3W0WA

The complex between t36-5 tcr and hla-a24 bound to hiv-1 nef134-10(2f) peptide in space group p212121
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
279
structure length
279
Chain Sequence
b'GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWGSLGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 76
structure length 279
sequence length 279
ec nomenclature
pdb deposition date 2012-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w0wA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3w0wA01
5D2NC 5AD0B 2VLLA 2RAMA 2UZIL 1JHTA 1YJDC 2DWEA 2W65A 3QXWA 4XNXH 3WIFB 1ZHLB 2IH3B 5L0QC 2YKLH 2A9MH 5T1DH 5GGRY 1F2XK 2P4AB 3HG1E 3VXUB 2XXMB 3O9WD 5GGTL 4UTAH 1UG9A 3UYRH 2YA2A 1VHPA 4HLZG 1D5MB 4AENB 1VFBA 4TUJB 3LRHA 1J10A 3WJJA 2DQTH 4PLJD 1MJJB 1UM5L 3JWOH 4IBLT 3VDCA 5FDWB 1UJ3B 3WO3B 1AE6L 4MDIB 5JIIA 1GL4B 4Y2OA 5AD0A 2E6JA 1JPSH 4IRSC 5GZNC 4PTUB 1XF5B 4HS6B 3WIFA 1ZHLA 1G9NL 2BOCB 2IH3A 1QBMH 2AGJH 3N0PB 1RQ5A 2EZ0D 3UO1H 1MQKL 1FZOA 3O4LE 1CVRA 1MCJA 3DX6B 4X6DE 5BMFL 5CINH 1OVZA 3BH9B 1GOFA 5FV2A 4XPTH 3VXUA 5L2JB 5LQBH 3OSKA 1JTOA 3OGOE 1KSRA 1OHQA 1CFQB 4K8RL 4LLVB 2GITB 3QXTA 1IBGH 1D5MA 4PRID 4AENA 2CGRL 4TUJA 5IROC 1R3HB 1J0IA 2YZ1A 5EO9B 43CAB 1OARL 5I1GL 4DK6A 1JUFB 5DC0A 3ARBD 1MJJA 1I85C 3GHBH 5FDWA 1UJ3A 5IMMB 3OKMB 3LIZH 4MDIA 4XAKD 4M1CD 4LPXA 5HDLA 4PTUA 1XF5A 4HS6A 1B2WH 2BOCA 4DEPC 4HIEB 1U92B 1RZ7H 1PG7W 4OFPA 3KHQA 1MAJA 3DX6A 1GJIA 3L5IA 2N56A 3BH9A 4HAGA 1ZLVK 5L2JA 1TJHH 2VZ3A 4M6AA 1OAYH 2VXSL 4NKOB 2XWTB 1XGPB 2CO7B 1ZLWK 1CFQA 2LVCA 4LLVA 2GITA 4Y5YB 4O58L 1R3HA 3KR3L 3GBML 5EO9A 1UACL 43CAA 4JR9H 4Z95L 1JUFA 4NNPL 5AZEL 4OFIA 5GRXG 5E08H 2NXZD 5BVPL 3IDYC 5IMMA 1RUPL 3OKMA 3VRLF 3MV9D 4KY1L 5EZOH 3EO0B 4ZAKB 4N0YH 3G6DH 2QQNH 5DD0L 4G9FE 3CSGA 1FJ1B 1DVFD 2NZIA 1BJ8A 4HIEA 4F9LC 1RY7B 1U92A 3DV6B 3QXVA 3SGKC 4ODHL 2XA3A 2DD8L 4HIHB 1BAFH 5FGBA 4NKOA 2XWTA 1XGPA 2G5RA 4Y5YA 5GJTH 3RVWD 4GBXD 1JRHH 1IAIH 4I3SL 4M1DH 3EJZC 1TQCB 1YY9D 4ZO8A 1OPGH 5IIEB 2VLKB 3DPBA 3EO0A 1PKQE 4ZAKA 5IG7B 1FJ1A 4GRLD 3IFOB 1BD2B 5I8OL 4WWKB 1IQDB 4ZNEE 4ZFZB 4I0PD 3DV6A 3CD4A 4G6JH 4M1GL 4WFEE 1UZ6E 3QIWC 1NCWH 4HIHA 4PJ5B 1MFAH 3VWKD 1L7TL 1JYWA 1D5IH 4XPHH 4FABL 2APVA 2WLZA 4GAJL 1FRGH 3REVB 1B0WA 3QWOB 3ILQD 1MAML 1V5JA 1MPAL 1D6VH 1JYNA 3BPLC 1Y6KR 5F70A 5IIEA 2VLKA 4TRPL 3TT3L 4HJJH 3ZDZF 5HGDB 3PWPB 5IG7A 4NOFA 5E24E 3MCG1 5JXEC 3IFOA 1BD2A 4JPKL 1IQDA 1YPZE 2EDFA 4TUOB 4ZFZA 3QI9D 2FX7L 2FX8L 3RAJH 3SDXE 4PJ5A 2YR3A 3FO2B 3FO0L 5L2KB 5TPWL 4L5FH 3REVA 1ZANL 3NGBB 4EZMA 3QWOA 3TPKA 3MBXL 5DRNB 1LO3L 4NQTA 1KTRL 2FATH 1BECA 2Z4QB 1BWWA 3MLPA 1M7IB 2K7PA 2P24B 5HGDA 3T0EA 3PWPA 5IHLB 4PFEA 3S3SA 1OF2B 1JHKL 4JFDD 3SY0B 1YJDL 3L1OL 4TUOA 4QT5B 3I6LD 3O2DA 2Q3AA 1Q0XH 4KI5E 3O6FB 1AC6A 1LE9B 2VN7A 4LSTL 4S11A 4HS3B 5F93C 4OZGB 3FO2A 5I6XB 3PWVB 4LRNL 3B5GA 5F3HB 5DWUH 4OI8A 2NTSP 4OZGF 5L2KA 2WW8A 3CFCL 5C09D 5LVEA 4WY7L 3IDJB 5IFHL 4FFWC 4P59L 5DRNA 2I07B 3FKUS 5E2TL 2KDGA 5KSBB 2Z4QA 1CN4A 1M7IA 2P24A 2UZIH 4XVTH 4NQXB 4IMKC 3W0WE 1OF2A 3EKCA 3KXFB 3SY0A 1T22B 3J8F7 1N5YL 2C4FU 3I50H 3QT2A 1A1OB 3MCLH 4QT5A 5IB1B 3HI5H 1OGAD 4NT6B 5J12C 1N2RB 1CGVA 3O6FA 2QQLL 4I3RH 1CIUA 3TC9A 4YHKL 4HS3A 4J7RA 5GGQL 3ZHDA 4OZGA 2GI7A 3PWVA 1NMAL 5J4MA 1HH6B 5F3HA 3DXAD 2MKLC 3LS4L 1MFBL 4MNQD 3IDJA 4KMQA 1U8IB 2I07A 4U2YA 5F96H 2GT9B 5KSBA 4G6ML 2BP3A 2R0ZH 4QGTA 5D7IE 5JDJA 4NQXA 4JGJA 3H9SD 5D5MF 1VACB 4OUUB 3KXFA 4M48L 1T22A 1G9NH 4OGXH 4HIXL 5FGCB 3MUY1 5K9KB 1A1OA 2VWEC 4N8VG 4N90E 5IB1A 4CVZB 4NT6A 3IB4A 1N2RA 4FXGB 4P3DB 4PJXB 3WSQL 4HUVB 4K8RH 1A9EB 1HH6A 4PJXF 3PDGA 3UZEA 4OD2B 2BOBB 3K2UH 4HPOH 3B6SB 1U8IA 4K7FB 3LH2H 5E5UB 2GT9A 1MI5D 2C3VB 4P46B 2NY6C 1WWBX 1EEYB 1BJ1J 3CU1A 4FFEX 1FO0H 4GSDL 4P49A 1TQBB 1I3GL 4EI5D 1VACA 4OUUA 1FORL 5DD5L 5I9QC 2H45A 1XR9B 1JWUB 4PJ8D 5K9KA 3PGFH 3VGEA 1UEMA 4PREB 1J1PL 4CVZA 4POZD 1V3MA 1RIUL 3MRHB 3RIAK 4MNHB 4FXGA 4Z7UE 1AR2A 4P3DA 3O4LD 1UKSA 4PJXA 4NN5B 3SKUD 4HUVA 5EOCJ 2ICES 1A9EA 4K8RD 3TCLB 1V3KA 4O58H 3N1FC 1EFXB 2XKUA 2B2XH 4F2MB 4OD2A 2BOBA 4Z95H 5A1AA 3B6SA 4TOYH 3GRWH 4NNPH 4K7FA 4Y4FD 3SDAD 1HCFX 5BVPH 2QKIB 2AEQL 2FCBA 4OCXH 2C3VA 3M8OL 4P46A 1ZLUK 4MD4B 1EEYA 1VEMA 1KTLB 1OTSD 1P84K 2BFVL 5DD0H 1N26A 1TENA 1XR9A 1JWUA 4BZ2H 3X3FH 2D7OA 4PREA 5TE7L 1FAIH 2BDNL 4EIZC 5JZ7D 4FZ8H 4IHOB 3K74B 3RPKA 3T0VA 4ODHH 3MRHA 3MRBB 4MNHA 3BFOA 3BT2H 4JHAL 1DFBL 3KYKL 3TCLA 1I9EA 2F5BL 3UCRA 1EFXA 4OZFB 4F2MA 4NWUL 1RUML 4I3SH 1RURH 2IFFH 4NNYB 3IU4L 5K9JL 2A6DB 3EW3B 4HBCL 4Z7QE 1J7VR 2QKIA 3H3KA 2DLFL 3IDXH 4MD4A 2CKBH 4N0RA 5E8DH 1KTLA 1Y6NR 3ZE2F 2BNUB 1N64H 4GRMB 2R15A 3QDGB 4TNVF 2HT4D 1X4YA 1AI1L 1K8IB 5JOEA 1JZ4A 2P43B 3MUZ1 4IHOA 4DUXA 2R29L 4M1GH 3MRBA 2IQ9L 4K3HA 2A0LD 2MCPL 3P11L 1E4WL 3F8UB 4HZAA 1DBJL 3BX7C 4OZFA 4GAJH 4LKXB 4WIQA 4K3DL 5IW1B 2FHFA 4NNYA 1ZVSB 2A6DA 4HWBA 4Z7VB 5IOPB 5DLMH 2DQEL 3H7LA 4FQJL 4XBGB 2BNUA 4GRMA 3QDGA 4EVNB 1TVHB 3EDFA 3WNOA 1K8IA 4LASL 4EN3C 1KB9J 1QRND 4JGMA 2Z92B 2V17L 5GGUB 4OLWH 1SYSB 2X9WA 3O6KH 4WFED 4HH9B 12E8L 1PQZB 5EU4B 1REIA 5CEZL 5GRVL 5LCVL 4LKXA 1OD9A 3QRGL 5E6ZA 5TPWH 3RI5K 5IW1A 5ADPL 2E27H 1SM3L 3FN9A 1ZVSA 5C6TL 1BF8A 4PJDB 4Z7VA 3LAFA 1WICA 4PJ7E 5IOPA 2NTFB 4PJDF 5CILL 2JCCB 3BP4B 1TJGL 1T03L 2MPAL 2EXWC 3FCTB 4XBGA 5DUML 3BP5B 1YEEH 3WXVL 4EVNA 2XNAB 3FJTA 1TVHA 3CLEH 3W82A 5IMKB 2ZP0T 1JPGB 1YJDH 4WI5A 5KZCD 1VFUA 3EDKA 3MBED 3MQIA 1KC5L 2Z92A 3GM8A 3GMPB 2DLIA 3LPGA 5GGUA 3B9KC 1J86A 1SYSA 3VXRB 4OQTA 4N9GB 4HH9A 1L4IA 1PQZA 1KELL 4LRNH 5EU4A 4IJ3C 4NQEB 1NLDH 3CFCH 3T2NL 4DFIA 1AQKL 3HLAB 5HI4D 5GJSL 5JHLH 2AEIT 4P59H 4YXHL 4PJDA 1U8LB 1L9NA 3C8KB 2NTFA 2X4SB 2JCCA 3BP4A 1RIHL 1XGTB 2CLZB 3FCTA 1DQDL 3BP5A 5D70L 4ZTPL 3IFPB 2FO1A 2XNAA 5IMKA 4ZOAA 2DLTA 1JPGA 1FE8H 4LCUB 5DJDB 3THML 2I9LB 3GMPA 1EHNA 5CJQL 4D9LL 3VXRA 3AM8A 4N9GA 3VA2C 3TH2T 1RUKL 4JHZA 4KI5D 3NOIA 4KGJA 1L7IH 4NQEA 1MFBH 5FUCE 5HHPB 1B0GB 4QRUB 3BGAA 2BZDA 3GO1H 3HLAA 4CN4A 1R6VA 1LGVA 4OB5H 4ZXBC 2B7DT 2RQ8A 1U8LA 4DGYL 3C8KA 2X4SA 4G6MH 4PP2B 2GY7B 1XGTA 2C4FT 2CLZA 1IEHA 1RULH 4RFOL 1A6WL 4KUCD 4XP6L 1U8QB 3VE0B 3IFPA 2AJYH 4NBZB 4LCUA 5DJDA 4HIXH 2QQQA 3T09A 2I9LA 3VJ6B 4XWGL 1TZGH 1WZ1H 5GZOC 4R97C 5ADOL 4CMMB 2XYCA 3P73B 4CU6A 1QG3A 2AXJA 4OJFH 2NY2B 3BMWA 5HHPA 1B0GA 4QRUA 4L8DB 4FOMA 1NUFA 1I8MB 2RB8A 4PP2A 5C0AB 5DZLA 1U8QA 4H26B 3VE0A 3M07A 1JNNL 3QJFB 4U1IB 3CFEB 3BDBA 5IJKA 3C08H 1U8PB 3VJ6A 5I8EB 3O81A 4AQ1B 4GKZB 4V1DB 2E9WA 1M05B 2P7TB 2Q6WB 5C6WH 4CMMA 5DD1H 3P73A 3QJHB 4N90D 1T7YA 4LIQE 3SCMC 1HI6B 1NGXB 2CDEB 3VD5A 3FAXA 3DHJA 4K71B 2VDMH 4L8DA 3EJJX 4NHUE 1I8MA 2VO5A 5DA0B 5C0AA 3F58L 3VG0L 3S37X 1EERB 3WCYA 5IVXB 5GGSB 3N9GH 4H26A 3H9HB 5IVXF 3QJFA 4U1IA 3CFEA 1PY4A 5KVMC 1U8PA 5I8EA 1QQDB 2BDNH 4NC1C 4GKZA 4NNXB 4G8GE 4V1DA 1M05A 1YZZA 2P7TA 2Q6WA 3QJHA 5ISZB 5TJWK 4KK6C 4JHAH 1N3NB 1PGRB 3QUMB 3KYKH 1HI6A 1NGXA 4YFDB 4XCCH 5F7YC 2CDEA 1BFVH 4W4OA 1UADC 2K7QA 3OKEB 3TYGL 3IU4H 5K9JH 3TGXA 1BM3H 4U1HB 3V0VB 3EJZD 4LPVA 3WS6C 2DLFH 5DC9B 3DLQR 5IVXA 5GGSA 5IB4B 3U30C 3H9HA 3PXJA 2VL4A 3EZJB 1J0ZA 4MAYC 3MRGB 2YA0A 1QQDA 2KQMA 1MWAH 2Y36H 3Q5YA 1J1OL 4NNXA 2D7TL 2XIDA 2Y06L 1KBGH 3ISWA 5ISZA 1CFVH 3TVMC 1N3NA 1T66C 3VI3F 5JOPE 3QUMA 4ZUUB 3P11H 1DBJH 1XZ0B 5KOMC 2AQ2A 2VTFA 5C71A 2NXYB 3OKEA 2CR3A 4LLDB 4AIZB 1OQOA 1ZK9A 1ZKAA 2Z93B 4KQ3L 4U1HA 3V0VA 5BV7B 1I9RH 4OM1H 2OSLB 3D0LB 3W39B 3HPLB 2R23B 4OKVB 4XMPH 5DJ2B 4YHLL 4FQJH 4RWHA 4DCQB 4KTDL 5IB4A 2JTDA 3ETBF 5C9KA 5F89B 3MRGA 4OLYH 4MJIB 1E4KC 5EO0B 2V17H 4EOWL 3BSZH 4RGNE 2H1PL 1UWXH 4ZUUA 2FD6L 1CQKA 1FIGH 3E6FB 5BRZE 1XZ0A 5F88B 2UZXB 5ADPH 3MLTB 4KTYA 2GYSA 4LLDA 5C6TH 4AIZA 3E6HB 2DLGA 2EKJA 2Z93A 2ERJB 2OSLA 3D0LA 1CDGA 4NQCB 5CILH 3W39A 3HPLA 2R23A 4JY6B 4JREC 4OKVA 5DJ2A 2B8OT 5HHQB 2MPAH 1T03H 4DCQA 3CLFL 5F89A 3L5HA 2OI9C 2AJZB 4PJ9B 1IGTB 5EO0A 4X6FB 3NIFF 3DUUB 1U8JB 3GI8H 3VFNB 5JXAL 1CLOL 3TP4A 3ZTJH 2ZKHL 3E6FA 2E7LA 5F88A 1H3GA 4N1CA 1YA5A 4F7CB 4GAGH 4YJZL 3MLTA 1EVUA 4YXHH 3E6HA 3JWDC 1LO2L 3VD3A 4FFWD 2R0LL 4NQCA 4JY6A 5HHQA 4DGVL 1RZIB 1WZKA 4OIAA 3ZZ1A 4HWEH 1DQDH 5C2BL 3CFIC 3ZE0E 3H3PL 4WEMB 1WSST 5HHVL 2AJZA 4G3YH 4PJ9A 4IIQB 1N0XL 1IGTA 3U36B 5I1JH 4X6FA 1KXTB 4OIIL 3DUUA 2O26U 4HXBL 1CDJA 1Q0YH 1U8JA 5CJQH 3VFNA 4D9LH 5CLWA 2J12B 5F21B 2DQIL 5B8CB 1OT1A 1SBBA 3IGAB 3SJVD 3OBAA 3CFKB 4F7CA 4OCYL 4NUGL 5ENWB 4E41B 3ABZA 5C0CE 3D6GA 3GM0A 4DGYH 4P4KC 1QKZH 1NAMB 4HHAB 1RZIA 2R39A 1J5OH 1A6WH 1JN6B 2HYMA 2YUVA 4XP6H 4YX2H 4XCNB 3BJLA 2VAJA 3D85D 5E03A 3P30H 5C0NC 4MXVE 4IIQA 1JFQL 3U36A 5C08B 2OL3H 1CD8A 4M43L 3QG7H 4FFYL 5B8CA 1CLCA 3WBDA 2JIXB 4JY5L 3IGAA 3CFKA 5I15L 1JCKA 2WSKA 3CDYA 5JW5B 5ENWA 4HS8L 4E41A 3SKJL 5IESL 4IOFC 4D9QE 1E28B 2WAHA 3BO8B 4JRXD 4Y19E 1NAMA 4MQTB 4HHAA 2WBJC 1JN6A 1NAKL 4UI2A 3WE6B 4DK3A 4XCNA 2H2SC 3FQWB 5A3ID 1P9MC 2NY6D 4J12A 1JNNH 1PYWB 4P5TC 2EH7H 3FB8B 4NC1E 2XTJB 1JGLL 5C08A 3BKMH 5I17B 3ZO0A 2VL5B 2JIXA 5DT1H 5GS2H 4LIQH 2J8OA 2KL6A 5D1QD 1I7ZB 5SWZD 4U1NB 3VA6A 4GQPH 2VXTL 5JW5A 4LVEA 4MNGE 1E28A 2CK0L 3CPLB 3BO8A 4PJIB 2GSIB 3O9WB 4R4ND 2LU3A 2FSEB 5E7FA 4ZS7L 4PJIF 2CQVA 2NY7L 3WE6A 1OAUL 3FQWA 1A14L 4XB7A 1MJ8L 1PYWA 4XPGL 4X99B 4J4PC 4NC2B 3D3VE 3FB8A 4N8VB 3GJFA 5DVLA 2WV3A 4L4TE 5B3JF 5I17A 4PV8B 3NAAL 1Z6JT 2VL5A 4LGPB 4JHWL 2BY1A 3NBNA 1S3KL 1I7ZA 4U1NA 5IHBA 4CU7A 4OF6A 3I2CL 4DN3L 1T83C 1EEQA 2OP4L 2D4DA 5I2IB 3CPLA 3QHFL 1FL6B 3QP3A 4PJIA 4XP9L 4KRMB 2GSIA 3O9WA 5TDNB 3MCKB 3UPAA 3V0WL 1CBVH 2FSEA 4GRWF 3R1GL 1WLHA 4R7DB 4M8VA 4PRIB 3BRFA 4X99A 1IGFH 2VR5A 2ORBL 3C2SA 3ARBB 1J1OH 1KEML 4N8VA 5HVWA 3TNNB 2D7TH 2Y06H 4NPYB 1XF1A 4G8GD 2Y6SC 4WV1B 3RTQC 4PV8A 1Q1JL 2JJTC 1UA6H 4JB9L 1BVZA 4JQVC 3QEGL 5JUEL 4YFEA 4LHJB 3LB6C 5I2IA 1SVZA 5TDNA 1FL6A 3NIDE 3MCKA 3O2VH 4ODTL 3GJEB 5IVOA 3LEYH 4YHLH 1A1MB 4WHCA 4ORZC 4PRIA 5GS3A 4YC2B 1HYSD 1M1SA 5C6PB 4F7EB 5FUOL 3ARBA 2R9HC 2OJEB 2NY4C 3TNNA 3SN6N 2NXZB 3WKMH 4EN3D 4NPYA 5I8KH 1JRHI 3MV9B 4WV1A 1IAII 4JRYD 1GVIA 2ZG1A 2ZPKL 2EDHA 5JOPD 1DVFB 1QBAA 1EO5A 2YD6A 1NANH 4H20H 3WIHH 5EBGA 4I8DA 1EAJA 4ZG1A 2AJVL 1PW3A 3UJTH 4Z5RB 3JWDL 3GJEA 3SKOB 5F9WB 1A1MA 1A7QL 5C0DB 5HYQB 2O5XH 3CLFH 4GBXB 1IGIL 4F7EA 1TFHA 2MHAB 1NGPH 2GJZB 3MRDB 3RX5A 1JZ7A 1ODAA 2OJEA 4DZBB 5F9OL 3AAZB 3MV9A 1JNLH 1F4WL 4DVRL 4HIJB 5GGVY 2VDRL 3MGTB 1IQWL 3B9KD 1H3UA 3PWNB 4RGND 4GRLB 1DVFA 1ACYH 4KK5C 4RIRB 4GJTB 4I0PB 4Z5RA 3NFSH 2R0LH 4J3TA 4U6VH 3VWKB 1NBQA 1J8HE 3SKOA 4M62L 4DGVH 1U6AL 4HPYL 3ULUE 5C2BH 5C0DA 2IANE 5HYQA 4WGVB 1PVHA 4GBXA 1MCCA 3G9AB 4OLXL 1B6DA 2HLFC 2MHAA 5I1IL 2GJZA 1A64A 2VZSA 3MRDA 5HHVH 1N0XH 4DZBA 4KRLB 2BNRD 4OIIH 4IS6B 5K59F 1KJ2L 3AAZA 1BREA 4HIJA 3MGTA 1LO4H 3E3QE 1FPTH 3PWNA 5T5NG 3BESR 4GRLA 1CDCA 4Y2DC 3NH7H 4R90L 1TETH 4HCRL 4OCYH 4NUGH 4RIRA 4I0PA 1JGDB 1I9IH 1G6VK 1QFWL 3QI9B 4GXVL 3UAJC 1KOAA 1ROWA 3VWKA 5DJXB 3ZTJG 2J88L 4RGMB 4W70A 1NCDL 4HG4K 3GB7B 3DJ9A 4FQXD 5KJRL 5L7XH 4PLOB 1NEZG 2FYYB 4IS6A 3T0WA 5SWQB 1ZWIB 2DS4A 1G7MB 3PGDB 5GZOD 5EA0L 4KROC 5MI0C 4LCCB 4JFDB 3EUUA 1ZMYA 4QHLB 2B5IB 3SKJH 4LSUL 1JGDA 5I1CH 4R7NB 3QI9A 4GXUN 1UQSB 2QHRL 2IPUK 3TFKC 5DJXA 5C0CD 1IGYB 4QOKD 4LLYB 1RIVH 5JQ6L 5C09B 3LS5L 2ILLA 2V7HB 1JI2A 1A7PL 5DRZB 3GB7A 5EBMB 2FYYA 5AWNL 1JGLH 4TNVK 5SWQA 1ZWIA 2XZZA 2ICWJ 4LVHC 5DGRA 4JKLA 1G7MA 3PGDA 4JFEE 2IWGA 1FCCA 3QQ3B 5MERB 5JW4R 2I27N 4LCCA 3NIGE 4JFDA 4Y88A 2Y9RT 3SCMD 2W92A 4QHLA 4KUZL 1VDGA 4YDLB 4R7NA 1OGAB 1UQSA 4KK9D 3RA7H 3GKZA 4I77L 5EG6C 2J5LB 5IQ7L 2WANA 4LSSH 4JPIB 4D9QD 4Y19D 3DXAB 1IGYA 4UBDC 4LLYA 4OLZH 5C09A 4MNQB 2V7HA 4OFDA 3NACH 5DRZA 5EBMA 5FYLH 3IJHB 1X5FA 5HHNB 3PHSA 5B3NA 4TSCH 1Z0MA 4MS8D 3QQ3A 1NSNL 3H9SB 2CMRH 5MERA 4KK6D 1ZVHA 1NBVL 3MYZA 1KB5L 5C3TA 3I2CH 4LPCA 4JFZL 2J8UE 1OGAA 3E8UL 3VGAC 2Y72A 1G1YA 2VR9A 1P69B 1AC0A 4JPIA 3R1GH 3CMOL 1V7NL 4U1JB 2FDBP 3DXAA 2YA1A 3QUYC 2QADD 5KSAD 4MNQA 3H42L 2XFXB 4J2XA 1WGOA 3LQAC 3S36X 4DKEH 3IJHA 1KEMH 4X6CB 3DVFA 1S7XB 3BPCB 3OJMB 5HHNA 3MJ9L 1MI5B 4O4YL 3KG5A 4FXKB 4X6CF 3RZWA 3MROB 3H9SA 5DVMA 4EI5B 2XICA 1J1XH 5JUEH 3QEGH 4PJ8B 1B6UA 1FFOB 1MY7A 1IEAB 2JJUA 3AMKA 3GSRB 3BMVA 1MRFH 4Q6IC 4NJAL 5SX5H 3BKYL 4HGMA 4LVNB 5E6ID 4XX1E 1JL8A 3O4LB 4X6DB 2HMIC 3L9RB 2ZSWB 1BHGA 2DMKA 4U1JA 4X6DF 4MAUL 4P2QE 2XFXA 1X4XA 1XH3B 1VB9A 1DZBA 4Y4FB 3O6LH 1P1ZB 4N8CL 4X6CA 3SDAB 2A2QT 1S7XA 3BPCA 1MI5A 2DF3A 3MNZB 4FXKA 1F3JB 2VIRB 1FO0B 4U7SA 1EHLH 3BGFB 3MROA 1WWWX 3KWWB 4EI5A 1MRCL 2HT3C 3V7MA 4PJ8A 4Z7WB 2J2ZA 1FFOA 3I6KB 1IEAA 4NJ9L 4Z7WF 3GSRA 4XNYL 1BQSA 2AJVH 4XPBH 3NABH 2AVGA 4HUXB 2DTSA 5HGHB 1DLHB 3JWDH 3O4LA 4X6DA 5F7FA 4RWYL 1IL1B 5LJYH 3L9RA 2ZSWA 1QZ1A 1A7QH 3EO9H 5KVFL 1MREH 3WFZA 1XH3A 1H3PH 1T4KB 3DBXB 5GPRA 2EE3A 4Y4FA 1P1ZA 5E2UL 3SDAA 5F9OH 5HHXH 4NFBA 3MNZA 1F3JA 2VIRA 3OG6B 1F2QA 1FO0A 3ILPB 3KWWA 1EHXA 1JZ6A 3GI9H 4Z7WA 1UB5B 5FXCH 3I6KA 5BO1L 4RMUA 4EQ2A 3VW3H 1L6ZA 5C3LD 3OJ2C 3WJJC 3CAFA 4HUXA 5HGHA 1DLHA 3BRDA 1IL1A 4M62H 2QSTA 3ZT7A 4PRPE 3OXSB 3ULUH 1VGEH 4IDJL 1D6EB 1T4KA 3KHOA 3TM6A 1QA9B 3DBXA 3GRWA 2X7LB 1UKTA 3T0AA 2E6PA 3MA7B 4HBQA 2ZUQB 2CKBB 4G8FB 3ILPA 4JFFE 1M6OB 4GG8B 1PKQB 1M7XA 3W2DL 4OUOA 3N1GC 1UB5A 4R90H 1HCVA 2Q7YB 1Q8MA 1QRNB 1A2YB 4HFWB 3GBLA 1QFWH 4JJHA 1JWMB 1MCLA 2WIMA 4MDJB 4XT1C 3SE9L 3CFBB 3S36H 3OXSA 5ECJE 3EDEA 5HYJE 1J8HD 5JR1L 1LEGB 4YH6A 3ULUD 3FN0L 1RZ8B 1D6EA 4BQBA 5C8JB 3VMOA 5CGYD 1QA9A 2IAND 5KBNC 5DJ0B 3DRQB 1NCDH 2DJSA 2X7LA 3ZHKA 1JZ2A 4OCLC 3MA7A 2C1OB 2CKBA 1J0KA 4G8FA 3F6LA 4Y16C 2EECA 3MC0A 5LWYL 1M6OA 4GG8A 1XIWC 1PKQA 4OLVH 2Q7YA 1EO8H 5KZCB 1QRNA 3LZFH 3MBEB 1A2YA 4HFWA 1YPZB 3I02B 4ZNEA 1JWMA 4JPVH 4D94A 1U2HA 1YPZF 4MZ3A 2DQCH 4IOFD 4MDJA 3CFBA 3SDXB 2QQKH 1Y6MR 5E8OB 1Q94B 1LEGA 3DUSB 4HEPG 1RZ8A 5C8JA 1H8NA 2A77H 2VUYA 1A7NL 5DJ0A 3DRQA 4LQFH 1C5DB 2UY7A 5I19L 4NRZB 4YBHA 5ITBH 3DX8B 2C1OA 2OXGA 5DJ8B 4H0GA 2EXYD 4AJ0A 1A5FL 3GZKA 1ZLSL 3T4AB 4ZTOH 2VJXA 1ETZB 4OI9A 4H88H 1LK3H 2P8LB 4Y5YC 5E4EC 3DTXB 3MBEA 3PWJB 1YPZA 3I02A 3VXOB 3C5SB 4DQOL 3S35X 5IQ7H 2J4WL 2JK5B 5A2FA 1FDLL 4FHBD 3FMGL 3SDXA 3MLRH 4CADB 5E8OA 1Q94A 4U05A 5F9JB 3AS0A 3DUSA 3EJYC 4JM4L 1BBDH 4QWWC 2VLRE 1IJ9A 1QSEE 1C5DA 1JYXA 2EDTA 4NRZA 3V0AC 3LQAL 1MHEB 2XQBL 4XHJC 4J4PD 3DX8A 3U7YH 5DJ8A 5J13C 2CJUH 2BSTB 3OKOB 3T4AA 1NSNH 1T1YB 1ND0B 1ETZA 1S9XB 5K93A 4F8QA 3CU7A 2P8LA 4KUCF 2NY3D 2WBWB 5HHOE 5LBSH 3DTXA 4Z76B 3PWJA 1KFAL 3VXOA 2AQ3A 3EYQD 3C5SA 4G6KH 4ELME 1TQCC 2JK5A 2HFGL 4JGUA 3K0WA 4JN1L 3DSFH 3KLSA 3W11D 3A6BL 4CADA 2H2PD 5F9JA 3OKDB 3HR5B 3PHQB 1G6RL 4XMKL 4YWGH 3FQTB 1LHZA 1MHEA 1QFUH 3FONB 3MJ9H 4O4YH 2BSTA 3OKOA 4JQIH 4YHYB 6CGTA 2D7NA 5I1HL 1T1YA 1ND0A 4OZIB 1S9XA 3IYLW 5CLTA 4OZIF 4Z76A 1AXTL 1QFOA 4WI2A 1BBJB 5CSBA 4DEPB 3LB6D 2AEWA 4P9MH 4JCMA 1IZKA 4BUHA 4ENEC 3HC4L 3ET9F 3U0WH 3OKDA 1I8LC 3T0EC 3HR5A 1A7OH 2IMNA 4JPWL 3BRGC 1KN2H 3PHQA 4ZSOE 2XKNB 5IROA 2XZQL 1JGEB 1G7QB 3FQTA 4N8CH 3FONA 1DLFH 1RZGB 5A2JH 1I85A 4QTHB 2R9HD 5CWSB 2NY4D 4RAHA 3IDYB 4OZIA 3BUYB 4Y4HC 1DUYB 3OJVC 3V52H 1Z9SA 3CDGB 1WIUA 3BEVB 3RGHA 3REWB 3T08A 3U4EB 1HDMB 5JIHA 3NGBC 1S7WB 5DD3L 1BBJA 4XNYH 4RA3A 4PGBB 4LQ1A 5CHNB 3OPZL 2OR9L 5EIQA 4PR5B 4C56E 2XKSA 3ARTA 4Z7UB 2W1NA 4WRLA 2PETA 5CJ8A 2XKNA 4U1LB 4OZHE 1K4CB 4XNUL 1A0QH 2OR8A 4P2QD 1NCAH 1JGEA 1G7QA 5E2UH 5TDOB 1RZGA 2GY5A 4QTHA 3D9AH 5CWSA 4EUPG 1MLCB 2G2RB 2W0LA 2IJ0C 3BUYA 4PG2C 1DUYA 1X5HA 2WNGA 3CDGA 4KKAD 1U8HB 3BEVA 3U4EA 3REWA 1HDMA 3MJGX 1S7WA 5CS7A 3CXDL 2VDQH 4PGBA 2KKQA 5CHNA 4PR5A 5IQ9B 3U1SH 3SGKA 4RA0C 3MA9L 4Z7UA 1P7QD 4M3JA 4QNPE 1JPTL 1IC5L 4WTWA 4U1LA 5ID1B 1K4CA 5C0BD 3IFLH 4OI7A 2DOCA 4E42B 5TDOA 2NNAB 4UV4H 4OLEA 3LY6A 5DMGD 1MLCA 2EYTB 3BPLB 2G2RA 1A9BB 5F6IC 4Z7QF 3W2DH 1F90L 4GKSB 2BSSB 1U8HA 5MHSD 4DZ8B 4QF1B 5AAMA 1K9TA 3UMTA 4A2LA 3PABB 4NO2B 5IQ9A 5HSFA 1LDPH 1OSPL 2QEJA 3SE9H 3P9LB 1J9CT 3N85H 3HNVL 2XOTA 4PRPD 5ID1A 3R8BB 2EC8A 6FABL 4E42A 4XI5C 2NNAA 4BJLA 4BQ8A 3EYVB 1FG2B 1ZXQA 5E2JA 3QYCA 1GPOL 2EYTA 3BE1L 1P4LB 1A9BA 4WTXA 2BXYA 4GKSA 3CZJA 2BSSA 2V9TA 4N9OB 2WWKO 2DMBA 4DZ8A 4KROD 4QF1A 3WL9B 3LV3B 1CLZH 3PIQB 1HIMH 3PABA 4NO2A 4DVBB 2DIJA 1K3IA 3P9LA 2UUDK 4YK4B 3BP7B 4MQSB 5JA8B 1TQBC 5HYJD 4K2UL 1A7NH 1FFNB 5I19H 3OG4B 5KVDH 3EYVA 3QUZC 1FG2A 2F15A 4PJ7B 1A5FH 3NZ8B 1P4LA 1AD0B 1BF2A 4NN5C 5C70A 4HV8B 2IEPA 4HJ0C 4Z8FL 5I71B 3LKOB 3WL9A 5CGTA 3LV3A 2IGFL 3PIQA 1MCRA 4DVBA 3DX7B 4M9PA 1CE1L 4UNTA 4WUKL 5J12B 1NCBH 3EDJA 3SJVB 1FIEA 3RWHB 3BP7A 5HBBA 1JPFB 3C2AL 1K3ZA 4UBDD 1FFNA 3U4AA 1S5HB 3PNWB 2XQBH 4HXAH 1NEZB 1RHHB 2FLBT 1DDHB 2ZCLL 1U0QA 4PJ7A 3NZ8A 1E6OL 1AD0A 4QXGH 4XPAL 4DW2H 3D85B 1FH5H 4HV8A 1YEHL 2YPVH 3VXQB 4JZJC 5J1SC 3LKOA 4O2EB 2FL5B 5KS9E 1I7RB 2FWOB 4ETQB 3KJ6L 4P3CH 5EIVA 4JFYB 2ATPB 3DX7A 1OB1B 4XNZC 3PP4H 3OAUL 3SJVA 4BZ1H 3RWHA 1R5VB 4LNVA 4BH7B 4PD4J 4QYOB 1JPFA 4KV5E 4RRPG 1GRWA 3SO5A 2O93L 1S5HA 3PNWA 3ZE1E 4RMTA 4ZODA 2QHLA 1WBYB 1TDQA 1NEZA 1QLEL 1IARB 4JRXB 1QSED 1RHHA 4KHXL 3QB7C 1FNSL 1DDHA 4TYUA 5BCAA 2ED7A 4NZTL 5I1HH 2ADGB 2NY6B 3D85A 2Y1VA 5GSVB 3Q3GB 1OAXL 3VXQA 4O2EA 2FL5A 1AXTH 1I7RA 2FWOA 2YRLA 5I9QB 3ESVF 4ETQA 1S9KC 5HHOD 4F58L 3I9GH 2VNCA 4KQ4L 4JFYA 4JO2H 1MCSA 2ATPA 1DN0B 1OB1A 4D9RE 2KPNA 3JBG7 1MCDA 4O9HL 5DK0B 1R5VA 1MSPA 5D1QB 5SWZB 1B4JL 4ISVB 2HMID 4BH7A 2ICWI 4QYOA 2WQ8A 4CBPA 4YQXL 1SY6H 2XZQH 1WBYA 2E7CA 4JRXA 4CL7A 5F9DC 5B22A 2PKDA 2ADGA 2X4PB 4P2RD 2NPLX 4RCAA 5GSVA 3Q3GA 3RWCB 5CSZB 5T3ZL 4EQ3A 3T0BA 1K5NB 1QO3A 2VUOA 2EKSB 2OX5A 1H3WM 1R0AH 4HC1H 4HQQL 2OR9H 1X3DA 3QHZL 5GS0H 1X6NA 1DN0A 1RPQA 3P0VL 4HEME 4PGDB 3P40A 2BC4B 5DK0A 5L8JB 5D1QA 5SWZA 4ISVA 3KLDA 4QXUH 3BXNB 1FNLA 4Y1AE 3LKPB 1CDHA 1BPVA 2HJFB 2FEEL 3LRSB 4XX1G 3K4ZA 4LF3B 2X4PA 4ZFOL 2HRPL 3RWCA 4PUBH 1KENL 2O5ZH 5CSZA 5GRUL 4KRPD 5TDPB 4I0CC 1NC2D 1K5NA 2EKSA 5CJBA 2ZUXA 2JB5L 2ICWB 2AJ3B 3UJJH 4G8GB 3IF1B 1HHGB 5C7XL 3MA9H 2OMNA 5C86A 4PGDA 4C56D 2BC4A 3M45A 3P9MB 2BJML 3EFDL 1CK0L 3RIFF 3BXNA 4Z0BH 1JMZA 5E7BA 3LKPA 5KANG 1PEZA 2HJFA 3LRSA 3VFRB 3BW9B 1GGBH 4LF3A 4ALAH 4D0CB 3CIQA 2PYFB 4EBQL 1F90H 5DF0A 5TDPA 2L0DA 4TSAH 2IBZY 1PD6A 2ICWA 5J1AB 2AJ3A 4EN3B 2PTVA 2XPGB 3UTZB 1GZQB 4G8GA 3IF1A 2O61B 1HHGA 4JRYB 2HRLA 3VCLB 1GGCH 3P9MA 2HAZA 1KB9K 2H41A 3HNVH 4RX4D 4G59A 2A74B 5GIRB 3VFRA 3BW9A 5DK3A 4KI1A 2EDDA 1F97A 4D0CA 5D8JL 2PYFA 3O45B 4POYA 4Y16D 5HDBE 5EOTB 1R24B 1XIWD 3OTTA 3O3BB 2VKXA 4W6XB 4MD0B 5ELIA 5HYFA 5J1AA 4PJGE 4EN3A 2XPGA 3UTZA 1GZQA 2XI9A 3H2WA 4XVSL 2O61A 4ONGL 4JRYA 2B1AH 3VCLA 3TZVC 3B9KB 4RGNB 1C1EH 2VC2L 3RQ3A 3VD4A 1S7VB 4K2UH 2A74A 1A4JB 4HKBB 2LFGA 4LCWE 3NA9L 5GIRA 1KCSL 1FGNL 4PDCE 4K7PL 3WFHB 1NEUA 5E8NB 2H6PB 4HT1H 3RVUC 3O45A 4MQ7B 5EOTA 1R24A 3NTCL 2HVJB 3O3BA 4W4OC 2BNRB 3HE6D 4MD0A 1W0VB 4NN7C 4P5KB 1QLRB 2CRMA 1O7VA 4RSVA 1RZFL 1CE1H 3HNSL 3B9KA 3OKNB 4PB9L 1NDGB 4NC0B 1S7VA 2J3SA 1GGIL 3C2AH 2AW2A 1IKFH 1HHHB 1U42A 1A4JA 4HKBA 4QWWD 5EZIL 3WFHA 5E8NA 2H6PA 3K7UA 2CSPA 1MNUL 1EUTA 2X2YA 4MQ7A 5CZXD 2HT2D 5CKGA 2DKMA 3ARWA 3LKNB 3MRQB 5ILTH 1MCOH 3CK0H 2HVJA 1YEIH 4FQXB 2CPCA 2BNRA 4YXLL 1QYGL 3HI6L 5K9OB 1W0VA 1V8HA 4P5KA 1QLRA 1W0YT 3UP1A 1VEOA 4K55A 3WFEL 4EDWL 3OKNA 4OD1L 4R97B 3S3PA 3BJ91 1NDGA 4F37F 5D6DA 2DL9A 5J6HB 3ULVE 4N68A 2EIBA 2A9NH 4WHDA 1HHHA 5DR5L 1F6AB 2CDFB 5FCUL 4QRPE 5IP4A 5C0CB 4KHXH 3FT3B 3MODH 3RGVD 1AHWC 1MHCB 3MJ6A 4QOKB 3JZ7A 3LKNA 3MRQA 1T0PB 1RFDL 1YQVH 5F3BB 3S4SG 4FQXA 2UYLB 2NXYC 5K9OA 4KQ4H 3T1WA 5F6HJ 1UH3A 3CZFB 4WU7B 5BV7C 4PS4L 3FN3A 5IBLD 4R26L 2AJXL 1KCGC 4QTIL 5JO5B 4ENED 3SCMB 5J6HA 1OP3H 3KPPB 4YQXH 3RL1B 1F6AA 2CDFA 1TNNA 1EJOH 3K46A 2C3WA 5C0CA 4FQLL 1AGDB 4Y5XC 3FT3A 3C5ZD 1LO5B 4Y19B 5B38G 1MHCA 4QOKA 3LD8B 4JKPH 5FKPB 3UTTE 5DEGB 5F3BA 3MGOB 1CR9L 5HGBB 4Y4HD 3HZVB 3S7GA 2UYLA 4OD3L 4JANB 4NP4H 5EWIL 1U91B 3NCYS 3CZFA 5EU7C 1D7FA 4NO0D 4WU7A 5LGHL 3P0VH 4JQXC 1U3YA 2ADJB 4D9RD 4U6HB 2COQA 1IAOB 3GBNH 5JO5A 1N4XL 5FHBH 3SCMA 2VSDA 4YHML 3KPPA 3MRLB 4K9EL 3RL1A 5LXGL 3CX5J 2MQCA 4UQ3B 4JKMA 1S9YB 4PJ9C 2APFA 3RVVC 1AD9B 1BOYA 5ABDE 1AGDA 2WY3A 1LO5A 2UZYB 1U93A 2VQ1B 3ZKMD 3AY4C 4Y19A 2FRGP 2EDRA 1I1RA 3QDAA 1T89A 2QADB 4PRHD 5KSAB 4K94L 5FKPA 5DEGA 4AG4L 3MGOA 5T3ZD 3U30B 5HGBA 1SJEB 3HZVA 1QNZL 3VXNB 5E0QA 3V4VH 4JANA 2DTMH 4G6AC 1U91A 2F53E 5E99L 4I2XE 3WMSA 2CLRB 4MS8A 2H3NB 5C7XH 4LVOB 4P3WA 2ADJA 4PJHF 4PRAB 1SBSH 2EDXA 2BJMH 1LO0H 4U6HA 1IAOA 5F44A 3MRLA 5DTFB 3QXUA 4LPUA 3PV6B 4Y1AD 4J3OC 4UQ3A 4AEHL 1S9YA 4F7TB 4IIQC 1AD9A 5E6IB 3EYFB 2VQ1A 1YNLL 1MCFA 3WS6A 1MFDL 5TF1L 3MV11 5KSAA 5B8CC 3FRPG 3D5OF 2R56H 4C54A 1JF1B 1UWEL 3AB0C 1SJEA 3SDDC 4DN4L 1LP9E 3X11B 3VXNA 2E9JA 3QH3B 4M6NL 4X83A 4AL8L 1AQDB 1Z9LA 2CLRA 4GKNB 2HTLC 2H3NA 4NZRH 1BIHA 2L7UA 1CICC 1FN4B 2Q8BL 4PRAA 2VQTA 5C0EB 3FFCE 4JVPA 1GXEA 2EE9A 1VPOH 1D5ZB 5DTFA 4E0RB 5DHVH 4TUKL 4JVWA 1MRDL 5H37G 3PV6A 3O0RL 4KKBD 4F7TA 1FZMB 4X7EC 5E6IA 3EYFA 3VFWB 4LHUD 3MV01 4X4MA 4NCDA 5I18L 5D8JH 3FQXB 4EXKA 3VFGL 2NY1C 5CJXC 2BRQA 1GOGA 5MENE 2FBJH 1L0QA 1JF1A 3CH8A 3BD4A 3X11A 4WI4A 3QH3A 5JW4N 1AQDA 3BPNB 4EJ1C 2OI9B 1AFVL 1E4KA 1RJLB 4GKNA 1FN4A 2X09A 5GS1C 3HAEH 5C0EA 2X40A 1PZ5B 1T1XB 1D5ZA 4E0RA 5H35B 3MNWB 4D0BB 2FZ3B 2YK1L 3L5JA 1FZMA 3VFWA 1JK8B 1DR9A 3Q2CA 4PJBB 2ID5A 1FYTD 4LFHD 4L9LB 4LSPL 5EUOE 4PJBF 3FQXA 3QUZD 1QFWI 2XWBB 3MV8E 1NMBL 1HQ4B 3HTLX 3L5XL 4NUJB 3IDGB 4DGIL 2R4SH 4R2GC 4HJ0D 2E7BA 1CYGA 2OI9A 3GSVB 3OV6A 1T7XA 4AT6B 2CRIA 1DQLL 1RJLA 4KTEL 4PB9H 3CDCA 3VGGA 3RWEB 3ZLQC 1PZ5A 1T1XA 3O3AB 5H35A 3MNWA 2YD8A 2DQUH 4D0BA 2APTA 2QSVA 2FZ3A 3MLXL 5DVNA 4KZDH 4LARL 5EZIH 4DTGL 1JK8A 4YHZL 4LCWD 4PJBA 1U8MB 3UC0L 4AIOA 4L9LA 1MNUH 1J8HB 2XWBA 5DDHB 3LVEA 1HQ4A 4TN9A 4QRRE 1ITCA 4UZGA 5D96B 4NUJA 2IANB 1WK0A 3UEZA 3IDGA 5FYKE 4ODVH 5DQJB 1JTTA 1QYGH 1KCRL 5FYKL 1N8ZB 3GSVA 4QKXB 4LLQB 1KJ2B 3ME0A 4AT6A 2X05A 3WFEH 4K3EL 1ZLVH 2RGSA 3NCYP 4FXLA 1ZLWH 1KEGL 3DYOA 4PGCB 4MXWL 3RWEA 4CDGC 5BV7L 1N6QH 3T3ME 3MLZH 1QACA 2I5YL 3O3AA 5I73C 2VDNL 2Y4SA 1WISA 4RMQA 2X4RB 1CIDA 3ULVH 5FCUH 2DQDL 2Y07H 3ARBC 3ZDYF 4E9LA 1U8MA 3B5HA 3JWOC 1DQQB 4FQ2L 1I8IB 4BELD 2C5DC 4M1CC 1J8HA 5DDHA 1HQRB 1UM4L 3L3DB 2IANA 1RFDH 4GT7A 1MJUL 4BQ9A 1VENA 5DQJA 1N8ZA 2VXUH 4LLQA 4CU8A 1KJ2A 3PUCA 4UNUA 5EU7E 2VAAB 4JFQB 4YE4L 1JGVH 5J06A 4GG6E 4PS4H 1S8DB 2VXQL 4OCSH 5LGKA 5I76B 4PGCA 1DEDA 4M5YH 3VXMD 4YC2C 4S1QH 4FFZH 2X4RA 3QDMD 4AK1A 1BEYH 2R2BB 2Y23A 1B88A 3MLWH 4QRPD 1DQQA 1I8IA 2ZUYA 3F62A 1BVKB 2VDKL 1A21A 1D9KC 5JDSB 2QSCL 1HQRA 3L3DA 3AC0A 3NCFB 4CUCA 43C9B 4D3CH 2CUMA 3S5LG 5E6YA 4PGZA 4TTDC 3F7PC 4X7SH 2R0KL 2VAAA 4JFQA 5CIPH 5LGHH 4YFLI 1S8DA 2YWZA 5I76A 3Q0HA 5F9WC 1ZT7B 2NY3B 5J8OA 2AS5M 4YHMH 3U48A 1X6LA 4K9EH 3B9VA 1NCUA 5LXGH 1KN4H 3ORJA 2Z8RA 1X5GA 2R2BA 1YY9C 4CNIB 1TPXB 4N1EA 1Z9MA 4IMLB 1JBJA 4HW6A 1BVKA 2HKFH 3B2VL 3OX8B 5JDSA 2RBLA 4K94H 43C9A 1CXIA 2D03H 1QNZH 3UTTD 3SQOL 1G0XA 3AS3A 4I0PC 3WLWD 5E99H 3B2UC 3VFPB 1IAMA 3ZTNL 1E6JL 3PP3H 1ZT7A 1JNJA 4GKOA 1KB5B 2UWEF 4XCFL 4RRPA 2IPTL 4ZD3L 1T83A 3GIZL 4CNIA 4OF0A 5HGAB 4IMLA 3D39E 5KANI 1MFDH 5TF1H 3OX8A 4AEIL 3B9EA 3TJEH 3Q1SL 3O6ML 1UWEH 5D2LE 3ZDXF 2C1PB 5DEZA 5ALCL 2V5TA 3BKJL 3QI9C 4NQUA 2NY4B 3MRPB 2YPKB 3VFPA 2F53D 2FEDC 2DKSA 2Q8BH 2X1XR 2Z91B 1KB5A 3G9VA 4RGMC 4JQVA 1MRDH 1N6VA 1INQB 4N0CD 1P4BL 3MLSL 3P9WB 5HGAA 4L4JA 3LEVL 4C59B 1NFDB 5J1TC 3RZCC 3IFNH 8FABB 1NFDF 35C8L 4LCCC 2BRRL 3RJQB 2AK1L 3EOTH 4P2QB 2C1PA 3V6FB 1BFOB 1ULVA 3AXLB 4X7CC 3MJ9A 1DBKH 1FL5B 3H3BC 4LHUG 5F7NC 3ZYIA 3MRPA 2YPKA 3MLVL 3TWCL 4NFDA 1FLRH 3LKRB 5CFHA 5F6IB 1XF2B 3TZVD 3FFCD 3KYOB 5DMIL 4KDTC 5FOJA 4K3GA 1INQA 2HH0H 2WP3T 1O7SA 5MEQB 3L7EB 1GZPB 4S10A 1NFDA 2B0SH 1NLBH 1EMTL 1P7QB 1YUHB 2GK0B 1NMBH 8FABA 3L5XH 5C0BB 4GH7B 3V6FA 4P2QA 2C3GA 1MCQA 1S7UB 5MEND 1BFOA 3AXLA 3O2WL 2EH8H 5BS0D 4ZFGL 4YDLC 1FL5A 5JMRA 2EICA 4KTEH 2A9ML 5T1DL 3GMRB 4CRPA 4P48A 3LKRA 1XF2A 5DQ9B 1GOHA 5CD3B 3KYOA 5E2WH 4LNRB 4C83B 4J6RH 5FB8B 1X5ZA 3MLXH 5F7LB 4LARH 4Y4KD 5MEQA 3L7EA 4YHZH 1GZPA 4POUB 3HAEG 4ERSH 1P7QA 1YUHA 2GK0A 4JHBA 4AQOA 2YRPA 2H32H 4PRPB 5D72H 5C0BA 3TBYB 3MV8D 5HDQH 1JPSL 1FAKT 1S7UA 4WFGE 1PG7L 5FYKH 4YAQB 4L1DA 1T0MB 1QBML 2A73A 2AGJL 3QHTC 3GMRA 3KLHC 4HUUB 3UO1L 1PEWA 2EEDA 1IC1A 4OLUH 5JHDE 5DQ9A 3E2HC 1YYLH 5CINL 4XPTL 1A3LH 5CD3A 2I5YH 3GSQB 5LQBL 4D0DB 4KROB 4HH8A 4LNRA 4C83A 2NY0C 5FB8A 4EXPX 3V4UH 3BIAX 1IBGL 4ZOBA 3NFPB 1HINH 1FSKC 1ZLUH 4FQ2H 5E5MB 4KVNL 3ARGD 1F3DJ 1NL0H 3GHBL 1UXWB 1UM4H 4JFOB 3LIZL 4PRPA 3TBYA 5HYJB 3CFJB 1MJUH 4PJ8C 4QRRD 2QSQA 3W9EB 3EFFB 1B2WL 3HMXH 5FYKD 4YAQA 4POZC 2F5AH 3MV7E 1T0MA 1YDPB 1RZ7L 4YE4H 4LVNC 2GW5A 3SE4A 1MHPL 4HUUA 2VXQH 5L88L 1JP5A 4DKFH 4URTB 2P1YA 4K8RC 1TJHL 3GSQA 1OAYL 4D0DA 1VERA 3DIFB 4PJFE 1N6UA 3NFPA 1W8OA 4OZ4B 4Y4FC 3VMNA 1MCHA 2B39A 3V7AE 5E5MA 2VDKH 1P6AB 3NCBB 1AXSB 4LCIH 1UXWA 4JFOA 1UYWL 5HYJA 3CFJA 4PBWD 4NDMB 1A6PA 4N0YL 3G6DL 1GAFH 3W9EA 3EFFA 3UROR 1YEGH 5JZ7C 2Z35B 1YDPA 2R0KH 1LD9B 4XP5H 1HHKB 4X4ZA 4E5XB 2LU4A 4ZYKB 1BAFL 2D0HA 3PWLB 3CUPB 3RWFB 1VESA 3DIFA 1CU4H 4CN1A 5GJTL 4XC3H 1IC7H 3NA4A 4OZ4A 4NGHL 4Z9KB 4N0UE 1JRHL 4YGVB 4DFHA 3LDBB 1II4E 2W38A 4RGOH 2DM4A 1NC4D 3B2VH 3RVVD 1AXSA 2R4RH 3G5VB 4Y8AA 1OPGL 3D48R 4U1KB 5JOFB 4NDMA 1W0WB 1JMXA 1F58H 4NKQB 2AJUL 3HKFA 2VDOH 3S4SB 4W81A 2Z35A 3JSSA 1QSEB 3ZT5A 1FC2D 1I1FB 1LD9A 3GDBA 1P6FA 4G6AD 1HHKA 2ADFL 1E4XH 1YEJH 4G6JL 4E5XA 1E6JH 3UTSE 3VFOB 1BGXL 1NCWL 4ZYKA 1JGUL 1MFAL 3CUPA 3PWLA 3VXUE 3TT1H 3RWFA 1D5IL 4XPHL 2E7HA 5HHOB 1DQML 4ZD3H 1PLGL 3ZL4H 3GIZH 4YGVA 4BM7A 1IEBB 3RNQB 4ELMB 4JFHD 5MEPB 3BIKB 3G5VA 1D6VL 4BQ6A 4ELMF 5B38B 3Q1SH 5F6HI 4U1KA 5JOFA 1W0WA 4HJJL 3WJLA 1PJ9A 4FQ1L 3S4SA 1DP0A 1PKOA 3K4AA 5J56B 1G6RB 3BKJH 1UB6B 3SDDD 1QSEA 3WDJA 1I1FA 2R0WH 2CUIA 3MRFB 4P2RB 5D7KD 1JNHB 4PP8C 2HTLD 2YSSB 3RAJL 3VFOA 1CICD 1MIMH 4LPYA 5HHOA 3M1BB 5F7HA 3C8DA 3MLSH 4L5FL 3G6JB 2XN9D 1IEBA 3QO1B 3RNQA 4ELMA 3G6JF 5MEPA 1KACB 3BIKA 5B38A 2ZUTA 2FATL 1DSFL 4DJMA 1N7MH 2BRRH 2NY1D 1G6RA 4ZSOB 1UB6A 3V6OE 4I9WE 1V3JA 1EZVX 2VLMD 5E00B 3MLVH 2VN4A 5DFWH 3UJIH 3MRFA 4P2RA 1JNHA 4JKWA 3SO3B 2YSSA 3NCJH 1QP1A 1Q0XL 4KRPB 2Z8WC 1NC2B 5DMIH 3ULSB 3M1BA 2MCG1 4KKNA 4F37K 2K3TA 3G6JA 3QO1A 4OT1H 4XHQA 4HWZB 4MB4A 4MCYB 3O11B 3MRRB 4C56B 4WU5B 1AKJD 3VRLE 4QCIB 1FBIH 4OCWL 4Q9BA 1FFQA 4XVTL 1UH4A 4ZSOA 3P4LA 2P5WE 3T0DA 4OZHB 1KXVC 3O2WH 4ZFGH 5ANME 4R2GD 3I50L 5E00A 3MCLL 3HI5L 5ICYB 2BK8A 1FZOB 4KI5C 4I3RL 4L1HA 5ICXB 2OS7A 1NC2A 1VFOA 3ULSA 5IMOB 1A6TB 4HC1A 2DBLH 1JPST 3VFTB 5TQ0H 4HWZA 4MCYA 4GUPB 3O11A 3MRRA 4C56A 3QQNA 4KKCC 4WU5A 5F96L 3CNKA 1M4KA 3FRPA 4JN2B 4QCIA 4CJ1A 2R0ZL 5IWLC 3QAZB 2VLKE 1BMGA 4GFTB 3KNBB 4OZHA 1PG7H 4Q7DA 4OGXL 1BD2E 5ICYA 4B53A 4Y16B 4WTZG 1XIWB 4PJ5E 5ICXA 4M9OA 5IMOA 1A6TA 4NKDB 3VFTA 3K2UL 1WIOA 1WAAF 2WMPA 4HPOL 3M17B 4WO4D 4GUPA 3LH2L 4KVNH 4YHYC 4JN2A 3B83A 4RX4A 3ZDZE 1FO0L 3KNBA 2G5BB 4BUGA 5L9DL 3AGVA 3ESUF 1BIIB 4WFGD 4Z7OF 3RBGA 3TV3H 4YO0B 1ZGLM 3PGFL 2JKXA 4PRNB 2YD2A 1MHPH 5L88H 4WENB 3FOMB 4OQ1A 4Y16A 4B7IA 4ZUTB 2HWZL 1XIWA 3HC3H 5FUZH 5E4EB 3GSNL 3HE6B 1WAAA 5DMKB 4NKDA 2B2XL 3M17A 4WCYL 3RHWF 4TOYL 3GRWL 3LKQB 4OCXL 1UYWH 4PB0H 5DS8B 2X89D 4F80A 1D9KD 2G5BA 2FNBA 2CRZA 1BIIA 2H9GB 4Y89A 4BZ2L 3X3FL 4YO0A 4PRNA 1FAIL 4NO5B 4TTDD 5T5FH 4FZ8L 3QNZB 5J13B 4JG1L 3FOMA 2OZ4H 3P0YH 3KS0J 4ZUTA 3BT2L 2HJKB 5I1KL 3LN9A 4UOW1 4OZGE 3HE6A 4PG9B 5DMKA 5I1EL 4NGHH 4M5ZH 4X9BA 1OWWA 1RURL 2IFFL 3NCEB 2EE6A 4G80B 4U33A 3DURB 4Z6AT 3LKQA 1EZVY 4U2ZA 1INDL 2JF1A 3VWJD 3IDXL 5DS8A 2CKBL 1UVQB 5SX5K 3QIBC 3TBSB 5E8DL 2GQHA 2YMXH 2AJUH 3A67H 4ODBD 1N64L 3OB8A 4YHIB 1MIEH 2AV1B 2H9GA 5EH1A 4QHMB 4W68A 3KXFE 1UWGH 4Q97A 4NO5A 3RGVB 1IC4H 2M8XA 4GW5B 7FABL 3QNZA 2ADFH 3B2UD 4OV5B 3BHBB 5FCSH 1BGXH 1JGUH 1D3CA 2HJKA 1KCKA 5DJZB 1DQMH 4PG9A 1PLGH 5KS9B 1A6UH 5TQ2H 4H1LH 4NYLB 4YZFF 4G80A 4L8SC 3DURA 2E8YA 5DLML 1UVQA 3N1PC 3TBSA 5E8PB 4FQ1H 3T0EB 3HPJB 1CDYA 1OAQL 4U31A 2PTTB 5D5ME 2ADIB 4YHIA 2AV1A 3RP1A 3FO9B 3S5LB 4NM8L 4QHMA 4KV5F 3C5ZB 4Q2ZB 4XP1H 3RGVA 2AI0L 4GW5A 3K3QA 1HK6A 1B4RA 2FEEI 4OV5A 3BHBA 4OLWL 2FEDD 3O6KL 5IJVB 4Y4HB 5FIEA 5DJZA 5HVFB 1F4XH 3UTSD 1EDQA 4M61B 4PJXE 4X6EB 1KGCE 3BISA 2A6IB 5KS9A 2A1WL 3SGDI 3QEQE 4NO0B 4NYLA 2ZNWA 1S5IH 2E27L 1NFKA 1IAIM 1LK2B 2BY0A 1DSFH 1SJHB 4MMXC 1I8LA 5E8PA 3HPJA 3RZCD 2PTTA 2ADIA 1YEEL 3FO9A 3S5LA 1IAKB 1ZT1B 3CLEL 3UTQB 4Q0XH 2YBRB 1Y18B 3MNVB 3C5ZA 4Q2ZA 1N59B 3ARFC 4NO3B 2AK4D 2YZ8A 4MYWB 4PRHB 3PE9A 5A2KH 1N5AB 2FH6A 3QISA 3MFGB 5IJVA 4Y4HA 4YK4C 4BSJA 2MNUA 4M61A 4X6EA 3OWEA 2A6IA 2PCPB 4GMSH 1NLDL 4NO0A 5JW4Q 5K9QI 4KJPC 4RISH 5JHLL 4ODWB 1OL0A 4L4VD 4NIKB 3CVIL 5T1KD 1KIPB 1LK2A 5HYEA 4OCWH 1SJHA 5KSBF 3FTGB 4Y1AB 2HVKB 5I71C 1IAKA 1ZT1A 4PLKC 3UTQA 2YBRA 1WT5C 1Y18A 1FE8L 3MNVA 4UDUB 1N59A 4NO3A 1CZ8H 4I9WD 2F54D 5EN2B 1CCZA 3U0PB 3JVGC 4PRHA 4ZFOB 1N5AA 1T5WB 4QHKJ 1I1AC 1INEL 4PG2A 1Z2KA 4DWHA 3OMZA 5DFTA 1RZKH 1L7IL 2PCPA 2P5EE 4IRJD 4TTGA 2B1HH 3GO1L 1T7VA 4ODWA 4OB5L 2D7MA 4J3XA 1DBML 1KIPA 3C09B 1RHFA 3ZE2E 3CH1B 3FTGA 1RULL 4HD9A 4Y1AA 2HVKA 3RFZC 2AJSL 2AJYL 3F5WB 3MOAH 4XMLH 1H15B 1F4YH 2P5WD 4LHUB 4UDUA 3QBTB 1RJCA 2VISB 1TZGL 5EN2A 1WZ1L 3U0PA 4ZFOA 2IBBA 5EUKB 2ZCKH 1T5WA 2QLVB 3SQBA 3KLHD 1MVUB 1A3RL 3QULB 4OJFL 3HG1D 3UBXI 5C1MB 5FUCC 2NY0D 2BERA 2F74B 1A02N 3LPFA 5F7WC 3WV0A 2K9UA 3CH1A 5A3IC 4FNLL 2R1WB 3TO2B 3RY4A 5L9DH 3F5WA 1H15A 3N06B 1IZJA 4LHUA 1FYTB 3C08L 1VEPA 2VISA 1A7BA 3QUZB 2A6KB 1ZT4B 4WWKD 5EUKA 1CDIA 5DD1L 5CCKH 2HWZH 1MVUA 1T2JA 5D1QC 3QULA 2H8PB 5F7MC 2VE6B 3GSNH 4XBEH 5HDBF 4YPJA 1TVDA 5FV1L 1WFUA 4KWUA 5DXWA 1ACZA 2VDML 4WCYH 3L3KB 4R4NC 5KSUB 2F74A 4RAVB 3HAEB 4YNYB 4PJDE 4FQIH 3BYTA 2VZ1A 3DSNA 3IJSB 2R1WA 2W9DL 3TO2A 3N9GL 5KVGH 2IC2A 1H0DB 3GEWB 4PRDB 4LCWB 1FYTA 1U2CA 1TTFA 5KVEH 4Y5VC 3BP6B 3QUZA 2A6KA 1ZT4A 1ZOXA 4JG1H 5CZVH 3DMMC 3VDBA 5I1KH 4K7PX 2H8PA 2VE6A 4XCCL 3ZKQD 4JZJB 5I1EH 1C5BH 2XG5A 1NGZB 1BFVL 4NQEE 4NM4H 1UFUA 5D93C 1OWRM 1RSFA 3Q5TA 3L3KA 4UV7L 3BZEB 5KSUA 2BVPB 4RAVA 3HAEA 1BM3L 4YNYA 4PTTB 4XNZB 4O2CB 1INDH 3AU1B 2DDQL 5DUPH 3IJSA 4S1SL 2MOVA 5IGXL 4J23A 1RK0B 1H0DA 3EYUH 2R1YB 2XT1B 4LCWA 4GLRH 4PRDA 4G9FD 1XR8B 2OTWB 2Y36L 1MWAL 4PD4K 3JTTB 3BP6A 5DYOB 1WCQA 1NUGA 1FFRA 7FABH 3V7AG 1KBGL 1CGXA 3MXVH 1CFVL 1CQYA 1XGUB 2GTZB 2PR4L 3WN5B 1GYAA 4JZJA 4UINL 5F1NB 1NGZA 4KJQC 3U9PL 1XCQB 5F1SA 4NKIH 3BZEA 2BVPA 3DARA 1DANU 2DN7A 4QGYA 4PTTA 1I9RL 1UT9A 4O2CA 4OM1L 3AU1A 4Z7VF 3VXMB 4XMPL 1HYSC 3MXWH 3SDCC 1OAQH 5BVJB 3QDMB 4X4XB 3BUTA 4NM8H 1RK0A 5GRYA 2R1YA 4QRPB 1XR8A 4OLYL 5IT2H 2OTWA 1AXIB 3JTTA 5DYOA 2AI0H 5DEFB 2Q20A 4Q74A 3BSZL 3P2TA 1XGUA 2GTZA 3WN5A 1FIGL 3IRPX 5F1NA 1MFCH 2EYRB 2A1WH 3D2UD 1XCQA 5GQBA 2DMCA 5FA3B 5CP7B 3JV0A 3T04D 2X42A 3L7FB 3VXMA 3QO0B 5CSGA 3B9AA 2JCCF 1RZJL 3QDMA 1K4DB 4X4XA 4OGAC 5BVJA 5J7CC 1IKNA 4H1LG 4HUKB 4QRPA 2JELH 2BHYA 4S0UC 3JXAA 2BSRB 5DEFA 4V1DE 2AABH 3GI8L 4RGNC 5KAQG 2EDKA 3UX9B 1ORSB 3UTTB 3QFJE 1S7SB 3SHSA 2EYRA 1KGCD 4GAGL 5L8KB 1GC1H 3IXTB 5CIPB 4JO1H 5FA3A 1KPUB 5CP7A 3S37L 3QEQD 3CVIH 3HB3C 4ZS6C 2GEEA 3L7FA 1TTUA 3QO0A 2DI7A 4HWEL 3QSKB 4LPWA 1K4DA 2G75B 3TF7A 1CGTA 2X1QA 4U7KA 3T0XA 2VDLH 2IPKB 4G3YL 3QXAB 2D9QB 5I1JL 2BSRA 5IFJB 1NDMB 1Q0YL 5C0RH 1INEH 5DI8B 5D6DC 3B9DA 1ORSA 3UTTA 4YBLC 2E9BA 1S7SA 1OTUD 1X5JA 2LAGB 3MMEB 5CIPA 3IXTA 2F53B 1KPUA 1SEQH 4OZFH 5JQHC 3BN9C 1DBMH 1QKZL 4HWBH 4KKCD 1J5OL 3QCUH 2G75A 4XC1H 4YX2L 4IM8A 4JG0H 2AJSH 2NY5H 5EU5B 1DL7L 4FQXC 4LU5H 4ORGB 3P30L 1XT5A 2IPKA 3LMJH 3QXAA 4K7PY 3W0WD 1FCGA 3RUGE 5IFJA 1CWVA 1NDMA 2OL3L 4NN6B 1AR1C 5IUSA 4JE4B 3QG7L 3VI3E 3VMPA 5DI8A 4MA3B 1A3RH 3DUHA 4OF7A 1TXKA 3TN0C 4WVRA 5DHXB 4HDIB 1LP9B 3MMEA 2BSED 3K1KC 2F53A 2P5ED 1ZAGA 3HRZB 3GNMH 3TZVB 2GK2A 5F97E 3FFCB 3NCCB 4FNLH 5AUMB 3VGBA 1I3VA 4N0CA 4JRWA 1YEFH 4UOW0 3ARUA 2KH2B 4LRIA 5EU5A 4ORGA 4AY0A 3TJHC 1HH9B 2YPLE 4LLMB 3F7RA 5J9PB 4MJIE 2EH7L 3I6GB 1CTNA 3BKML 4PGJA 4MA3A 4KDVA 5DT1L 5MENB 3K8KA 1WVZA 4HDIA 3P4NB 4LIQL 1T04B 5BS0B 1LP9A 4MJ2A 4OQTH 2ESVE 1LWRA 2E7LE 3WXWL 4KK9C 2ICEB 3BPOC 3WUZA 4NN7B 3HRZA 4WEBL 3JUZA 3SDYH 3TZVA 3TBWB 1T89C 3FFCA 3LD8C 4DOHE 2W9DH 4TSBL 5AUMA 2R2CA 4OM0H 4Y4KB 1NH6A 4JDTH 3HFMH 1HH9A 4CVXB 2DM2A 3IS0X 4LLMA 4OFYD 1U8KB 5J9PA 3CSPA 5CP3H 2X4QB 4BFGA 4MS8C 3I6GA 3RKDC 2UVEA 2VABB 1MF2H 4PJCB 4N5EC 3MV8B 3RY6A 4NSKB 5MENA 4PJCF 2ZUUA 5FYJE 3P4NA 4WFFE 1T04A 5BS0A 4OBRA 3EOAB 5FYJL 2ICEA 4UV7H 1CBVL 1T5XB 3EIFA 4PJEB 3EBAA 1Z5LB 3TBWA 4FA8A 2DDQH 5I0ZA 2QADC 5KSAC 4UT6H 5ESAB 3H9ZA 4PJEF 1QRKA 3OF6D 4S1SH 1W8NA 5IGXH 4V2CB 2ZUVA 3LPWA 4Y4KA 3QIBD 4J3UA 1EUUA 4YDKH 1IGFL 2IF7A 4CVXA 4CAGA 1U8KA 2NYYC 2X4QA 3ARGB 2EDQA 3AMLA 4TULH 2VABA 2H32B 4LVOC 1AHWB 4PJCA 4WTZA 3MV8A 2MJWA 4NSKA 4QRRB 3MZTA 1UA6L 1U58B 2PR4H 1EVTC 1OD7A 3BIBX 2VDPL 4UINH 3EOAA 1P4IL 3U9PH 1MFEH 4E41E 5E6IC 3SPVB 3D25B 1T5XA 4PJEA 1Z5LA 1QHPA 4KGLA 3O2VL 5ESAA 4G5ZH 3LEYL 5KTEH 1KT2B 3L3HB 2VITB 4XVUC 2CXKA 1IVLA 1YECL 2BVUA 3T2PA 1KYOJ 3DETD 3EAKA 1YNTB 3D1MC 1WQVT 3ARGA 5A16B 4Y5XB 3WKML 2H32A 4BZYA 1AHWA 5FHAL 5I8KL 1BZ7B 3V4PH 3GUTB 4QRRA 4R3SB 1U58A 1YNKH 1DANT 1LVEA 5CBAB 4H20L 3WIHL 4YBQD 1YYMH 3SPVA 3D25A 3K81A 2P8PB 2AKRB 3UJTL 4GG6B 5T33H 2APXA 2I60H 1RZJH 4LSRH 2O5XL 1C8PA 1KT2A 2VITA 3L3HA 4UTBH 4CKVX 2F8XC 3BPNC 3F7QA 4KVCH 1NGPL 4RDQG 1IT9H 3U82B 1YNTA 5CGMA 5IBTL 1NC4B 1RVFH 4JCLA 4Y5XA 5A16A 2VZOA 2XTJE 3ARFD 1HYRC 3CX5K 3V2AR 2ICCA 1BZ7A 1JNLL 5D1XC 3GUTA 3GGWB 1G9ML 4R3SA 4P9HH 1M71B 4IRZH 5HVHB 4B41A 3LSOB 4PRBB 1JJUA 3MFFB 3MACH 5AYQA 3HMXA 1ACYL 5CBAA 4HLZH 1FGVL 3S37H 2P8PA 2AKRA 4GG6A 3PHOB 3NFSL 4KJPD 1L9MA 4L9LC 1OTTD 4JQXA 4U6VL 5J89A 4LSVL 3VD9A 2KZWA 4RZCB 4YUEH 5F7EH 1EO7A 4RMRA 1BQLL 2E9IA 4ZO9A 2JB6B 1J88A 4PLKD 1NC4A 5B3JE 3MR9B 3AY4A 4XZUB 4RMWA 3GGWA 5C2UB 2D31B 1CFTB 2IG2H 1M71A 1LO4L 1FPTL 5IF0B 3LSOA 4PRBA 3MFFA 1I1AD 3SDDB 3AB0B 4AH2B 3NH7L 1TETL 25C8H 3QFJD 3AS1A 2QL1A 1I9IL 3WUWG 3R06B 3LCYA 5I1LB 3RBSA 3PHOA 4GRWE 1CICB 4H25B 5ALBH 4RZCA 4UB0H 3ULUC 3QDJE 3RHWK 3HC0B 2E8ZA 4XGZB 5CGYC 5D96C 1EBAA 5GGSY 4PRIE 1DL7H 2XN9B 2JB6A 2OYPA 5L7XL 3S96B 4FQPA 3MR9A 5D6CB 4XZUA 1BWMA 1WWCA 4X0KB 2D31A 2NY1B 1CFTA 4HWNA 3E3QC 3LN4B 1GH7A 3SBWC 5IF0A 2ZOLB 5D2LB 3SDDA 1Q9OB 3KPMB 4AH2A 2FHBA 5D2LF 4X7DC 4ZMAT 3WD5L 1UCBH 5I1CL 4WW2C 3R0NA 3R06A 5I1LA 1CICA 4H25A 5GS1B 3KLAB 3GFUA 3HC0A 4HF5H 4XGZA 3U46B 5AZ2H 2WUBL 1RIVL 3B5TA 1OSZA 1VKXB 2XN9A 5B21A 2LV4A 2EXYC 1L6XA 3S96A 1CE6B 1AKJB 3GJFB 4QHUB 5HGGS 5D6CA 4X0KA 1FNAA 5CJXA 4S1DC 1FVCB 3LN4A 2ZOLA 1PSKH 5D2LA 1Q9OA 3KPMA 2V2TB 4R2GB 3WXWH 1ZA3B 5FM5M 3GKWL 4R4FH 3RA7L 4WEBH 4X8XA 2EDJA 3TPUB 5EPMB 3IKKA 2Z0BA 4LSSL 5EORH 4NWTH 5GS1A 3AS2A 3KLAA 4IDLA 2IAMC 4TSBH 3U46A 2EDYA 3AROA 4OLZL 1VKXA 2JE8A 3T3PF 5FYLE 5IVNA 3NACL 4QHKI 5TE4H 1UENA 3EHBD 5FYLL 1CE6A 1AKJA 2YPLD 4QHUA 4X9FA 5JLZB 4MJID 4TSCL 4FP8H 1JHLH 1FVCA 2NY3C 2OJZH 2XQYG 2CMRL 2P44B 5GS2D 3DMMD 1F6LL 2V2TA 3EYQC 5FYJH 4LDEB 1ZA3A 3K80A 4J3SA 2ESVD 3WFDH 1TPXC 3W11C 3TPUA 5EPMA 2H2PC 1NGQH 4NRXB 5I73B 3FHQA 1R5WB 2Q1EA 2XTLA 4WO4B 1IE5A 1X5LA 4DKEL 4U0RB 1F4AA 1U3JA 5CJOL 3TH3T 5K59E 3PV7A 5EOQH 4IOIB 5JLZA 4C58B 1YC7A 1Q72H 3QA3B 5ITFB 3OXRB 1AGCB 2VDPH 1J1XL 2HP4A 1P4IH 5FYJD 3EZ8A 1SQ2N 4WFFD 5AG9A 1CGYA 5DD6B 4KJQD 2CDGB 1MRFL 2MKWA 4NRXA 4PP1C 3VI4F 4ONOA 2FECI 4F57H 1NAMH 5BZDB 4FZEL 1R5WA 1YECH 1CL7H 5TE6L 3SDCD 4WO4A 2F9BT 4TQEH 3O6LL 3WNNA 4FRWA 2RCSH 1U3ZA 4IOIA 4M7ZC 3HHRB 2Y25A 5FHAH 1D9KB 3QA3A 5BW7C 5I16B 1EHLL 5ITFA 3OXRA 1AGCA 5GGVH 1DBBH 3IU3B 5DD6A 2NX5E 2CDGA 1OAZH 3I6LE 3L6FB 4XPBL 5HD8D 3NABL 1HZHH 1KJ3H 1FNGB 4F3FB 4P5MB 1PX3A 5BZDA 3EO9L 2APBA 1MREL 2PN5A 3DX9B 4APQD 2OMBA 3EYOB 5C09E 1H3PL 3BZ4B 4OGAD 4M7JH 3ZKNC 1NBZB 2C4XA 4J3WA 5IBTH 5HHXL 1KLFA 1R3IH 3VWJB 3KJ4B 2X89A 1D9KA 3C87A 5JW4M 1G9MH 1X5AA 5I16A 2ZSVA 4KKAC 1G7IB 3RWJB 3IU3A 3QZWG 4LLWB 3GI9L 4BSVB 3F65A 5BRZD 4JO4H 4O5LH 1FGVH 3VW3L 2ZG2A 1OAKL 1MH5B 3L6FA 4TVPE 3D0VB 1IM9D 2ITDB 4LSVH 1SMAA 1FNGA 5IV2B 5E8EB 1S7TB 2IFGA 4P5MA 3HB3D 4ZS6D 4F3FA 3MTRA 3MUHL 5HHME 5CD5C 1S9WB 1EX0A 3FOLB 3DXAE 3DX9A 3ULUL 1VGEL 3EYOA 1BQLH 3BZ4A 2XZCL 4HGWB 5FDYA 1NBZA 4N0UB 1SJVA 5DMGC 1PDKA 3VWJA 1I1YB 4Q9RH 1EV2E 2WUCH 2PXYC 1JF5A 4KDWA 5FO8B 1G7IA 3ALXA 3RWJA 3H9SE 5EO1B 4LLWA 2P47B 1CD1B 1DJSA 4BSVA 1OGTB 3QG6B 1MH5A 5HXMA 2OZ4A 1FQ9C 2UUDH 3D0VA 2ITDA 3N1QC 4XNQA 5IV2A 5E8EA 1S7TA 3BN9D 4GRWH 4YDJA 3UTSB 3BAEH 5DRXB 3S36L 2M2DA 1S9WA 3UPCA 3FOLA 3EOYG 5FOBB 4F15B 4HGWA 3H9YA 4H1LB 3GHEH 3ZT6A 4N0UA 3TNMB 1YC8A 2V9RA 4X6CE 1I1YA 3SE4C 1MI5E 4NBYB 4MWFB 4GS7B 3RZCB 2HFFB 2YUXA 1AR1D 5FO8A 2BVQB 1F3RB 4H8WH 5EO1A 5KAQF 1CD1A 4OLVL 3HE7C 4AYFA 1EO8L 3TN0D 4KFZC 2AK4B 2YN3A 1T1WB 3LZFL 3WD5H 3HS0B 3CX2A 1OGTA 4OCRL 1H3XA 3DGCR 3QG6A 4JPVL 4Z18A 3TYFB 2DQCL 2VYRE 3UTSA 5DRXA 2CO6B 2QQKL 2A6JB 3K4DA 1UJTA 2WUBH 3QDJD 5FOBA 4H1LA 2A77L 3Q48A 2W07A 4EDXB 4LQFL 3I85A 4L4VB 3TNMA 1A6VL 5T1KB 3TJHD 5ITBL 3C8HA 4MWFA 5TFSH 3RZCA 4ZTOL 2HFFA 1T21B 1ZEAL 2BVQA 1MEXH 4H88L 1LK3L 1T2QH 3KPSE 4GQ9H 4Z7WE 2AK4A 2VSCA 1T1WA 3HS0A 2F54B 5ICZB 3GKWH 4KAQH 4Z7NF 3TYFA 1DQJB 4K23H 3SOBH 2FGWH 4OFKA 5GRJL 2BMKB 3MLRL 2A6JA 3WYRA 1HKFA 3HI1B 3Q6FB 3H7BB 1BBDL 5IHUL 4IRJB 4KDTA 5C07E 4EDXA 3WLBB 4L4VA 3WFBH 4R9HA 5T1KA 4ZQKB 3U7YL 2CJUL 3L5WB 2E3VA 1MLBB 1T21A 3RKDD 3UYPA 4JM2C 4C55A 2EDBA 4LKCB 4N5ED 1BJ1H 3S34H 1NQBA 2P5WB 4U4BA 3SE8H 5LBSL 3V6OA 2F54A 5ICZA 5ANMB 3LDBC 5CEYB 5DA4A 4G6KL 1DQJA 3DSFL 1F11B 5I1AB 2BMKA 3HG1B 3E2HB 5IFAH 1I9JH 5JW3H 3HI1A 3Q6FA 3H7BA 3WJLC 4MA1B 2NY0B 4IRJA 5EOCH 4M3KB 4O51B 3WLBA 1FSKB 5CJOH 5FYLD 4YWGL 5DGQA 1QFUL 2FB4L 3D3VD 4ZQKA 4JY4B 2PUQT 5LGJB 1UH2A 2NYYD 3L5WA 4JQIL 1NBYB 3WNLA 1MLBA 4L4TD 3OZ9H 2CIKB 4LKCA 4XPFH 1KJMB 3L95B 2P5WA 3ZHLA 2EDEA 5LAXB 2EDLA 2APWA 5KSVB 5ANMA 1QRNE 2XRAH 5CEYA 1WEJH 5E1AB 1QSFE 2HLAB 1F11A 4P9ML 5I1AA 3HG1A 4ODXB 3E2HA 1QBLH 5C0IB 3U0WL 3F7VB 1IFHH 1A1NB 1A7OL 2WK2A 4FZEH 1KN2L 2YD1A 2BVOB 3FB6B 5TE6H 4FFVD 4O51A 4N8PA 4XVUD 1H3VA 2OXHA 1DLFL 4JY4A 5LGJA 2C9AA 1MY5A 1NBYA 5FO7B 3N50A 3TLRA 2ZG3A 2CIKA 2V5RA 4X80L 1KJMA 2IQAB 3L95A 3V52L 4NZUL 3SEPA 2J6EL 1KIRB 5LAXA 2F58H 5KSVA 2B4CC 2NR6D 4WWKA 1HKLH 5E1AA 5EULV 4R96B 2HLAA 3QUXC 3FQUB 4XXCA 1E4JA 4GLRI 4ODXA 1J0YA 1GCFA 5C0IA 3F7VA 3GSNB 5DK2B 1A1NA 4OIBA 2BVOA 3FB6A 2HTKC 5D7JC 1X7QB 2R8SH 2LVEA 3ECBB 3PP3K 3RX7A 1A0QL 1CLYH 3L3JB 1NCAL 2YHGA 4YHNB 4WHTB 5EU6E 3D9AL 5FO7A 3SO3C 4KRPC 5D1XD 2IQAA 3C6LD 5D2NE 3S35L 1KIRA 3IETB 4G9FB 1EPFA 1J87A 4OF8A 2BHUA 5GS0C 1OAKH 1ZTXH 2VDQL 4R96A 2NX5D 1UM6H 3FQUA 2LAAA 3C60D 3U1SL 2PW1B 3V79C 4TVPH 4X98B 3FB5B 3S97C 2DAVA 3NFNB 1C5CH 3GSNA 5DK2A 2WM0A 1I1CA 3LN5B 4NRYB 1X7QA 2XZCH 5BXFB 3ECBA 2Q3ZA 1ADQL 3IFLL 3L3JA 4LDOB 5DMJB 1JZ3A 1XGYH 4YHNA 4WHTA 4MA8H 4UV4L 4QRTB 3S6CA 2FGZA 3LQMA 4B7LA 3IETA 4G9FA 2HG5B 3PWUB 3QCVL 1T3FB 2R2HB 1IM3B 3SGJC 4BK4A 1LE9A 2BHZA 2PW1A 1LDPL 3H8NA 1WFTA 5HYSG 4X98A 3FB5A 4TVPD 2VXVL 3DYMA 3NFNA 3QAZC 5GGTH 1UZ6F 3PJSB 3LN5A 3D2UB 3N85L 3P3YA 4NRYA 5HHMD 5BXFA 2LE9A 4X9HA 4AM0B 4G9DB 1H9VA 1UZ8B 3ARZA 1E27B 4G8IB 3GSOB 1VSCA 4RDQF 4CN6A 2DQGL 2MFNA 1UM5H 3QPQC 1WF5A 1AE6H 4QRTA 3I3BA 4OZIE 4LCYB 5D5MB 3ZKXB 3OKKB 3BQUD 3R4DA 5E94B 2HG5A 3PWUA 1T3FA 1B0RB 2R2HA 1CLZL 4OCRH 1IM3A 1JWSB 1HIML 3VU2A 2KUTA 4FMFA 5A40E 3WNPA 1JZ5A 1MQKH 2SEBB 5BMFH 3PJSA 1HHJB 5EU3B 3D2UA 3SDXF 1QUNA 5IEHB 1EJ6A 1T0NB 4AM0A 3QEQB 2CGRH 4G9DA 1A6VH 1UZ8A 4G8IA 1E27A 3JTCA 1OARH 3GSOA 5KVDL 1OP5K 5HY9B 5I1GH 4HX1B 3H0TB 1MVFA 3BD3A 2DM7A 2VZTA 1ZEAH 3FO1B 1NUNB 5ID0B 4LCYA 2YWYA 5D5MA 3OKKA 4S1DD 3HE6C 1X5XA 5E94A 3LRGA 1B0RA 1H3TA 4YEEA 2NZ9D 1JWSA 1KJVB 3WUWB 5GRJH 4UT7L 1QFWM 4M7LL 3CSYB 1NCBL 2SEBA 3WFCL 1HHJA 5EU3A 3HA0A 5ESQB 2VXSH 2IAMD 4KI5F 5IHUH 5IEHA 1T0NA 9CGTA 2BVEA 3QEQA 3KR3H 3GBMH 4XWOD 1UACH 4GO6B 4HXAL 5HY9A 4HX1A 5AZEH 3MLYL 5CZXC 2HT2C 3H0TA 3I3EA 4WI8A 3FO1A 4QXGL 1RUPH 4BA8A 4JFED 4DW2L 5ID0A 4KY1H 3IRZA 4ETYA 4X7FC 1FH5L 4RBPH 2YPVL 3W0WB 5AAWA 3IAQA 1CXLA 4XH2B 3KPSD 4P3CL 4P2OC 1KJVA 3HZMB 3WUWA 4X8JB 4OGYL 4QY8B 3VG9B 3CSYA 1ONQB 3PP4L 3RX8A 4BZ1L 2DD8H 5ESQA 3P4MB 1YMHB 4QRQB 3ALPA 2BVYA 2JJVA 3PGCB 3GSUB 3X13B 2P5EB 1EIBA 5DFVC 5C07D 1RJYB 1JIBA 3V5DB 1VFAB 3RGVC 5BQ7B 2FB4H 5IWLA 3QUKB 5D7IB 1ORQB 4FS0A 3W0WA 5D7IF 3S3JA 4JJ5B 3QQ9D 4KMLB 4XH2A 1R3LB 3I9GL 5I8OH 3WEXB 3HZMA 4JO2L 4OCMC 4UIKL 2B4CL 5IBLC 4X8JA 3NN8B 4QY8A 4GW1B 1ONQA 4HLJA 4PGEB 1BQHB 3P4MA 1YMHA 4QRQA 1L7TH 4PP1D 2FLRT 1MFNA 3PGCA 3GSUA 3X13A 1SY6L 4FABH 2P5EA 4ZPVB 3C5ZC 1RJYA 3V5DA 5BQ7A 1VFAA 3ARXA 1C7SA 5IBUG 1LQSR 2B20A 1MAMH 1MPAH 1D5XB 3IDMB 1EHAA 2Z31D 3QUKA 4TRPH 3TT3H 4X80H 5D7IA 1ORQA 4NZUH 2J6EH 4JJ5A 3KYMB 1R3LA 4JPKH 1CGUA 1R0AL 3WEXA 4HC1L 4U3XA 3CJJA 3NN8A 5E70A 5GS0L