3W1AA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with 5-halogenated orotate derivatives
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with 5-halogenated orotate derivatives
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 108
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w1aA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w1aA01
4LW7A 5LSMA 3DKJA 3VCRA 1BKSA 2RDWA 2YCEA 1FY6A 1G4TA 2CLEA 3T44A 4BI5A 5EA9A 4GE8A 3KVKA 1O5KA 2ZZ3A 3N14A 1RQHA 1A50A 1FDJA 2DZWA 3T40A 1P0NA 4FEZA 1AK5A 2X1UA 3UY8A 3T7VA 3NAVA 3NL2A 3HO8A 3OHIA 5CKSA 3NL5A 3I7RA 3AO0A 4ZZ9A 3CHVA 1FWTA 5BNKA 1KFJA 3NQ8A 3B0VC 2BWGA 1AW1A 3LRKA 1KM6A 1DQWA 3TU9A 1JCJA 1LBFA 1LRNA 3DFOA 1LOSA 1I2QA 3A23A 1SZNA 4GRSA 1RQEA 2VEMA 1GTHA 5D2VA 2H8XA 3C2FA 3E96A 3TUUA 3B0PA 4JYEA 4WOZA 4NZJA 3INPA 3WJSA 2NWRA 4AWUA 1A5AA 1EB3A 3EB2A 1TRDA 1KV5A 1XXXA 2E09A 2YPIA 4X9SA 4ADUA 3CM4A 1JRBA 2GUUA 2W0UA 2YR1A 3LDVA 3M6YA 1QOQA 3ABSA 3RLUA 3TSMA 1GQNA 1NFBA 2VFFA 3W1AA 1AG1O 2VKZG 1B4KA 1P0KA 5D30A 4QIUA 3MYPA 1TPWA 1Q45A 3L65A 4NT0A 1JVNA 3PBWA 4WXYA 3CEPA 2QJGA 4HSOA 2W79A 1I2RA 2HS6A 4OV9A 1TV7A 1KTBA 3CWNA 3NYZA 1BTMA 1XUUA 2I14A 4DO5A 5K4ZA 4N2YA 4K7YA 4P61A 2H90A 3SY5A 3TH6A 1QPRA 5KZMA 1P1XA 1SFJA 4O8RA 4FXRA 3KOFA 3W87A 4LTSA 1M6JA 1ICQA 4TMCA 1SSGA 3NPVA 1U5JA 3NL3A 5AHNA 4AWSA 2O7SA 5A8GA 3GXPA 2DZSA 2ZZ5A 1TSIA 6ALDA 3HPSA 3C0JA 2NUYA 5K3VA 4IX2A 3UPBA 2VOMA 1T96A 4JXCA 1S5WA 1SZEA 4KKXA 3EKZA 3UZ5A 5FF4A 3ZWSA 3LTYA 3O6CA 1JUBA 1GWJA 3TK7A 4RR4A 1YPIA 4UNKA 2ISVA 5CZJA 5FF2A 5FEPA 4DO6A 1XBVA 4ICNA 4POCA 1WV2A 2HMCA 1EA0A 4O4VA 3BLIA 1TV5A 1FDYA 4E2BA 3HPXA 3LOTA 4FX8A 1HL2A 4ORIA 2YFNA 3GDTA 1NVMA 1ADOA 4X2RA 1NEYA 3FIGA 1X1OA 2YX0A 5SWUA 3TQ0A 1VRDA 2QCDB 3MI6A 3FYOA 3W75A 5DLCA 3UYCA 1J2WA 2Q8ZA 2Z6JA 1DL3A 2E1DA 2V2DA 3HPZA 3LTPA 1QMLA 1KFBA 1UBSA 5AOUA 4O17A 1TB3A 4BFAA 1UJPA 5CGQA 3W85A 1G4EA 4PL2A 2OJPA 3EWYA 3KXQA 3QQ0A 3QJAA 4Q4KA 5AHLA 4XBSA 1EEPA 1U83A 3KVLA 2Q3OA 4RJEA 2FIQA 3W23A 3LV6A 2CLMA 5EMUA 1GJPA 2EF9A 4O52A 5HUPA 2V30A 2FPTA 3L5LA 1G4SA 2Y85A 4WY0A 4WD0A 4Y8FA 1B4EA 3CTLA 5D2WA 1GVRA 3KRZA 1QPOA 3EXTA 5C6MA 5D2YA 5FF3A 3I68A 1EUAA 5K2ZA 4JTEA 3O63A 1G6CA 4WY0B 1L6SA 3SECA 2V2CA 2YW3A 1RZMA 1IIGA 1TRIA 2LLEA 4KFPA 3UWVA 2ZA3A 1BWKA 4RK8A 3PSVA 3R2GA 4UFJA 1DQXA 4ZMGA 1VQTA 4NNCA 1BWLA 3MBFA 1ZAJA 3BW2A 4ADTA 2AQWA 4YXGA 3W7EA 3P82A 3G1HA 3W7KA 3IVUA 3UWYA 2QCCA 3TC6A 1UUMA 2Y62A 4CNNA 3MWAA 3S6DA 5LNRA 2CLHA 2FPYA 2QCLA 3G1SA 3G3MA 2OT0A 3M44A 3TX9A 2VFIA 5TBOA 1NSJA 3LCXA 4OQVA 1W5QA 4A3UA 1PS9A 3NQGA 3A24A 3Q94A 2WKJA 2AGKA 1OFOA 3FKRA 4KFNA 4BWLC 4UTHA 3P80A 1TV8A 4JGDA 4JTFA 5C54A 3LV5A 3DFQA 2B4GA 3BLEA 5C5YA 2ZRZA 4XKYA 2A1YA 2EHHA 3EXSA 3S42A 3W83A 1MZHA 3N19B 2TMDA 3NXFA 3LCLA 4JDBA 1H7RA 1VYRA 1H7NA 3KAOA 1H61A 1LZOA 3A9IA 3W1XA 2NXGA 2A6LA 4IJBA 3BW4A 4JN6A 3B06A 1IGSA 3A5VA 1FUYA 2DORA 1WX0A 1KV8A 3GIYA 5L9FA 2YSWA 2G5WA 1VC4A 4CQAA 1Q6LA 5CPLA 1H51A 3BG3A 3WJYA 3DI1A 4NU7A 3QZEA 5CPNA 2NWSA 3GB6A 1HTIA 3NL6A 4HKPA 2VFEA 3TJXA 1QWGA 2FJKA 3P84A 5LZLA 4YLWA 4O11A 2ZDRA 5DCBA 4K8HA 3FEMA 4NXKA 4JTJA 2J24A 1KFLA 4IX0A 3EWUA 4FNUA 4ZQOA 1B9BA 3TR2A 1RPXA 1G67A 4AF0B 3C4UA 1I8JA 3V1PA 4AEOA 4FB7A 3HMJG 3U2OA 3W1RA 3QMSA 1W1ZA 1QOPA 3NZRA 1JUKA 1DORA 5G2WA 5CZ0A 3FA5A 2RH9A 1YTKA 5LKYA 1FBAA 2J9YA 3G0UA 3P7YA 2WNQA 2ZA1A 1WA3A 4B5NA 1H60A 1FQ0A 4PH6A 1Q6RA 3DU0A 4O18A 4BR1A 2NX3A 5AHEA 3A22A 1PV8A 1E51A 3FKKA 3EWXA 4RZ6A 2VEKA 1GVOA 2VFHA 3ZS4A 2NV1A 4NJGA 3G18A 1Q3NA 1XC4A 2B7QA 2VENA 4DELA 2Y61A 4O50A 1RR2A 1XBYA 1YXYA 5D02A 1I2NA 4IUOA 2OX1A 1D3GA 1VYPX 5LNVA 1K7FA 3I65A 3H53A 3HG4A 4LVFA 3PAJA 3W2KA 3DENA 2V0TA 4JTSA 1M7OA 4PA8A 1SW7A 3TSBA 4U4MA 1WOBA 2E6YA 1CW2A 5F2MA 1K8ZA 4UFIA 4W9TA 4X3ZA 2QCDA 3QRHA 3L0NA 3O07A 4N9CA 4NNAA 4LOCA 2ZFAA 4HPJA 4O4WA 5AC8A 2Y63A 2ZZ7A 2GQAA 3O8AA 4XWUA 1OFBA 4IMDA 4NXSA 1ICSA 3E9AA 4NVTA 3E02A 5I3IA 1NAL1 3HJZA 3MW7A 3TMLA 3DBPA 3HG2A 3GNNA 3C2RA 3DI0A 3RNDA 4ZQRA 4UTWA 4WX2A 5H91A 1TCDA 1PHWA 1UB3A 2CZDA 3L2IA 3ZWTA 3B0UX 3VNDA 4QNEA 2TPSA 4U28A 1XFBA 1WOAA 3UXAA 3C8FA 1W56A 1XBZA 4YCPA 4A22A 4BWLA 1VHNA 2RHGA 3TW6A 2JKPA 3MJYA 1HO1A 2IQTA 1H5YA 3USBA 3EXRA 5F1UA 4HPXA 3TNOA 1VHCA 3SJ3A 5CG7A 3GZ3A 2QUTA 4MZYA 2BX7A 3BARA 1IXNA 1KTNA 1VGAA 3SZ8A 3BV4A 5D2XA 4XUGA 1ZAHA 2NX1A 1GG1A 3PM6A 4ZQNA 3LX9A 3D0CA 4TO8A 3P8JA 3MI3A 5EKYA 1SQ7A 1F73A 1RQBA 4ZQCA 3KRSA 2CZFA 1JQVA 3HF3A 4JTIA 5CZTA 5D05A 4NJKA 3GX9A 3E0IA 2GJNA 3DKLA 5AB3A 1TQJA 5T26A 1OX4B 1CX9A 4BK9A 3G0XA 1YPFA 1UCWA 3PF3A 1H7OA 1OF8A 5HQEA 3W07A 3CIWA 5HWMA 2TRSA 2FB2A 3W1QA 2ZRXA 1FWRA 3JRKA 1SZGA 3OG3A 5F4XA 1QPNA 2QCMA 1L6YA 2Y7GA 3IV3A 3LXBA 1OX4A 4IMFA 3TFXA 3TMQA 3PY2A 4NJJA 3QW3A 1OFQA 2H3BA 3ABRA 3QPZA 1G4PA 4YCOA 4JTGA 4LVGA 1H7XA 5D2TA 1PIIA 3GDLA 4Q33A 3L0GA 2H8ZA 5I3KA 3Q37A 3W2UA 3NQMA 4DO4A 3W7QA 2CWNA 3W2LA 3BGGA 3THAA 4AH7A 3R5EA 3EWWA 4I9AA 2TSYA 4GWEA 2C14A 4HT3A 3TXVA 1H1ZA 4O1CA 3R13A 1BEUA 1VH7A 3W1PA 4JNMA 4TMBA 4AHPA 4AHOA 3CWOX 3LCGA 3P62A 4LVAA 1ZAIA 2JKAA 2JGQA 2QUVA 2WSQA 4ORMA 4FIQA 1W5OA 4ZQMA 5DY3A 1PCWA 3W1TA 3GR8A 3W1MA 3B05A 4TIMA 4R33A 1R2SA 3OIXA 3G22A 3IVSA 2JK2A 4O53A 3NM1A 4Z1DA 5FI8A 5K9CA 2ISSA 3W6YA 2NXHA 2VC6A 1WBJA 2EPHA 4O19A 3QC3A 4O28A 2XN0A 2V81A 2OCZA 3OBKA 5DN1A 5H2ZA 2WV8A 2WSYA 3CT7A 2ZCGA 3SSJA 2B0MA 1Q6QA 1JULA 2OT1A 3WJXA 1TIMA 4PEKA 3MHUA 5F2LA 1TPDA 5EBUA 1KBIA 1LROA 4JTTA 4Z0SA 1FWSA 4ZQPA 2A5HA 1W54A 5D37A 2P1FA 3P60A 3N2MA 3BK0A 1DVJA 5HJLA 1F7BA 4IQLA 1FXPA 4H4IA 3TFCA 5CPMA 1OFAA 1TYGA 1ZY9A 4GUJA 5HWJA 1N7KA 4EOUA 2C6QA 4QAIA 1KW1A 3FOKA 2FB3A 2FLIA 1S3HA 3VFLA 1K7XA 3W22A 2E5DA 1KFCA 4EF9A 3CPRA 5LHEA 1PCKA 4N9DA 2YFOA 3GKAA 2YDAA 4OE7A 4E38A 1THFD 2QDGA 3F1QA 5AFDA 2CU0A 1K02A 1MEIA 3PC0A 4LUJA 3G1XA 4UTKA 1O5XA 2E77A 5L6UA 2ZRVA 3UPWA 5KINA 3DFNA 4N02A 2ALDA 2RFGA 2PRLA 2VEIA 4RV8A 2WQPA 3L5MA 4JEQA 4LNYA 4MZ1A 1R30A 3LLFA 2CLLA 1PL9A 2RDUA 5KITA 1KBJA 3WK1A 4FF7A 2EKCA 2B7PA 2NUWA 3KX6A 5DCDA 4M6QA 2X2GA 4JTUA 1KA9F 5F2GA 3W73A 1J4EA 1VPXA 4PC8A 4M6PA 2C13A 3RF9A 2P10A 2NUXA 4P2VA 4GJ1A 1F5ZA 1T8XA 4JS3A 4UTWC 3MUXA 4MY1A 1QR7A 1YTDA 4MOZA 3UNDA 3UWZA 1ALDA 3MO7A 4OBTA 4OV4A 3W7IA 2ZQ0A 3M5VA 1IF2A 5AYZA 5TIMA 2A7NA 4AMAA 1KM2A 4JICA 1W3IA 2DZPA 5F2IA 4YL2A 4IGHA 4MLRA 4K7VA 3GLCA 4WOQA 3TAOA 4OWGA 4YMZA 1OFDA 3L0KA 5CZSA 8TIMA 1NF0A 1FCVA 4MFDA 3EWZA 4JTLA 1AL8A 2XN1A 3E12A 5EY5A 1A5SA 2WNZA 3PBUA 3IIPA 4J9JA 1JRCA 1EWDA 4O57A 2QCGA 3W7OA 3IVTA 2DZVA 3UD6A 2E6FA 4AF0A 4QNWA 4MLJA 2DJXA 3LBMA 4UFHA 3TC7A 5G4WA 3W7GA 4CQ9A 3G3DA 3MMTA 4NZFA 3C2VA 5D38A 1LP6A 4AB4A 4D2JA 4LC6A 4EIVA 3HG5A 3QMTA 3N3MA 3S5NA 4TX9A 4A21A 5DXYA 2JKEA 4RX0A 3DHFA 4PCFA 4IMEA 3VI2A 3E49A 3Q58A 4UTTA 5HR6A 4XBKA 5AHMA 3TCEA 3UY7A 1LLZA 3EWBX 5HUOA 4M7TA 1OF6A 2FTPA 1B57A 4LS0A 4HNVA 4JTKA 4R7JA 1W3NA 1OABA 1TPC1 3EX2A 3G1YA 2C16A 3MP5A 1M7PA 4UFKA 3KFTA 1FCBA 4O10A 1EP3A 1A5BA 1QFEA 1K7EA 4IPIA 3QEZA 5DY2A 3W7HA 1CI1A 3MP3A 3I6RA 3O05A 5D04C 5HULA 3L21A 3QQ1A 2HTMA 4MVAA 1H7PA 1GTEA 3B04A 3LB0A 4N9EA 4NJIA 2ZYFA 1IXQA 3S5OA 2C0AA 4UIOA 4QJ1A 1TMHA 1IXPA 3P61A 4WQ6A 3P5ZA 3GYEA 1GVFA 1YDOA 1OFPA 3W9ZA 1DV7A 1VR6A 1LCOA 4DF2A 2QCEA 2DU2A 1JCXA 3NQAA 4ZL1A 2G96A 1FCUA 3PB0A 3SIZA 2KZHA 1DBTA 1W37A 3U8GA 4QM1A 4O0KA 2FQIA 1TTIA 3LRLA 2J9XA 4FIRA 1ZFJA 1K8XA 3G1AA 1I45A 1RV8A 3UWQA 3W84A 4UTJA 2C3ZA 1PHQA 1WQ5A 2VFDA 3AJXA 3FYPA 2VEPA 3M16A 4N9BA 4O1AA 3LHVA 4M5PA 1G7UA 3BPWA 4HNTA 4DQWA 2YW4A 1HO4A 3DAQA 2X1RA 2Y88A 1F6KA 2CLOA 3HBLA 2Y6ZA 3M41A 4TR9A 1KM3A 1C9DA 3STFA 3T78A 3B8DA 1LBLA 3DZ1A 1MXSA 1D3HA 3G1FA 3NVTA 3MYOA 3LCHA 3MHFA 4ZVJA 4HSNA 1D9EA 3N9RA 1G69A 3NQVA 3LHYA 3I7QA 2J88A 3LHZA 4HIBA 1ZENA 4BF9A 3VKJA 5CSRA 4UTIA 2ATSA 4CNOA 3MHGA 1N55A 4CQ8A 5G5IA 3PUOA 2PURA 4QITA 2QCNA 1F05A 1FX6A 3S9YA 1VCVA 3KRUA 2WNNA 5LGZA 1L9WA 4XTIA 5BRBA 1LORA 3M1ZA 3CIXA 4G1KA 4O15A 4R53A 3A21A 5EPDA 4JTHA 3PVFA 3GKFA 4UTUA 3W72A 4JYFA 3NOEA 4M7SA 2QF7A 4UC5A 1UASA 4GUHA 2E5CA 3W1NA 2DZUA 4TU1A 2WSRA 1ML1A 4QISA 3TQVA 2G95A 3STEA 4FNTA 4IOTA 4EVZA 1LLWA 2V9DA 3NA8A 2J27A 1YDVA 1VJIA 3IEBA 1TPH1 1SO4A 1LBMA 4E0CA 5EL1A 1SR9A 3TQKA 3WJZA 3QF0A 4Z1AA 1DKWA 1A5CA 1JJKA 4UTMA 1GYNA 2C19A 4MPQA 4R34A 2QCHA 5D09A 3FS2A 1QPQA 2CW6A 4XQ6A 4Z08A 3N73A 4Y90A 3PB2A 2UV8G 4FNQA 4KFOA 2Z2UA 3R12A 4UTTC 4CLMA 2PE4A 3QFEA 4JIPA 3R89A 1JCYA 3NEVA 1Z41A 1SUXA 3IRDA 5G2HA 1HUVA 3O1NA 1WXJA 3GDMA 5U4NA 1P4CA 3CEUA 2CFFA 4O14A 3W7CA 1VLIA 4L4MA 3EKLA 4MY8A 2RDTA 3UXDA 3DGRA 2ZBTA 4O1DA 1M5WA 1O4UA 2VELA 3Q2DA 3PBYA 3ANYA 3NDOA 5IM51 3W71A 3W7PA 3LCWA 3M9YA 2B7NA 1FCQA 2OZ0A 3LI1A 6TIMA 1ONRA 3W1UA 1QO2A 3LM7A 4GNJA 3LI0A 1DOSA 3HIJA 3QMRA 7TIMA 4UUIA 5D32A 2X1TA 1OYBA 1VLWA 2DZTA 1LDCA 4MZ8A 2FPVA 4MYXA 1QNVA 3BVJA 3S1UA 4JDYA 3R8RA 4PODA 2QDHA 2Y89A 4N6EA 4RXFA 4QSHA 5G1TA 4AXKA 3LGEA 1EPXA 3L68A 5U7SA 4GXMA 5BOOA 3O15A 3WJWA 3SI9A 4UFMA 2Y7EA 1SU5A 1OJXA 1PVNA 4OT7A 1JCNA 1LTDA 2VXNA 4N4QA 5MHBA 5F4SA 1TPVA 3I7SA 1XKYA 3UWWA 2I1OA 4IXHA 3HB9A 3KVMA 3NPUA 1ME7A 1X6UA 2QAPA 4HHPA 4PFMA 1F6PA 4DBEA 1UUOA 2G97A 4ALDA 1JR1A 4JD4A 1OK4A 5K4XA 1ZNNA 1EIXA 4JR5A 1F2JA 3NZ1A 1X8FA 1W5PA 1I2PA 1SFLA 3HG3A 2QR6A 1EUNA 3NG3A 2H3DA 3GVGA 2J6XA 3QM3A 3LXCA 3HGOA 2Z0IA 3G1DA 2ZZ1A 1EX5A 1I4NA 2ZRUA 4RLIA 3O06A 5AN7A 3SGUA 1T0OA 4LS2A 1W5NA 3ELFA 5TQLA 2A4AA 1EWEA 5K9DA 4Y6GA 3L9CA 1DJQA 2GVJA 3JR2A 3DHDA 3WFAA 3NQDA 4DBDA 2V8ZA 1QAPA 2Y7FA 3QSRA 4IMGA 4ADSA 1AW2A 2R8WA 2AAMA 3UQNA 3NQ6A 1HG3A 3L5AA 4JY9A 3WK3A 3SGZA 1KM0A 4S1FA 1SPQA 3GNDA 1X1ZA 3FJ6A 4UMAA 1K3UA 3BGJA 3K30A 4IXXA 5J5RA 4E2DA 1TPUA 1GVQA 1MO0A 1VCGA 4DEFA 2A2IA 2GJLA 3EEGA 1EP1A 3P81A 1SZFA 4NUWA 3GXNA 1A53A 2TYSA 2QAFA 1KM4A 1IXOA 4O0ZA 1LOQA 3RMJA 3NM3A 3ABOA 1LRTA 4UNLA 1GOXA 4HNUA 1IIHA 1XL9A 4PTNA 1G7VA 3VE7A 5FEZA 2GOUA 2A85A 4KWVA 3W7MA 3F4NA 4MJZA 5IBXC 3GAYA 4S2BA 4Z1BA 1WBHA 3TDFA 3W7RA 2Q3RA 2YGYA 4IMCA 4XKYB 5DXXA 2B7OA 1K03A 2E68A 4O12A 2VFGA 3S1WA 3M43A 3W1LA 1JCLA 3UZJA 4FNRA 5CSSA 1T99A 4FXSA 5BMXA 1ICPA 1O94A 4M19A 3ABQA 3IIOA 3TIMA 1OFEA 3NQ7A 4LC8A 2NXIA 1N8FA 1F74A 3FJLA 5LNSA 2EGZA 2D73A 3NPWA 4RZ4A 3NQEA 1SW0A 1OX5A 2E6DA 3C2EA 1OX6A 2CLKA 5DBUA 5FF0A 1VCFA 3W3OA 5LNWA 3MP4A 4GUIA 3W2NA 4MUZA 4JYDA 4RKAA 4Z0JA 3PR2A 1ME9A 2XFWA 3M5XA 2ZTJA 1XBXA 3RFAA 1XI3A 4EF8A 1MSSA 4GUFA 1EP2A 1KM1A 3YPIA 2PC4A 3THQA 2P0OA 3NO5A 4RZ5A 1V7YA 1L2UA 4LV9A 4WJEA 5F4WA 3TXZA 3W7LA 1YXDA 3DXIA 1R46A 5D03A 2CLFA 3QH2A 1S5TA 3W2JA 3GAKA 5KMYA 2A21A 1R2TA 3W7JA 3LCFA 3W86A 5AC6A 3O6YX 2ZA2A 3TE9A 3NR0A 3LTSA 3O6DA 2BZNA 4HN4A 2ZZ6A 3O16A 2QCFA 1FWWA 4LWWA 3FFSA 4JX4A 3IIXA 4NNBA 1YADA 3W7DA 1SO3A 3OVRA 3GDKA 4GC4A 4OGZA 4UMBA 1XUZA 3T4CA 3L66A 3RLVA 2HSAA 5I3FA 3G1VA 5HINA 4MKNA 5E93A 2BLEA 4QQ3A 1TO3A 2JGYA 2ISWA 3VE9A 3LHUA 3TJLA 3H55A 5I3GA 3IGUA 3MBDA 3PULA 4N6FA 1SO5A 5AHFA 4HNNA 4LT9A 5E0KA 1R2RA 2GQ9A 4A2SA 2BXVA 1OYAA 2V5LA 1AW5A 3S1XA 3GDRA 1MEHA 2V2HA 1WYIA 3C56A 5GVJA 4AWTA 3G8EA 1X7FA 1F76A 2X30A 3P74A 1SW3A 4K37A 4LY8A 3NQFA 3BG9A 1W8SA 2R14A 3GK0A 4MJMA 4S2CA 1W31A 3UWUA 3S8HA 1K8YA 5HR7A 2ATMA 4FX6M 2XN2A 3EX6A 4L4LA 2DP3A 4H6KA 4DPPA 2OMAA 1TJRA 1TPFA 1SSDA 5HWNA 2WPBA 2CLIA 3W7NA 1V5XA 4LS1A 5I3HA 1KM5A 5I3JA 3SW6A 4MFEA 1H7WA 2NZLA 2FDSA 4FNSA 3JS3A 3NNTA 3HGJA 2A7RA 2A7PA 5KSWA 3CU2A 4X22A 5A5WA 1H50A 2ABBA 2V82A 3C6CA 4MY9A 3W76A 3LHWA 1VS1A 5HNRA 3TROA 5DELA 3P67A 5AYXA 3WK2A 1LOLA 2A6NA 1JUEA 2I9EA 1B3OA 2YXGA 2QJHA 1GG0A 2H6RA 3G8RA 5BW6A 3U6WA 5CPOA 1W3TA 5FF7A 4C1KA 3OVQA 4LRSA 2GVGA 1XCFA 5DBTA 3DFSA 3LRMA 3PS7A 3S5YA 2WOQA 3HGRA 2YYTA 5AYYA 1OK6A 4CNPA 1ZCOA 2C18A 1TQXA 4LV4A 3CC1A 2Y7DA 3S0CA 1H1YA 1KLZA 2NV2A 4O13A 2X1SA 2PCQA 4FNPA 1JCMP 3W2MA 1W0MA 1Y0EA 1FXQA 2DJLA 1GVSA 3TA6A 5IBXA 1OVDA 1L6WA 5ABTA 4FX7A 1TTPA 1JQXA 3N2XA 1O60A 1KFEA 1Z44A 3PBVA 3LCIA 3KVJA 1MEWA 1QO5A 4XTDA 5LGXA 2R91A 3BLFA 4UMCA 4K6AA 4WY0F 1TPB1 3ATZA 4XZ9A 3STGA 3PG8A 3DFPA 5FESA 1LM1A 4WXZA 1OG0A 3M0ZA 3N9SA 3C3NA 1H62A 4WUIA 3IIZA 1OFRA 4CCEA 1FWNA 3M5YA 3A5FA 4N4PA 4UR8A 4GBUA 4A29A 1W5MA 3BG5A 1S5VA 4DPQA 1GYLA 1WDWA 4K8EA 3IIVA 4O54A 3QW4B 2BTMA 3CQ0A 4NX0A 1KFKA 3C52A 5F1VA 1Z48A 1ZJIA 2Z1BA 3G24A 4BI6A 3M7WA 4LRTA 5G4EA 4IPJA 2A0NA 1HFBA 3DH7A 1GZGA 3EX4A 4BI7A 5J5DA 3NQ2A 2ZTKA 3GR7A 1PE1A 3CB8A 1Z42A 3G0SA 3QSTA 3T55A 2GVLA 2PRHA 1GT8A 2E6AA 1TPEA 4K36A 2V5BA 5LNUA 3OVPA 4UR7A 2O7QA 2YYUA 2C1HA 3DFTA 4K39A 4C1LA 4GFSA 3LLDA 1ZHAA 1YDNA 3NQCA 2R94A 3WK0A 3C2OA 2JBMA 1O95A 2YZRA 4UFLA 3NGJA 4JY8A 4NQ1A 4UCGA 5G1YA 4M6VA 2RKXA 5HMSA 1RD5A 2CZ5A 2QUUA 1OHLA 1XDMA 3OEXA 1H63A 3N34A 3CLMA 3W74A 3F03K 2Z6IA 1YXCA 2EAWA 5C55A 1WAUA 2ZZ4A 4OU1A 2E5BA 1VYSX 4Z1CA 5G2IA 5D33A 4PL1A 3W88A 4YWIA 1C8VA 4JX6A 4MYAA 1YLVA 4H3DA 3B4UA 3W70A 4ONVA 4OHQA 1VZWA 2Y70A 1RVGA 3SFKA 2F84A 1YTEA 2HS8A 2NX9A 4NX5A 1R47A 4RXGA 5DCEA 1ZALA 4CCDA 5K9XA 4ML9A 2W6RA 3RU6A 1ME8A 4RCXA 2Q8LA 1TTQA 4Y96A 2ZRWA 3STCA 1I2OA 3S5ZA 1OYCA 3NPXA 3RK8A 2ZRYA 3IGXA 3KHJA 4FO4A 2J9ZA 3TAKA 3P8IA 3PWAA 4JX5A 2WO5A 3IGSA 4K38A 3F4WA 1LYXA 1AL7A 3SR7A 3B03A 3M5ZA 4UXDA 3LERA 4WZHA 3PG9A 2PRMA 3LXAA 5FEWA 3PSWA 2BSLA 2GQ8A 2ZZ2A 2QEZA 4FHAA 1P5BA 2CZEA 4JIQA 3ZR4A 1DHPA 3QYQA 5AHIA 2GPTA 5EYWA 2DZXA 4GUGA 4DF1A 2ABAA 2C15A 2QJIA 1KLYA 1AMKA 3QPYA 1TJPA 3HGSA 3BO9A 3EX3A 2QKFA 4KWWA 5AC7A 5E1QA 1QCWA 3S1VA 3LBCA 1XM3A 1XDLA 4AAJA 3GXTA 4LUIA 4DF0A 1KTCA 1Q6OA 2WJZA 3C61A 1TREA 3FLUA 4MIMA 3EX1A 4I7WA 4IWWA 5BMWA 3BW3A 4Q32A 4A2RA 1QDSA 1C29A 3HQ1A 3P5YA 3L67A 3HOJA 5FEXA 3OA3A 3V75A 4LU0A 1LRQA 3ZFHA 4DXVA 2FFCA 1NF7A 3M47A 3TSDA 2X16A 3H54A 5C2XA 3ATYA 1J5TA 3LHTA 4AHQA 4EWND 4LVDA 5KZEA 1FDZA 5K7JA 5KTLA 4UTLA 3TW7A 1DJNA 1TTJA 4LVBA 4O1BA 3TV8A 5KZDA 4I7VA 1GPWA 5LHFA 4O16A 4CCCA 4Y9AA 3PUEA 1SO6A 4NJHA 3TKFA 3MI2A 3PUDA 2NLIA 2F7FA 1YYAA 1GEQA 4AVFA 4I7UA
chains in the Genus database with same CATH superfamily
3M0MA 1BKSA 4TXEA 3CGTA 1QK0A 2ZZ3A 2Z29A 3N14A 3CYVA 2DZWA 3T40A 2E8YA 2WQDA 4IJRA 2X1UA 3UY8A 1UD5A 3NL2A 2ZUSA 4H9UA 3NIYA 1RPKA 1RA0A 4MWAC 2Y24A 3KBMA 2V5CA 4P8XA 4PULA 4C6IA 3TR9A 3TU9A 3W0KA 2DVXA 3ZLGA 3ARYA 1E0XA 1M41A 3C2FA 5ABEA 1NQKA 3BSMA 1IR2A 2XH4A 3WJSA 2NWRA 4I5XA 1DJZA 1KV5A 1RY8A 2G8ZA 2E09A 2D1ZA 5C0QA 4X9SA 4ADUA 2BS9A 4IF2A 3M6YA 1QOQA 3TYEA 3M0YA 1NFBA 2VFFA 2QPXA 5E09A 4W5ZA 1DJHA 1IEWA 4H6EA 1J6PA 5CSYA 2OGJA 4DNMA 3CTTA 1TCMA 1TPWA 4NT0A 1JVNA 3PBWA 3CEPA 4Y9MA 4HSOA 2WKLA 1I2RA 4H00A 2HS6A 3FAXA 1GOQA 1RP9A 2VZSA 2QYGA 3EGJA 1KTBA 1BTMA 1MDLA 1UR8A 2VGGA 2I14A 4K7YA 2YJQA 4P61A 3SY5A 3VMPA 3TH6A 1SFJA 2DVUA 7A3HA 1NWUA 4DM2A 1SSGA 2BP1A 1NOWA 3NL3A 4C6LA 1IWBA 4AWSA 1TA3A 1RUSA 3PZIA 3T07A 2DZSA 2ZZ5A 3HPSA 1TV2A 4CD8A 4HCLA 4MNJA 3ZVHB 4GZEA 2VOMA 1V0KA 1SMDA 2QPUA 3DFHA 4JXCA 5DRCA 5ECVA 1OGGA 1SZEA 4CN1A 3EKZA 5FF4A 3ZWSA 3BAKA 3LTYA 4LCSA 1V6TA 1GWJA 3MZNA 1UWAA 4RR4A 2ISVA 5FEPA 3ARXA 3T0AA 2YCLA 4POCA 4NAEA 1WV2A 2HMCA 3H7VA 1EA0A 3E0VA 4O4VA 4HZMA 4AX6A 3LOTA 3WFLA 4AVNA 1QOXA 1FHDA 3R10A 4X2RA 4JKMA 3FIGA 1X39A 1QUMA 4H01A 1AJ0A 3FYOA 3W75A 5DLCA 1J2WA 2BB0A 2E1DA 1HL9A 2V2DA 3W29A 4E5TA 5AOUA 5EMLA 4GPNA 5H6HA 3K5XA 4BFAA 4MJ2A 5CGQA 3W85A 1G4EA 1RK6A 1CGTA 5JU6A 3KXQA 1X7IA 3OZOA 4XBSA 1EEPA 2FIQA 3LV6A 2CLMA 1B3WA 1TV4A 1GJPA 2FTWA 4O52A 2YA0A 1M04A 2GGJA 3CTLA 1V03A 5I6SA 1GVRA 3VA8A 3KRZA 4GGHA 2HRWA 3TC3A 3VX1A 2FDMA 2IKJA 2E28A 3OZPA 4HN8A 1G6CA 4WY0B 2ZC8A 1ONWA 4QEEA 1L6SA 3PTKA 4ATDA 2WKGA 2YW3A 1U30A 2C79A 5D4YA 1JF6A 3UWVA 4Y9PA 4P7OA 5D9MA 2OSXA 4DIAA 3GYCA 3AMLA 4NNCA 4IFRA 1BWLA 1VFOA 3IS4A 4YXGA 5A2CA 3KP0A 3WNMA 3AWOA 1TJ2A 1W9XA 3BWWA 1DQUA 3S6DA 4FAMA 1EQPA 4GZIA 2QCLA 3MKVA 4GKTA 3M44A 4EAYA 2WJFA 4US6A 2VFIA 1Y5VA 4OQVA 4AD2A 1EZ2A 3H7RA 2CETA 1Z89A 5XIMA 1YKWA 2HV5A 3FKRA 4AC1X 3WQEA 4BWLC 5EMKA 3EMCA 1BG4A 3P80A 1TV8A 2FKPA 4OOUA 5C54A 4JFTA 1S3TC 3WBEA 1DJWA 3URBA 3DFQA 5C5YA 1KR0A 1AH4A 1H4PA 4XKYA 1CZ1A 4WSHA 3S42A 3PJTA 1UD4A 2REQA 3BUVA 1E70M 3U2ZA 5XIAA 1H7NA 2OG9A 3KAOA 1DPMA 2A6LA 1HGWA 2PTXA 4IJBA 3SUVA 4IFKB 3E6EA 4J3VA 1XIHA 1KRMA 3OGSA 1XC6A 2RDXA 3ZYZA 1FUYA 1HNYA 2QIWA 3H8AA 1ZS2A 3V4BA 5XINA 3URAA 4CQAA 1M7XA 3BAJA 1DIKA 3POHA 3T0DA 4NU7A 3QZEA 5CPNA 3GB6A 1HTIA 4US5A 4HKPA 2VFEA 3TJXA 4U5IA 1KQYA 4AZCA 3WH5A 4YYCA 4F2BA 4GQ0A 3UEQA 4GK8A 1FWGC 4PSRA 2H9AA 4DUVA 4LBRA 4W8LA 3O7UA 1V3HA 4IQEA 4IX0A 4MDOA 1V3KA 1QT1A 2Z1WA 4FNUA 1CB7B 1BVWA 4WLCA 3TR2A 1Q4NX 1XPYA 1G67A 1FVPA 4C6BA 2W27A 2VYOA 3GUWA 1PJ9A 3V1PA 3TN6A 3DYOA 3PJUA 2Z1VA 3CL8A 2UZ9A 3W1RA 1EF2A 2GDVA 2FZ9A 3N13A 1J96A 4RUBA 1LQAA 1DORA 1JG9A 3VC5A 5I23A 2RH9A 5LKYA 1FBAA 2J9YA 1KKRA 1H60A 3IK4A 4ZTYA 3CT2A 4BR1A 3ZT6A 3A22A 4JHMA 4QCFA 3ARPA 5CXPA 1HP5A 1GVOA 3ZS4A 2X1IA 4MB4A 3R7MA 2GGGA 2VENA 4O50A 1CGUA 1O66A 2ICSA 5I0DA 3P0XA 4CVWA 1OQFA 1RAKA 2O9TA 1O5RA 1VYPX 3TCSA 3I65A 1NJJA 2PTYA 3HG4A 2IS7A 4LVFA 4PA8A 3OIHA 3H22A 2E6YA 5DMYA 2FJUB 3L0NA 4NNAA 2OZ3A 2GQAA 4LNCA 1OFBA 4H6RA 2EPMX 3WQ6A 3APGA 4PMUA 4NVTA 1PX8A 1NAL1 3D5HA 3W02A 3WEZA 3EEZA 5FD0A 3H4GA 1PYMA 3CZGA 4I5UA 4ZQRA 1EC8A 1WO2A 1U5HA 1XRSA 1ADSA 4UTWA 3WLJA 3T2OA 4DJDD 5H91A 2VX6A 1PHWA 3L2IA 1J9YA 3VNDA 4QNEA 3LPGA 1WNOA 3UNTA 3RCYA 4EPDC 1W56A 1HKKA 1J11A 1VHNA 3MJYA 4Y9NA 1HO1A 4MAVA 2O56A 3USBA 2MNRA 3EXRA 4GH1A 1ZLPA 4IM4A 3MMDA 4ZOEA 4H9ZA 3DERA 4WJ8A 1VHCA 5HQMA 3V5OA 1OIFA 3WD0A 2WMGA 3NO1A 4JFUA 3FK4A 1US3A 3F5LA 1EQCA 3SB0A 2I57A 1KTNA 1VGAA 5I02A 4AZHA 5E6ZA 2PBOA 4AIBA 1J01A 3FA3A 3QV7A 2DPEA 1WKYA 1O6IA 3MI3A 5EKYA 5TAOA 3VKBA 1AMYA 1SJBA 3N2BA 3KRSA 4IGSA 3QXBA 4HP5A 1V02A 5CZTA 3I10A 5C9UA 1ZP3A 3GTFA 3E0IA 3UJSA 2GJNA 3BL3A 5AB3A 3ITXA 3TTYA 3W1QA 2FMOA 1FWRA 5F4XA 4V28A 3N6QA 4A35A 5C70A 4IMFA 3PY2A 2XIIA 3QW3A 1OFQA 3ABRA 1XH0A 1FWAC 4O8AA 1UWQA 1H7XA 2ONEA 1PIIA 3GDLA 4C5ZA 1KXTA 4PBGA 3T6CA 1VBGA 2DV0A 2BGSA 2ZVRA 1GW9A 2HBXA 3L4VA 4PUEA 3W2UA 2OLSA 3ERPA 3N6JA 4CD5A 4DO4A 3ARUA 2CWNA 3NO3A 3THAA 4HZ6A 4GCXA 3EWWA 1KBBA 3E5BA 1XLAA 3R6IA 4O1CA 2RGLA 1V0MA 1EPVA 4JNMA 1A0DA 4KCWA 3AIRA 4JKKA 4LVAA 3EMQA 2JKAA 2QUVA 4WGHA 1EYEA 4Q8PA 1W5OA 1S39A 4QFUA 3S46A 1PCWA 4IQDA 3W1MA 1B3YA 2OWXA 3R8HA 2UWFA 1ZBVA 3WH6A 4Z1DA 1DEDA 5K9CA 1PTGA 3W6YA 4ZO8A 2WCSA 3P0WA 4O19A 4DWSC 3LY0A 2XN0A 2V81A 3E3HA 2OCZA 4WVXA 1Y5WA 5M17A 4AIEA 2J7GA 2ZCGA 2QJJA 2OT1A 3KZPA 3GXDA 4PEKA 3ARZA 2DW7A 1TPDA 2AMXA 5EBUA 1LROA 3VNJA 4Z0SA 2YCIX 2PF0A 1FWSA 4ZQPA 1V8EA 3WUGA 3BLPX 5JIWA 4HJFA 1GK8A 3FNDA 4G7FA 4U3CA 5D37A 2PDHA 4V27A 4M1BA 4OTKA 1NWTA 3VAVA 4H4IA 3SCWA 5CPMA 1TYGA 4QE5A 1KW1A 3WD2A 2FLIA 1S3HA 3VFLA 1K7XA 3W22A 1Q2SA 5I00A 4EF9A 1AFSA 4DXXA 5LHEA 2OU4A 3OTRA 2DZAA 2PWDA 3HZ3A 2V69A 3VDHA 4E38A 4UTKA 1O5XA 4AC7C 5L6UA 3QQWA 3UPWA 1E0UA 1YBQA 4L7ZA 3RLHA 4RV8A 3N29A 1BKHA 1R30A 2DSVA 5IFPA 3B9DA 3PTMA 3BCDA 1RCXB 1XKJA 1KBJA 1PDZA 1S38A 4FF7A 3I4KA 4YWSA 2OSYA 1CGVA 4M56A 4EE9A 4NG3A 5DCDA 1Z3NA 4M6QA 2X2GA 1KA9F 3A4XA 1J4EA 3I6TA 3SJNA 4ZFCA 2XYLA 4U33A 2E8ZA 2P10A 2X42A 3LSCA 3UERA 4JS3A 1AD1A 3VGBA 3MUXA 1YTDA 4MOZA 1KNWA 4W87A 3UWZA 2NT1A 4G9PA 1K77A 4ZOAA 1XCXA 4NZ3A 3W7IA 2ZQ0A 1CGWA 2DW6A 3VKDA 3BURA 3AXMA 5IHRA 4YL2A 1KQZA 4K7VA 3GLCA 1U22A 5FL0A 2ZICA 3PNUA 1OFDA 3OYXA 1SGJA 8TIMA 1NF0A 3USZA 2O0TA 5A2BA 1FCVA 3ARWA 1GQJA 2R1PA 3EWZA 1AL8A 2CBVA 3DUGA 2WNZA 4MADA 5I77A 5I78A 1EWDA 3V36A 3LGDA 2UY4A 1TZ9A 4O57A 1VFFA 3UD6A 4MLJA 2ACQA 1A3WA 4UFHA 3TC7A 5G4WA 3WQ4A 3VIMA 3QKEA 1JIBA 1E5NA 4HVXA 5FJPA 3LPPA 5A3HA 1AZ1A 2OFJA 1QHPA 3DHFA 3DHUA 3GC5A 3VI2A 5G4HC 1Z69A 1F6YA 4UTTA 3OVGA 5AHMA 5HUOA 2GK1A 4HOWA 1HVXA 4LS0A 3ES8A 3IUHA 4JTKA 1OGSA 1W3NA 4H9MA 3G1YA 3MP5A 2XWEA 2VZTA 3ZZ1A 4XSLA 1K7EA 3TTSA 5DY2A 4L6HA 4IMAA 3CXOA 1JFHA 1XLCA 4FLQA 4H04A 5D04C 3QV6A 3L21A 5HULA 2HTMA 3BCFA 3RRAA 3WZ0E 4XBJA 1CXLA 3AU2A 2WM1A 2PWFA 1WKDA 1TMHA 1XYBA 1BVZA 4QS6A 2PBGA 2PWVA 2VURA 1E4IA 1JCXA 2QDDA 5REQA 5HJXA 1VBRA 3QKZA 4L65A 3SIZA 1W37A 2VWTA 4GVIA 3VOGA 3RRXA 4G7EB 2FQIA 1TTIA 2J9XA 4S23A 1K8XA 4KIEA 1RV8A 4QXIA 2XWDA 3UWQA 4QROA 4F66A 3AJXA 4Q7IA 2QS8A 3FYPA 5C8BB 2R1MA 5GJNA 3K4AA 4O1AA 1P0BA 2XISA 3JZEA 4TV5A 4BQ2A 3GIQA 3E2QA 3MVTA 3NZGA 2CESA 3CO4A 5CCZA 3THUA 3HBLA 1KM3A 2HXTA 5D8ZA 3STFA 3T78A 1LBLA 1JNEA 2Y5SA 2XVGA 3DZ1A 1D3HA 4GI4A 2FGBA 3G1FA 2WMJA 1PBGA 3NVTA 2HQAA 4E3VA 4ERAA 1G69A 3I7QA 2EBNA 4RPQA 3RITA 2XGIA 3LHZA 4BF9A 3UCDA 1RJQA 5CSRA 3CUZA 4CNOA 5G5IA 2PURA 4QITA 2QCNA 5FSEC 1VCVA 1O1HA 3BAXA 4CQBA 1AH3A 3WLRA 4OOZA 1PZ3A 1TJ0A 4C91A 3M1ZA 4F0SA 3A21A 1OBAA 1N8IA 4D6FA 1GZJA 1W1VA 2YZ5A 3WF4A 4KRZA 3F7JA 1GJUA 1J0KA 4X60A 3UWEA 3SCRA 4GUHA 2E5CA 4F48A 2E9BA 3AHVA 4IOTA 4EVZA 1LLWA 1SVDA 1WPCA 5BOFA 1YDVA 1BGGA 2NQ5A 4L1WA 2HNHA 1GORA 1W3HA 3IWPA 5EL1A 3QF0A 2XGZA 4CEXC 2F6KA 3L4YA 3A4WA 2C19A 4W4QA 4R34A 3N15A 4O0QA 4J4KA 1M65A 2G3NA 4IIEA 4KFOA 3KWSA 4YNGA 4P7QA 1V02E 3QFEA 3WLIA 3S6OA 4JIPA 3NEVA 4DJFA 3PZMA 4GVHA 1NFGA 1EJXC 3O1NA 2YCKX 5U4NA 3CEUA 4O14A 3EBVA 4B4FA 3WLMA 3AYTA 3QBUA 4U2ZA 3WDQA 4XAYA 1ZSXA 3EWCA 3Q2DA 3PBYA 5IM51 3NDOA 1IZJA 3UR2A 1PB0A 2GJXB 3O6AA 5CLWA 3G2GA 2OZ0A 3K46A 2DIKA 1QO2A 3LM7A 4GNJA 1DOSA 3BSHA 2OB3A 7TIMA 3EDKA 4UUIA 1XPGA 3UG3A 3FDGA 2OR2A 2GFTA 3M0IA 1VLWA 1CNVA 4HGXA 4K68A 1CB2A 4GY7A 2FPVA 3S1UA 1QHOA 2ALRA 4FALA 4JIIX 4N6EA 5G1TA 5U7SA 4GXMA 3WBWA 4GYJA 2DY3A 3GC2A 4UFMA 3REQA 4OT7A 3ZM8A 2GZXA 3AAMA 2VXNA 4XIMA 5MHBA 2YL8A 3VX0A 1TPVA 1N82A 2I1OA 1NFPA 4E8GA 2OZ8A 1AH0A 4X61A 4ALDA 4JD4A 3IJDA 4D72A 1X8CA 4JQAA 4Q8UA 9XIAA 3NZ1A 4LAZA 4GQBA 2OOGA 1NTHA 4C65A 3NSNA 3RPTA 3T9PA 4GO9A 4BCEA 1EX5A 1R5YA 4LUYA 4LUSA 1BFNA 4IHCA 1S5MA 3GG0A 1W5NA 5TQLA 1CDGA 2GVJA 3NQDA 2V8ZA 2EKGA 1A0CA 3UQNA 4QE1A 3RR1A 3LBOA 4JY9A 3RG6A 1X1ZA 9CGTA 2YKKA 1K3UA 4WSKA 1S2TA 4E2DA 1MO0A 4DEFA 5GPRA 2A2IA 1OCQA 5I09A 4D6CA 4NUWA 5A6TC 2WYSA 1ESWA 1A53A 3IRSA 1KM4A 4O0ZA 1Q8JA 3UG5A 1G7VA 3VE7A 2GOUA 1CENA 5CGTA 1DTUA 1QASA 3W7MA 5E0CA 1KWGA 2WC7A 4IMCA 1VPQA 1E0WA 5DXXA 1KGXA 1I0DA 1SFTA 4O12A 1TX2A 3S1WA 1JCLA 3RCMA 4A8IA 2W4XA 4XUYA 4Y7EA 4M19A 1BGAA 3ABQA 3ZSTA 3WSUA 4CGTA 1V6XA 3RO6A 1E6SM 3NQ7A 4LC8A 5A8MA 1F74A 4GACA 1LL7A 4ZO9A 3WNNA 1AZ2A 2D73A 3NPWA 4RZ4A 2OX4A 1WZLA 3AHXA 1GVIA 2E6DA 3UBPC 2Z1KA 5DBUA 5FF0A 4DZ5A 5LNWA 1XIEA 3MP4A 3H21A 3R94A 4MUZA 4QJ4B 2QT3A 3PR2A 3M5XA 4IQJA 1XBXA 2D20A 3LEPA 1FHUA 1M03A 1KGUA 3TONA 4JEJA 1KM1A 1J79A 3THQA 2P0OA 4ZE4A 1LJYA 1V7YA 4WJEA 5BRPA 3U57A 3TXZA 2XINA 1YXDA 1H2JA 1R46A 2BXYA 3GNRA 2CLFA 4MUPA 3W2JA 3AICA 1EA9C 3GAKA 5KMYA 2A21A 3LCFA 3W86A 5AC6A 1HVQA 3NR0A 4LUTB 2X0HA 1MFVA 4HN4A 2DQWA 2ZZ6A 3RJYA 2GSHA 1KCZA 3BLLA 3MKCA 3GDKA 1BF2A 1C92A 1MDRA 5LIYX 4S3AA 3RLVA 2HSAA 3TOYA 1XICA 3G1VA 3SADA 3BAYA 2BLEA 1JDEA 2QHAA 3VE9A 3VPLA 1UOZA 3TJLA 5I3GA 4S3GA 1HGYA 1LWJA 4LT9A 3MB9A 4TX6A 5E0KA 3RMEA 4CD6A 1OYAA 1VBHA 5EFFA 1KBLA 5CBJA 2OWWA 4D8LA 3UR5A 4AWTA 3KBSA 1X7FA 2PDLA 3QYSA 2X30A 2ZX6A 3P74A 1EZWA 5I2UA 4CNUA 4K37A 3NQFA 2J8TA 3BG9A 4J40A 7ENLA 2AL2B 4MJMA 4C1NB 1W31A 1Y8BA 3SRFA 3UWUA 2R1LA 2J7BA 1Q6CA 2C1GA 4NYUA 3B9NA 2ATMA 2G3IA 3EX6A 3WLSA 2CIPA 4IG2A 2OMAA 4DPPA 4S3DA 3MJMA 1ONEA 2OQYA 3WLOA 3VD4A 5IXEA 1OSEA 2A7PA 5A5WA 3PZQA 4OECA 3LHWA 5HNRA 1VS1A 3TROA 1CEOA 1MW2A 5DELA 1QI4A 1LOLA 4DI9A 4PYSA 3W82A 2YXGA 2QJHA 1GG0A 2ACRA 2VZVA 3K13A 3G8RA 1CCWB 4DJDC 1K6AA 5CPOA 4QR6A 4C1KA 4NZ4A 1XIFA 1BQCA 2GVGA 4GY1A 4AEEA 3LRMA 4YHEA 2QIIA 2NW0A 3HGRA 2YYTA 2D0GA 4JKLA 1UROA 4LEQA 3MZ2A 1F4HA 1UA3A 5TNVA 2Y7DA 3S0CA 5CPTA 1C8YA 2WZIA 2NV2A 5LA2A 1GYMA 2W92A 3VNYA 2X1SA 4JFWA 4R85A 3RPMA 4J2MA 2EPKX 2DJLA 1GVSA 2Z27A 4FMVA 5E9XA 4GA8A 1OVDA 5ABTA 4FX7A 1VENA 1EC7A 4GJJA 5FIPA 3KVJA 4MG4A 5LGXA 2YB1A 2VR4A 3BLFA 3RXZA 3U7BA 3ZVHA 2J4GA 1LL6A 2VX7A 3NEHA 3ATZA 4XZ9A 3STGA 5HPOA 2O4MA 4JL2A 5FESA 4XAPA 1OZQA 4WXZA 1OG0A 1EH9A 1WZKA 3N9SA 3IIZA 1OFRA 1W2PA 3TN5A 4N4PA 2JF6A 4UR8A 3A5FA 3KLLA 3BG5A 1S5VA 1WDWA 1W1YA 2BTMA 1TWWA 4EKJA 1Z48A 1ZJIA 1B2YA 3CUHA 1L0PA 4OZOA 1GZGA 4IG2B 1CGXA 1H49A 1T7LA 4DLMA 4D6DA 5JH2A 3UVIA 1HJVA 3KEHA 4PMDA 2PRHA 3URNA 2E6AA 3GVQA 3CZJA 4GY0A 3HU7A 4FR1A 4MJ4A 4GFSA 4UNIA 5BXSA 3WMLA 1IEXA 4HHMA 2DT2A 4UFLA 1J12A 1XLMA 3NGJA 4NQ1A 3AIWA 1PZ2A 2I9UA 2A3LA 5G1YA 1E72M 3LMZA 1J5SA 5HMSA 3KTSA 1RD5A 1VFMA 2QUUA 1JPDX 3MCOA 3WQOA 4J7RA 1W91A 1YXCA 2WJDA 3VYLA 4Z1CA 5LIXX 5G2IA 3UZZA 4UR9A 1VB9A 3MMWA 1C8VA 4JX6A 4A8RA 4MYAA 3CL6A 2D2HA 4A05A 1UJQA 3UZWA 2WXDM 3WH9A 4UCFA 1RVGA 3T0BA 3WEOA 3M07A 1A5LC 4NX5A 5DCEA 1GOWA 1ZALA 4MMWA 4CCDA 3ARTA 3BJFA 4P7NA 4ML9A 2W6RA 7CGTA 1ME8A 2Q8LA 3P6LA 3AIEA 2WZHA 2ZRWA 3STCA 1G1YA 1OYCA 3MCNA 3EOLA 4OBRA 3GG7A 1UC5A 4XISA 3IGSA 2NVCA 1NP2A 3LERA 4GIRA 2R9RA 2XU2A 1YQ2A 3ANVA 1G01A 5M1TA 4I6KA 5EYWA 2GPTA 3GVVA 4C6DA 2ABAA 1AMKA 3B4YA 4TVCA 1TA3B 3BO9A 4AZ5A 2G50A 3DIPA 3DC8A 4KWWA 2QKFA 3C0SA 2HVMA 2JALA 7TAAA 1GOKA 2AL1A 2WLZA 3L2LA 1VFSA 1JD7A 2P5NA 4XD5A 3S1VA 3VABA 2Q01A 1Z7AA 4LUIA 4JFVA 3S2MA 1J6OA 1Q6OA 3XISA 2DUAA 3FLUA 4DYKA 3WF1A 4F0MA 1W3KA 2DSUA 1QDSA 1BYDA 1PTDA 3PPFA 4QP0A 3L67A 3HOJA 5FJOA 4EK7A 4GLEA 1A5NC 3PHAA 1LRQA 2FFCA 1NF7A 1KXVA 3DYPA 3TSDA 2X16A 4PUMA 5C2XA 3ATYA 1EDQA 4GISA 1J5TA 4AHQA 4EWND 1TR1A 4IL2A 4D8ZA 1PX4A 4PCSA 3TW7A 1DJNA 2GQ3A 1XQLA 3V1HA 2YBTA 5KZDA 2Z26A 1BTCA 4QDMA 5LHFA 2X09A 1FWHC 4F0RA 1XSKA 2EPNA 3PJWA 3PUEA 1SO6A 3TKFA 2QPSA 4AUBA 4QLLA 2XIBA 3O0FA 5A1AA 4Q4SA 1EGVA 1A3XA 2VC9A 3AYVA 1GEQA 4I7UA 1V3IA 2BOFX 4YU1A 2WANA 4NY2A 3DKJA 4NILA 4X2PA 1HKIA 3SN0A 1FY6A 4B5WA 2BNJA 2XIQA 3L4WA 1EL3A 1O5KA 1RQHA 1A50A 2WC3A 1S1PA 4FEZA 1AK5A 3L4ZA 3VU2A 5A8NA 1RXOB 3IJIA 4HPHA 4W8BA 2FZ8A 3OHIA 3NL5A 1UYQA 1PWMA 3I7RA 4ZZ9A 4B90A 1KFJA 2W63A 3B0VC 2IUZA 2BWGA 3LRKA 1KM6A 5IHSA 1XCWA 2V3GA 1KO0A 3ZOAA 1LBFA 1LRNA 3DFOA 1LOSA 1I2QA 3A23A 4GRSA 5FJJA 4D6GA 1GTHA 3WDJA 5D9OA 4H9TA 4DX3A 1AJZA 3B0PA 3BLOA 1H5VA 4JYEA 4NZJA 4WOZA 1Z6KA 4BEQA 4AWUA 1EB3A 1QBAA 1QXLA 3EB2A 1TRDA 2YLAA 4Q4PA 2YPIA 8CGTA 1ISXA 1HF6A 3DG3A 2W0UA 2YR1A 1EBGA 3A64A 3MSYA 3LDVA 3T05A 4PCPA 2HDJA 5DRIA 1AG1O 1PKYA 1B4KA 4HHLA 2GUYA 4DUOA 3CAQA 4YPJA 3L65A 4WXYA 3GNXA 2NVDA 2PC8A 2D3LA 2W79A 4DJDA 1R3WA 2ISFA 5K4ZA 3BMVA 3N2TA 2GOKA 3ABXA 5KZMA 1P1XA 4IL0A 3RDKA 3PK7A 1V4YA 2XIOA 3KOFA 3W87A 3P2VA 1L8NA 4NI3A 2XVLA 2O7SA 3CQJA 1TSIA 4IISA 4DUWA 1HJXA 3WX7A 3C0JA 1S46A 2NUYA 4IX2A 1E55A 5A6BD 3UZ5A 3LPOA 5A6MA 4LB4A 2XIJA 1JUBA 2ZWYA 3VIPA 1C93A 1OD8A 4DO6A 2HXUA 2IKIA 3VNZA 2WVUA 2VT0A 4ZFMA 3SCQA 3BLIA 4GQRA 1E56A 2QXWA 4N7QA 1VD6A 1RD6A 3PFMA 5IFTA 3AXHA 2PB1A 1VRDA 4H8NA 5AYBA 3MI6A 3WLHA 2PDGA 4DXKA 2Z6JA 4BA0A 4LGXA 5H8PA 1QMLA 4E2VA 1FA2A 4O17A 5DF0A 1UJPA 2YLLA 4PL2A 3EWYA 3KOXA 4KEMA 4IIBA 4RW3A 3THCA 4J3TA 5AHLA 4JQ2A 4PCNA 3VD5A 4YTQA 4MSSA 1FP9A 5EMUA 2R24A 3L5LA 2NQZA 3W24A 4WD0A 4XVEA 1B4EA 3B8SA 3NYDA 5D2WA 1R9XA 4M1RA 5JBFA 1QPOA 2E3ZA 3B8VA 3MC5A 4LUSB 1XLFA 2QVNA 4E8DA 1GVEA 1XGDA 3O63A 5K2ZA 1C8XA 1OT1A 4B3ZA 4ZB0A 4H2CA 2V2CA 1XWYA 2CXEA 4GYPA 1RZMA 5LA1A 3B8TA 1BWKA 5A8PA 3GVRA 2CHNA 3R2GA 4B4HA 3D47A 4ZMGA 4WGXA 1R9YA 3MBFA 1BYCA 2XTKA 3MDUA 5GNXA 3IVUA 3UWYA 4C6JA 2VVSA 3VDCA 2Y62A 3MWAA 1JZ5A 4GZJA 3G1SA 3LD5A 3G3MA 2NVAA 3QHOA 4GX9A 1AJ2A 5A6JA 3CNYA 3ZLFA 3UJ2A 2DFAA 3LCXA 1BPLB 4PMJA 2F9RA 2Y8UA 3NQGA 5IDZA 3Q94A 5CBIA 2WKJA 2VDIA 3VDAA 1OFOA 4XD4A 2D2JA 3FSTA 4JGDA 4S39A 1JDFA 2X05A 4CUCA 3LV5A 2VMFA 4GJIA 3EXSA 2IPFA 3A4AA 3ITLA 3QV9A 1MZHA 1X38A 1BRLB 4US5D 1UWTA 1W9PA 4F3HA 1VYRA 4H7VA 1LZOA 3A9IA 3W1XA 4J1OA 3BW4A 4EP8C 2PDUA 1FFQA 2PDCA 5D8WA 3WENA 5CAKA 4WRHA 5GNZA 1AVAA 3GIYA 3BE7A 2PLJA 1VC4A 2P88A 3AQUA 4Q8TA 1H51A 1J0HA 2D3NA 2QUNA 3GBEA 3KL5A 4PMNA 3NL6A 3SCOA 1ECQA 3SEPA 2D0HA 4MNMA 5I07A 2VM8A 1PZ1A 2FJKA 1EJRC 4YLWA 1L2QA 5DCBA 4K8HA 4NXKA 3N4EA 3GXMA 5T9CE 3I3DA 3EWUA 1B9BA 1RPXA 1MXGA 2REQB 1A3HA 5CAHA 3OA5A 2FZNA 1K1DA 1DIOA 3A4JA 4FXJA 4FB7A 3K1DA 2G3MA 3SRDA 3UA4A 3U2OA 4EPKA 1GZ1A 2G0WA 4XVDA 4HTBA 2NT0A 1QOPA 1TZ7A 3W81A 1EJUC 5CQ1A 4HZ7A 1Z9AA 2XPKA 3G0UA 2O9RA 2ZA1A 3MU7A 1EIBA 1ECEA 4PH6A 1Q6RA 4ZB5A 1HKMA 3B8IA 1ADDA 1E51A 2PAJA 3EWXA 2VEKA 3N2CA 3WCZA 3HQOA 5HNUA 2QF8A 4NJGA 4XAFA 3G18A 3CJPA 3WIJA 1XC4A 2B7QA 4GC3A 1PWLA 3T2PA 4ERGA 4DELA 2Y61A 2EJAA 1XBYA 1JYXA 1K7FA 1CXFA 3H53A 2OYMA 3GNOA 1RCQA 2JQXA 1M7OA 1SW7A 2BDQA 3TSBA 3TYBA 1CW2A 1K8ZA 3QRHA 4O4WA 8XIAA 3O07A 1MZRA 2Y63A 3O8AA 1XDJA 4DZIA 4IMDA 4L1XA 4NXSA 3E02A 3C0LA 3RM4A 5I3IA 5BU6A 3QZ6A 2P0IA 1DXIA 4FOKA 2QZRA 2HK1A 3TMLA 3L23A 3DBPA 3HG2A 4FZIA 3RNDA 3KRBA 4XZWA 4KEVA 1GNXA 1UB3A 3ZWTA 3B0UX 4ERIA 3CAWA 1XBZA 4A22A 4BWLA 2RHGA 1PUDA 2IQTA 3BAWA 4W8AA 5F1UA 3QHNA 3R8GA 4HPXA 5REQB 3WNPA 1K9DA 2ACUA 2QUTA 4MZYA 1EBHA 4D8AA 4KF1A 3CK5A 1IXNA 3CYJA 3EOEA 4F9JA 1R3TA 3SZ8A 5I7GA 3VOJA 2OLHA 2NX1A 3LLXA 5DO8A 4PFHA 3PM6A 2F6UA 1SYTA 3LX9A 4P8UA 3D0CA 4CD7A 3PAOA 2WMHA 1SQ7A 4PUDA 2CKSA 4KS0A 2CZFA 3P14A 4D6HA 1JZ8A 4JTIA 3VGFA 5A6SA 1UW9A 4LCQA 5D05A 4NJKA 3CS2A 3GX9A 4B92A 1TQJA 3MTWA 4WDTA 1YPFA 3SQSA 1Y7VA 3W07A 3CIWA 2CBIA 3VFCA 3GZAA 4F0KA 1SZGA 3OG3A 3FV9A 3CHCA 1OX4A 1V3LA 1NM9A 2D23A 3PZNA 1R3RA 2JEQA 4Z2GA 1O5QA 1G4PA 2XH0A 1W9UA 3L0GA 2H8ZA 1R7AA 5I3KA 3WF3A 2PWUA 1BHGA 2DUXA 3Q37A 1IQ8A 1XIDA 2ZOXA 1E5JA 1RP8A 2XG9A 3M64A 3W2LA 3BGGA 4CKQA 5BRQA 3R5EA 2TSYA 5EU9A 2C14A 2EQDA 1RBAA 3R13A 3GXFA 1VBUA 4TMBA 4AHOA 1FKWA 2PDNA 3W1TA 3B05A 4TIMA 2FVLA 4R33A 5DQPA 3IVSA 3GS6A 2JK2A 4O53A 2ISSA 2EPHA 2E1WA 3QC3A 1E6XM 2WPGA 5A8QA 4W93A 3OBKA 5DN1A 1XYMA 4UQAA 3HPAA 1EHNA 3VZZA 1FHLA 3GTHA 3DOPA 3V0UA 4D6JA 4E8CA 4M80A 3A6OA 3LM3A 1Q6QA 4PUJA 1IZKA 2WWDA 1KBIA 1S2WA 3N25A 3VOCA 2A5HA 4NAFB 1A0EA 4XD6A 2P1FA 2OYLA 3BK0A 2NSXA 1UD2A 1DVJA 3CUGA 1F7BA 1BLIA 3VXGA 3WMCA 2V3FA 3WQGA 1Q7MA 5I06A 4GUJA 5HWJA 4EACA 4MKSA 4EOUA 4Q4RA 2FB3A 1P7TB 3B8WA 2E5DA 1ITXA 2PU1A 3CPRA 3IUIA 3BLDA 2HCVA 1B30A 1GCYA 3GKAA 2Z7GA 2XVNA 2WMKA 1JNDA 3B9EA 1IT0A 1THFD 3F1QA 4QSFA 3V3WA 1T41A 3AUJA 3G1XA 3DBNA 3DFNA 2VEIA 3L5MA 4MZ1A 3WLQA 8RUCA 2CLLA 1PL9A 3AFBA 3WK1A 5CLTA 2OODA 2IKGA 2YBVA 2DSWA 2PGEA 4DJEC 1FWDC 2GWGA 2J78A 1D7KA 1KCLA 3E5PA 2FTYA 1T8XA 1DHKA 4UTWC 4GKLA 1WDDA 4MY1A 3N4FA 3UW6A 3UNDA 3PPHA 5HOSA 2BOEX 3TJIA 3IJ6A 4OV4A 4ZA0A 4HK6A 1GOOA 3M5VA 3AMGA 4HB7A 3S47A 4ACYA 5TIMA 3WLKX 2VUYA 4JTRA 1XIJA 1YEYA 1RALA 2A7NA 4AMAA 1KM2A 2A3HA 1D8CA 2DZPA 3VGHA 4MLRA 4PTWA 4WOQA 1VFHA 1I75A 4YMZA 4HK7A 3TN3A 1N2VA 3L0KA 3BMXA 1DJXA 1D7FA 4CQDA 3E12A 1A5SA 1BYAA 2QCGA 3W7OA 3IVTA 4AF0A 1U1JA 3G1RA 1CXEA 2DJXA 4CQ9A 4BY3A 3MMTA 3C2VA 5D38A 1LP6A 4EIVA 3HG5A 3S5NA 5H1WA 4HU3A 3R0DA 5DXYA 1O7AA 4O1FA 1NELA 4ILSA 3E49A 3Q58A 3P3BA 3OP2A 3H26A 4M7TA 2ISDA 4R7JA 3IJQA 4FK9A 5J8LA 1M7PA 3KFTA 1FCBA 4M0XA 3HA1A 1A5BA 2BGNE 3WL0A 3MP3A 3O05A 1BXCA 3AIQA 2VQTA 4JNYA 3ZO9A 4MVAA 4JQ1A 4H19A 4ES4A 1QNRA 3S3GA 3T4WA 1VEOA 3H2AA 1IXPA 4WQ6A 1KRBC 6CGTA 4TV6A 1LCOA 4DF2A 4JFSA 2GK1B 4U10A 4DHGA 2E67A 5BYWA 2WMFA 1XLLA 6TAAA 1OC5A 4M51A 2KZHA 4L1GA 4WJXA 3MMUA 2PDYA 3KL3A 4O0KA 4GYFA 3AHYA 3VK5A 4FIRA 1JYWA 1O12A 3G1AA 2CHOA 3R0KA 3UXKA 1I45A 3II1A 4RPPA 3A12A 4Q8OA 4KPLA 4KWUA 3HV8A 3C86A 3VOHA 4UWMA 2OO6A 4PEEA 4ECLA 1MUMA 4MWAE 1J2BA 3BPWA 4HNTA 5CC3A 3NWRA 6PTDA 4ZSUA 2CITA 2YW4A 4RDYA 3DAQA 1LWHA 1F6KA 2CLOA 3U0HA 1C7SA 4H7CA 4TR9A 1ELSA 4B5VA 4BS0A 1P48A 2QJNA 1LG2A 1MXSA 5A69A 3BSGA 1GUVA 4WK9A 4HSNA 2J77A 2UY5A 2Q02A 5FACA 3N9RA 1YNPA 2RGMA 1BXBA 4I3GA 5LXEA 3OOQA 3VKJA 1D8WA 4ZO7A 4RZBA 3MHGA 1N55A 4C5YA 1OGBA 3KRUA 2DIEA 1HJSA 5LGZA 1L9WA 2IQDA 1LORA 4V15A 2WC4A 3AMCA 3W72A 2C8NA 2RUSA 3NOEA 2FZBA 4QG9A 2WHKA 4XZIA 3PPCA 1UASA 1FH8A 4TU1A 3I3BA 4ZXOA 1ML1A 5C9WA 1K4HA 3UFYA 2G95A 4TVUA 2J27A 1JXKA 1VJIA 3IEBA 1WXYA 4KQNA 4C6FA 1LBMA 3WJZA 4Z1AA 1T5AA 4F0HA 1A5CA 1CXHA 4MPQA 2WVTA 4PMRA 3FS2A 4PN2A 2CW6A 4XQ6A 4Z08A 3GG1A 2W66A 1FWBC 3GHUA 1XLJA 3PB2A 1V3MA 2V63A 2BOGX 3ARSA 3RO8A 4E4FA 1WDQA 2Q09A 4CLMA 3FJ4A 4HA4A 4Q8NA 1JDCA 1G0CA 1JCYA 2HNEA 5G2HA 4J3SA 1HUVA 4KCUA 2BASA 1WXJA 1P4CA 3UGVA 1OIMA 3HMCA 1VLIA 3FSUA 2EG6A 3EKLA 4MY8A 2Q71A 1ITUA 2YDQA 5LA0A 3R1ZA 1M5WA 2EO7A 3H2OA 3W71A 3LQLA 1UC4A 2B7NA 5MKGA 3MUAA 1ONRA 2I7GA 1C91A 4G6CA 3LI0A 2OLAA 1YHTA 1YMYA 4HD5A 3VIGA 2AKMA 5D32A 3FVMA 2OQLA 2J7CA 2X1TA 1LDCA 1BWVA 1TKKA 2CC0A 4JDYA 3R8RA 4PODA 1YX1A 1ZP4A 4RDZA 2ZUNA 3LYEA 3ZMRA 3DCPA 4JTCA 5HNTA 4BQ4A 1NH6A 2DGAA 3I3EA 2CEQA 3O15A 4GQQA 4JHZA 3M4HA 1E6QM 1US0A 3MVIA 1PVNA 1E1CB 1LTDA 4N4QA 3VKKA 1B5TA 1DJYA 3ISIX 3KVMA 3NPUA 4GXPA 4KRTA 4UOQA 4DBEA 3CQHA 1JR1A 4GOAA 3NUKA 3RX2A 4ZO6A 5CC7A 2EPOA 4S3FA 4D6EA 3M7SA 4BKNA 4HA0A 2V5JA 3DYMA 1SFLA 2P3ZA 5EMMA 4BQ3A 1EUNA 1UR2A 1V51A 4G7EA 2E9LA 3EPNA 2OVLA 4XAGA 3SRHA 1I4NA 3CV7A 3O06A 2P76A 4LS2A 5JBDA 3ELFA 2XFRA 1EWEA 2CCRA 3OZMA 1DJQA 3L9CA 5ABGA 1BXNA 2FGZA 2Y7FA 3QSRA 3RAOA 3V0TA 2AAMA 1KRCC 1RK5A 4QQUA 4U3AA 6REQB 2OGYA 3WK3A 4Q7NA 1KM0A 4S1FA 1BVNP 1SPQA 4W85A 2NQJA 2ZXDA 3SCNA 3K30A 2ZX8A 1TPUA 1GVQA 4PMYA 3ZJ6A 1EP1A 1DIEA 1SZFA 3KL0A 1W9DM 3SCSA 2TYSA 1P6CA 2W67A 1F3WA 3ABOA 4PTMA 4UNLA 4HNUA 1IIHA 4PTNA 2I5QA 1EO5A 5FEZA 2YCLB 4KWVA 2IPGA 3L4XA 1NWSA 4S2BA 4Z1BA 3E2VA 1JAEA 2YGYA 2Y0FA 3PN8A 4R27A 4J28A 4XIAA 4IP7A 4RNIA 2E68A 1XLDA 4Q8MA 1KD0A 4R5EA 3MKKA 2Z1XA 2XH2A 4B5UA 1ICPA 2GWNA 2D22A 3CB3A 1V3JA 1DWHM 1OFEA 1IYXA 2NXIA 2YDRA 4Q22A 4GYPC 1XG3A 4YTUA 4LH8A 3M0JA 2XUCA 2PP1A 1SW0A 3C2EA 4CCZA 1GONA 4ZSTA 3QOMA 4UB9A 1VCFA 4MB1A 4W7UA 4GUIA 4E4UA 1Z32X 4ZEPA 3W2NA 3ECQA 4KESA 2XFWA 1JPIA 2DT3A 3R11A 2ZUVA 1TUFA 1MFUA 1R87A 2E25A 4IT1A 5FCZA 1L2UA 3DXIA 3VINA 4AD3A 4OFCA 3QH2A 1S5TA 5HMFA 1DJIA 4ACZB 3TE9A 3KM8A 2BZNA 1C3FA 3KHDA 4KEZA 1UPPA 2ZXQA 3VILA 4LWWA 5B7YA 3UU0A 3OVRA 2BVWA 3VNLA 2HBVA 4GQGA 1OADA 3L66A 3ABZA 4TVDA 4YTRA 4LYRA 4AEFA 3EB3A 3ZLHA 1TO3A 1VAHA 1WUFA 4LQ1A 4IFOA 1W1B1 4AG0A 4GNKB 3IGUA 3VO0A 4WCJA 3PULA 1SO5A 3QGVA 4HNNA 2PPGA 1R2RA 1J0ZA 1R6WA 1AW5A 1P6BA 3GIPA 4NRSA 1BG9A 1MEHA 4DZAA 3GM8A 2B81A 5GVJA 3JZUA 2TAAA 5FAGA 1KXQA 4AMCA 1F76A 4CN4A 1VEPA 1SW3A 2QMJA 2RJHA 2XVKA 3FCPA 4IIFA 1W8SA 4LUTA 3GK0A 4OVXA 1JI1A 1MRQA 3S8HA 5HR7A 4FX6M 1XGEA 4H6KA 1AQMA 3TWBA 1TJRA 1UQYA 3R79A 5HWNA 2I17A 2CLIA 3W7NA 3T8LA 3GU2A 4MFEA 1VIZA 3WQCA 1EGZA 1F3EA 2NZLA 3OYZA 3ENLA 3NNTA 3HGJA 4X22A 1H50A 2V82A 3C6CA 4U2YA 4MY9A 3O0KA 3P67A 2A6NA 1V6WA 1JUEA 2CPUA 1B3OA 3N3TA 3WKZA 1MXDA 4RNJA 2H6RA 4C6KA 4YHGA 3U6WA 4F0LA 1W3TA 5HBFA 1WZMA 2VUNA 3XINA 2PGRA 5DBTA 3PS7A 3B97A 3CUXA 3S5YA 2DH2A 5AYYA 4CNPA 1WDSA 1DP0A 4MWAD 4LV4A 3CC1A 5A6AA 1H1YA 2YL5A 1UR9A 4MTVA 4FNPA 3LNMA 2F8QA 1Y0EA 1Q66A 2PZNA 3PBGA 3KBWA 2POZA 3HFTA 4IIHA 4B5TA 2BGQA 3JVAA 1TTPA 2PEVA 3N2XA 1KFEA 1Z44A 1WCGA 2NSOA 3TJ4A 4B9ZA 2F2HA 4G1NA 3BOLA 3QY8A 4XTDA 1XH2A 4RDWA 2FGLA 3FVDA 1UBPC 3GFZA 3PG8A 5BXRA 1LF1A 3WDHA 1QVBA 1AQ0A 1UH3A 3H2FA 5IOBA 3BH4A 1RBOB 4UQEA 4GBUA 3ZIZA 2PZ0A 4M6UA 3CMGA 4O54A 1GYLA 3IAQA 4NX0A 4B5XA 2PSNA 1KFKA 3C52A 1FOBA 2Z1BA 1MNSA 4DUXA 3B3DA 3VC6A 3G24A 4MB3A 4RE2A 2WCGA 5G4EA 2V3EA 3AMDA 3DH7A 3EX4A 1UKTA 1H41A 1H3GA 4INFA 4LANA 1O68A 1ISZA 3WEMA 3PWIA 2HZGA 3COTA 1FWFC 3G0SA 3T55A 3WNOA 3BZJA 3OVPA 1B0IA 3U3HA 3DFTA 5FOOA 4C1LA 3LLDA 2W3ZA 1KGWA 2XGBA 3R4IA 1FH7A 2BY3A 3EAUA 4JY8A 3GE7A 2J74A 7REQA 4PTVA 4UCGA 3UA3A 4ZTXA 3HURA 4I9JA 1OEPA 4B2DD 2QV4A 5A2AA 1WAUA 4OU1A 3L12A 2CZVA 4PL1A 2ZE3A 3N12A 4U5KA 4H3DA 3E2SA 3B4UA 4ONVA 1A5OC 3KWXA 2Y70A 2HS8A 3GH5A 3T09A 3AYRA 1QI2A 1R47A 2PI6A 4GABA 5K9XA 2PS2A 4RCXA 4C6QA 4KEUA 1W1PA 2YL6A 4GXWA 4C6OA 3B0YA 1EJVC 1Q85A 3P8IA 2HK0A 4JX5A 2WO5A 5CC5A 3CV6A 4K38A 3MT1A 4NIRA 4PUUA 3STPA 4FP1A 3S2LA 2BSLA 2ZZ2A 2AL2A 1TE6A 4GIAA 2DT1A 4B16A 2CZEA 4P8WA 4DM1A 4A4AA 3GU1A 1DHPA 2OEJA 4GZ7A 3OLDA 3EMZA 4DF1A 1ZPTA 3BICA 2Q6ZA 4HYVA 1H11A 5E1QA 1XYLA 1ZU8A 4UZUA 4LBSA 3LBCA 2SFPA 4H83A 3RGTA 1XDLA 3SCTA 5AC5A 4DF0A 3ARRA 1XYFA 3PZUA 1R3SA 3URQA 3C61A 1TREA 4WSJA 2MUCA 3BW3A 4Q32A 2GSJA 4Z2JA 5LIWX 4A2RA 4PMOA 4OJYA 1PIFA 3WELA 7PTDA 4X9YA 4Z2KA 4AD5A 4A8LA 4AZIA 3OA3A 3V75A 3GXIA 4LU0A 1Z8AA 3ZFHA 3QY7A 1MW0A 3WQ5A 2ZVIA 4LVDA 5K7JA 5KTLA 1IR1A 3ANUA 2J8FA 1ZB5A 2D2GA 3VGEA 4LVBA 4W7VA 3TV8A 1GPWA 2YL9A 2O92A 2VP8A 1TWIA 4O16A 3E74A 4CCCA 4PZVA 1B9ZA 4NJHA 5ABHA 1HP4A 3MI2A 5LXXA 2F7FA 3RU8X 3AZTA 1I60A 1YYAA 2XZ9A 1T40A 3U2EA 3IARA 1W3LA 1IE7C 3UVAA 1A5UA 3H7UA 4LW7A 5LSMA 2F6XA 2ESCA 4PUNA 2P50A 1G4TA 2CLEA 3T44A 3QLDA 4BI5A 3GU9A 3KVKA 1FDJA 1RCOB 4RE0A 2WZMA 1P0NA 4LFYA 1REQA 4Y9OA 3CMFA 4WKHA 3NAVA 3HO8A 2CLPA 3TOPA 1CLXA 5CKSA 1TWDA 3A9BA 1GKPA 3SY8A 1TZZA 2YA2A 1FWTA 2XSAA 3NQ8A 5IRPA 1DQWA 1JCJA 1BQGA 2ZXAA 1RQEA 2BVTA 2VEMA 3POCA 2HE8A 5FJTA 1KXHA 1TJ1A 3INPA 5BXPA 3H4WA 3W53A 3T42A 3OO2A 2GVYA 5CC6A 1V93A 1JGIA 3PPGA 3CM4A 1JRBA 3DFYA 2GVEA 4LYKA 3RLUA 3MANA 4O1EA 1GQNA 4KETA 1UZ1A 1JL8A 2NV9A 2VKZG 3ITVA 3UETA 5D30A 4DY1A 2QV5A 2XSBA 3M0VA 4W5UA 1IGWA 3BTNA 3GDBA 2QJGA 3NDYA 2V3DA 3AWNA 4OV9A 3CWNA 3NYZA 1PPIA 1XUUA 1RY0A 2OXNA 2WVVB 3GTIA 4N2YA 2H90A 1EKOA 4HPGA 4O8RA 5I24A 1E9ZB 4FXRA 1P1MA 7XIMA 1TWSA 4CVUA 2X8RA 1U5JA 1FH9A 1BD0A 1J10A 3GXPA 6ALDA 1IEIA 4Z2HA 1XW8A 2NLYA 3ARQA 1S5WA 3EA1A 2OZTA 3LZ5A 3O6CA 4BF5A 1YPIA 2GJXA 1ITQA 1UHVA 4JHOA 1PEZA 4Z2LA 1XBVA 4ICNA 1B1YA 1EJWC 3A3HA 2MANA 2WCAA 4IJCA 1Q63A 4L56A 1QNSA 1TV5A 1FDYA 3WDPP 1HL2A 4S3KA 3PNZA 2YFNA 1DXFA 1NEYA 3ITTA 2RJGA 4IIDA 2YX0A 5J04A 3TQ0A 3DN5A 3UYCA 2Q8ZA 1S2AA 1UBSA 3WDRA 1TB3A 3UR7A 1XSIA 2OJPA 4TQTA 3RHGA 1F8MA 1OC6A 3QJAA 4Q4KA 4RV3A 4HZ8A 3KVLA 4RJEA 1AQFA 5GNYA 2AQOA 1BYBA 2EF9A 2PTWA 5HUPA 1EFZA 1G4SA 2WSPA 3IAPA 4WY0A 4QLKA 4Y8FA 4E6MA 3EXTA 5C6MA 1IV8A 1HXJA 5D2YA 2BXZA 3AS3A 4F2UA 3WBXA 3RX3A 5EGRA 1FFRA 1Q8AA 1S2VA 3SECA 3ALGA 4HHHA 1IIGA 2LLEA 3WQ8A 2AAAA 3OGRA 4KFPA 4DWDA 1YE6A 3PSVA 1DQXA 3Q45A 9RUBA 1VQTA 4NSBA 4D6IA 2DDXA 3VNMA 3BW2A 4B5SA 2D0FA 3WNKA 4ADTA 4LAUA 3LN3A 2C91A 3P82A 3G1HA 2C1IA 4S38A 2PDBA 3QHMA 1ONXA 2WW5A 3TC6A 1UUMA 1R3YA 3SCUA 4CNNA 3VNIA 2FPYA 2XDFA 4GD0A 4PUWA 3ALFA 2P8BA 3UG8A 5HMEA 3EOSA 2OT0A 1V0LA 1WKFA 4H1ZA 2GDUA 3GD6A 5TBOA 1NSJA 4IPNB 1NDWA 1W5QA 4A3UA 2Z28A 4GHRA 1TFVA 4IPPA 3T1GA 4X63A 2P53A 2GJRA 2AGKA 2YCJA 3TQPA 1MQQA 3SRKA 3UYIA 3EB4A 4UTHA 3OQEA 3LNPA 1IZCA 3C3UA 4B91A 3RPDA 2B4GA 2ZRZA 2Q8XA 3H4XA 2EHHA 4XAZA 2VX5A 3V0SA 3N19B 3OB8A 5RUBA 3LCLA 1J0IA 1H7RA 3NZQA 1H61A 4BEUA 5BWFA 2NXGA 1SJCA 3B06A 1IGSA 3A5VA 4JTQA 4AD1A 3N17A 2VQUA 2DORA 3CZ8A 2OQHA 2IXUA 2YSWA 2ZKMX 5CPLA 2NWSA 3AS0A 4Z2IA 3RX4A 4QS5A 2BV9A 2PU0A 1CECA 3TTOA 4QRNA 1UD8A 4W88A 3NXLA 1ITCA 1QPKA 4MAZA 3LGGA 3P84A 2ZDRA 3XIMA 3UZYA 3FEMA 4JTJA 3E0LA 2J24A 1KFLA 4ASTA 4PBEA 4AF0B 5A94A 4EWJA 8XIMA 3C4UA 1I8JA 4J3ZA 2XZ7A 2CBJA 1YE4A 2Y1HA 3FXYA 3FN9A 3QMSA 1W1ZA 3AZRA 3NZRA 1BSLA 1JUKA 1QTWA 4XK2A 5G2WA 3HPFA 5H8UA 3FA5A 1YTKA 4ZBCA 3ZJKA 2ZWZA 4NZ5A 3NVDA 2V5KA 3E0FA 4A6GA 3DU0A 4O18A 2NX3A 5AHEA 1PV8A 1TUXA 1QJWA 4Q8QA 5DEZA 2VGIA 1Q3NA 2XFYA 1ZCCA 1ISYA 5T91A 4QTGA 4S3JA 1YBQB 3F2BA 5LNVA 1UMYA 3PAJA 1EOKA 3DENA 2V0TA 2XHYA 4JTSA 3VM5A 3W4RA 1PZ0A 3PJXA 1H0GA 5F2MA 1TR9A 3U5YA 4W9TA 2QCDA 3LSBA 4N9CA 2ZFAA 4HPJA 2ZZ7A 4RNHA 3G77A 5E9AA 2R1KA 2EG8A 1POKA 3E9AA 2OKTA 5C9RA 4XV0A 3BOXA 4DJFD 3MW7A 1A47A 3C2RA 3DI0A 1E0TA 4S3EA 1GHRA 2WAGA 3R58A 3B9OA 2FH6A 4ZXLA 1TCDA 3APYA 2CZDA 3EOUA 4E2OA 2TPSA 4U28A 2R82A 2VCBA 4JPGA 4AZ6A 3UXAA 4L80A 3S5SA 4KIRA 3TW6A 2JKPA 2HPIA 3T8QA 1ZQ5A 1NOUA 1XF0A 1W1A1 3SJ3A 5CG7A 2BX7A 1XGZA 2C0HA 4UZSA 3BV4A 4AYSA 4XUGA 1ZAHA 3KZSA 1GG1A 3MUZ1 5KEZA 2QNEA 1DWFM 2VDHA 1ISVA 4TO8A 3P8JA 1MUCA 3UESA 4HA3A 1QW9A 1S1RA 1RQBA 4ZQCA 3EDFA 1OM0A 1ZBKA 3WBYA 4K8GA 2EG7A 2F38A 2FVKA 4QHRA 5T26A 4BK9A 4BQ5A 3G0XA 4B15A 3PF3A 2ZUMA 2FB2A 3QR3A 2ZRXA 3JRKA 1UA7A 1QPNA 1MYRA 2QCMA 1L6YA 1E40A 3IV3A 3LXBA 1VKFA 3TFXA 2VRKA 4NI8A 2BFGA 1G5AA 4U31A 4M82A 3SAZA 5I3DA 3RLGA 4ENLA 2GGIA 1RLCL 3S4TA 3NQMA 1EJ7L 2YOCA 3W7QA 2Y8VA 3UP8A 4AH7A 3T81A 2Z00A 1XFCA 4GWEA 1H1ZA 1RA5A 1BEUA 3ES7A 1ZJAA 3CWOX 3LCGA 3WN6A 4CN6A 2WSQA 1UWUA 4JIHA 2BY0A 2J62A 3M0KA 3LPFA 1F4AA 3E38A 4L6OA 4C7FA 3NM1A 1QNQA 3Q65A 5LIKX 2J25A 1VJZA 2NXHA 2VC6A 5GJPA 4OBSA 1WBJA 3B40A 4O28A 3CT7A 1PKMA 3SSJA 1TIMA 1VF8A 3MHUA 4KRUA 4JTTA 3DX5A 1XP3A 1R3QA 3KOWA 4LAMA 5HJLA 1OCNA 4MM1A 4JQ3A 3CZEA 1OFAA 2A3CA 1N7KA 3FOKA 5EMJA 3AIUA 1YW1A 1KFCA 1XX1A 1JDAA 3TYAA 1PCKA 2GUBA 1V0NA 2QGHA 1TG7A 4C7GA 2YDAA 2ZX5A 4J27A 2QDGA 2C71A 1K02A 3PC0A 2DEPA 4LUJA 3HJEA 3I6EA 3MSRA 5KINA 6XIMA 2RFGA 2PRLA 2WQPA 4JEQA 4LNYA 4GMEA 4OIFA 3WO8A 1XV8A 3D3AA 2RDUA 5KITA 1O1ZA 2B7PA 2PDMA 5CSUA 3N04A 4F4RA 4JTUA 5F2GA 3W73A 1UIOA 3RF9A 4I9TA 2ZXBA 1E4NA 3AROA 1F5ZA 4CQCA 3QOKA 3TYZA 2QGYA 2GSEA 3FXGA 5ENLA 4C90A 2J75A 3MO7A 2OSWA 5CH9A 1LL4A 4OBTA 4L6DA 2J7HA 1IF2A 4JICA 1W3IA 3FX4A 3AOFA 1R7OA 4HU4A 4Z42C 4IGHA 3TAOA 3WLTA 5CZSA 2AKZA