GV1A 4YJVA 5KMKA 4AS0A 1H01A 1U5QA 1XH5A 3OT8A 5LJJA 2XNBA 4OBOA 4YLJA 1FPUA 2CKPA 5CVHA 5D41A 1YVJA 1M7QA 3PPJA 4IX4A 4X21A 4G5JA 5AEPA 4QMVA 4JDIA 4J98A 3SRVA 3F7ZA 1HCLA 5FUTA 4E8AA 2GU8A 5IQFA 1Q24A 4QMZA 3TNHA 3C13A 1KV2A 2VTPA 4HPTE 4I0SA 5CU3A 3COIA 4NW6A 4NM7A 1GIIA 4CXAA 3Q96A 4FIFA 5CF4A 1H4LA 2CPKE 2AYPA 3MA3A 3MPTA 5AUZA 3Q32A 2BAQA 1AD5A 3A8WA 5DT0A 2O0UA 3N4UA 1OPKA 4IDTA 4JX7A 3VRZA 4JRNA 4TXCA 3VUMA 2VTJA 3V6RA 5AUXA 4F09A 2UW5A 4JQ7A 1UNLA 3MW1A 3OCGA 2PPQA 3Q2JA 1U4DA 3FI8A 3ET7A 3GXLA 2R3GA 5HKMA 1O6LA 4PX6A 1OIRA 1T46A 2IPXA 3PIZA 4JBPA 4O7NA 4QEBA 5E7RA 3ZYAA 4TYIA 1ZAOA 1KWPA 5HNBA 1JKSA 4RVKA 1OL2A 3RGFA 3HLLA 4Q9SA 4DT9A 5JK3A 4BGQA 4J96A 5LCKA 3UOJA 4C02A 4I24A 5CAQA 2YCQA 2UW6A 3PDTA 5DA3A 5A14A 3G2FA 2IVTA 2UZBA 3MN3A 3RWPA 4E5AX 3VQHA 5CVGA 2VNYA 2VX3A 3LOKA 4BDCA 4C4HA 2QOQA 5I9XA 3FL5A 4FV3A 3HX4A 1FVVA 4GYGA 4BYJA 2ITOA 4G3FA 2GQSA 3NNVA 3QHWA 4XNEA 1H8FA 4IWDA 4NM0A 1SM2A 2H9VA 4W8EA 1Y8YA 3AKLA 1PYXA 5HBHA 4DFZE 4EHGA 4F9YA 3C9WA 1ST4A 3R1NA 4QNYA 2CN5A 3FZRA 2WMTA 3TV6A 4GIHA 4K77A 3Q9WA 2X6DA 3JUHA 3W2CA 4DT8A 3RNIA 3ORZA 3V8SA 1H07A 4YPSA 5ICPA 2PZPA 4K1BA 2VTRA 3BCEA 4D4YA 5IEVA 1UVRA 4HYIA 2BKZA 4I1ZA 2W5BA 4GG7A 4RFZA 5DVRA 1OIYA 4E4MA 2ZDTA 4KIPA 4ZXTA 4TYHA 3IDCA 3O7LD 5EM6A 3R8PA 4OGRA 2R7IA 3IW7A 3PFYA 3HV5A 5IF1A 2BRHA 4N57A 5F9EA 1Q3DA 3LFQA 2WMRA 5DG5A 3RTPA 3WZEA 4BCNA 4I94A