3W0PA

Crystal structure of a thermostable mutant of aminoglycoside phosphotransferase aph(4)-ia (d198a), ternary complex with adp and hygromycin b
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
295
structure length
295
Chain Sequence
TSVEKFLIEKFGSVSDLMQLSEGEESRAFSFDVGGRGYVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLPETELPAVLQPVAEVMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHAAFGSNNVLTDNGRITAVIDWSEAMFGDPLYEVANIFFWRPWLACMEQQARYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSGAGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the ternary complex of APH(4)-Ia/Hph with hygromycin B and an ATP analog using a thermostable mutant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
molecule keywords Hygromycin-B 4-O-kinase
total genus 84
structure length 295
sequence length 295
ec nomenclature ec 2.7.1.163: Hygromycin B 4-O-kinase.
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.150 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w0pA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 3w0pA02
3C5IA 3SG9A 4DTAA 1ND4A 1J7LA 3FI8A 3LQ3A 5C4LA 2CKOA 4O7PA 4BR3A 3W0NA 3W0PA 5EQEA 5BYLA 2PU8A 3SG8A 3TDVA 3G15A 5AFVA 3HAMA 4DFUA 5IQGA 3W0MA 2PUNA 4ORKA 2B0QA 3UZRA 5IQCA 3DXPA 2I7QA 5IQIA 4EJ7A 2PUIA 3TYKA 4DT8A 2CKPA 3F2RA 3JR1A 2PYWA 4PDYA 4FEVA 4DFBA 5FUTA 5EQYA 3DXQA 3TM0A 1NW1A 4DA5A 4FEUA 3Q2JA 2QG7A 3N4UA 4CG8A 2CKQA 4DBXA 3MESA 4R77A 1J7IA 4FEWA 1J7UA 3SGCA 4FEXA 1L8TA 2OLCA 5C4KA 2PPQA 3W0RA 5EQPA 4WZYA 4GKHA 4H05A 3W0SA 5FTGA 2Q83A 2IG7A 4O7OA 3ZM9A 3W0QA 4R78A 4CG9A 3HAVA 4DTBA 3N4TA 2BKKA 3FEGA 3TDWA 5IQAA 4CGAA 5IQDA 4R7BA 4U94A 3N4VA 5IQHA 3CSVA 3ATTA 2PUPA 4N57A 3W0OA 4DE4A 3ATSA 5IQEA 5IQFA 5IQBA 4U98A 4DT9A 4GKIA 4DCAA 2PULA
chains in the Genus database with same CATH superfamily
3DLZA 2R3MA 3PP1A 4KWPA 4MK0A 5HIBA 4BCIA 4I4FA 2OZOA 4ZSLA 4CCUA 3UYSA 4A06A 4D4YA 2BFXA 3HL7A 4WNMA 5C8NA 5KNJA 3QUPA 2UW7A 3MH1A 4ONAA 4XOYA 4YZCA 3ZO3A 3ODZX 2YM7A 3VS3A 5DIAA 3PWYA 3KRJA 2F2CB 2VX3A 4GT4A 2BR1A 2G1TA 2BILB 3EFWA 5BYLA 3QWJA 2PU8A 4IMYA 4CRSA 3GP0A 4OR5A 4F78A 5CANA 1OL1A 4FV3A 4FL2A 1L3RE 2DYLA 1T45A 2XANA 2QC6A 5E91A 3LCKA 3Q32A 4LQMA 5D7AA 3B2WA 5ANJA 5H8BA 3IKAA 5KZIA 3W10A 4JQ8A 5IQGA 3W0MA 4FA2A 4ID7A 1T46A 3C13A 4HZSA 1UNHA 3I7CA 4AW5A 2UV2A 2XAOA 3HMPA 2UZDA 3PTGA 4RQKA 4YJNA 4K2RA 4D1XA 4D2SA 4EJNA 4NW6A 4W4WA 2XARA 4CEGA 4QPSA 1BL6A 3HDNA 2EU9A 2JFMA 4LDTA 4QP6A 2XKDA 3D14A 2ESMA 3QHWA 3F88A 3ZC6A 4B6LA 2JGZA 4AW2A 5IF1A 3ACKA 2X9EA 4AA0A 4G6NA 2OU7A 1M14A 4BIEA 2BCJA 4A4LA 3WOWA 5HO8A 4JG8A 4JXFA 4EKLA 3UODA 1OUYA 4BYIA 4HW7A 3UBDA 5FP5A 4NCTC 5IA3A 4FE2A 2QG7A 1A06A 3N4UA 4CG8A 4GG7A 1U5RA 5DBXA 4AGCA 5JZJA 1UKHA 1XWSA 2ITQA 4XV3A 2VWZA 3HRFA 4D5HA 3ML1A 2UVXA 2BIKB 3QF9A 3DAJA 4Y46A 5C9CA 4PMMA 2IZUA 2JBPA 3PXRA 3E63A 4JMQA 4AN2A 2C0TA 3A62A 3MFTA 3SX9A 4RWJA 4KB8A 2ZYBA 1IA8A 3IW5A 3ROYA 3C0IA 4JDHA 3PJ8A 1PXJA 4CTCA 3CPBA 1BX6A 4YO6A 5HU9A 2P33A 2VO3A 2PK9A 4II5A 4IZ5A 3W2SA 5JKGA 2OXXA 4D55A 1CKJA 1R3CA 2J7TA 2VO0A 4AXCA 3MWUA 4IADA 2NRYA 3GEQA 2QVSE 2ZV2A 4MBIA 4DEIA 3W0QA 4UZDA 2IJMA 4E26A 3D5WA 3D9VA 2YZLA 3IOKA 4G3GA 3BRBA 5CVHA 4DTBA 3B2TA 3FEGA 2O0UA 3TDWA 1IASA 5IQAA 1J1BA 3VBXA 3FDNA 2QHNA 2W99B 2RFNA 2Y4PA 4AX8A 4EK5A 2RKUA 3IGOA 3FLWA 4TYJA 2I0HA 5H8EA 4CT1A 3RINA 3ULZA 3FPMA 3VF8A 3E87A 4H3PA 3W16A 4X21A 3W32A 2E9OA 4DEEA 3UQCA 2VTPA 1IG1A 3R28A 4KNBA 3BE9A 3HMOA 1QPJA 2W5HA 2ZAZA 3A7FA 3GXLA 2YIQA 4BDBA 2JIVA 4NWMA 2YWPA 5HVJA 3ITZA 3OCBA 3F69A 2X8EA 4HVGA 1CKIA 1UNLA 2R9SA 4RJ6A 4KAOA 3KKVA 3PXFA 4XP2A 1M2PA 4EBWA 4AZEA 2YDJA 4JX3A 5D1JA 1CM8A 1BI8A 4L3JA 2CKOA 3RAWA 3QCXA 1EH4A 1YKRA 1S9IA 1QPDA 3GB2A 5C01A 4IX5A 1ZMUA 2XNNA 4X3FC 3PA3A 5AA9A 1H28A 2OWBA 1DM2A 5AV0A 4CZUA 3FZPA 3UP7A 4YR8A 3V5TA 4LI5A 1XH5A 3RHKA 3SG8A 4DF3A 2VTLA 5T6KA 5JGBA 5IDPA 4P7EA 3SW4A 3UIXA 3HMIA 4NT4A 4F9AA 5A46A 2CHLA 1RQQA 3O5AA 2IVTA 1BLXA 4CFXA 4QYFA 2UZOA 4G9CA 3NW5A 5AAGA 3KULB 4B8LA 3H0YA 3DQXA 3MN3A 4EQUA 2QCSA 5ETCA 4BCKA 3W2OA 3R0TA 2ONLA 3EFKA 5A54A 4EJ7A 4YLJA 3SOCA 2PUIA 2R64A 3E64A 3OY3A 3G6HA 5H8GA 4EHVA 2RFDA 2QOFA 2OJJA 5AUWA 3TXOA 4GMYA 3EZVA 4FBXA 4C35A 4DDGA 4IHPA 4AUAA 5IZFA 2HAKA 3CS9A 2JIUA 4CLJA 4C2VA 2OBJA 2CGVA 2UW3A 5F95A 3ZO4A 3T9IA 1R1WA 3NVKI 4AFEA 1JOWB 2EB3A 3IGGA 2CDZA 3IOPA 4TNDA 5CI6A 1YOLA 4V04A 2WD1A 3VBWA 1WVYA 3PVGA 3RPRA 4O7SA 3R1SA 4XUFA 2YA9A 4E8AA 3CY3A 4USDA 3ELJA 2W1FA 4QMZA 3G9NA 3K2LA 3NUYA 3TZ9A 5I9YA 4D58A 2HIWA 3HV5A 3OXIA 2GNJA 1E1XA 4J95A 2GMXA 4TWPA 4YC8A 3ZUVA 4AQCA 2QR8A 2XMYA 3K3IA 2J0LA 2QO7A 3KK9A 4FZAB 3KXNA 4TW9A 5AP1A 4GUEA 5ETIA 4CMTA 4WZYA 3D83A 3KEXA 4XBRA 1NA7A 5BVNA 3R9NA 5AEPA 3R9DA 5BX0A 5BUEA 2R3OA 3QHRA 5CALA 3OEZA 2Q83A 5CS6A 3RM7A 3DOGA 4KINA 5DA3A 3ORMA 5CAOA 3CJFA 5EHOA 3QCYA 2J0MB 4JAJA 2IW6A 4RJ8A 4YJTA 4X7QA 4QP8A 3Q5ZA 4GT3A 5CAUA 3BCEA 4WO5A 4H3QA 4GL9A 4C02A 5IUGA 2OFUA 2VNYA 4JQEA 3BHTA 5EW3A 3ZRKA 2W1GA 3C1XA 3QC4A 3VS5A 3C4WA 3NUUA 4HCVA 4OBOA 4HYHA 4K11A 5L2IA 2XIXA 3E3BX 3G2FA 4ZY6A 4N57A 4YHTA 2ACXA 2PVMA 1BMKA 5AV2A 3ZSIA 3UO4A 2C6KA 2E9UA 3F66A 3K5VA 2XA4A 3S4QA 2H9VA 3HYHA 2WTDA 4Q5EA 5CZIA 4C2WA 4PL4A 4TWNA 4FG7A 3OT8A 4ZTLA 3SQQA 4O0TA 4KS7A 4EOMA 1OGYA 3ZLYA 5I0BA 4LG4A 4GK4A 3C5IA 3NAYA 1VEBA 3CD3A 2JKQA 3QD2B 4FKOA 3WBLA 4DCEA 4GK3A 3S95A 4NTTA 3BYSA 3MBLA 3PRFA 4ZK5A 2WU7A 5FEDA 4BGGA 4BR3A 4AU8A 3ENMA 2LAVA 3FKLA 5DWRA 3UDTA 3D7TA 2F2UA 4CFVA 2R3NA 4M8TA 4FSMA 1KUTA 5B2MA 3ZXZA 3QLGA 2UW4A 2O5KA 3BQCA 3QQGA 3R00A 5EQEA 3RPOA 4HGEA 2PTKA 3DBCA 5CX9A 5CF6A 3V6RA 4ITJA 4ALUA 3RM6A 3T3UA 5KUPA 4UX9A 2BFYA 4B9DA 4BCNA 3L8SA 4ORKA 2YCQA 4Y85A 4NU1A 3C4XA 2O3PA 4G1WA 4EOIA 3R8LA 2E2BA 2X81A 3VO3A 4Y72A 3JS2A 2QHMA 3PLAE 2BMCA 4JBPA 4OTQA 4ZTMA 4MF1A 3PUFC 4C36A 4QMMA 2YJSA 2XIYA 3A8XA 3C4EA 4EK8A 5HO7A 3UNKA 1PXPA 3PG3A 4DFBA 3MI9A 5C1QB 5IPJA 2B52A 3MFSA 2WMTA 4F7JA 5AV4A 2ZVAA 4J53A 4UN0C 3TM0A 2JC6A 1XH6A 2GQSA 2CN5A 3EKKA 5EDPA 3QXPA 1E1VA 3F3VA 2V62A 3MH0A 3Q2JA 4FT3A 5GJFA 5CF4A 3WZEA 2I40A 4F7NA 4X3FA 3MB6A 4LUEA 2BAKA 5H3QA 3R9RA 3ZLXA 2Y0AA 2UZNA 2WGJA 5IEYA 1TQPA 2BZHB 1BYGA 5FM3A 4EWHA 2WELA 1YW2A 4FEXA 5AAFA 3GU6A 2B7AA 3VS2A 3DZOA 4FKRA 4GSBA 2XRUA 4L7SA 4BVUA 4X2JA 5CU0A 2JKOA 5C03A 4EK4A 4IEBA 4CMUA 1VZOA 4PP9A 3DDPA 4ZS0A 4DH3A 5M4UA 2JKMA 3WI6A 2OXDA 1Z9XA 3EN5A 3KGAA 4IX4A 4GYIA 4IAKA 3W2RA 2DQ7X 3ZM9A 3QKLA 4OTRA 4YJOA 4FNZA 1Q24A 3OC1A 3R63A 5LVMA 4FV6A 4GU9A 4KUJA 5HE2A 4G3EA 2O64A 4RC2A 4USFA 3DJ7A 4YZNA 3BU6A 2B9JA 2WTWA 3QQKA 4JR3A 3QL8A 4AAYA 4O0WA 3HNGA 1YI3A 4KA3A 2UW0A 3FKNA 5TKDA 4ZTSA 3R04A 2GNLA 4IWQA 3UZTA 3W2CA 5IA4A 2ZV9A 4QMSA 4UXQA 3OTUA 4NYEA 4WOVA 1PMNA 1DS5A 4QTCA 4XJ0A 5A4EA 5BUIA 2YDKA 4MXCA 4ACCA 5H2UA 4N6ZA 3C4CA 2OK1A 2BTSA 5CNOA 5BQ0A 3U6HA 3AC4A 5DVRA 2OXYA 1OPKA 1V0OA 1Y6AA 2CSNA 4RSSA 4ZJIA 5TF9A 4CFNA 5CNNA 2C5OA 3DXNA 4H39A 2J4ZA 3KIOC 3RVGA 4FKLA 3FYKX 5M44A 1WVWA 2X2KA 3FHIA 3LVPA 3KXZA 4O6LA 3ZONA 3OUKA 1JVPP 4O7PA 2GS6A 3CQUA 4MX9A 4R1YA 2PVJA 3QYWA 4FG9A 4BCJA 3RK5A 1XBBA 3R1NA 3TACA 3AKLA 4ASDA 4HGLA 4E93A 3MIYA 4FT7A 4FG8A 5CZHA 1YHVA 4BDKA 1K3AA 2YM8A 3UTOA 4CT2A 3MDYA 5HZNA 4ZTRA 4EH8A 2YCSA 4EOSA 4C62A 2WB8A 4AS0A 3ZBXA 4AF3A 1IEPA 1FBNA 4F6SA 3VIDA 2GHMA 3F5UA 4TYHB 4FT9A 3UNJA 4QTBA 2ZV8A 4QMXA 3DGKA 4K6ZA 2BRNA 2IZTA 3LFEA 1ZYSA 2XBAA 3QX2A 3UZPA 4EH4A 3L8PA 3A99A 3JR1A 4TTHB 2YJRA 2A0CX 1YI6A 3FMEA 2Q0BA 3KMMA 3NUAA 4QP2A 2QOIA 3D7ZA 4F4PA 2BPMA 1PMUA 4U8ZA 5EW9A 5ANIA 3I4BA 5K3YA 4AOJA 2WMVA 4M13A 4A9RA 1CMKE 3DFCB 4XMOA 5CU6A 4DDIA 4Z55A 2VU3A 2ITTA 4V0GB 3MTLA 4QP4A 4GH2A 5CAPA 4AGDA 3ZRMA 3VS0A 2R7IA 4DEDA 3S1HA 3G0FA 2CCHA 4FEWA 3PJ1A 5DRBA 3UDBA 5HIEA 2WPAA 1OMWA 3GCQA 4E4MA 5IMXA 1OB3A 3PG1A 3Q04A 3NSZA 2OH4A 2VO6A 3QRJA 4HGTA 4IDTA 4UALA 3A7GA 4LL5A 3VQHA 5KBQA 3P4KA 2XH5A 3ALNA 2C6LA 1OECA 3PPJA 4U3ZA 4RX7A 3F5PA 1TFFA 1J91A 1YQJA 2OICA 3QKKA 4RGJA 2Y7JA 4L3PA 4A4OA 5CAVA 2XK9A 3O0GA 2ZB1A 3RTPA 2HZNA 4FVPA 4O2PA 3GT8A 1KV2A 3NGAA 3IPHA 3O8TA 4BCMA 4KRCA 2QOQA 3GQLA 4FTNA 1H4LA 5HE1A 2Z60A 2P2IA 5IA0A 2UZVA 4XH6A 3FQHA 5CSVA 1H8FA 4O83A 3Q3BA 4NJDA 3CJGA 3ORLA 4WNOA 3C4ZA 4TWCA 3TKHA 1RE8A 5BUJA 4M7IA 2IO6A 2ITNA 3QC9A 4GU6A 3MSSA 3POZA 5CT7A 1B6CB 3BBTB 4QMOA 3VUHA 4XYFA 3R2YA 4TYHA 2HOGA 2QOBA 2JDOA 4FEQA 5LVPA 3F6XA 3EWHA 4XX9A 1GIHA 5HGIA 3UE4A 1O6LA 4FNWA 4EEVA 3CGOA 4J96A 3DAKA 4FIFA 2B54A 3HX4A 3GCSA 3JPVA 2FB8A 2GDOA 4C7TA 2I0YA 4DT9A 4FKPA 4B0GA 5J9YA 4EC9A 1V0PA 4QTAA 1Q41A 5DT4A 2HELA 3PSCA 4CV8A 4ZTNA 4EOJA 2REIA 2WQEA 3KRXA 5B2LA 3OHTA 5M08A 1JSTA 4E73A 1OKWA 3DQWA 5AP6A 4MNFA 4IAZA 5AV3A 4CQEA 3BWJA 3M42A 4AGUA 4NM3A 3OUNB 3E7OA 4FOBA 3HA6A 4U43A 1O9UA 4AZSA 3DK3A 4MCVA 4LMUA 4FL3A 3ZDUA 5K5XA 4W4YA 1RW8A 2EWAA 4AN9A 4FC0A 1FQ1B 3HRBA 2YISA 4QMQA 4LGHA 4G6LA 3PA4A 3DAEA 5M07A 4NCTA 3TZMA 3MA3A 5JT2A 4I20A 3DCVA 4HPTE 2I7QA 2G2FA 5KE0A 4D28A 1XMLA 3KQ7A 4C3PA 2B4SB 5CASA 3TG1A 3SLSA 5TO8A 3B8RA 4RRVA 4B99A 2VTMA 2BZKB 5KMMA 3FI3A 1KV1A 1KOAA 3L9NA 2PUUA 2VWYA 3Q9WA 4E5AX 5HD4A 2J50A 2BHHA 3EJ1A 5DT3A 4F0GA 4I0TA 4RX5A 3LJ2A 3MFRA 3V8WA 2KTYA 5L2TA 1CKPA 1R0PA 1F0QA 3LFQA 5GIPE 3DY7A 4YSJA 2ITZA 3IDPA 2Q0NA 2NRUA 5ANEA 5HQ0A 5KMKA 4WA9A 3R1YA 4FUXA 3EQPA 4FV0A 2FO0A 4OTGA 5HVYA 4E5BA 3CE3A 3AXWA 1NVRA 3TJDA 4F6WA 4FV5A 3PY0A 3EFJA 5CY3A 3LXLA 2C6MA 2Y8OA 4FV4A 1KE7A 4LV8A 1OKYA 2R3JA 2XK3A 2X6DA 3PXKA 4I5PA 4IAYA 4IDVA 3P7CA 4AAAA 3VN9A 2PWLA 4OW8A 1KOBA 3EQCA 4I23A 3S00A 4EK6A 2DUVA 3AMYA 1XO2B 2Y4IC 5HTCA 3QUEA 3G0EA 5HE0A 3DDQA 4NM5A 1PY5A 3EQIA 1URCA 3TTJA 3VNTA 4ZLOA 5GJDA 5CEMA 4FYOA 3FHRA 3KREA 5KBRA 3F3UA 4NM0A 3FLSA 5FXSA 4JIKA 4FOCA 3NFGB 1JAMA 5CEKA 4PUZA 2OIBA 2UW5A 3AKKA 3EN9A 3KMWA 3HAVA 1OL6A 3MS9A 4JG6A 5HESA 1XKKA 5J95A 5HG5A 5A4TA 3UPZA 3QQFA 1Q3DA 4KKHA 3TNHA 4FX3A 3C0GA 4C3FA 2PVFA 4I1ZA 4MNEB 2XNMA 3NUXA 2GFSA 4FSTA 4Y8DA 3TNIA 5AUTA 5FP6A 2VTRA 3MPTA 4YURA 4U94A 2WMAA 4NZWB 4MNEA 4QP7A 4CKIA 1P5EA 3QRUA 2YABA 2XK6A 3HP2A 4W4XA 2WKMA 2PUPA 1SVEA 2CPKE 4G34A 3RPSA 2ITXA 3HDMA 4DC2A 3QALE 3FI4A 3ZLWA 5T3QA 1O6YA 3TI1A 3LXPA 4FTMA 5EOBA 5AUZA 1PRYA 3OD6X 4ZP5A 1WCCA 2ERZE 2JFLA 4FSUA 1DAYA 3MJ2A 4LUDA 1DAWA 4R6VA 2CMWA 1MRUA 5L2WA 2C3LA 1H25A 1OIRA 4FT0A 2PVRA 2C3JA 4ERKA 2EVAA 2NYAA 2C0IA 1P14A 4W8DA 4BCQA 4GFOA 5DGZA 4YTCA 3H4JA 2ZDUA 3U9NA 4GG5A 4RVMA 4F64A 4Z7GA 4XHKB 4IAFA 3TT0A 3KVXA 4BZOA 3GC0A 3D5VA 3JYAA 1YHWA 2VWIA 2HWPA 3OW4A 5ETAA 1GZNA 4U97A 3NMUF 1H01A 2YZAA 2IZRA 5E8YA 4CVAA 4M14A 3AC2A 4D4VA 3ENHA 2ERKA 3SXSA 4HVIA 3SA0A 2UW6A 4TNBA 5JK3A 4PQNA 3Q4CA 1WBVA 3OMVA 4K77A 1PXIA 1STCE 5HG9A 3ZFYA 3LCOA 2Z7SA 4MXAA 4XV1A 3O7LD 2PVNA 4EH7A 3WE4A 3FBVA 4ERWA 1B38A 5LWMA 1H1RA 3HA8A 3A4OX 2C4GA 5LMAA 4YJSA 3FLQA 2BDWA 1K9AA 3O17A 3QU0A 2XB7A 4J8MA 4GJ3A 3FMHA 3QTUA 4MKCA 2XM8A 4O38A 1ZYDA 3BHYA 3VVHA 4CZTA 3U4UA 4KSPA 2DS1A 1NW1A 2UZBA 2QG5A 3BGQA 3CC6A 4N4SA 4S34A 5E90A 5FLFA 4I0RA 3T3VA 3NFFB 4IAIA 3BQRA 4FNYA 3QQHA 1ZY5A 2WZJA 5TR6A 4ASXA 1SM2A 3RI1A 4JI9A 5BVOA 3RAIA 2AC5A 2WTIA 2NP8A 3OF0A 3V01A 5EYKA 3OVVA 1XQZA 5CXHA 3ZTXA 4HVHA 1L8TA 1XR1A 2VGPA 1H08A 2OIQA 4BDDA 5ICPA 5GNKA 1BL7A 4O7YA 5HTBA 2XBJA 3EL8A 1MQ4A 3U6JA 3N9XA 3AGLA 3ORNA 3P9JA 3LLAA 4BTKA 4HCTA 4M67A 3VWAA 2UW9A 4IAAA 4RIOA 4YHJA 5EI6A 2VN9A 4AW0A 1FGIA 3E92A 4EL9A 2AUHA 2FH9A 3L8VA 4O7VA 4FKQA 4WKQA 1VJYA 1ST4A 3KFAA 3RKBA 1XH7A 4RX9A 5HG7A 3UPXA 5F20A 4JDJA 4R78A 3BU5A 4FTLA 3COMA 1W7HA 4DBNA 4G31A 3Q4TA 2C6DA 5ACBC 3RPYA 3CGFA 3A7HA 5CEQA 2WMUA 3TWJA 3DT1A 3LFCA 3ZLSA 1LR4A 4DHIB 1GZOA 4BICA 3AC3A 2ITOA 3A4PA 2WTJA 3BI6A 3IK3A 4AA5A 3CBLA 2QONA 3ETAA 5EDRA 4PWNA 4XBUA 5EW8A 2IN6A 2HY0A 3U55A 2YACA 2J6MA 4PF4A 2OIDA 4L9IA 4H58A 4ZZOA 2OSCA 5IH6A 1G8SA 4OT6A 3RGFA 4A7CA 3PIXA 3ALOA 4MBJA 1FINA 3DBFA 1MUOA 2PVLA 3FUPA 4RIWA 5IA2A 3FY0A 4FTKA 5A3XA 4BDAA 3BL9A 5EDQA 5C8MA 4TYGA 3WF8A 5B2KA 1YHSA 3F5XA 5ANGA 5LMKA 2W1HA 1ND4A 4RJ4A 4PNKA 5AP3A 2QD9A 1ZOGA 3OBGA 2A19B 5CU4A 3UGCA 4QPAA 4JR7A 3ORTA 3P7AA 4QQTA 3GI3A 3LCSA 3K5UA 2C5VA 4AP7A 4AZWA 5EHLA 1YDTE 5C26A 2XYNA 4J98A 4NTSA 3SOAA 4JIAA 1ERKA 1YXTA 5DHJA 3NR9A 4TRLA 3LPBA 2VTIA 2HW7A 5EG3A 5AFVA 4BDJA 4C4GA 2R7BA 1AQ1A 1WAKA 3SRVA 3COKA 2X6EA 2XJ2A 3KMUA 3VF9A 3ZC5A 2YM6A 5IEXA 4BB4A 3GBZA 4DEAA 5J9ZA 2F7ZE 3PXQA 4RFMA 2JITA 4AT5A 4YBJA 4WHZA 3V5PA 3HLLA 4RWKA 3WE8A 5KKRC 2PZIA 5E92A 3PXYA 4K33A 3UYTA 1S9JA 3KU2A 4AXFA 4IX6A 5KX8A 4PDYA 2BUJA 4UZHA 5LJJA 4A9YA 1YRPA 2ZMCA 5FUTA 2GTNA 3LCTA 5JGDA 4YLKA 2G01A 5J8IA 4EHGA 4FKTA 3MY5A 4GK2A 3ZUUA 4DFNA 3EB0A 2GFCA 4KIQA 3P86A 2BVAA 4AWIA 4UEUA 3NYNA 4ITHA 4FTCA 3Q6UA 4IJ9A 2P4IA 3E62A 3QRKA 2J0JA 3FLNC 3NUPA 3EQBA 4RIXB 4DFLA 1UV5A 3FMMA 4X6QC 1OKVA 2QLQA 2A2AA 2GU8A 2ZM1A 5HICA 4EHEA 3G6GA 5DPVA 5C4KA 4F08A 2PPQA 3TN8A 3W0RA 1R78A 2V5QA 4H3BA 5AUUA 2WHBA 2RIOA 1V0BA 2WU6A 3OWKA 3T8OA 3WZDA 4J1RA 5EM6A 3FZRA 3QWKA 4JL9A 3TUBA 1GAGA 5FTGA 1Z5MA 2EUFB 3A7IA 3AT2A 4UY9A 3TJCA 3HUCA 3UC4A 3MPMA 5CSPA 3TUDA 2CGWA 4Q2AA 4ANMA 5DOSA 1GZ8A 4AFJA 5CQUA 5JN2A 3BL7A 4QP9A 4I6HA 4QP3A 4YJVA 3FZSA 1GZKA 3DBQA 3NNUA 4Y83A 3I60A 3LW0A 3QFVA 4PNIA 2JEDA 5FD2A 3F61A 4FK6A 1R0EA 2CNVA 3GVUA 1CDKA 3R1QA 4IE9A 3FQEA 3QCQA 1PYEA 2YN8A 2CN8A 2WMBA 3F3TA 3NEWA 1ST0A 4ZTQA 4WRGA 3FMLA 3N51A 5GINE 2C3KA 4Z16A 3FMKA 3NYXA 1OBGA 2WMQA 1WBOA 4APCA 2P0CA 4F1OA 2BALA 5M4CA 2Y6MA 4OBPA 2JAMA 1E9HA 4GKIA 4KSQA 4MQ1A 3WILA 1VLRA 3CIKA 5HLWA 3KXXA 3ORPA 4ANSA 3SG9A 4EC8A 3QQUA 2BHEA 3ZM4A 4C33A 4F7SA 5C4LA 4PTEA 4WRSA 3AGMA 3GFWA 4EOKA 4IZYA 1PXOA 3NAXA 3PPKA 3RP9A 5A4QA 3NIZA 3UMWA 5JEBA 4NJ3A 2C68A 3QGYA 4I21A 2UUEA 5K5NA 1YVJA 3WYXA 1B39A 3BV3A 4TY1A 5CVFA 4O0XA 4RA4A 2PE1A 5IUIA 4D1ZA 5J7HA 3QX4A 1MQBA 1DI8A 2O63A 2R2PA 3L1SA 5FXRA 4C58A 1X8BA 2VD5A 2XNGA 4WNPA 3R01A 3O50A 4E6DA 1QCFA 4AG8A 1XMMA 2B0QA 1GY3A 3POOA 4QEBA 5DR2A 1FMOE 1DI9A 3H9RA 3LZBA 4ZZMA 3H3CA 3TNQB 3KVWA 1PXLA 3BYMA 4C3RA 4IBMA 3H9OA 2ITYA 3UG2A 3CKXA 3HRCA 3PVBA 2R3LA 3VUIA 1WBNA 2RL5A 4V05A 2JDVA 4YNEA 3TZ8A 4BC6A 4F0FA 2G2IA 4BGQA 4MXOA 3IECA 5LVNA 2WIHA 4I6BA 3KCKA 4KD1A 4FK3A 4GT5A 2XK8A 4QMWA 2OO8X 3O71A 1ZAOA 2UZTA 4XP3A 5D11A 4YTFA 4OTIA 5EYCA 4JG7A 3MESA 3UQGA 4R77A 4NKSA 3I0OA 3DFAA 3UJGA 4ANBA 3FPQA 2GS7A 3ZOSA 1JLUE 1J7UA 3D0EA 5G1XA 2E9PA 3F82A 5EKOA 2JDRA 3UG1A 5AV1A 4UYNA 4ZMEA 4LV7A 2NO3A 1YOJA 3FY2A 5L8KA 3QAME 3P7BA 4GW8A 4C4JA 4QQCA 2VTHA 5HX6A 1KE5A 5I9VA 3MGYA 2C6OA 1ZMWA 1ZRZA 2XKFA 3AOXA 3PY1A 3MV5A 3QYZA 4L3LA 4U9AA 3HKOA 3C4FA 5IDNA 2IVSA 3R21A 3ZUTA 5DEWA 4FV1A 4IC8A 4DGMA 1Y8YA 4EH2A 3OG7A 3GC8A 1YWNA 3U6IA 3QXOA 4D4RA 3BWFA 3KC3A 2QU6A 4MUQA 5JMSA 2W1IA 2XRWA 4UXLA 4ZEGA 4JVGA 1V1KA 3JVSA 4P4CA 3LFNA 2FVDA 2VWXA 4QMNA 5AIKA 1Q8ZA 3Q9XA 3W18A 4RBLA 4MTAA 4W4VA 4AT3A 4CG9A 3VJOA 2GCDA 5F4NA 4O7ZA 4F9BA 3VULA 2OJFE 3MTFA 2ETKA 3CTQA 3QGWA 3LMIA 5JGAA 3R8MA 1Q8YA 2YIXA 4WNKA 4EZ3A 2V7OA 1Y57A 3O23A 2C30A 2BDFA 2VX1A 2XNEA 3I5ZA 4LMNA 5FGKA 2R3FA 4IVCA 4BY9E 5CLPA 4HVSA 4FKJA 3BLHA 2FSMX 2QOKA 2SRCA 4HYSA 3DU8A 1JSVA 4BCGA 3ATTA 3SW7A 4JRNA 4PRJA 4XCUA 1OM1A 2J2IB 2WEVA 2YCFA 3FSFA 1M7NA 5E8SA 4H36A 3Q6WA 5HBJA 1VYZA 2UZLA 4LGGA 4BDCA 3HMNA 4IVBA 4EHZA 3R9HA 4QQ5A 1SNUA 5L8JA 3FYJX 2W4KA 4PL5A 2XF0A 1R39A 1NVQA 3GOKA 2PVHA 1ZOHA 3GU7A 1UVRA 1FVVA 2Z2WA 3C9WA 4GFGA 5M55A 3TV7A 3BLAA 5HE3A 3FI8A 3U51A 5DG5A 3HECA 3LQ3A 3MVJA 3BGZA 4YPDA 5ETFA 3LFBA 2PE0A 5LWNA 2B9IA 4EONA 5JFXA 3RZBA 4L46A 2IW9A 4MXYA 5BVFA 4FKGA 3OCSA 4QNAA 4IW0A 4IB1A 3U54A 4ACGA 3FZ1A 2QO9A 3FJQE 4RVKA 3LMGA 2AYPA 4Z9LA 3S3IA 3TCPA 3FXWA 4OBQA 2A1AB 2JAVA 3C0HA 4BTMA 4KKEA 3OOMA 2X7FA 5CEIA 3WIGA 4EOQA 3QQLA 3DKFA 3O7LB 3D2IA 4IWOA 4OLIA 5HEZA 4BDEA 3GUBA 3DK7A 4YMJA 4CKJA 5IQCA 1PMVA 3GCPA 4O81A 3DPKA 3FLYA 2XALA 1H24A 5I9UA 3IW8A 4BCPA 4CCBA 4DT8A 2ZDTA 3ACJA 2C3IB 4ZAUA 2IVUA 4MD8E 2VTTA 3VQUA 4M69B 4OT5A 5DYJA 3CR0A 3Q4UA 4B4LA 2F57A 4FV9A 3PLSA 4O0RA 3WZKA 3UVRA 3QTSA 2YWVA 1M7QA 4F1MA 2WMRA 1G8JA 2GNFA 2QNJA 5FRIA 3JUHA 4I3ZA 4D2RA 4DGOA 4O21A 2CKQA 4TPTA 4M0YA 5DN3A 4XRLA 2YIRA 2XKEA 5FDXA 2JDSA 5KZ0A 4IQ6A 2ZM4A 2JIIA 3DA6A 2ITPA 2VX0A 3PJCA 4KRDA 4LOQA 4QT1A 4R7HA 4HGSA 3CQEA 3BELA 1TKIA 5A9UA 3VS7A 2WMXA 3FE3A 4WUNA 5DE2A 3RCJA 5D7VA 4HNFA 3EQGA 1YDSE 5EQPA 2I1MA 3DJ5A 2AC3A 3E93A 1REJA 3DB8A 2I0VA 3GQIA 2X8IA 1JPAA 2XCKA 3BV2A 3OY1A 4MQ2A 1SZMA 3VBVA 2W1DA 4L52A 3F5GA 3I7BA 3BEGA 3Q2MA 4D0WA 3PVUA 3PZHA 3COHA 4N0SA 3D15A 4M3QA 4L67A 3DZQA 3LFDA 2FSTX 4FTAA 4CFMA 2OG8A 3PP0A 4IIRA 3PFQA 4JOAA 4EI4A 2BKKA 3AT4A 3FZTA 4LOPA 3VJNA 4OTHA 4KKGA 2BZJA 1VYWA 4KBAA 3VBQA 3A61A 4RC4A 3U8WA 4AA4A 3VONA 4LL0A 4IVAA 1Q4LA 3O96A 2X7OA 4JDIA 3OZ6A 1UU9A 2VGOA 4BBEA 1Y91A 4FV2A 4AXEA 4F09A 4JNWA 4FZ7A 2WQNA 2HCKA 2XVDA 3NYOA 4TZRA 1OPLA 4P2KA 5IQFA 3LM0A 4R5SA 4XV9A 1YWRA 1JKLA 3EZRA 4EWQA 3V5WA 4I5HA 4ANQA 2YEXA 4YZMA 3GCUA 4BKJA 4ACMA 2BDJA 3FL4A 5LVOA 1YXVA 4M15A 5HORA 4ZS4A 2VWWA 2PZRA 4RWLA 1P2AA 5BVEA 4EORA 3P23A 5AP2A 3IW6A 3NUNA 4WG5A 4C34A 5D9HA 5BVDA 4EK3A 3V6SA 4J97A 5LARA 1M2RA 1H00A 1UU3A 4RJ5A 3R83A 2OZAA 1OBDA 4MVFA 3EIDA 3Q96A 3UVPA 5JZNA 3QD3A 1PKGA 3R8ZA 1OZ1A 3TNPC 4EZ7A 2R3KA 4LFIA 2R0UA 4F0IA 5EI8A 3OEFX 4OTDA 3I6UA 4I93A 3KF7A 4HNIA 1KE8A 4D9UA 2C1BA 5CQWA 3VRZA 4BI0A 1YXXA 2CLXA 4RX8A 5I9XA 1M17A 4EUUA 3F7ZA 3O51A 2W0JA 3RAKA 5T68A 3R30A 3SD0A 4DHFA 5BVWA 4MXZA 3SC1A 2X4FA 3TYKA 5HNBA 2EB2A 4JBQA 4L68A 2VTQA 4TYIA 5FXQA 4HCUA 1ZYCA 4BZDA 1AD5A 3AC5A 3EQRA 3EYHA 2HENA 2RF9A 4L42A 4XS2A 3EHAA 3G5DA 5FBOA 3VBTA 4O0UA 4ZOGA 3GGFA 4BDGA 1JQHA 3QRIA 5I9ZA 3D4QA 3W55A 4HYUA 1IAHA 1Y8GA 2C47A 2Y4IB 3PUPA 3ZXTA 4O82A 4Q5HA 5KMIA 4FTUA 4RLKA 4JRVA 5HCZA 4FSRA 4MD9E 3R8PA 2A4LA 2CGUA 4YBKA 4FKUA 1SNXA 4JLCA 3R7VA 3UP2A 4BIBA 4L53A 4DGGA 4GVAA 4D5KA 4R7IA 4FICA 4W8EA 3U9CA 5DH3A 3R8UA 4X2KA 4F9YA 5IA1A 4FTOA 5C27A 2WTKC 4RZVA 3UDSA 1OIYA 2ZFYA 3K3JA 3AD5A 4C38A 3SRVB 3IDCA 1ATPE 3CY2A 3NYVA 4ALWA 4NM7A 4I4EA 3UMXA 4RLLA 2QODA 3MB7A 4BF2A 4U3YA 5HNIX 3FMDA 3KN5A 3KXHA 4IC7A 5E8TA 3R7UA 4K8AA 1NVSA 4U42A 2VAGA 3VS4A 3W8LA 2LGCA 4BN1A 3BBWA 4IB0A 4U6RA 2QKRA 1Q3WA 2P2HA 3FKOA 4DHZA 4AGWA 4MXXA 2VTSA 3OOGA 3FXXA 3QKMA 4FIHA 5CI7A 4AT4A 4LYNA 3BEAA 2IPXA 4M84A 1WBWA 1QPCA 2VNWA 4R7BA 4YZBA 2YM4A 5AM6A 4XG6A 3OCGA 3EKNA 2X0GA 4DLIA 3FXZA 4M0ZA 4BHNA 4CFFA 4ZLYA 5M56A 3QTXA 4QMUA 1I09A 4PL3A 1ZARA 4ZSGA 2V55A 1WZYA 5ACKA 4EBVA 4FIEA 4GEOA 3V8TA 4ZJVA 5HX8A 3VHEA 5CAQA 2WXVA 3EFLA 3LQ5A 4RA5A 4FTQA 3UVQA 4APPA 4PTCA 5IUHA 4PV0A 2XNBA 5L8LA 4WBOA 2I6LA 1H0WA 2XM9A 2RGPA 5HG8A 5F94A 5HD7A 3EN7A 3IDBA 3JVRA 4QDEA 4E5WA 3LJ1A 1WBTA 3I1AA 3C50A 4EQMA 3EN6A 3VRYA 5CENA 5AAEA 1G8AA 3MYGA 5IG1A 5DFPA 3CPCA 3PZEA 4JAIA 4AACA 5E7RA 5I5ZA 4KIOA 4FGBA 2OW3A 3F7WA 3TZ7A 3CP9A 3PFYA 1UNGA 4EH5A 4IFGA 2QKWB 2XK4A 1FOTA 5JRSA 5BVKA 4FNXA 1ZZ2A 3D94A 1A48A 4E20A 1KWPA 4O91A 4YPSA 3S2PA 2Z02A 4C4FA 4HZRA 2QO2A 3PSBA 4E4LA 3PXZA 5DRDA 2R0IA 3ZZEA 5KHWA 4RJ3A 4GJ2A 2XUUA 4FTIA 1YI4A 3CLYA 4AXAA 3K54A 4DEBA 3DTWA 4FL1A 5CEPA 2GNGA 4NIFB 5CYIA 2XJ1A 3THBA 3ZYAA 5EM5A 2W7XA 3RWQA 4XG2A 4GFMA 2CKPA 2QOLA 5FBNC 5FTQA 2BIYA 3EQHA 4S30A 3NS9A 3UOHA 1Q8TA 2WMWA 3AC1A 3O8PA 3TKIA 4BYJA 3MA6A 4F65A 3BLRA 1XBCA 4ALVA 4O0SA 4XEYA 1GOLA 1LEZA 1NY3A 3KXGA 5AP4A 4C4HA 4CD0A 4DA5A 5JFVA 4FSYA 3NVMB 4I5CA 4F70A 4UWYA 4XP0A 3O8UA 2X4ZA 4UBAA 4DH1A 1TQIA 4ZIMA 4L8MA 4RPVA 2HW6A 1J7IA 1G8KA 2UZWE 4GS6A 5CSWA 2YIWA 5AX9A 3UOKA 4TYEA 3I79A 1OIUA 3OT3A 3PY3A 3LHJA 1SMHA 2ZV7A 1SVGA 3NDMA 4FTRA 4GRBA 1O6KA 2OJ9A 2P3GX 4KIPA 4QP1A 1LP4A 5E4HA 5AUYA 3SKCA 3ZCLA 4BBMA 3VHKA 4YZDA 3D5UA 4I92A 3U4WA 4ZZNA 3R71A 2V0DA 4RIYA 3W2PA 3LKMA 2Z7LA 4U7ZA 3R7YA 5CEOA 4O27B 5KCVA 4BDHA 3D7TB 4HPUE 2R3HA 2QURA 3DLSA 4Y5QA 3MPAA 1SYKA 5EH0A 5H9BA 2CGXA 3BU3A 2G2HA 2CNUA 5G6VA 3Q52A 3LIJA 3PDTA 5AX3A 4YJQA 4EYMA 3OXZA 4DFZE 3VW6A 3UOJA 2RFSA 5AP5A 3JY0A 3TIZA 3CCNA 4TN6A 5A4LA 5LXMA 2CJMA 3TV6A 4E7WA 1UKIA 3F3ZA 2KULA 4YJPA 5HLPA 5J5SA 1UU8A 1AGWA 1OL2A 1Z57A 3FAAA 4TT7A 3H30A 5CF8A 5IQDA 4K1BA 4FKIA 4OTWA 5E9EA 1JNKA 3E8DA 3P0MA 1FMKA 3IW4A 3COIA 3ZEWA 5IQHA 4QMVA 4H1JA 3HVCA 2X2MA 2F4JA 3KK8A 3TL8A 3FMNA 2ITUA 2VWUA 3NX8A 3ZRLA 4CTBA 3NZ0A 4RIWB 2QQ7A 2C6EA 2QOOA 2WTVA 1MRYA 2FYSA 2XEYA 4FUYA 2JLDA 2C1AA 5FEQA 3AMAA 3WF9A 3SVVA 1ZYJA 4AOTA 4BI1A 3FL5A 4IB3A 4L45A 5LMKC 2ETRA 3PE2A 2B9FA 3PIYA 4DAWA 1KSWA 5F9EA 2GQGA 4ZMFA 4MWHA 4XG7A 4AE6A 2VO7A 4ANLA 4F63A 5EYMA 4K9YA 2RFEA 5E8XA 4AZTA 3PSDA 4S33A 1UA2A 1VR2A 4DEHA 4S2ZA 5AIRA 4HYIA 3B8QA 2XS0A 4FR4A 1I44A 1KE9A 3MVMA 4YP8A 4XG4A 4FZFB 3WF6A 3WF5A 3E7VA 5IH4A 2YIYA 4IACA 1FGKA 3FQSA 3RNYA 4DG2E 3MH3A 4QYGA 4DG0E 2ZB0A 3LAUA 1U46A 2PZPA 4IANA 1OPJA 1IR3A 5EFQA 4PDSA 1ZXEA 3BYVA 4DN5A 3EN4A 3QRTA 3V8SA 5DNRA 4MBLA 2AEGA 5ITAA 4IWPA 1OUKA 1Q8WA 4FIGA 4UWCA 4Y95A 1NT2A 2QR7A 1PXMA 3MY1A 3KRLA 1OL7A 2YHVA 3MH2A 5ANDA 2X7GA 3ZFMA 1P4FA 2Z7QA 1JSUA 3IS5A 1H1WA 4I22A 5KKRB 2YAKA 4PMPA 4FEVA 4EYJA 5D12A 2PE2A 1TQMA 5KMNA 3FMJA 4BGHA 3UDZA 4TL0A 1CSNA 2Z8CA 3GU8A 4QMYA 3D2KA 3H9FA 4P5QA 4K18A 1QMZA 3ZFXA 3ZHPC 5J1WA 1LUFA 3RMFA 2O65A 4QOXA 2R3QA 3ZO2A 3AG9A 3HGKA 3QD0A 3ID6C 4BTJA 4IZAA 2OF4A 5D10A 4NL0A 4F1TA 4ITIA 1F3MC 4YU2A 4FIJA 4GUBA 3LFSA 4EH3A 2H34A 3OS3A 2B55A 3CQWA 2W17A 5BV3A 3QTZA 4IVDA 2FSLX 2HYYA 2R3GA 3U87A 4FZ6A 4G3CA 2B53A 4I6LA 3V5QA 4L43A 3NWWA 4JT3A 4BCHA 4X2GA 1OVEA 3CD8A 5EKNA 2WTCA 1M52A 2WOUA 4UV0A 4O7NA 4EOLA 3BPRA 5HLNA 2VTNA 3BLQA 4FJVA 5HVKA 4I41A 4O6EA 4EQCA 3PYYA 5CSHA 4I5MA 1FVRA 3PVWA 5FEEA 3E88A 4RZWA 3F3WA 5CU2A 3QTIA 3C5UA 3NNWA 2OJIA 2XJ0A 2X2LA 4EZ5A 2C5NA 2CNQA 4X0MA 5EYDA 3CSVA 4BRXA 3E3PA 2VTJA 4A4XA 4ZLZA 1H26A 3HV7A 3OXTA 4RIXA 1KE6A 2QI8A 5L6OA 3P5KA 4FKVA 3HV6A 3E5AA 4FZDB 3RHXA 2J9MA 3RCDA 4GV1A 3GNIB 1U54B 2FGIA 2E9NA 5BYYA 4XG8A 4IM0A 4QYEA 4DCAA 5F1ZA 1IAJA 3LCDA 2HXQA 5ANKA 3ZO1A 3CKWA 4U41A 4ASZA 4D4SA 2WNTA 2NPQA 3GC9A 5HKMA 3TMOA 4LRMA 1U4DA 2C6TA 2V22A 3MFUA 4ACHA 5JQ5A 4XLVA 5CU3A 5LCJA 5DT0A 2OI4X 1J1CA 3R22A 3NUSA 4NUSA 2R3PA 3DBDA 3C51A 5K4IA 2WFYA 3GCVA 5A6OA 3P78A 3OW3A 3SV0A 1H27A 5GIOE 3W33A 2ZMDA 2HY81 4IJPA 3A60A 2X9FA 4N70A 4U80A 3FC1X 4FSZA 1U54A 4DFUA 3PE1A 2QOCA 5AWMA 3WYYA 2GSFA 2JD5A 3FC2A 3UC3A 3CTJA 2PUNA 1ZOEA 2XZSA 3LE6A 4FVQA 3P08A 5HNGA 4PMSA 4CFWA 3DS6A 5CF5A 1H0VA 3KY2A 4O7TA 1W83A 4G5JA 2CCIA 4XG9A 5IQIA 5KO1A 3P1AA 3MVLA 3NPCA 2YM5A 2BAQA 4QMPA 1LPUA 3F2RA 1OI9A 3DJ6A 3BX5A 3TUCA 4MAOA 5J87A 2X8DA 3VW8A 1YWVA 3ERKA 3KRRA 3SHEA 1WFCA 1ZLTA 4V0GA 4RMZA 3VUMA 4BDFA 1OITA 5IMEA 2VWBA 2VV9A 2JKKA 2ZJWA 4AN3A 3LOKA 3NCZA 1PJKA 3QTQA 3MY0A 4AE9A 4QRCA 1H1PA 4RFYA 1BKXA 1GJOA 4C59A 4DBXA 2IZSA 5DLSA 4LRJA 5JH6A 5JSMA 4U44A 2HK5A 3SGCA 2XKCA 3LLTA 3GU5A 4MEDA 3ZZWA 5I4NA 5HHWA 2OFVA 2R3IA 2BROA 5JFSA 2XNPA 3L9MA 4R3RA 1Q99A 5CSXA 3AC8A 5E8ZA 3RAHA 3QZIA 1W8CA 3ZBFA 1QPEA 3TIYA 2W96B 1H1QA 1YOMA 3ZU7A 3GC7A 4WUAA 3R8VA 3TTIA 3ET7A 1WMKA 4A9SA 3DV3A 4C0TA 3QUDA 2C6IA 5M57A 3H0ZA 4DHJA 4E1ZA 3PIZA 5BNJA 1REKA 2GNHA 5ANOA 5E1SA 4NH1A 3WZJA 4CMOA 1APME 3KB7A 5E8VA 4J99A 1JBPE 4BCFA 4MD7E 4FVRA 3VUGA 3R73A 3P79A 3GOPA 3WARA 1JKSA 4QYHA 3KL8A 4TXCA 5AP0A 4CGAA 4F6UA 5IH5A 2JDTA 4YZ9A 3ZH8A 4GYGA 3G90X 2W4JA 3OWPA 2H6DA 3BKBA 5CT0A 5BMMA 3R9OA 4DGNA 4USEA 3W0OA 3E8NA 2ZM3A 2XCHA 5IQEA 5IQBA 4YNOA 3ZSGA 4MHAA 3CXWA 4RWIA 1PYXA 2EXMA 3QLFA 3AT3A 5JQ8A 3DKCA 3P5JC 3G51A 2C5YA 4X6RA 4E6QA 2W9ZB 2R3RA 2W9FB 3JXWA 1J7LA 1IA9A 4U5JA 3VAPA 1PHKA 2X1NA 3QBNA 3HMMA 5K9IA 3PA5A 4HOKA 3VS1A 3ZMMA 3KULA 4I94A 4XV2A 5K4JA 4G3FA 3R7IA 4R1VA 4YUQA 5EOLA 3KRWA 2GPHA 3OP5A 3Q53A 1WBSA 2OGVA 4P5ZA 3IONA 4F9CA 4BCOA 3TDVA 3L8XA 3RWPA 4DFYA 5CVGA 4QQJA 3QTWA 1UU7A 3SXRA 3MIAA 4I6FA 2OJGA 3NRMA 4RQVA 3UIBA 4CLIA 3LM5A 4WBBB 5CTPA 3Q4ZA 4IB5A 4M68A 5EM7A 4C37A 5HCXA 3UZRA 3ULIA 5L6PA 2J0KA 4X3JA 4ZSJA 3OBJA 4R3PA 3BIZA 5HIDA 1XHAA 2QLUA 4NFMA 3VBYA 3UNZA 5E1EA 4X2NA 4A9UA 4S31A 5IA5A 5L6WL 4J7BA 3L9PA 5AA8A 3FLZA 3RPVA 2PMOX 2XIZA 4C4IA 3Q9ZA 2RG6A 3LJ0A 1URWA 4F7LA 3PJ3A 4WG3A 4DFXE 3I6WA 4O96A 3KA0A 3NIEA 4QMTA 4Q9ZA 1CTPE 2XK7A 4NFNA 4BZNA 4ZSAA 2XYUA 3NW7A 2XAMA 4O2ZA 4JBVA 3C7QA 3NLBA 4S32A 2W5AA 5J9LA 3CTHA 4L6QA 5JFWA 4JX7A 1W84A 3OCTA 3DTCA 4DH5A 2A27A 2P55A 2W1CA 3A7JA 5LQFA 3EQDA 1ZYLA 4RVTA 4X2FA 4G9RA 3ROCA 4A9TA 4CNHA 5AADA 1Q62A 3E8EA 3IW7A 3LXNA 5AJQA 2VTAA 2XIRA 2F9GA 2Z7RA 2VWVA 3V51A 4D0XA 2I0EA 4G2FA 4WSYA 1HCKA 4GKHA 4L00A 4AW1A 5LMBA 3UQFA 4H05A 5M4FA 3W0SA 3TEIA 2PL0A 2PVKA 4O0VA 3AD4A 5KMJA 1P4OA 2YAAA 2PZ5A 3OWLA 4G3DA 4WT6A 2YDIA 4XOZA 4U79A 2W1EA 4AZVA 4BJJB 4V01A 4LOOA 4NKAA 4O7OA 4ZSEA 4QYYA 3DBEA 3AD6A 1XH4A 1J3HA 2UZEA 4FKSA 2FA2A 4FTTA 3QQJA 4GIHA 4YTIA 3SAYA 3UOLA 4D1SA 3N4TA 4FKWA 5A4CA 3WF7A 3VUDA 4UYAA 1Q8UA 5HBHA 4DG3E 4U40A 4AOIA 4DINA 4O7RA 3FV8A 4YC3A 2B1PA 1ZMVA 4FSQA 4EH9A 1PXNA 2FSOX 5EM8A 2Y9QA 3N4VA 3I81A 4UB7A 4RVLA 3RK9A 4FV7A 4G5PA 5L3AA 4A07A 2E9VA 2Y6OA 2X39A 3BZ3A 1GIJA 2OZAB 3NCGA 2ITWA 2XIKA 4K0YA 2VZ6A 3BYOA 1PMEA 3F2AA 4YLLA 1YDRE 3AMBA 3QZFA 4U45A 1SVHA 2W5BA 4RIYB 1UWJA 5IEVA 3F9NA 3H10A 2PULA 3VC4A 4QTEA 4DEGA 5M09A 4RC3A 4WG4A 3OWJA 4IM2A 4PY1A 4E6CA 4O22A 4KS8A 2HXLA 4CRLA 4F99A 4BDIA 4XNEA 1RDQE 5AMNA 3ODYX 3TV4A 4FSNA 2C5XA 4ASEA 4ZTHA 1TVOA 3M1SA 4PP7A 3BE2A 5KHXA 3R7OA 1JKKA 3BHUA 4Q9SA 2IVVA 3W0NA 4XRJA 4BHZA 4ENXA 1G3NA 4C61A 5EK7A 2W1ZA 5L2SA 4GVJA 1WVXA 2WMSA 4RFZA 2BZIB 5CXZA 2WOTA 4R5YA 2QU5A 5KMLA 1ZZLA 3HAMA 2BKZA 3AQVA 5FTOA 3M11A 3BHVA 4FSWA 4TKSA 2PSQA 1Y6BA 3ORKA 3R2BA 1XH9A 2UVYA 3L9LA 4J8NA 1W82A 2GHGA 1UWHA 3JY9A 2WQOA 4FODA 4MWIA 3EH9A 5A14A 1FVTA 5M51A 4I0SA 3Q5IA 2BAJA 2PMNX 2R4BA 3KCFA 5AP7A 3REPA 3RJCA 2PYWA 5M53A 3QCSA 4GIIA 4ZY4A 4CSVA 3UO6A 2H96A 1Q61A 4PMTA 5E8WA 5J1VA 1RJBA 3FWQA 3HP5A 4WIHA 4DH7A 1OGUA 2WIPA 3MW1A 4YJRA 2PMIA 4L7FA 2YM3A 2GS2A 2VTOA 4FEUA 3W2QA 3A2CA 3DKGA 3EYGA 1ZY4A 3QZHA 4FV8A 4IWDA 2GTMA 3CEKA 3FSKA 4E4XA 3W8QA 3O2MA 3ANRA 3HZTA 3KF4A 5TOZA 4YHFA 2UW8A 3KN6A 3VUKA 4DYMA 3S0OA 2BRBA 1W0XC 2F7EE 3OFMA 2PZYA 1YXSA 1NXKA 2OH0E 2PVYA 3II5A 4PDPA 4R3CA 3EMGA 3WIKA 2ZOQA 3ORZA 5DI1A 3DNEA 5I9WA 1WBPA 4FT5A 2C69A 2HWOA 2DWBA 2J51A 4E6AA 2V7AA 1LEWA 1GIIA 3ZS5A 4MYGA 3QA0A 4PTGA 4ACDA 3BYUA 4JQ7A 2GQRA 3AKJA 5KMOA 5E8UA 5TT7A 2B9HA 1GNGA 1M2QA 2O2UA 2IG7A 2HZ0A 5EI2A 2WQBA 5FDPA 1PXKA 1W98A 4ZJJA 3T9TA 2PMLX 4FMQA 2VRXA 5HI2A 4BTFA 2ITVA 2HZ4A 5DEYA 3GU4A 3PRIA 3LQ8A 2WAJA 4I24A 3TNWA 1MP8A 3EQFA 4C4EA 3V5LA 3WZUA 3OROA 4ZY5A 4M97A 3I0QA 3DB6A 3ORIA 5D41A 4D9TA 3DKOA 3IG7A 5A6NA 1HOWA 5GJGA 4AQKA 2NNWB 2PY3A 3A8WA 5LCKA 3ZDIA 3ANQA 4F9WA 2J5FA 3HV3A 2WEIA 1PF8A 4O7LA 2W4OA 2ONLC 3PWDA 4CXAA 4DE4A 4DLJA 2IWIA 4M12A 3ATSA 4RG0A 4P90A 1BUHA 2C0OA 4IH8A 4OTFA 4U98A 1OKZA 2BRGA 4L01A 3NW6A 4U0IA 5IU2A 2J90A 4NSTA 1XJDA 1JWHA 1H1SA 1FPUA 4FGRA 2VUWA 3SDJA 3HEGA 2BRMA 5GHVA 5C8KA 4DTAA 4EH6A 4IM3A 4KABA 1G5SA 2J5EA 4U81A 4XLIA 5FM2A 4DH8A 4Y5HA 4PDOA 3IO7A 4EKKA 1QL6A 3Q60A 4BJJA 4DITA 2G9XA 1U5QA 4YJUA 3GENA 4ARKA 4CFUA 4LM5A 3IQ7A 4AZFA 5LOHA 1OL5A 5HCYA 2OKRA 3RK7A 3W0PA 3MJ1A 4NW5A 4AXDA 2XNOA 4J52A 3KXMA 4JDKA 4B7TA 1F5QA 3F2NA 3LFAA 3G15A 5BPYA 3LXKA 2XP2A 5AM7A 3V3VA 3E8CA 2ETMA 2J0IA 3EOCA 3ORXA 4RJ7A 5LVLA 3SXFA 4CKRA 3R02A 1Q97A 2H8HA 2BRHA 5FQDC 3GFEA 5FG8A 2GHLA 3G33A 4FI1A 1BI7A 2OF2A 2W06A 2YERA 3DXPA 2XEZA 5DR9A 5BMSA 2HZIA 2UZUE 3R6XA 3V5JA 4YO4A 5B7VA 4HVDA 2YCRA 5JRQA 1XBAA 4IFCA 2F7XE 4UWBA 4I6QA 2EXCX 4PX6A 4BIDA 4IZ7A 4O84A 3R7EA 4Z7HA 3DK6A 1JKTA 3NNXA 4QDVA 5EQYA 3UIUA 2G15A 3TKUA 3V04A 1YXUA 3EL7A 4G16A 4YGAA 5DR6A 3DXQA 5M06A 3MVHA 3PJ2A 4IX3A 1K2PA 2GNIA 3LMHA 5AUVA 5CWZA 5HBEA 4E4NA 3PPZA 4WD5A 1XH8A 2FUMA 2WQMA 3NNVA 4QO9A 2O8YA 4LV5A 4EUTA 3FI2A 3BHHA 4OGRA 3UIMA 1H07A 1PW2A 1PKDA 3FZOA 4LRKA 3LFFA 2CKEA 2YITA 4ZXTA 4EOOA 5HU3A 4O7WA 4KBKA 4B8MA 2OLCA 4CV9A 2BTRA 3VS6A 2IW8A 3HUBA 3OTVA 4MH7A 3RALA 2PHKA 4JBOA 3D5XA 1Q5KA 4DTKA 4DGLC 4L44A 4NK9A 4GCJA 3M2WA 5M4IA 2R5TA 1HCLA 1U59A 2W05A 4XG3A 3HV4A 4QNYA 2RG5A 3BGPA 4BBFA 3QTRA 4QMLA 5BYZA 3ZSHA 4O86A 3RNIA 4YC6A 5EHYA 4Y73A 4YSMA 1ZWSA 5AUXA 1MRVA 5B0XA 3W1FA 4HJOA 4H1MA 4FTJA 3I5NA 4QTDA 4FYNA 2WO6A 4G17A 2WTKB 3QD4A 4YTHA 4JS8A 4RT7A 3G9LX 4ENYA 3UO5A 2CLQA 2YFXA 2QOHA 2UVZA 4N6YA 3Q9YA 4JJRA 3DNDA 4OUCA 5IISA 4TWOA 4O0YA 4X3FB 4BI2A 4EOPA 4G6OA 3ZEPA 4Z3VA 4FIIA 3QZGA 1IRKA 4J71A 1OIQA 1A9UA 4KBCA 3QA8A 2JBOA 2F49A
chains in the Genus database with same CATH topology
3DLZA 2R3MA 3PP1A 4KWPA 4MK0A 5HIBA 4BCIA 4I4FA 2OZOA 4ZSLA 4CCUA 3UYSA 4A06A 4D4YA 2BFXA 3HL7A 4WNMA 5C8NA 5KNJA 3QUPA 2UW7A 3MH1A 4ONAA 4XOYA 4YZCA 3ZO3A 3ODZX 2YM7A 3VS3A 5DIAA 3PWYA 3KRJA 2F2CB 2VX3A 4GT4A 2BR1A 2G1TA 2BILB 3EFWA 5BYLA 3QWJA 2PU8A 4IMYA 4CRSA 3GP0A 4OR5A 4F78A 5CANA 1OL1A 4FV3A 4FL2A 1L3RE 2DYLA 1T45A 2XANA 2QC6A 5E91A 3LCKA 3Q32A 4LQMA 5D7AA 3B2WA 5ANJA 5H8BA 3IKAA 5KZIA 3W10A 4JQ8A 5IQGA 3W0MA 4FA2A 4ID7A 1T46A 3C13A 4HZSA 1UNHA 3I7CA 4AW5A 2UV2A 2XAOA 3HMPA 2UZDA 3PTGA 4RQKA 4YJNA 4K2RA 4D1XA 4D2SA 4EJNA 4NW6A 4W4WA 2XARA 4CEGA 4QPSA 1BL6A 3HDNA 2EU9A 2JFMA 4LDTA 4QP6A 2XKDA 3D14A 2ESMA 3QHWA 3F88A 3ZC6A 4B6LA 2JGZA 4AW2A 5IF1A 3ACKA 2X9EA 4AA0A 4G6NA 2OU7A 1M14A 4BIEA 2BCJA 4A4LA 3WOWA 5HO8A 4JG8A 4JXFA 4EKLA 3UODA 1OUYA 4BYIA 4HW7A 3UBDA 5FP5A 4NCTC 5IA3A 4FE2A 2QG7A 1A06A 3N4UA 4CG8A 4GG7A 1U5RA 5DBXA 4AGCA 5JZJA 1UKHA 1XWSA 2ITQA 4XV3A 2VWZA 3HRFA 4D5HA 3ML1A 2UVXA 2BIKB 3QF9A 3DAJA 4Y46A 5C9CA 4PMMA 2IZUA 2JBPA 3PXRA 3E63A 4JMQA 4AN2A 2C0TA 3A62A 3MFTA 3SX9A 4RWJA 4KB8A 2ZYBA 1IA8A 3IW5A 3ROYA 3C0IA 4JDHA 3PJ8A 1PXJA 4CTCA 3CPBA 1BX6A 4YO6A 5HU9A 2P33A 2VO3A 2PK9A 4II5A 4IZ5A 3W2SA 5JKGA 2OXXA 4D55A 1CKJA 1R3CA 2J7TA 2VO0A 4AXCA 3MWUA 4IADA 2NRYA 3GEQA 2QVSE 2ZV2A 4MBIA 4DEIA 3W0QA 4UZDA 2IJMA 4E26A 3D5WA 3D9VA 2YZLA 3IOKA 4G3GA 3BRBA 5CVHA 4DTBA 3B2TA 3FEGA 2O0UA 3TDWA 1IASA 5IQAA 1J1BA 3VBXA 3FDNA 2QHNA 2W99B 2RFNA 2Y4PA 4AX8A 4EK5A 2RKUA 3IGOA 3FLWA 4TYJA 2I0HA 5H8EA 4CT1A 3RINA 3ULZA 3FPMA 3VF8A 3E87A 4H3PA 3W16A 4X21A 3W32A 2E9OA 4DEEA 3UQCA 2VTPA 1IG1A 3R28A 4KNBA 3BE9A 3HMOA 1QPJA 2W5HA 2ZAZA 3A7FA 3GXLA 2YIQA 4BDBA 2JIVA 4NWMA 2YWPA 5HVJA 3ITZA 3OCBA 3F69A 2X8EA 4HVGA 1CKIA 1UNLA 2R9SA 4RJ6A 4KAOA 3KKVA 3PXFA 4XP2A 1M2PA 4EBWA 4AZEA 2YDJA 4JX3A 5D1JA 1CM8A 1BI8A 4L3JA 2CKOA 3RAWA 3QCXA 1EH4A 1YKRA 1S9IA 1QPDA 3GB2A 5C01A 4IX5A 1ZMUA 2XNNA 4X3FC 3PA3A 5AA9A 1H28A 2OWBA 1DM2A 5AV0A 4CZUA 3FZPA 3UP7A 4YR8A 3V5TA 4LI5A 1XH5A 3RHKA 3SG8A 4DF3A 2VTLA 5T6KA 5JGBA 5IDPA 4P7EA 3SW4A 3UIXA 3HMIA 4NT4A 4F9AA 5A46A 2CHLA 1RQQA 3O5AA 2IVTA 1BLXA 4CFXA 4QYFA 2UZOA 4G9CA 3NW5A 5AAGA 3KULB 4B8LA 3H0YA 3DQXA 3MN3A 4EQUA 2QCSA 5ETCA 4BCKA 3W2OA 3R0TA 2ONLA 3EFKA 5A54A 4EJ7A 4YLJA 3SOCA 2PUIA 2R64A 3E64A 3OY3A 3G6HA 5H8GA 4EHVA 2RFDA 2QOFA 2OJJA 5AUWA 3TXOA 4GMYA 3EZVA 4FBXA 4C35A 4DDGA 4IHPA 4AUAA 5IZFA 2HAKA 3CS9A 2JIUA 4CLJA 4C2VA 2OBJA 2CGVA 2UW3A 5F95A 3ZO4A 3T9IA 1R1WA 3NVKI 4AFEA 1JOWB 2EB3A 3IGGA 2CDZA 3IOPA 4TNDA 5CI6A 1YOLA 4V04A 2WD1A 3VBWA 1WVYA 3PVGA 3RPRA 4O7SA 3R1SA 4XUFA 2YA9A 4E8AA 3CY3A 4USDA 3ELJA 2W1FA 4QMZA 3G9NA 3K2LA 3NUYA 3TZ9A 5I9YA 4D58A 2HIWA 3HV5A 3OXIA 2GNJA 1E1XA 4J95A 2GMXA 4TWPA 4YC8A 3ZUVA 4AQCA 2QR8A 2XMYA 3K3IA 2J0LA 2QO7A 3KK9A 4FZAB 3KXNA 4TW9A 5AP1A 4GUEA 5ETIA 4CMTA 4WZYA 3D83A 3KEXA 4XBRA 1NA7A 5BVNA 3R9NA 5AEPA 3R9DA 5BX0A 5BUEA 2R3OA 3QHRA 5CALA 3OEZA 2Q83A 5CS6A 3RM7A 3DOGA 4KINA 5DA3A 3ORMA 5CAOA 3CJFA 5EHOA 3QCYA 2J0MB 4JAJA 2IW6A 4RJ8A 4YJTA 4X7QA 4QP8A 3Q5ZA 4GT3A 5CAUA 3BCEA 4WO5A 4H3QA 4GL9A 4C02A 5IUGA 2OFUA 2VNYA 4JQEA 3BHTA 5EW3A 3ZRKA 2W1GA 3C1XA 3QC4A 3VS5A 3C4WA 3NUUA 4HCVA 4OBOA 4HYHA 4K11A 5L2IA 2XIXA 3E3BX 3G2FA 4ZY6A 4N57A 4YHTA 2ACXA 2PVMA 1BMKA 5AV2A 3ZSIA 3UO4A 2C6KA 2E9UA 3F66A 3K5VA 2XA4A 3S4QA 2H9VA 3HYHA 2WTDA 4Q5EA 5CZIA 4C2WA 4PL4A 4TWNA 4FG7A 3OT8A 4ZTLA 3SQQA 4O0TA 4KS7A 4EOMA 1OGYA 3ZLYA 5I0BA 4LG4A 4GK4A 3C5IA 3NAYA 1VEBA 3CD3A 2JKQA 3QD2B 4FKOA 3WBLA 4DCEA 4GK3A 3S95A 4NTTA 3BYSA 3MBLA 3PRFA 4ZK5A 2WU7A 5FEDA 4BGGA 4BR3A 4AU8A 3ENMA 2LAVA 3FKLA 5DWRA 3UDTA 3D7TA 2F2UA 4CFVA 2R3NA 4M8TA 4FSMA 1KUTA 5B2MA 3ZXZA 3QLGA 2UW4A 2O5KA 3BQCA 3QQGA 3R00A 5EQEA 3RPOA 4HGEA 2PTKA 3DBCA 5CX9A 5CF6A 3V6RA 4ITJA 4ALUA 3RM6A 3T3UA 5KUPA 4UX9A 2BFYA 4B9DA 4BCNA 3L8SA 4ORKA 2YCQA 4Y85A 4NU1A 3C4XA 2O3PA 4G1WA 4EOIA 3R8LA 2E2BA 2X81A 3VO3A 4Y72A 3JS2A 2QHMA 3PLAE 2BMCA 4JBPA 4OTQA 4ZTMA 4MF1A 3PUFC 4C36A 4QMMA 2YJSA 2XIYA 3A8XA 3C4EA 4EK8A 5HO7A 3UNKA 1PXPA 3PG3A 4DFBA 3MI9A 5C1QB 5IPJA 2B52A 3MFSA 2WMTA 4F7JA 5AV4A 2ZVAA 4J53A 4UN0C 3TM0A 2JC6A 1XH6A 2GQSA 2CN5A 3EKKA 5EDPA 3QXPA 1E1VA 3F3VA 2V62A 3MH0A 3Q2JA 4FT3A 5GJFA 5CF4A 3WZEA 2I40A 4F7NA 4X3FA 3MB6A 4LUEA 2BAKA 5H3QA 3R9RA 3ZLXA 2Y0AA 2UZNA 2WGJA 5IEYA 1TQPA 2BZHB 1BYGA 5FM3A 4EWHA 2WELA 1YW2A 4FEXA 5AAFA 3GU6A 2B7AA 3VS2A 3DZOA 4FKRA 4GSBA 2XRUA 4L7SA 4BVUA 4X2JA 5CU0A 2JKOA 5C03A 4EK4A 4IEBA 4CMUA 1VZOA 4PP9A 3DDPA 4ZS0A 4DH3A 5M4UA 2JKMA 3WI6A 2OXDA 1Z9XA 3EN5A 3KGAA 4IX4A 4GYIA 4IAKA 3W2RA 2DQ7X 3ZM9A 3QKLA 4OTRA 4YJOA 4FNZA 1Q24A 3OC1A 3R63A 5LVMA 4FV6A 4GU9A 4KUJA 5HE2A 4G3EA 2O64A 4RC2A 4USFA 3DJ7A 4YZNA 3BU6A 2B9JA 2WTWA 3QQKA 4JR3A 3QL8A 4AAYA 4O0WA 3HNGA 1YI3A 4KA3A 2UW0A 3FKNA 5TKDA 4ZTSA 3R04A 2GNLA 4IWQA 3UZTA 3W2CA 5IA4A 2ZV9A 4QMSA 4UXQA 3OTUA 4NYEA 4WOVA 1PMNA 1DS5A 4QTCA 4XJ0A 5A4EA 5BUIA 2YDKA 4MXCA 4ACCA 5H2UA 4N6ZA 3C4CA 2OK1A 2BTSA 5CNOA 5BQ0A 3U6HA 3AC4A 5DVRA 2OXYA 1OPKA 1V0OA 1Y6AA 2CSNA 4RSSA 4ZJIA 5TF9A 4CFNA 5CNNA 2C5OA 3DXNA 4H39A 2J4ZA 3KIOC 3RVGA 4FKLA 3FYKX 5M44A 1WVWA 2X2KA 3FHIA 3LVPA 3KXZA 4O6LA 3ZONA 3OUKA 1JVPP 4O7PA 2GS6A 3CQUA 4MX9A 4R1YA 2PVJA 3QYWA 4FG9A 4BCJA 3RK5A 1XBBA 3R1NA 3TACA 3AKLA 4ASDA 4HGLA 4E93A 3MIYA 4FT7A 4FG8A 5CZHA 1YHVA 4BDKA 1K3AA 2YM8A 3UTOA 4CT2A 3MDYA 5HZNA 4ZTRA 4EH8A 2YCSA 4EOSA 4C62A 2WB8A 4AS0A 3ZBXA 4AF3A 1IEPA 1FBNA 4F6SA 3VIDA 2GHMA 3F5UA 4TYHB 4FT9A 3UNJA 4QTBA 2ZV8A 4QMXA 3DGKA 4K6ZA 2BRNA 2IZTA 3LFEA 1ZYSA 2XBAA 3QX2A 3UZPA 4EH4A 3L8PA 3A99A 3JR1A 4TTHB 2YJRA 2A0CX 1YI6A 3FMEA 2Q0BA 3KMMA 3NUAA 4QP2A 2QOIA 3D7ZA 4F4PA 2BPMA 1PMUA 4U8ZA 5EW9A 5ANIA 3I4BA 5K3YA 4AOJA 2WMVA 4M13A 4A9RA 1CMKE 3DFCB 4XMOA 5CU6A 4DDIA 4Z55A 2VU3A 2ITTA 4V0GB 3MTLA 4QP4A 4GH2A 5CAPA 4AGDA 3ZRMA 3VS0A 2R7IA 4DEDA 3S1HA 3G0FA 2CCHA 4FEWA 3PJ1A 5DRBA 3UDBA 5HIEA 2WPAA 1OMWA 3GCQA 4E4MA 5IMXA 1OB3A 3PG1A 3Q04A 3NSZA 2OH4A 2VO6A 3QRJA 4HGTA 4IDTA 4UALA 3A7GA 4LL5A 3VQHA 5KBQA 3P4KA 2XH5A 3ALNA 2C6LA 1OECA 3PPJA 4U3ZA 4RX7A 3F5PA 1TFFA 1J91A 1YQJA 2OICA 3QKKA 4RGJA 2Y7JA 4L3PA 4A4OA 5CAVA 2XK9A 3O0GA 2ZB1A 3RTPA 2HZNA 4FVPA 4O2PA 3GT8A 1KV2A 3NGAA 3IPHA 3O8TA 4BCMA 4KRCA 2QOQA 3GQLA 4FTNA 1H4LA 5HE1A 2Z60A 2P2IA 5IA0A 2UZVA 4XH6A 3FQHA 5CSVA 1H8FA 4O83A 3Q3BA 4NJDA 3CJGA 3ORLA 4WNOA 3C4ZA 4TWCA 3TKHA 1RE8A 5BUJA 4M7IA 2IO6A 2ITNA 3QC9A 4GU6A 3MSSA 3POZA 5CT7A 1B6CB 3BBTB 4QMOA 3VUHA 4XYFA 3R2YA 4TYHA 2HOGA 2QOBA 2JDOA 4FEQA 5LVPA 3F6XA 3EWHA 4XX9A 1GIHA 5HGIA 3UE4A 1O6LA 4FNWA 4EEVA 3CGOA 4J96A 3DAKA 4FIFA 2B54A 3HX4A 3GCSA 3JPVA 2FB8A 2GDOA 4C7TA 2I0YA 4DT9A 4FKPA 4B0GA 5J9YA 4EC9A 1V0PA 4QTAA 1Q41A 5DT4A 2HELA 3PSCA 4CV8A 4ZTNA 4EOJA 2REIA 2WQEA 3KRXA 5B2LA 3OHTA 5M08A 1JSTA 4E73A 1OKWA 3DQWA 5AP6A 4MNFA 4IAZA 5AV3A 4CQEA 3BWJA 3M42A 4AGUA 4NM3A 3OUNB 3E7OA 4FOBA 3HA6A 4U43A 1O9UA 4AZSA 3DK3A 4MCVA 4LMUA 4FL3A 3ZDUA 5K5XA 4W4YA 1RW8A 2EWAA 4AN9A 4FC0A 1FQ1B 3HRBA 2YISA 4QMQA 4LGHA 4G6LA 3PA4A 3DAEA 5M07A 4NCTA 3TZMA 3MA3A 5JT2A 4I20A 3DCVA 4HPTE 2I7QA 2G2FA 5KE0A 4D28A 1XMLA 3KQ7A 4C3PA 2B4SB 5CASA 3TG1A 3SLSA 5TO8A 3B8RA 4RRVA 4B99A 2VTMA 2BZKB 5KMMA 3FI3A 1KV1A 1KOAA 3L9NA 2PUUA 2VWYA 3Q9WA 4E5AX 5HD4A 2J50A 2BHHA 3EJ1A 5DT3A 4F0GA 4I0TA 4RX5A 3LJ2A 3MFRA 3V8WA 2KTYA 5L2TA 1CKPA 1R0PA 1F0QA 3LFQA 5GIPE 3DY7A 4YSJA 2ITZA 3IDPA 2Q0NA 2NRUA 5ANEA 5HQ0A 5KMKA 4WA9A 3R1YA 4FUXA 3EQPA 4FV0A 2FO0A 4OTGA 5HVYA 4E5BA 3CE3A 3AXWA 1NVRA 3TJDA 4F6WA 4FV5A 3PY0A 3EFJA 5CY3A 3LXLA 2C6MA 2Y8OA 4FV4A 1KE7A 4LV8A 1OKYA 2R3JA 2XK3A 2X6DA 3PXKA 4I5PA 4IAYA 4IDVA 3P7CA 4AAAA 3VN9A 2PWLA 4OW8A 1KOBA 3EQCA 4I23A 3S00A 4EK6A 2DUVA 3AMYA 1XO2B 2Y4IC 5HTCA 3QUEA 3G0EA 5HE0A 3DDQA 4NM5A 1PY5A 3EQIA 1URCA 3TTJA 3VNTA 4ZLOA 5GJDA 5CEMA 4FYOA 3FHRA 3KREA 5KBRA 3F3UA 4NM0A 3FLSA 5FXSA 4JIKA 4FOCA 3NFGB 1JAMA 5CEKA 4PUZA 2OIBA 2UW5A 3AKKA 3EN9A 3KMWA 3HAVA 1OL6A 3MS9A 4JG6A 5HESA 1XKKA 5J95A 5HG5A 5A4TA 3UPZA 3QQFA 1Q3DA 4KKHA 3TNHA 4FX3A 3C0GA 4C3FA 2PVFA 4I1ZA 4MNEB 2XNMA 3NUXA 2GFSA 4FSTA 4Y8DA 3TNIA 5AUTA 5FP6A 2VTRA 3MPTA 4YURA 4U94A 2WMAA 4NZWB 4MNEA 4QP7A 4CKIA 1P5EA 3QRUA 2YABA 2XK6A 3HP2A 4W4XA 2WKMA 2PUPA 1SVEA 2CPKE 4G34A 3RPSA 2ITXA 3HDMA 4DC2A 3QALE 3FI4A 3ZLWA 5T3QA 1O6YA 3TI1A 3LXPA 4FTMA 5EOBA 5AUZA 1PRYA 3OD6X 4ZP5A 1WCCA 2ERZE 2JFLA 4FSUA 1DAYA 3MJ2A 4LUDA 1DAWA 4R6VA 2CMWA 1MRUA 5L2WA 2C3LA 1H25A 1OIRA 4FT0A 2PVRA 2C3JA 4ERKA 2EVAA 2NYAA 2C0IA 1P14A 4W8DA 4BCQA 4GFOA 5DGZA 4YTCA 3H4JA 2ZDUA 3U9NA 4GG5A 4RVMA 4F64A 4Z7GA 4XHKB 4IAFA 3TT0A 3KVXA 4BZOA 3GC0A 3D5VA 3JYAA 1YHWA 2VWIA 2HWPA 3OW4A 5ETAA 1GZNA 4U97A 3NMUF 1H01A 2YZAA 2IZRA 5E8YA 4CVAA 4M14A 3AC2A 4D4VA 3ENHA 2ERKA 3SXSA 4HVIA 3SA0A 2UW6A 4TNBA 5JK3A 4PQNA 3Q4CA 1WBVA 3OMVA 4K77A 1PXIA 1STCE 5HG9A 3ZFYA 3LCOA 2Z7SA 4MXAA 4XV1A 3O7LD 2PVNA 4EH7A 3WE4A 3FBVA 4ERWA 1B38A 5LWMA 1H1RA 3HA8A 3A4OX 2C4GA 5LMAA 4YJSA 3FLQA 2BDWA 1K9AA 3O17A 3QU0A 2XB7A 4J8MA 4GJ3A 3FMHA 3QTUA 4MKCA 2XM8A 4O38A 1ZYDA 3BHYA 3VVHA 4CZTA 3U4UA 4KSPA 2DS1A 1NW1A 2UZBA 2QG5A 3BGQA 3CC6A 4N4SA 4S34A 5E90A 5FLFA 4I0RA 3T3VA 3NFFB 4IAIA 3BQRA 4FNYA 3QQHA 1ZY5A 2WZJA 5TR6A 4ASXA 1SM2A 3RI1A 4JI9A 5BVOA 3RAIA 2AC5A 2WTIA 2NP8A 3OF0A 3V01A 5EYKA 3OVVA 1XQZA 5CXHA 3ZTXA 4HVHA 1L8TA 1XR1A 2VGPA 1H08A 2OIQA 4BDDA 5ICPA 5GNKA 1BL7A 4O7YA 5HTBA 2XBJA 3EL8A 1MQ4A 3U6JA 3N9XA 3AGLA 3ORNA 3P9JA 3LLAA 4BTKA 4HCTA 4M67A 3VWAA 2UW9A 4IAAA 4RIOA 4YHJA 5EI6A 2VN9A 4AW0A 1FGIA 3E92A 4EL9A 2AUHA 2FH9A 3L8VA 4O7VA 4FKQA 4WKQA 1VJYA 1ST4A 3KFAA 3RKBA 1XH7A 4RX9A 5HG7A 3UPXA 5F20A 4JDJA 4R78A 3BU5A 4FTLA 3COMA 1W7HA 4DBNA 4G31A 3Q4TA 2C6DA 5ACBC 3RPYA 3CGFA 3A7HA 5CEQA 2WMUA 3TWJA 3DT1A 3LFCA 3ZLSA 1LR4A 4DHIB 1GZOA 4BICA 3AC3A 2ITOA 3A4PA 2WTJA 3BI6A 3IK3A 4AA5A 3CBLA 2QONA 3ETAA 5EDRA 4PWNA 4XBUA 5EW8A 2IN6A 2HY0A 3U55A 2YACA 2J6MA 4PF4A 2OIDA 4L9IA 4H58A 4ZZOA 2OSCA 5IH6A 1G8SA 4OT6A 3RGFA 4A7CA 3PIXA 3ALOA 4MBJA 1FINA 3DBFA 1MUOA 2PVLA 3FUPA 4RIWA 5IA2A 3FY0A 4FTKA 5A3XA 4BDAA 3BL9A 5EDQA 5C8MA 4TYGA 3WF8A 5B2KA 1YHSA 3F5XA 5ANGA 5LMKA 2W1HA 1ND4A 4RJ4A 4PNKA 5AP3A 2QD9A 1ZOGA 3OBGA 2A19B 5CU4A 3UGCA 4QPAA 4JR7A 3ORTA 3P7AA 4QQTA 3GI3A 3LCSA 3K5UA 2C5VA 4AP7A 4AZWA 5EHLA 1YDTE 5C26A 2XYNA 4J98A 4NTSA 3SOAA 4JIAA 1ERKA 1YXTA 5DHJA 3NR9A 4TRLA 3LPBA 2VTIA 2HW7A 5EG3A 5AFVA 4BDJA 4C4GA 2R7BA 1AQ1A 1WAKA 3SRVA 3COKA 2X6EA 2XJ2A 3KMUA 3VF9A 3ZC5A 2YM6A 5IEXA 4BB4A 3GBZA 4DEAA 5J9ZA 2F7ZE 3PXQA 4RFMA 2JITA 4AT5A 4YBJA 4WHZA 3V5PA 3HLLA 4RWKA 3WE8A 5KKRC 2PZIA 5E92A 3PXYA 4K33A 3UYTA 1S9JA 3KU2A 4AXFA 4IX6A 5KX8A 4PDYA 2BUJA 4UZHA 5LJJA 4A9YA 1YRPA 2ZMCA 5FUTA 2GTNA 3LCTA 5JGDA 4YLKA 2G01A 5J8IA 4EHGA 4FKTA 3MY5A 4GK2A 3ZUUA 4DFNA 3EB0A 2GFCA 4KIQA 3P86A 2BVAA 4AWIA 4UEUA 3NYNA 4ITHA 4FTCA 3Q6UA 4IJ9A 2P4IA 3E62A 3QRKA 2J0JA 3FLNC 3NUPA 3EQBA 4RIXB 4DFLA 1UV5A 3FMMA 4X6QC 1OKVA 2QLQA 2A2AA 2GU8A 2ZM1A 5HICA 4EHEA 3G6GA 5DPVA 5C4KA 4F08A 2PPQA 3TN8A 3W0RA 1R78A 2V5QA 4H3BA 5AUUA 2WHBA 2RIOA 1V0BA 2WU6A 3OWKA 3T8OA 3WZDA 4J1RA 5EM6A 3FZRA 3QWKA 4JL9A 3TUBA 1GAGA 5FTGA 1Z5MA 2EUFB 3A7IA 3AT2A 4UY9A 3TJCA 3HUCA 3UC4A 3MPMA 5CSPA 3TUDA 2CGWA 4Q2AA 4ANMA 5DOSA 1GZ8A 4AFJA 5CQUA 5JN2A 3BL7A 4QP9A 4I6HA 4QP3A 4YJVA 3FZSA 1GZKA 3DBQA 3NNUA 4Y83A 3I60A 3LW0A 3QFVA 4PNIA 2JEDA 5FD2A 3F61A 4FK6A 1R0EA 2CNVA 3GVUA 1CDKA 3R1QA 4IE9A 3FQEA 3QCQA 1PYEA 2YN8A 2CN8A 2WMBA 3F3TA 3NEWA 1ST0A 4ZTQA 4WRGA 3FMLA 3N51A 5GINE 2C3KA 4Z16A 3FMKA 3NYXA 1OBGA 2WMQA 1WBOA 4APCA 2P0CA 4F1OA 2BALA 5M4CA 2Y6MA 4OBPA 2JAMA 1E9HA 4GKIA 4KSQA 4MQ1A 3WILA 1VLRA 3CIKA 5HLWA 3KXXA 3ORPA 4ANSA 3SG9A 4EC8A 3QQUA 2BHEA 3ZM4A 4C33A 4F7SA 5C4LA 4PTEA 4WRSA 3AGMA 3GFWA 4EOKA 4IZYA 1PXOA 3NAXA 3PPKA 3RP9A 5A4QA 3NIZA 3UMWA 5JEBA 4NJ3A 2C68A 3QGYA 4I21A 2UUEA 5K5NA 1YVJA 3WYXA 1B39A 3BV3A 4TY1A 5CVFA 4O0XA 4RA4A 2PE1A 5IUIA 4D1ZA 5J7HA 3QX4A 1MQBA 1DI8A 2O63A 2R2PA 3L1SA 5FXRA 4C58A 1X8BA 2VD5A 2XNGA 4WNPA 3R01A 3O50A 4E6DA 1QCFA 4AG8A 1XMMA 2B0QA 1GY3A 3POOA 4QEBA 5DR2A 1FMOE 1DI9A 3H9RA 3LZBA 4ZZMA 3H3CA 3TNQB 3KVWA 1PXLA 3BYMA 4C3RA 4IBMA 3H9OA 2ITYA 3UG2A 3CKXA 3HRCA 3PVBA 2R3LA 3VUIA 1WBNA 2RL5A 4V05A 2JDVA 4YNEA 3TZ8A 4BC6A 4F0FA 2G2IA 4BGQA 4MXOA 3IECA 5LVNA 2WIHA 4I6BA 3KCKA 4KD1A 4FK3A 4GT5A 2XK8A 4QMWA 2OO8X 3O71A 1ZAOA 2UZTA 4XP3A 5D11A 4YTFA 4OTIA 5EYCA 4JG7A 3MESA 3UQGA 4R77A 4NKSA 3I0OA 3DFAA 3UJGA 4ANBA 3FPQA 2GS7A 3ZOSA 1JLUE 1J7UA 3D0EA 5G1XA 2E9PA 3F82A 5EKOA 2JDRA 3UG1A 5AV1A 4UYNA 4ZMEA 4LV7A 2NO3A 1YOJA 3FY2A 5L8KA 3QAME 3P7BA 4GW8A 4C4JA 4QQCA 2VTHA 5HX6A 1KE5A 5I9VA 3MGYA 2C6OA 1ZMWA 1ZRZA 2XKFA 3AOXA 3PY1A 3MV5A 3QYZA 4L3LA 4U9AA 3HKOA 3C4FA 5IDNA 2IVSA 3R21A 3ZUTA 5DEWA 4FV1A 4IC8A 4DGMA 1Y8YA 4EH2A 3OG7A 3GC8A 1YWNA 3U6IA 3QXOA 4D4RA 3BWFA 3KC3A 2QU6A 4MUQA 5JMSA 2W1IA 2XRWA 4UXLA 4ZEGA 4JVGA 1V1KA 3JVSA 4P4CA 3LFNA 2FVDA 2VWXA 4QMNA 5AIKA 1Q8ZA 3Q9XA 3W18A 4RBLA 4MTAA 4W4VA 4AT3A 4CG9A 3VJOA 2GCDA 5F4NA 4O7ZA 4F9BA 3VULA 2OJFE 3MTFA 2ETKA 3CTQA 3QGWA 3LMIA 5JGAA 3R8MA 1Q8YA 2YIXA 4WNKA 4EZ3A 2V7OA 1Y57A 3O23A 2C30A 2BDFA 2VX1A 2XNEA 3I5ZA 4LMNA 5FGKA 2R3FA 4IVCA 4BY9E </