3W1AA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with 5-halogenated orotate derivatives
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
molecule tags Oxidoreductase
source organism Trypanosoma cruzi
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with 5-halogenated orotate derivatives
rcsb
total genus 108
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w1aA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w1aA01
5KITA 3NEVA 2ZZ1A 2YGYA 2GQ9A 5G5IA 3G3MA 3DFOA 1X7FA 4B5NA 1VGAA 4LC6A 3NG3A 5D02A 4N9EA 3L9CA 2V82A 3TQVA 3GZ3A 1LRNA 1OK4A 3MP4A 3F1QA 1M7PA 2E09A 3N2MA 3CC1A 1Z44A 1KV8A 4GC4A 3PUEA 3QM3A 3C52A 3NDOA 3W1AA 2YFNA 3EKLA 1EX5A 5AYZA 1SO6A 2A6LA 4LC8A 1W3NA 5K4ZA 5AHMA 3JS3A 3W3OA 4S2CA 3UWUA 1OJXA 2QCNA 4MY9A 2AAMA 4XQ6A 2TMDA 4JTJA 1K7EA 3UD6A 4IUOA 3T55A 5E0KA 1TB3A 4HSNA 3RFAA 1TCDA 2IQTA 3GDTA 4WUIA 2E1DA 1VZWA 2YYUA 2GVGA 3IIVA 5EPDA 1XL9A 2Y63A 3GB6A 3FYPA 4E0CA 5HR7A 3G1HA 3IIOA 3M5XA 1C8VA 3MBDA 2VFDA 3BGJA 3S5ZA 3LTSA 2CZFA 3SFKA 3PBUA 3W87A 1F6KA 1DV7A 2EPHA 4TMCA 3NQEA 3OEXA 4O15A 3LLFA 4BK9A 3ZWSA 1T8XA 4Q4KA 4ZQCA 1JCYA 2QKFA 4WOQA 2ZRWA 3CTLA 3L2IA 1FCQA 1EWEA 3TROA 2ZQ0A 4RR4A 1TTPA 3LHWA 3TIMA 3W85A 1W5OA 4UMBA 2BSLA 5D05A 2E6AA 1DBTA 5K4XA 1ZCOA 3W70A 5CGQA 1XCFA 3S0CA 1JULA 3LM7A 3UWZA 3W2LA 4JNMA 1T96A 3GKAA 1B4EA 2VFHA 2WNNA 2Q8ZA 4PTNA 2C16A 2NX3A 4U4MA 3HPZA 4UR7A 1OK6A 1GT8A 1PHWA 2NX9A 1O5XA 4RX0A 3M16A 1K8XA 3MP5A 1SFLA 3W7OA 4CCCA 4O8RA 1XXXA 4MZ1A 5CZTA 2QJHA 3LV5A 3NQMA 1W54A 1WBHA 4JX4A 2GVJA 3CHVA 2VEIA 3QFEA 3OBKA 5LSMA 4XTDA 2JGQA 3LV6A 2ZRYA 2EF9A 3GK0A 5DCDA 4KWWA 1GVOA 1Z41A 3ZFHA 1MSSA 4KKXA 5J5RA 4HIBA 3L65A 5TIMA 2YX0A 3QYQA 1NF0A 4MKNA 5D03A 1S5TA 3QW4B 2B7NA 3M1ZA 3MI2A 4ADUA 2CLMA 1RVGA 1WV2A 2YR1A 3E9AA 3W7IA 3G1FA 3W1PA 1XKYA 3KVKA 4Z1AA 4O10A 3UWWA 2DZVA 3M41A 4JN6A 1H1YA 1WYIA 4FO4A 3W2JA 2WO5A 2EAWA 1F76A 3A21A 4K36A 3EWZA 4HPXA 1Q6QA 4OE7A 5CG7A 1G4TA 3W2MA 1N55A 4IJBA 2LLEA 4WJEA 2NUWA 3KXQA 1LBLA 5G1YA 5DLCA 3HG5A 1R2SA 3W86A 4NJHA 4NJKA 1VR6A 4J9JA 4LS1A 2JK2A 3A22A 1KBJA 1FWRA 1FDZA 2QCMA 3NNTA 4AHOA 3OG3A 1XBXA 3W74A 3TJLA 4RXFA 1LLWA 4WX2A 3G1AA 3N73A 3QZEA 4FNPA 1A5BA 4DO6A 5F2GA 3L21A 1Z48A 1JQVA 1ICPA 4DBEA 2FPYA 5C5YA 3UY7A 4EOUA 3G0SA 3HIJA 4JR5A 4NJIA 1VCGA 5DCEA 2BWGA 3GXTA 3EWUA 3W1QA 1VC4A 3WK3A 5K9DA 1IXPA 2HMCA 3HG2A 3QEZA 3IGSA 2WJZA 4WOZA 2E6YA 3ATYA 2A7PA 5F4WA 3A5VA 4LTSA 2J88A 4G1KA 4O52A 2QAPA 4N9CA 2H6RA 1ZHAA 3W1TA 1MO0A 1I45A 3W7JA 4XZ9A 1SSDA 3L0GA 1AW1A 3RU6A 3OHIA 4UTHA 3L5AA 5K7JA 3N9RA 3ZWTA 4QIUA 1TV5A 1TJRA 1SFJA 2O7SA 5EL1A 5EY5A 3LCFA 5TBOA 1KFLA 4UFKA 3SJ3A 1QOPA 4IMEA 2Z6IA 3PBVA 1Z42A 1C9DA 4PCFA 3I7QA 4KFNA 2CZDA 3DFSA 3M5ZA 3IIXA 5FI8A 1T99A 3E12A 1QO2A 1H50A 3PAJA 4ZQPA 1NSJA 2BZNA 3TXVA 4JTTA 1F05A 2RDUA 5I3GA 2P1FA 4UIOA 2C14A 3HGRA 1ALDA 2E6DA 1TTJA 2ZTKA 4JIPA 1ZAJA 2YFOA 2J6XA 5FEWA 3DFPA 2ZZ7A 4RZ4A 4BR1A 1ME7A 1P1XA 2C19A 3ABSA 1OFOA 2C15A 2ZA2A 3NXFA 5AC7A 2WPBA 3CEUA 1R30A 4O13A 4UNKA 4HNVA 1SUXA 1EUAA 2V2HA 1HL2A 4CNOA 2VFEA 1GVRA 3GVGA 1OYAA 3T7VA 1GTHA 1WAUA 1KTCA 3NQ6A 2V5LA 1N7KA 1TV8A 1J4EA 1H5YA 3BO9A 3VKJA 1RQBA 1OFEA 1IXOA 4QNWA 3KAOA 1NF7A 1PL9A 2V2DA 3LHZA 1C29A 2ZZ3A 5HNRA 2ZZ4A 1K02A 2C3ZA 2CFFA 4O1DA 4ORMA 1X1OA 1OX5A 3I6RA 2HSAA 4WXYA 4AWSA 4O16A 1YYAA 4JTGA 3GXNA 3SIZA 1Q6LA 4LV4A 3NL3A 1MEIA 4CQ8A 1KV5A 4PL1A 4ZVJA 3C6CA 3WK0A 2PCQA 1Q6RA 5LNVA 1A5AA 1UCWA 2RKXA 3MI3A 2GUUA 4EF8A 3OVQA 4HHPA 4NNBA 1F2JA 2DZPA 2TSYA 4LVBA 3HGSA 3B8DA 4CQ9A 2FJKA 1YPIA 2ZZ5A 2X1UA 4OGZA 1ML1A 1KM1A 4Y90A 1W5MA 4TIMA 3STEA 3UXAA 3W7RA 1Q3NA 1TPEA 2J9YA 3LBMA 3SGZA 1OX6A 1KM6A 3G1YA 4M6QA 3C0JA 1UB3A 2JKEA 3N19B 4IXHA 3STCA 3ELFA 3BW3A 4OQVA 5KTLA 5KZEA 4IX2A 4KWVA 5F4XA 3GDRA 3S5YA 4S1FA 2GQAA 3CU2A 1H7XA 3WJXA 2VEPA 5I3HA 3P67A 2FB2A 3W22A 4O11A 1NEYA 1R46A 1V5XA 4FX7A 3V75A 3HJZA 1H7OA 1L6SA 2WQPA 3MMTA 3RLVA 5HR6A 4TO8A 2QCLA 4IWWA 3T44A 4MIMA 5I3JA 3LOTA 4YWIA 3W83A 3TX9A 3UQNA 2GVLA 3W2KA 1SW0A 2J27A 3QPZA 3BARA 4TMBA 3PF3A 3K30A 5D30A 2RDTA 3O1NA 3BLEA 5CPOA 3FOKA 2JGYA 3QRHA 1JJKA 1QOQA 4OWGA 5AOUA 1KM5A 4GXMA 1IIGA 3ZR4A 3BV4A 3W7EA 1OFBA 3TSMA 1M7OA 1YXCA 2TPSA 1YXYA 3JR2A 3QPYA 3GR7A 1W3IA 5BW6A 1S3HA 4XUGA 3B06A 5KZDA 3QF0A 3E49A 3PUOA 2OZ0A 1MEHA 3TCEA 2I14A 3DKJA 1TPWA 4DXVA 3P61A 1TPFA 4CQAA 5AC6A 5LKYA 4UTLA 3GNNA 5D38A 2XN2A 2CLKA 4P2VA 1P5BA 4Z1DA 4A3UA 1GEQA 4MVAA 3W2NA 2GJLA 4M7SA 4JS3A 3CWNA 3R12A 2X16A 2RFGA 5D04C 2RDWA 3MYPA 3NPUA 1B9BA 4C1LA 4NU7A 4LU0A 1Q6OA 3G8RA 4HNUA 4YCPA 1LRTA 5K3VA 5D2TA 2B7OA 4C1KA 1JCNA 3U6WA 2NX1A 3C2FA 1CI1A 5LGXA 3LTPA 1XI3A 6ALDA 4FXRA 3I7SA 1KLZA 2VFFA 2QUUA 3W7NA 4DF0A 1TPVA 3NO5A 4I7UA 3DGRA 3W88A 1DJQA 4O14A 4AXKA 3SI9A 1ONRA 3DFTA 2EHHA 2QCGA 3W1XA 1G6CA 3W1NA 4HPJA 1NAL1 3NZ1A 3U8GA 4EF9A 1E51A 3PVFA 1GQNA 3RMJA 2ZA1A 5HULA 3TAOA 4UTTC 3TFCA 1EB3A 5DBUA 3NQ8A 1UJPA 2DZTA 1W37A 3FYOA 3HQ1A 1KM4A 2TRSA 5H2ZA 3LCHA 4DF2A 3G0UA 1KTNA 2FQIA 2NUXA 5G2WA 1VQTA 3B4UA 2HTMA 1R2RA 3MI6A 1GVFA 1HO4A 2VEKA 3INPA 5FEPA 2KZHA 1AMKA 3P62A 4Y8FA 1W3TA 3N34A 3YPIA 1AL7A 1IXNA 2QCFA 3TW7A 4UTUA 4DPPA 1YTDA 4O18A 1FXQA 4AWUA 3GXPA 4N2YA 4LOCA 1A53A 2V30A 3NPXA 2Q8LA 2C13A 2QCCA 3M5YA 3W7DA 1QAPA 4Z08A 3SY5A 1LLZA 3HG4A 5LNUA 1X1ZA 1K03A 3RF9A 8TIMA 1SW7A 3NQVA 2H90A 4N6EA 2YSWA 2BLEA 1W56A 4O1BA 4BI5A 3M5VA 2H3BA 1B57A 1UUOA 4IPIA 1TO3A 1DQWA 3TMLA 3FJ6A 4I9AA 3P8JA 1DL3A 3M44A 2GPTA 5CPNA 1I2OA 2ISSA 3G8EA 1O94A 3P7YA 2ZDRA 3S1VA 3BVJA 5A5WA 1F7BA 3N9SA 3Q2DA 1W5NA 3SW6A 2WSRA 4K37A 5D2WA 1SU5A 4A2RA 5FF2A 1WOAA 4JX5A 1H60A 2PRMA 3W84A 2DP3A 1XC4A 4PEKA 1SO3A 3IIZA 2QCEA 2DU2A 2V0TA 1QPRA 1DVJA 4LV9A 1YXDA 3I68A 1P4CA 3UYCA 1DOSA 4ADTA 1WBJA 1MEWA 2QUTA 3GNDA 1FUYA 2OT0A 4JDBA 1KFJA 4LNYA 2ZTJA 2ABAA 1XUUA 3G1DA 3LHTA 4JY8A 4DPQA 1SR9A 5FF3A 1HFBA 3NPWA 3B0VC 2WKJA 4ZZ9A 3UZJA 2NLIA 1FQ0A 4L4MA 4ONVA 1LZOA 5L6UA 3VI2A 1OYCA 5LZLA 5FF4A 3B04A 3TSDA 4EIVA 5DN1A 4QJ1A 4ZQOA 1FCUA 1F73A 3LCIA 2C6QA 1I8JA 2BX7A 4QNEA 5MHBA 2A21A 4N4QA 3P74A 1I4NA 1R47A 2H3DA 4FNTA 3NQFA 4UTJA 3ABOA 3DKLA 4NT0A 3VE9A 4UFIA 4JDYA 3JRKA 1VYPX 1RPXA 3W1RA 2CLEA 5BMWA 3KVLA 3O6YX 5CPLA 1O4UA 1TJPA 4FNQA 4UTIA 4Y96A 2Y7EA 1GVSA 1YDVA 5ABTA 3LXAA 3S5NA 2EGZA 4ZQRA 3B03A 3LHVA 2P10A 1PIIA 3W76A 1DKWA 1GTEA 1ME9A 1RQHA 1TPH1 2GQ8A 3UPBA 4W9TA 1EWDA 4JIQA 4RZ5A 2DJXA 3P84A 4BWLA 1H62A 5C55A 2C1HA 1JCLA 3LCWA 3QW3A 4CCDA 1FWWA 4UUIA 4GUHA 3IV3A 4NNCA 1FX6A 1L6WA 1QWGA 1TPUA 2CZEA 2ZA3A 3H55A 4LUJA 2CWNA 3TV8A 4ZL1A 4IMFA 4IMCA 5CZJA 1GZGA 2Y7GA 5K9CA 2X1SA 3VCRA 5EBUA 1TPC1 4X9SA 1QCWA 3S8HA 2E77A 3U2OA 4O19A 3B05A 5I3FA 3EXTA 3FLUA 4OHQA 4WY0F 1LOLA 2OJPA 2V5BA 3TK7A 2DZXA 3T4CA 1GJPA 1YLVA 5G1TA 3LBCA 1OYBA 1ZJIA 5D32A 4Q32A 3LTYA 3STGA 4MFEA 2E5BA 1OHLA 1JCMP 5F2LA 3S6DA 5EA9A 1YDNA 2OCZA 3NQ7A 3DHDA 1M6JA 1FWNA 4FNUA 1PCWA 1RR2A 2WNQA 2QJGA 3THAA 1RQEA 2FDSA 5CSRA 1TRIA 4DEFA 5AFDA 3QC3A 4X3ZA 1TRDA 2VFIA 4FHAA 2A0NA 3L67A 2A1YA 1THFD 2YCEA 5LNWA 4BWLC 1ZAIA 3AO0A 2NXIA 3MW7A 4LUIA 3EB2A 1VCFA 1WA3A 2VC6A 3OIXA 4I7VA 4CNNA 5KMYA 3MUXA 3ZS4A 1B3OA 3A24A 3LI0A 4LY8A 4GRSA 1G4SA 1OFAA 4QSHA 2A7NA 4K38A 2NUYA 1JRCA 3SZ8A 3R8RA 1WXJA 4UFLA 4XTIA 3OVPA 3QMRA 1PV8A 4GFSA 3GIYA 2G96A 4QQ3A 1JRBA 4O4VA 2DZUA 4FNRA 4FX8A 4LVGA 3UXDA 5A8GA 4BI6A 4MPQA 2Y85A 5FEZA 2R8WA 5IBXC 4GE8A 3Q94A 4POCA 3C2OA 4RLIA 1SZFA 1L6YA 1ICQA 4HKPA 2FFCA 5BNKA 3LRLA 4HNNA 2Q3RA 1W1ZA 3PSVA 4JYEA 3S42A 5E1QA 5HUPA 3IRDA 1H7PA 3GDLA 1O5KA 4TU1A 3GDKA 5AHEA 4U28A 4JXCA 3P81A 3E0IA 1KW1A 2PRHA 3LGEA 4JY9A 1TQJA 1EA0A 3DFNA 1Y0EA 5BRBA 4FEZA 3SR7A 3GAYA 5G2HA 3EX3A 2E5CA 4BI7A 4RXGA 3WJYA 1JCJA 3PUDA 1LDCA 2G97A 1YDOA 1LCOA 4AHQA 4MZ8A 1HUVA 3NL2A 5I3KA 5CZ0A 5LNSA 5EKYA 3KFTA 3MBFA 1LOSA 1VYRA 4GJ1A 4O17A 4LW7A 2VOMA 4BF9A 3QH2A 3WJSA 3O05A 4BFAA 1G7UA 3C2EA 3FKKA 1A5CA 1OFPA 3MYOA 1GG0A 3TC7A 3CEPA 3EWYA 3S9YA 3BK0A 1CX9A 3W07A 1QR7A 1OX4A 3N3MA 4UXDA 3VE7A 5BOOA 3P5ZA 3TA6A 2YYTA 4IXXA 3NM3A 4TX9A 2W6RA 5U4NA 4MJZA 4R33A 3C4UA 1W5QA 2B7PA 5DXXA 4HSOA 1VHNA 4AF0A 1QPNA 4NXKA 3FEMA 1EUNA 2ABBA 2GJNA 5DELA 3MP3A 1F5ZA 5F4SA 1AK5A 1P0NA 1DHPA 1PHQA 2NV1A 1H7WA 1XBZA 4RCXA 3W7QA 4NQ1A 2TYSA 1SO4A 1ADOA 5FF0A 3LRKA 4O12A 1ICSA 4ZQMA 2QCHA 3IEBA 3W72A 2VXNA 3L0KA 4XKYA 3PG9A 3R13A 4D2JA 1QO5A 1XUZA 3HB9A 5IBXA 3Q58A 4LT9A 4RKAA 2OMAA 1K7XA 3G0XA 4AF0B 2CZ5A 2X30A 2QEZA 2YPIA 4MFDA 1K3UA 2NXHA 4YMZA 3PY2A 1SSGA 5AHLA 1EIXA 1WOBA 2VKZG 1FCVA 1SZGA 3IVUA 1LBFA 1I2PA 3BPWA 4UTMA 2YDAA 2H8ZA 3R5EA 5F2IA 4HNTA 4P61A 4H4IA 4AVFA 4R53A 2R91A 3NPVA 2ZZ2A 2F7FA 5G4EA 4QITA 1F74A 1TPB1 4JGDA 4EVZA 4AAJA 1OX4B 3CPRA 2WSQA 2YW4A 4K39A 3CIWA 4RK8A 3FKRA 2C18A 4CNPA 2BXVA 2Z0IA 3GYEA 3NGJA 1JUBA 3HOJA 4NX0A 2XN1A 3NL5A 1GPWA 4K8HA 3NQGA 2O7QA 4IX0A 2Y89A 3ABQA 1IGSA 3TKFA 4GUGA 4CCEA 1OVDA 1VRDA 4DO5A 4LS2A 4NVTA 1EP2A 5D09A 5EYWA 1BKSA 4OV9A 5FESA 4YXGA 1MZHA 1QFEA 3IGXA 5HINA 1KM0A 3DXIA 1M5WA 4A29A 3PWAA 2I1OA 2NV2A 3D0CA 4H3DA 1BEUA 4Z0SA 1ME8A 4QISA 3NQCA 3G1XA 2E68A 4O57A 1IF2A 5LHEA 3C8FA 3FS2A 3KOFA 2X1TA 3VNDA 1ZAHA 3UPWA 1FWTA 4M5PA 2Y7DA 4AEOA 4MLRA 4JTIA 3LLDA 4ZQNA 2F84A 1QMLA 3E96A 3UNDA 4OT7A 4GBUA 3I7RA 5D33A 1F6PA 1AW5A 1PVNA 3W7GA 2VFGA 4Z0JA 1KFCA 4DBDA 3TU9A 3BG5A 2PC4A 3GAKA 3PULA 4JICA 2YW3A 3S1XA 2A85A 1FCBA 3TH6A 5DY2A 2R94A 4MLJA 5C2XA 3AJXA 1LP6A 1UBSA 3TUUA 3W9ZA 4OU1A 4FNSA 4O1AA 1GYLA 3BW4A 3P5YA 1AL8A 1JUEA 4WQ6A 5HWJA 2X2GA 2Z2UA 3SGUA 1XDMA 4FB7A 3KRSA 2P0OA 2DORA 3PS7A 3DI0A 4MOZA 3P80A 3OA3A 3S1WA 1TTIA 3LHUA 3OVRA 1O60A 3GR8A 4JYFA 4UNLA 2VEMA 1GOXA 6TIMA 4HN4A 3CLMA 4JTKA 5GVJA 3EX6A 1SZEA 4E2BA 3C61A 5FEXA 4O0ZA 1VS1A 4UMAA 1CW2A 3B0UX 2R14A 4LVFA 3W1LA 2QDHA 5HWMA 3UWQA 1DORA 3L5MA 1A50A 3WJWA 4GUFA 3S5OA 3VFLA 4NNAA 5BMXA 4R34A 1SO5A 3KX6A 1OG0A 1H1ZA 3DBPA 4CLMA 4Y9AA 3UWVA 4FX6M 2ISVA 5HMSA 4RV8A 4FXSA 1H51A 2CLHA 4JTLA 2A7RA 3PB0A 4GNJA 4OV4A 2RHGA 3W1UA 4S2BA 3PC0A 3PSWA 4XKYB 3DFQA 3A9IA 1FBAA 1NFBA 4MUZA 1PCKA 1Q45A 3UY8A 5DCBA 2Q3OA 1D3GA 4K7YA 5L9FA 4JTHA 2J9XA 4FF7A 1U5JA 3KRZA 4KFPA 2J24A 1FDYA 1JVNA 1KFKA 3MWAA 1K7FA 1G7VA 1ZY9A 4KFOA 1VH7A 3EKZA 4PA8A 2ZRVA 3EX2A 1EP3A 2Y62A 2DZWA 1ZENA 4ADSA 2X1RA 2W0UA 3G18A 3M9YA 3CQ0A 3TQ0A 1WQ5A 4O4WA 1HG3A 3QJAA 2ATMA 5AYXA 4UTWA 1XFBA 2A5HA 5D2YA 3CT7A 3QMSA 1S5VA 5AHNA 4A21A 1KM3A 1X8FA 2QDGA 3TFXA 1GWJA 1LORA 2XN0A 4MYAA 4X2RA 2QCDB 4UFHA 3W6YA 1LTDA 4DQWA 5SWUA 2QR6A 4LVAA 4A2SA 3G3DA 1A5SA 1V7YA 1VPXA 2QUVA 5AHFA 1TPDA 3TQKA 2ZBTA 1JCXA 3ABRA 4M6VA 1SPQA 3EWXA 4UC5A 3HG3A 5E93A 2WSYA 3WK2A 3QSRA 4JYDA 1UUMA 1HO1A 1U83A 1W8SA 5CZSA 5T26A 5C6MA 3N2XA 4JTUA 4IMDA 3N14A 5CSSA 2EKCA 3L66A 3V1PA 3ANYA 4GUIA 4Y6GA 2H8XA 4R7JA 3T78A 3TR2A 4XWUA 1I2QA 4NJJA 3WK1A 3KVJA 2AGKA 4X22A 3S1UA 5EMUA 1BWLA 2Y7FA 3DI1A 1LRQA 3R89A 3NQDA 3IIPA 2WOQA 3EWWA 3NQ2A 1AG1O 2E6FA 2RH9A 4UFJA 4PFMA 1TQXA 3EX1A 5AN7A 4YL2A 3HBLA 3LHYA 3G1VA 2DZSA 3UZ5A 1VCVA 3MHFA 3HO8A 5CKSA 3O07A 1KBIA 1KM2A 1O95A 3QQ1A 1AW2A 2CLIA 2G5WA 2Y61A 4UTTA 1UASA 3NM1A 5G4WA 3HPSA 1OFRA 4O53A 1T0OA 3W23A 3TJXA 4AWTA 3B0PA 3DU0A 5DXYA 2ZYFA 3P8IA 4UFMA 5DY3A 4RJEA 3QSTA 3TAKA 4N9BA 5H91A 1HTIA 3QMTA 4PODA 4E38A 1L9WA 1B4KA 1JR1A 3NA8A 4NUWA 1TTQA 2VENA 4UTKA 2JKPA 1TV7A 4E2DA 3M7WA 3Q37A 4JD4A 5HQEA 4NZJA 2PE4A 3CIXA 1TSIA 3EEGA 1XM3A 5D2XA 3WJZA 4NJGA 1QPQA 4DELA 2ISWA 5G2IA 3C2VA 1K8YA 5CPMA 1VHCA 5J5DA 1H7NA 4UTWC 1ZNNA 1L2UA 3PB2A 3O6CA 1H63A 1IXQA 2V8ZA 4YLWA 5K2ZA 3G1SA 4WY0B 3M43A 3DAQA 4FIQA 4O0KA 2OT1A 2DJLA 5KINA 5KSWA 1D3HA 2Y70A 5K9XA 3BW2A 3NQAA 5D2VA 3M0ZA 1WDWA 1I2NA 4O28A 3W2UA 5C54A 3W71A 4LRTA 2NZLA 3BGGA 4NZFA 1FY6A 3LXBA 1G67A 1ZFJA 4Q33A 4Z1CA 4DO4A 5AC8A 1DJNA 2PRLA 3I65A 4HT3A 2NXGA 2JBMA 3HGOA 2YZRA 1KLYA 2ZRZA 2FTPA 3O16A 4WY0A 1J2WA 3E02A 1WX0A 5AB3A 3GLCA 1G4EA 1RV8A 5F1VA 1W5PA 3HMJG 1PE1A 4Z1BA 1GYNA 4K8EA 4M7TA 3O6DA 1ZALA 4RZ6A 4WD0A 1FDJA 1OF8A 1VLWA 2AQWA 2V9DA 3HPXA 3EXSA 4FIRA 4JTEA 3W1MA 3IVSA 1KFEA 3BLFA 2WV8A 4MZYA 1I2RA 1D9EA 3TSBA 2XFWA 1W31A 3W7HA 4QM1A 5I3IA 1TIMA 2V2CA 4IOTA 1H61A 1YADA 3MO7A 3FA5A 3QQ0A 1SZNA 2J9ZA 3DENA 5TQLA 4M6PA 4JTFA 1FXPA 1OF6A 2FLIA 4TR9A 3MJYA 4N02A 7TIMA 5HJLA 5AHIA 1XBVA 4K7VA 2V81A 2QCDA 4EWND 3BG9A 3STFA 3TW6A 1LROA 4YCOA 1SW3A 3PG8A 1NVMA 2Z6JA 1RD5A 5HUOA 4MY1A 3UWYA 3LCGA 3NOEA 4WZHA 2CW6A 1TMHA 1BTMA 4IPJA 3SECA 3F4NA 5HWNA 3NR0A 3A23A 3H54A 3CWOX 3KVMA 1TREA 3TXZA 2ZRUA 3PR2A 3O15A 4XBSA 1JUKA 4AB4A 3W7CA 1JQXA 4UCGA 1QDSA 3P82A 2NWRA 3FFSA 3LDVA 1S5WA 4AHPA 1TYGA 4I7WA 3L68A 1EEPA 3H53A 3PM6A 4O54A 3LI1A 3PBWA 4IGHA 2ZRXA 1LYXA 3EX4A 3CB8A 1OABA 4K6AA 5LGZA 4AH7A 4N6FA 4H6KA 3TNOA 2Z1BA 4GWEA 3GKFA 2CU0A 1SQ7A 1VYSX 1GVQA 1J5TA 4ALDA 1YPFA 1QPOA 3LCXA 3FJLA 1KA9F 4O50A 3DHFA 2D73A 3TC6A 3KRUA 1VLIA 3BG3A 4UR8A 5IM51 4IQLA 3C3NA 4M19A 2GOUA 3LX9A 3P60A 4NXSA 2FPVA 1QNVA 5F2MA 3M47A 1IIHA 1RZMA 2CLLA 5FF7A 5KZMA 4JTSA 3KHJA 3W73A 2I9EA 1XDLA 4MJMA 3L5LA 4ORIA 3MHUA 3LERA 3C2RA 1W0MA 4IMGA 1FWSA 1OFDA 1P0KA 1GG1A 1DQXA 2B4GA 3LXCA 3W7MA 4PH6A 3O63A 1XBYA 1BWKA 1LOQA 3LB0A 4LWWA 4QAIA 3NYZA 1G69A 3A5FA 3LCLA 1KTBA 4MY8A 3RLUA 5DBTA 4A22A 2ZZ6A 3G24A 3L0NA 4AMAA 4DF1A 3F03K 4ZMGA 5D37A 3THQA 2VELA 3ATZA 4NX5A 1X6UA 1PS9A 1EPXA 3CM4A 2WNZA 3RK8A 3TDFA 4O1CA 3BLIA 1YTKA 1VJIA 3O06A 4LVDA 4GUJA 4LRSA 2FPTA 5LNRA 3TE9A 2Y6ZA 2YXGA 3M6YA 2JKAA 5LHFA 2QAFA 1OFQA 3NL6A 3IVTA 3NZRA 1G4PA 3HGJA 2ALDA 1YTEA 5F1UA 3G22A 2CLFA 3O8AA 3EXRA 3RNDA 3HF3A 4XBKA 2G95A 2Y88A 4JX6A 4LS0A 1N8FA 2NWSA 3DZ1A 4WXZA 4ML9A 1LBMA 3GX9A 2FB3A 3MHGA 3NVTA 3F4WA 5U7SA 4OBTA 1KFBA 3W7PA 3DH7A 3R2GA 4N4PA 3GDMA 2ZCGA 1MXSA 2HS8A 1EP1A 3LRMA 3PBYA 2ZFAA 4PC8A 2QJIA 4L4LA 5AYYA 3W7LA 2UV8G 3W75A 3TMQA 2A2IA 3EWBX 4N9DA 2OX1A 1LM1A 4PL2A 2C0AA 3T40A 2W79A 1K8ZA 3NAVA 3IGUA 3SSJA 2HS6A 4MYXA 2QF7A 3USBA 1R2TA 2FIQA 2A6NA 2E5DA 1H7RA 4UMCA 2CLOA 3WFAA 3FIGA 4ICNA 2B7QA 2PURA 2A4AA 2BTMA 3W7KA 2ATSA 3C56A 4JEQA 2B0MA
chains in the Genus database with same CATH superfamily
3S2LA 4AD1A 1NDVA 2GQ9A 3MV01 3N2CA 1TKKA 3PZTA 4MF4A 4N9EA 2V82A 3TQVA 3GG7A 2WLYA 2VZVA 1GOKA 4MM1A 4XZIA 3QV9A 2E09A 3N2MA 3WZ0E 3CC1A 3CUZA 3GO2A 4ZCWA 5ECVA 1GOQA 3PUEA 3QTGA 3C52A 5IRPA 1MW0A 3HFYA 2Z1VA 2FGLA 4AZ7A 2CHNA 4R85A 2WSKA 1EOKA 3EKLA 2IUZA 4AZ5A 1KWKA 3M0XA 2A6LA 3BLPX 1FWFC 4LC8A 5AHMA 3JS3A 4HMEA 2CITA 1N8IA 3UWUA 1OJXA 3ZSSA 1OC7A 4XQ6A 3I6EA 1K7EA 5H1WA 5E0KA 1DXEA 3OGVA 1J18A 5FACA 2GDQA 3IIVA 2J74A 1HXJA 2Y63A 3FYPA 1ISZA 2BY2A 3S5ZA 2AMXA 2VFDA 3BGJA 4B4FA 1DWIM 5M17A 3VOHA 2V3FA 3U57A 4ZQCA 4DI8A 2QKFA 1X8CA 1OADA 3L2IA 3TROA 2XGBA 3TR9A 1UD2A 2QUMA 1XRFA 2BSLA 2E6AA 1XWYA 1DBTA 3WQ4A 1XCFA 4UR9A 3UWZA 3W2LA 1T96A 3GKAA 1B4EA 2ESCA 5I7GA 2E9MA 5M3WA 4D6JA 2NX3A 3A3HA 1K6WA 1UWUA 1KNWA 3TYBA 1M65A 1OK6A 4EX4A 3LENA 5BZAA 2NX9A 4B91A 1O5XA 2VR5A 3ONCA 1FFRA 3AYSA 1SFLA 3AYVA 3AXXA 4MZ1A 4U5KA 3ZR6A 3GU9A 1W54A 3KL3A 3UJ2A 1WBHA 4JX4A 3QFEA 3RRAA 1EKOA 2O56A 3OBKA 3TTQA 4XTDA 7REQB 3TYZA 5EMMA 3DHPA 4HYWA 5J5RA 3IJIA 1XQKA 4NP7A 3IACA 3GNRA 3M1ZA 4ADUA 2CLMA 1RVGA 2YR1A 5A94A 3E9AA 4Q7IA 3G1FA 4GNKB 3W1PA 5CCZA 3H2MA 4O10A 2VZTA 2I5QA 3UWWA 4DWSA 2VR2A 1GJUA 3ABZA 1ZBCA 1UR9A 4JN6A 2POZA 4R27A 1PWMA 2FZDA 3VKDA 3V36A 3WDJA 2QQ6A 4K36A 3DG3A 5CG7A 4PE8A 1R6WA 1G4TA 1XIJA 3EDJA 1BRLA 4M24A 4IJBA 4WJEA 3KXQA 1CGXA 4J1OA 3HG5A 1R2SA 3EWCA 4NJHA 4NJKA 2NQLA 3CO4A 1YNYA 3NNTA 1FDZA 3A22A 1VBUA 3K46A 2QPXA 2YB1A 1VFOA 2P5NA 1XBXA 3WCZA 3W74A 1US3A 3TJLA 1XSJA 4WX2A 3QZEA 4DJED 1BVZA 5F2GA 1Z48A 1JQVA 3UY7A 3HIJA 1VCGA 3ZT7A 5AYIA 4OKDA 5K9DA 4B16A 1W9XA 3HG2A 2R1KA 4CNSA 4IL2A 2A7PA 5F4WA 2YCKX 4O52A 4N9CA 2H6RA 3GG1A 1MO0A 3W7JA 1JAEA 1SSDA 2HK1A 3OHIA 3L2MA 5K7JA 3N9RA 5EL1A 1Q66A 3T0DA 4W4QA 1QPKA 1UWAA 2ZWYA 4UFKA 4YTQA 1QHOA 4QBXA 1MQPA 4DM2A 1YEYA 3B8VA 4KRZA 3MUAA 1Z42A 1CTNA 1C9DA 5J04A 4IG2B 1KRCC 1CXIA 2IKJA 3FN9A 3M5ZA 3A4WA 4BZYA 4US5A 2A3EA 4PN2A 4TOQA 2QUNA 5TD4A 4ROPA 3QLLA 4PUDA 3MMUA 4GKLA 5I3GA 1TTJA 6CGTA 2ZTKA 2WMHA 3W38A 5KETA 4RZ4A 4BR1A 3KW3A 1DWGM 2XFYA 4B15A 2ZA2A 4P8WA 7PTDA 1S2WA 4WDXA 4Q8TA 3ZIZA 4H9UA 7ENLA 5T9BG 4HNVA 1O5RA 1TA3B 1WNOA 1HL2A 1W8GA 4CNOA 1K70A 1EGZA 2VUNA 3GVGA 1OYAA 1NQKA 1AUSL 1N7KA 4A3RA 3MCNA 2DT0A 1V6TA 3VKJA 4NKCA 3B4YA 1OFEA 1IXOA 4QNWA 1H2JA 4BQ5A 4GIAA 1W9UA 1CPUA 5I24A 2GZXA 3LHZA 1Y5XA 4C7GA 5HNRA 3AWNA 3ZYZA 4HOXA 2CFFA 3AIVA 3H2CA 3I6RA 3A64A 4KCVA 3IAQA 1YYAA 4JTGA 1DWHM 1EDGA 2NSOA 3CIVA 4CQ8A 5C2CA 1UOKA 1WKDA 3GNPA 3VNKA 4DUXA 5LNVA 1Y7VA 4S39A 3MI3A 4EF8A 4AZHA 1DXFA 4B5TA 1L6FA 3HGSA 1O6IA 1RY8A 3AZSA 2WHMA 2W92A 3B8DA 3W25A 2OVLA 3W7RA 3SGZA 2WHKA 1OX6A 3O9NA 3CL7A 3TLQA 3AMDA 1UH4A 3W27A 5A6SA 2GWNA 3C0JA 1UB3A 2JKEA 3N19B 3STCA 3ELFA 3REQA 1FP8A 5KTLA 1XCWA 1H49A 4HZ6A 3IV8A 1Z8AA 3UERA 1CXKA 2YL5A 2BGSA 3KTXA 1EZWA 2VEFA 1XFCA 4AD4A 4PTMA 2HDJA 2QCLA 2PDHA 1JZ2A 4QEEA 3T44A 1C9WA 5I3JA 1SJBA 3CNYA 3ITVA 1AH0A 3LOTA 4TVDA 5CH9A 4C6MA 4ZO7A 1DYSA 3UGVA 3UQNA 1SW0A 1GKPA 3BARA 5LXXA 2GDUA 3PF3A 4MDPA 4RNIA 4AZCA 4QFUA 4Q4SA 4NY2A 4AX6A 5CPOA 3QRHA 1JJKA 1QOQA 3W82A 3ZR4A 3FGCB 3W7EA 4MNKA 1OFBA 5JVLA 2GOKA 3ITLA 1YXYA 2BVYA 3JR2A 2XH7A 3QPYA 2ZXAA 3A3WA 5HAOA 3B06A 2ZKMX 1UH2A 3E49A 1YMYA 4F66A 3OZOA 2I14A 1TPWA 5AC6A 1W3KA 4P2VA 3VIFA 2QT3A 4A6GA 2BXZA 2X16A 3FGCA 2FGBA 1E71M 4OOUA 5I00A 3MDUA 1B9BA 4C1LA 4NU7A 3GXIA 4LU0A 1Q6OA 2QZRA 4X2PA 4QQUA 5K3VA 3RLHA 1KCKA 3U6WA 1CI1A 3WD2A 2PDFA 3CT2A 6ALDA 4FXRA 3Q65A 5GQBA 4PR4A 2VFFA 4O14A 3K4WA 2G4FA 2EHHA 3CWHA 4IT1A 4UZSA 2QCGA 4GYJA 3ITYA 1NAL1 3NZ1A 1AD4A 3U8GA 1TX0A 3WQ5A 4EF9A 4ZO9A 1E51A 1EJWC 3TFCA 3VGGA 2VTFA 5FAGA 2OO0A 2W66A 5DBUA 3K13A 2DZTA 5CLWA 3MUZ1 3GXDA 1KTNA 2NUXA 1QRQA 2OZ3A 1VQTA 4K2SA 3RMEA 3VC5A 1R2RA 3BCFA 1HO4A 3WNMA 5FEPA 2FHFA 3VO0A 4D72A 4AYSA 2YLAA 3CPUA 3F4DA 1IXNA 2QCFA 3TW7A 3GIPA 1X6LA 4O18A 5HMEA 4AWUA 2V30A 3LYEA 2PMQA 1V6UA 3H7VA 2DIJA 1QAPA 4Z08A 1C7SA 5LNUA 1LLOA 1SW7A 3F2CA 1RP8A 3AHXA 5D9PA 2D24A 2Y8UA 3M5VA 4BI5A 1QW9A 2H3BA 3MQTA 3LA4A 4W84A 1UUOA 3WQ8A 2PB1A 3FJ6A 1WDRA 3P8JA 1S2AA 3CV6A 5CPNA 3G6LA 1SR0A 1VD6A 1BQCA 1YHTA 1AMYA 3H23A 5A6AA 4HHMA 5A5WA 5HJYA 2OG9A 3N9SA 4AC7C 2QLYA 4A8LA 2WSRA 1TELA 2FZ8A 1V6XA 2GWGA 4JX5A 1JCTA 1DPMA 3T09A 1SO3A 2QCEA 3DUGA 4IFOA 1KCLA 3NJ3A 3HV9A 2NLYA 2BASA 4KF1A 3APGA 2BY1A 1EJXC 1DOSA 2HVMA 2MANA 1MEWA 2QUTA 2AQOA 3GNDA 4LNYA 2ZTJA 4JY8A 1Z3NA 4HSHA 5FF3A 1HFBA 3NPWA 1C8QA 3W37A 1HL8A 2DIEA 1IEQA 4PMNA 4L4MA 5I03A 3AYRA 4ONVA 3ZVHA 3FDGA 3OBEA 1LZOA 3K1GA 5ABGA 4E3TA 1KXQA 3WDQA 2OO6A 1IV8A 2PDNA 3OIHA 1JD9A 4DWDA 1XSKA 1I8JA 4QNEA 2PF0A 4G9PA 3B0YA 2WW5A 1R47A 1IEVA 3ABOA 2A3HA 3PZGA 3VE9A 4L56A 3D46A 1QBBA 1BYBA 1RPXA 1V3HA 4FNQA 5EB8A 2OGYA 1UR4A 3ANVA 4YVPA 2EGZA 3URBA 2J66A 1V4YA 2JEQA 1MUCA 2GQ8A 3H4XA 4DJDC 2F38A 4RZ5A 4FMVA 4RDWA 4BWLA 3OQEA 2C1HA 1JCLA 3LCWA 3M6DA 3ORWA 3EOLA 1CGVA 4HTBA 2WM1A 1C90A 1T7LA 4H7ZA 5CBBA 2YDQA 3L4ZA 3Q67A 1XIHA 1LT8A 3IV3A 1FX6A 1QWGA 1TPUA 2PDLA 4KCTA 4L65A 2ZA3A 3VTRA 5DT7A 2WBGA 1O12A 4IMFA 3OZMA 5CZJA 1EF2A 5K9CA 2X1SA 4MAZA 5EBUA 4IFKB 2HBXA 1QCWA 1VFMA 4CD5A 3SEPA 1UWSA 3T0TA 3M0YA 5I3FA 3TJ4A 4M6UA 3GXMA 3FLUA 4WY0F 2Z00A 1PB0A 2OJPA 2DZXA 3R0UA 1GJPA 3LBCA 1OYBA 2VL4A 1ZJIA 5JBEA 5F2LA 1JCMP 3K2GA 5EA9A 2Z26A 1RR2A 2WNQA 2WWDA 7XIMA 1RQEA 4AIUA 3UR7A 1J79A 3DEQA 2ACRA 3RAOA 4Q7NA 2VFIA 4QEHA 2A1YA 5H8PA 2XVNA 2CBJA 2VC7A 3W6MA 3WFZA 4CGTA 3QZ6A 4AQLA 3EB2A 4RDYA 4W93A 3VCCA 2VC6A 3OIXA 5CG0A 3MUXA 4QDWA 3CUIA 1A5UA 4ZENA 4F40A 4IGSA 1QJWA 4K38A 3KOXA 3R8RA 1C93A 2VHLA 2OLAA 4H04A 4QQ3A 4O4VA 4M3PA 5CJ5A 4I9JA 4MPQA 1G5AA 2XM2A 4GE8A 2INZA 4F0RA 3TN3A 1SZFA 2IKIA 1ICQA 4HKPA 4QJ3B 4RE3A 2PAJA 3LRLA 3N17A 2Q3RA 4M8UA 3S42A 2PZ0A 5E1QA 1DWJM 2NVAA 3S2JA 2W9MA 1ECQA 4I9TA 1HNYA 3GBDA 3E0IA 1KW1A 4CEUC 1LWIA 2OELA 1TQJA 3IUIA 3SR7A 1HP5A 3GAYA 3AALA 4H8UA 4ZE4A 5G2HA 2E5CA 4BI7A 5CQ1A 3GH7A 3WJYA 1E9YB 2WK2A 1HKIA 4JHZA 1AQFA 2CLPA 4GY1A 1DP0A 5EKYA 1R87A 4BA0A 4FZIA 3R11A 1JDDA 1R86A 5HJXA 1UZHA 3VDAA 2BG5A 2RDXA 3QH2A 1XSIA 4BFAA 3MPGA 2W27A 4OOZA 2Z25A 1GG0A 3TC7A 1K4HA 3CEPA 3EWYA 3BK0A 1DE6A 3W07A 1XQLA 4F3HA 4GI4A 6REQB 1PSCA 4HJFA 2WHLA 3KOZA 2YYTA 4MJZA 4R33A 1W5QA 3L23A 4GGHA 3RLGA 4NXKA 1EUNA 1J5SA 5DELA 3BAJA 1AK5A 1P0NA 1O66A 2OYMA 1KXTA 2F2HA 1AA1B 4WSJA 4HHLA 4H7VA 1RJQA 4J3TA 3VD9A 3AU2A 1GCYA 4ATLA 1DJYA 4O12A 1ICSA 1UD4A 2YIHA 4ZQMA 3BGAA 1FWBC 2PDQA 3W72A 3UG3A 3G0XA 4G7EA 2X30A 1FWAC 2YPIA 4C6IA 3N04A 1Z6KA 4YMZA 1JZ3A 1SSGA 4GC3A 3ARXA 4AFYA 3KTSA 1UKTA 1LBFA 3CZKA 2IXVA 2YDAA 3HQOA 1XYAA 2REQA 3W0KA 3N4AA 2QGYA 2VGGA 3B97A 4ECLA 2R91A 3CV7A 1ONEA 2ZZ2A 4ZR8A 4HU0A 3E5BA 3SQSA 4EVZA 4LBSA 3CPRA 3T0AA 2FJUB 1E55A 3CIWA 4HOZA 1HF6A 4DZHA 2C18A 5A69A 3VYLA 1F9CA 3GYCA 2BXVA 3NGJA 4NX0A 4IIBA 3D3AA 1JZ6A 4ICMA 3LG3A 5BXTA 1IGSA 3VUPA 3TKFA 3GFXA 1CZ1A 1Q7MA 4DO5A 1DE5A 5KZ6A 4LS2A 5D09A 2FZBA 4PCNA 4UTFA 5FESA 4YXGA 1HJXA 3IGXA 2WANA 2X7VA 4Y9PA 3I3DA 2CYGA 2XDFA 4C60A 2XIMA 4DIAA 1DTUA 1WZKA 1ZAHA 4MDOA 4MLRA 3TA9A 2CETA 3CK5A 3LLDA 1QMLA 1XV8A 1NDYA 5D33A 1F6PA 3N6HA 1KFCA 4DBDA 1R5YA 3WLSA 3BG5A 4XZLX 5AVNA 2B81A 3GAKA 4ZB5A 3S1XA 3GY1A 2A85A 2R94A 1IZJA 3AIWA 4ZE5A 4YS1A 2J7CA 1LP6A 1UBSA 3TUUA 3DECA 4D71A 3MA8A 4O1AA 3ES7A 1GYLA 3KBJA 2X2GA 2Z2UA 3SGUA 4FB7A 2XM1A 2DORA 3PS7A 4R9OA 3OVRA 4AIEA 3LMZA 1O60A 3GR8A 3T6CA 3BL3A 1GOXA 4HN4A 3VKBA 1SZEA 5A6MA 4E2BA 4XSLA 4B90A 5FEXA 3B0XA 4UMAA 1SJCA 3B0UX 4IFRA 3AIBA 2ACSA 5HWMA 1FH8A 3UZYA 3L5MA 1A50A 3VFLA 4Y7EA 4GG9A 3KX6A 3DBPA 1N8WA 1RXOB 3MKCA 3MT1A 4W8LA 4H2CA 4MNMA 2DW6A 4JTRA 4KQNA 1Q13A 4OV4A 1XX1A 3W1UA 3PC0A 2UY4A 3DFQA 3A9IA 1FBAA 4AU0A 1NFBA 2Y0FA 4P8VA 2PWUA 4PEEA 5EU9A 3AS2A 5L9FA 4K7YA 4GACA 1DJZA 3KRZA 2J24A 1FDYA 3RX4A 4U2YA 1V6VA 3VM7A 1UIPA 3O3RA 1ZY9A 3AHVA 4KFOA 3EKZA 5CC5A 2QGHA 4XIMA 2Y62A 2IPFA 3OB8A 2HE5A 3ABXA 2Z7GA 1CXLA 3LPFA 4JFSA 4O4WA 4N42A 1GOMA 3G6MA 3QY6A 4G5DA 3SGGA 3I10A 3MSDA 5AHNA 4A21A 1AJ2A 1KM3A 3CBWA 2QDGA 5CAHA 1LORA 2YA1A 3Q4DA 3I4KA 2QCDB 1LTDA 5SWUA 7TAAA 4L9ZA 4LVAA 3UFYA 3SRDA 1VPXA 3NDYA 2ZBTA 4K68A 3EWXA 3HG3A 3QSRA 3KEHA 1EFZA 5CZSA 5C6MA 4GI9A 3N14A 1KC7A 4AD3A 3ANYA 2ASHA 2O55A 3T78A 3TR2A 1YIXA 3V5OA 4HCHA 3R89A 6A3HA 3IIPA 2A3AA 4QS6A 1KD0A 4PFMA 1TQXA 2VMFA 4Z2JA 2GGIA 1MQQA 2X41A 2J25A 3HBLA 3TN4A 3AC0A 2Z2AA 3R79A 2NVCA 5MKGB 1O1HA 9XIAA 1AW2A 4XZBA 3NOYA 1TVNA 4B92A 5G4WA 3VM5A 3MSYA 4O53A 2G4JA 1T0OA 3LGDA 3H6OA 1KCZA 4H7CA 3IJ6A 3MZ2A 1JI2A 5DXYA 1L8PA 4UFMA 1J96A 4RJEA 1C91A 3DYPA 3QSTA 5H91A 3QMTA 3LGGA 3B40A 4PODA 4GVIA 1L9WA 5XIAA 3NA8A 4A4AA 4NUWA 2VENA 4UTKA 4IPLA 1C3FA 1TV7A 1PTGA 1KB3A 4W5UA 3M7WA 5AY7A 4KEUA 5AC4A 2JQXA 3DCPA 3CUJA 1TSIA 1MRAA 4RNJA 4A05A 4AMCA 4DELA 2ISWA 5IFPA 5DANA 3T2QA 5J5DA 3VNZA 1L2UA 4JL1A 5E09A 3ARYA 2OEKA 3QVQA 3R8GA 1X6NA 3M0IA 3WG6A 1NFPA 3EPOA 5K9XA 4DXXA 1R0MA 4W5ZA 2NT0A 5D2VA 4WCJA 1I2NA 4MG4A 2NZLA 4NASA 3AXIA 3QKEA 4IICA 3PJWA 2X05A 4XD4A 4UQBA 4DO4A 4DWSB 1B3ZA 3I65A 1TUFA 4PMYA 4DNMA 1XLBA 4LBUA 3E6EA 2WZHA 1WZMA 3E02A 1G4EA 5F1VA 2OGJA 1QNOA 4IF2A 4RZ6A 1TE1A 1FDJA 4HJWA 4GYKA 2V9DA 2OWWA 1TWIA 3EXSA 1VFUA 4LUSB 4HVXA 3KZSA 1D9EA 2IXUA 4D6IA 1HVQA 3VILA 5C8BB 5E70A 1W31A 3C0SA 3WUEA 4L6DA 3SCPA 3RX2A 2GGEA 2V2CA 3L4VA 4JZ5A 3TTEA 2YA0A 5FJRA 3WLHA 1T6MA 4E4PA 4NF7A 3BC9A 1P43A 2QMKA 3BV7A 4BF5A 3MJYA 4Y9OA 4Z2LA 3WLMA 1UPMB 5HJLA 4EWND 4NRRA 3S2NA 1LROA 4PTDA 3PG8A 3BJTA 2BNJA 4IPPA 1QW7A 4MY1A 3S46A 4UQAA 4IPJA 4MWAA 5HWNA 4KESA 3A23A 3KVMA 2WSPA 4HU8A 4RDVA 4PMXA 3GTIA 1X38A 3PR2A 3TXZA 1F4HA 1JUKA 1NH6A 2PWDA 3ITXA 1XYBA 4AHPA 4NYYA 4PSPA 1CXFA 4O54A 3LI1A 4GZEA 4IGHA 2ZRXA 1XGZA 3R4IA 4V33A 3EX4A 4GIYA 4AH7A 2INEA 4GWEA 3GKFA 3FA3A 2ADAA 1U1HA 2ZE0A 1GVQA 1VIZA 1YPFA 1C8XA 3FJLA 3UPMA 4S3BA 3SRHA 3KRUA 5M03A 3CQIA 4PUNA 1BQGA 2GOUA 1WE5A 3S83A 4NXSA 4BQ3A 3M47A 3W53A 4DRSA 4PUMA 3BH4A 3DYMA 3TTYA 2QJNA 1SGJA 2WMFA 3GTXA 4BY3A 1RPKA 4ORIA 5M1TA 4JPGA 2I9UA 3L12A 2X09A 4U2ZA 3CYJA 5FIPA 1FWSA 1OFDA 4GA8A 2B4GA 4PH6A 1KBLA 4MSSA 3TJIA 2ONEA 4QLJA 4NAEA 3II1A 3LB0A 5E0CA 2O0TA 3E38A 4QAIA 2PS2A 3WQOA 4OUIA 3LCLA 4J3XA 1GW1A 3E2QA 4AMAA 2ZZ6A 1DIKA 1J8VA 1Z89A 4H6QA 5D37A 3THQA 2TODA 3WEOA 1PS9A 3AFBA 2IKGA 3BLIA 2UY2A 4YNGA 1ISVA 1VJIA 1NIUA 3WF2A 1OIMA 1UP3A 2JKAA 3AS3A 5LHFA 4GH3A 2QAFA 1OFQA 4HNCA 4HYRA 1YNPA 2ALDA 3LN3A 2Y1HA 1J0YA 5C9RA 2ZX5A 1HJQA 3RNDA 3CZLA 3HQPA 1ISYA 4XBKA 1A4MA 4Q8WA 1WZLA 4ML9A 2FB3A 1UQYA 1BF2A 4C6LA 1KFBA 1DJHA 3GDMA 3LRMA 1BPLB 3GBEA 4X0VA 2GJXB 2QJIA 4ZO6A 4M1RA 3W75A 4AUBA 2A2IA 3CQKA 2DSZA 2OX1A 4PL2A 1LM1A 3A47A 2C0AA 3T40A 2P3ZA 5I6SA 2JFEX 4MYXA 3USBA 4D8ZA 3CXOA 1XD0A 2FIQA 4GIEA 3KCOA 1EC7A 2KAUC 7CGTA 3WFAA 3FIGA 2B7QA 2E9LA 2A4AA 3MY9A 4NI3A 4NRSA 2BTMA 1LL4A 3OODA 3E0LA 4JKKA 1AVAA 2PFHA 2HXTA 2DT1A 5KITA 3NEVA 2YGYA 2IMRA 5G5IA 3G3MA 3DFOA 1VGAA 2Q71A 3NG3A 2G8ZA 1OK4A 3ZZ1A 1J10A 1VIWA 2R9RA 4IFKA 1M7PA 1Z44A 3FV9A 4PMDA 1UR8A 1BYAA 4LYKA 3T2PA 3NDOA 5LA1A 1S2CA 4FLOA 3SY8A 2QXWA 3F2BA 3VDGA 1IQ8A 4JQ1A 4J28A 3T2OA 4S2CA 3M0JA 3UD6A 2F9RA 4DWSD 1K1DA 1TCDA 3VDHA 1VZWA 2VR4A 1OGGA 2GLKA 1XL9A 4J40A 1ZL1A 5HR7A 2WJFA 2DY3A 3H2EA 3IIOA 1Q6CA 3MBDA 4EANA 1ZB5A 1EJVC 5I07A 5H8MA 3W87A 1F6KA 5HDRA 4QHRA 3DBNA 4YPJA 3NQEA 1CDGA 9XIMA 3PPFA 3WLIA 3OEXA 2QPUA 3ZR5A 1JCYA 4IIGA 1HKJA 1L0PA 2OZ8A 2R24A 1FCQA 4BEQA 4B9ZA 1BF6A 1OGSA 1TTPA 2KX9A 4UMBA 5HPCA 4H9VA 2PDKA 5K4XA 1BXBA 1JULA 1MVYA 1BLIA 2C16A 1R7OA 3KL0A 4GY7A 1VAHA 1AQHA 4PB3A 1PHWA 4WGHA 3EOSA 4RX0A 4EXBA 2PC8A 4QLLA 2O9TA 4I90A 3VX1A 3OGRA 1GYMA 3K8LA 2WWCA 4GYPC 2DT2A 3B9EA 4XB3A 5CZTA 3LV5A 3NQMA 2D2JA 3CHVA 2VEIA 4JIRA 3GHSA 2JGQA 2ZRYA 2EF9A 2OFJA 5I79A 5DCDA 2Z1SA 6PTDA 1GPFA 2D2GA 3UR5A 2J7BA 2CCRA 1E3ZA 3FNDA 3PHAA 2YX0A 3QYQA 4JHOA 2QJMA 4MKNA 3N2OA 3UJRA 3MI2A 1TV2A 4LH8A 3T9PA 3C0LA 2VCCA 4JTAA 3AU6A 1XIMA 1H1YA 4NAFB 1VFFA 2RAGA 2WO5A 4CN4A 3ZT5A 1EXBA 3EWZA 1Q6QA 2XYLA 2IPWA 3PAOA 4FOKA 2VDHA 2NUWA 5A6BA 2DPEA 2F6XA 1H1NA 3W86A 2PGWA 2JE8A 3G5EA 4J9JA 1KBJA 2QCMA 4AHOA 1NP0A 3LNPA 5DMMA 3WMLA 3ZJKA 2CXEA 3OG3A 4LCQA 3AHZA 2WVVA 4RXFA 2P8BA 3K4AA 3HM7A 3N73A 2V67A 4FNPA 1MRQA 1ZTVA 1B90A 1QASA 1JZ5A 4D6FA 4EOUA 3G0SA 4NJIA 3GXTA 1VC4A 4MJ4A 2DDXA 1IXPA 1UH3A 3IGSA 2WJZA 4WOZA 2E6YA 3LZ5A 2J88A 4MB1A 3NZGA 2PTWA 5HQMA 4GQQA 4AVOA 3FEQA 4XZ9A 3BSGA 3RU6A 3VIJA 3L5AA 1SFJA 5TBOA 1KFLA 1AD1A 3SJ3A 5BXRA 2REQB 4IMEA 4KMQA 4OJYA 2Z6IA 3PBVA 3RN6A 4FPSA 4LB4A 4PCFA 1A80A 1OB0A 4A8RA 2WMIB 3I7QA 2PWFA 2CZDA 1U2YA 1L6GA 4PMRA 3ME3A 2CESA 4WSKA 3E12A 1XLCA 3E5PA 1NSJA 3B8UA 1F05A 1W1YA 2RDUA 4UIOA 1ALDA 1NOUA 4URIA 1XG4A 2YFOA 1F3XA 2ZZ7A 1P0DA 4W8BA 1XINA 1P1XA 2C19A 1PZ3A 4GX8A 1OFOA 1BWVA 3NXFA 4IGMA 3CEUA 4C6NA 4LGXA 2WM0A 4Q3MA 4NZCA 1NP2A 3URQA 3IJDA 3WLNA 1MXDA 2OWXA 2HVNA 4GHRA 3BAYA 3GVWA 3T7VA 2J7HA 1KTCA 3NQ6A 2V5LA 3H4GA 1TV8A 1J4EA 2ZX8A 1YKWA 4Y9MA 3SCTA 3R7MA 2OZTA 1PL9A 4G6CA 5AVHA 4IM4A 1NWRA 2ZZ4A 2D0FA 4PFHA 3OLEA 4XAPA 1X1OA 1OX5A 4QGCA 1A49A 2YKKA 1VFHA 3SIZA 1V6YA 1RBAA 4JIIX 4LV4A 3NL3A 3WH8A 1Q4WA 1MEIA 4Q8PA 3L4TA 2PTDA 3ENLA 4HMDA 3U3HA 5C9WA 1A5AA 4HA3A 1F61A 1F2JA 2DZPA 1CGUA 2TSYA 4LVBA 1JD7A 4HNLA 4MWAC 2ZZ5A 3MB9A 1CLKA 4YWSA 1ZP3A 1KM1A 1W5MA 2RJHA 3STEA 4XZWA 1Q3NA 1TPEA 1S5NA 3QGKC 1KM6A 2F2KA 4OIFA 3TN6A 5IXEA 3BW3A 4OQVA 4IX2A 4PMUA 3KBWA 2J13A 1E6RA 1P1MA 2ZX6A 4LEFA 3WJXA 5I3HA 4O11A 2RGMA 1V5XA 4FX7A 3HJZA 5EBAA 3WLQA 1L6SA 3MMTA 1FKWA 5HR6A 2OODA 3A12A 5DMYA 1EDQA 1K4GA 2FKPA 1W9BM 2IPGA 4MIMA 3WX7A 2XGZA 1QNQA 1W1IE 1P7TB 2GVLA 3W2KA 2XISA 3W24A 3VZXA 4TMBA 3CB3A 3V3WA 4PSRA 4QRNA 2RDTA 3V5FA 3BLEA 2JGYA 2XH4A 2Q8XA 3VMOA 1M7OA 1YXCA 2TPSA 1NFGA 1W3IA 2QDEA 3HTWA 2BY3A 1S3HA 4XUGA 3E0FA 3QF0A 4RW3A 2B31A 4TX8A 3DKJA 1ZBKA 1R9XA 4DJFA 4A3HA 4IG2A 3GNNA 3E0VA 4EPBC 2ISFA 1P5BA 4Z1DA 4A3UA 4MVAA 4MB4A 3UR8A 2IS7A 4M7SA 4JS3A 7REQA 5DRCA 3MYPA 3CZEA 2O4QA 2XIBA 3G8RA 4YCPA 1LRTA 3JVAA 2NV9A 5D2TA 2XIOA 4C1KA 1JCNA 1E6NA 1XYCA 2HV5A 2PGEA 4J2MA 4OVXA 4LUYA 4QCFA 3KHDA 3EAUA 4WDTA 3TTSA 3W7NA 4MB5A 3B8TA 4DF0A 4CQBA 4MWAD 4DZIA 1E6XM 1DJQA 4I3GA 1EQCA 2XIJA 1ONRA 5HBFA 3W1XA 2PZNA 1EF3A 3TQPA 3W1NA 1Z9AA 3SRKA 3LNMA 3SDOA 3WBWA 3PWIA 1BD0A 2ZA1A 5HULA 4UTTC 3RUBL 2OLHA 3KBMA 3SCSA 3ZVIA 3MVTA 3WYZA 3NQ8A 5FCZA 3HQ1A 3H26A 3UJFA 4DF2A 2FQIA 4MKSA 1TCMA 1POJA 2DFAA 4YTUA 3VIKA 3GU1A 4KEMA 4Y8FA 2P50A 3N34A 1AL7A 4B4HA 2DSUA 3N3TA 3N4FA 2QHAA 5FL1A 2Q8LA 3IUHA 5DMLA 1JL8A 4TXEA 1PKNA 5AYBA 1K03A 5C9XA 4N6EA 4WGXA 3MUY1 2VDIA 4O1BA 3BJSA 1RJRA 1GUVA 2V5JA 2CHRA 4IPIA 3TMLA 3VIPA 1DL3A 3M44A 1I2OA 1WDQA 2QIIA 1O68A 5FJPA 2ZDRA 3WF1A 2YCJA 4E8GA 3SCQA 3N6QA 1F7BA 1MYRA 1Q6FA 3QY8A 9RUBA 1NARA 3Q2DA 3SW6A 5A8QA 1NELA 2PDUA 4A2RA 5FF2A 1WOAA 2PRMA 2BVWA 3UCDA 3CZGA 4JFWA 4PEKA 1AZ1A 1BHGA 1BFNA 3OJGA 1GKRA 1YXDA 3TWAA 3UYCA 5CC7A 1FUYA 5D8ZA 4JDBA 5D9MA 4ZEPA 5C70A 4DPQA 3OA5A 4TTGA 4KT2A 3B0VC 3RIKA 3E3HA 4ZZ9A 3UZJA 3V1HA 1F3EA 4HPNA 2GDVA 1UOZA 1F6YA 2XFFA 5LZLA 5CBIA 2V63A 4ZQOA 4XZHA 5CPQA 1F73A 1NWTA 4LEQA 5A6TC 2A21A 3FSUA 3P74A 3SFWA 1FVPA 2H3DA 4FNTA 3NQFA 4UTJA 3DKLA 1V02A 1UA7A 4GI8A 1YRRA 2CKSA 4JDYA 3JRKA 1BRLB 5BMWA 3IANA 3KVLA 4S38A 2Y5EA 4PTXA 4UTIA 1W3LA 1KXHA 2ZDSA 2D3NA 2HQAA 1EX1A 3LXAA 1JXKA 4ZQRA 4BF7A 2W62A 3W76A 1IZCA 1GTEA 3UPBA 2DJXA 3ITTA 2ZC8A 3N1AA 4Z2IA 2EPNA 1JPIA 3QW3A 1DIOA 2OSYA 9CGTA 4E8DA 2HPMA 3CO8A 4HMNA 3IAPA 1TE6A 1JEZA 1RK5A 2CZEA 4GZIA 4XAZA 3NUKA 4B5WA 3H55A 3TV8A 4IIEA 4U3CA 4ZL1A 1QHPA 2GL5A 1CB7B 2HPIA 2BHYA 1V93A 4JTQA 1G9HA 1EDTA 4QG9A 3VCRA 4EK7A 2X1IA 1E9LA 2NQ5A 3PFRA 3S8HA 2E77A 4DB7A 1BXCA 5XIMA 2XVKA 3B05A 2GSHA 1LOLA 4G8TA 4H6RA 2XSAA 1YLVA 5G1TA 1IYXA 4KW2A 3WLLA 1E4NA 2D0HA 5D32A 4Q32A 3LTYA 3STGA 3T42A 4MFEA 2E5BA 1OHLA 3V0UA 1YDNA 2PDWA 1E56A 2YOCA 3DHDA 2VP8A 1MDRA 3OU8A 2D20A 5CSRA 2DVXA 1TRIA 4FLSA 3KOYA 1JNEA 3MDWA 1TRDA 1EOMA 4FHAA 1IZKA 3GNOA 1MNSA 4HZ7A 3LK6A 3L67A 1UC4A 2UY3A 5LNWA 1MZRA 3MW7A 4LUIA 1FWJC 4B2DA 3ARQA 4HHHA 1OC5A 1XLAA 1ZCCA 4GRSA 1RCOB 4QSHA 2A7NA 4C65A 1Q5MA 1TA3A 4Q4PA 3WD1A 2AGTA 1VFTA 4UFLA 4XD5A 4XTIA 1PV8A 8XIAA 1A4LA 1NWSA 1J9YA 3NURA 4DAFA 2D23A 4BI6A 1ZJAA 4ENLA 2Y85A 5A8NA 3UZXA 2OB3A 3BOLA 5IBXC 3C2OA 1M7XA 1KO0A 4QR6A 1FHDA 3QY7A 4F9DA 4GISA 1IT8A 2PDIA 1K77A 1TJ2A 2ZUSA 5CPTA 5HUPA 2DSKA 3IRDA 1H7PA 2JIWA 3GZAA 3GDKA 1QK0A 1EC8A 3OO2A 4JY9A 1XW8A 4C91A 1EA0A 3A13A 3UA3A 1V77A 5BRBA 4XAYA 1E4LA 1LUCA 1TJ1A 4HK6A 1ISXA 4GVFA 3PUDA 1JDAA 4MZ8A 1HUVA 3K5XA 2PLMA 3GWQA 1UP2A 2PI6A 3KFTA 3MBFA 5LIWX 5LIKX 3WN6A 1LOSA 4GJ1A 3VOJA 2VOMA 3WJSA 3BURA 3BUVA 1IEIA 1G7UA 3C2EA 1A5CA 2W67A 3PZQA 3WNKA 3WDRA 1CX9A 2BB0A 4WJXA 4E8CA 1JAKA 1OX4A 1XYLA 4WVXA 3DERA 3DC0A 4TX9A 4CNTA 3NO1A 1RP9A 4HU3A 4ZOEA 3GVQA 2ABBA 1ZPTA 1DHPA 1P6BA 2VX7A 4R7WA 2PPGA 4EKJA 4EXAA 3EB3A 5HK4A 2WXDM 4GCAA 3GVRA 2J6VA 1SO4A 1ADOA 4B5SA 4AG0A 1P0BA 2QCHA 3W26A 2FMNA 3WMSA 2VXNA 1EA9C 3D47A 1GQIA 3ZLHA 1PZ2A 3AMKA 3FSTA 4IHCA 1V79A 3HB9A 2HK0A 3CAQA 2QMJA 4LT9A 4RKAA 1AJ0A 2CZ5A 1HKMA 4MFDA 2QEZA 2GGJA 1OD0A 1OM0A 3DESA 1XPGA 1K3UA 1VBHA 3RCMA 1XIDA 3PY2A 4KCUA 1WOBA 2VKZG 1KGUA 1IGWA 3FA4A 3IVUA 3VPLA 2FTYA 2HNEA 3N13A 4UTMA 2H8ZA 3R5EA 4DUVA 2RGLA 2GSEA 4HNTA 1PX3A 3NYDA 4H4IA 3C86A 5A2AA 4XO7A 4EE9A 4AVFA 2PTXA 2J8GA 2QVHA 2E25A 4R53A 1M3UA 1R3SA 3H7UA 4AY8A 1TPB1 1AJZA 1D2KA 1UKOA 6REQA 4AAJA 4D6EA 2XSXA 2WSQA 5CZKA 1E0XA 4X9YA 3E2VA 3CUGA 4JEJA 3HOJA 2XN1A 1GPWA 4K8HA 3NQGA 2YXOA 1J01A 1QI0A 2O7QA 3GSMA 3RRXA 3CUHA 2PDMA 4H2HA 5EYWA 4PULA 4OV9A 1QFEA 2PCEA 1B3YA 3PWAA 1RCQA 1YX1A 2I1OA 3I4EA 4H3DA 2J78A 4QISA 1BG4A 4HCLA 2DT3A 2YBVA 3FS2A 3KOFA 3UPWA 2Y7DA 3S47A 1JFHA 1DJXA 4XO6A 6XIMA 1ZSXA 3BDKA 3PANA 3RR4A 1JG9A 2F84A 4WK9A 4DXKA 4C90A 4OT7A 3PFMA 4GBUA 3I7RA 1U30A 2P0IA 1PVNA 1AW5A 1VKFA 1FOBA 1QVBA 2WC3A 3PULA 4IQDA 4JICA 2NSXA 4A8IA 4M29A 1FCBA 3TH6A 3LMYA 1GQKA 1HL9A 1PTDA 4OU1A 1Q7ZA 4FNSA 3BW4A 2VZUA 1AL8A 2VWSA 3QV6A 2IW0A 3OA3A 3S1WA 3LHUA 3SN1A 4V15A 1KBBA 2AMGA 1JYNA 3EX6A 4NHVA 2GYIA 3GTNA 5I3DA 3ARPA 1HN1A 4DJFD 4JCLA 1CW2A 2W5FA 3SB0A 3VKCA 2X0HA 1TFVA 1VBGA 3WJWA 4Q6JA 1B5TA 4NNAA 5BMXA 2FHCA 3QZAA 4R34A 3STPA 3NGFA 3UWVA 4FX6M 2ISVA 5GNYA 2OOFA 4REQB 4JTLA 2A7RA 3HFTA 2RHGA 3FAXA 3FYYA 4GJJA 4XKYB 4MTVA 4GQGA 1OSEA 4MUPA 1KGXA 2FZNA 2HROA 2PUZA 3OBAA 3Q45A 1XISA 1E1CA 3OGSA 3UY8A 3T8QA 3T08A 4U10A 4NSBA 2J9XA 2PBOA 1TZZA 1U5JA 3CYVA 4FF7A 2DIKA 3L7RA 2E9BA 3WBXA 2GK1B 3PZMA 1XC6A 3NSXA 3PZVA 4DYEA 4PA8A 4QX4A 1EP3A 2F6UA 4JQAA 4K1GA 1VEMA 3CQJA 5B7YA 4ZB0A 2X1RA 1PIGA 3KBSA 3G18A 3TQ0A 1FTXA 2ZUVA 3S6TA 2PP0A 1XH2A 3CT7A 3QMSA 1Q6EA 3ECQA 3AAMA 1UG6A 3TFXA 4MYAA 1XLIA 4X2RA 3FVMA 4UFHA 4EACA 3E2RA 5AZ0A 3VNMA 4A2SA 1V7YA 1WXYA 2HVOA 3TQKA 1BGAA 3A4XA 5E93A 4JFVA 1UUMA 4DWSC 1HO1A 2OQHA 1W8SA 3CMGA 5T26A 3U0HA 3N2XA 4JTUA 4IMDA 5JBFA 2VUYA 3L66A 1ZUAX 4E6MA 3TOYA 4R7JA 3WK1A 1I2QA 3KVJA 2G41A 5EMUA 4JNYA 1OT1A 2JALA 3SCNA 4ATDA 5HXMA 1HQTA 3CHCA 2WOQA 2ZXDA 3SQMA 3C2YA 1JGMA 1MUMA 4PMJA 5AN7A 5HMFA 4LF1A 1JPDX 3UZ5A 2DZSA 3DX5A 4P5UA 5CKSA 3W02A 2WB5A 4KETA 2PP1A 4LAUA 1MFVA 4MGGA 4M51A 2J7FA 4C7FA 1UZ4A 1F3TA 1QTWA 3EA3A 4LNCA 2GUYA 3BAXA 1RAKA 2BS9A 2Y5SA 4MNJA 1JF5A 1LT7A 4J7RA 2NQHA 3N2TA 4E2DA 4XV0A 3HMCA 4JD4A 3VDBA 3CIXA 4HPGA 1M01A 1XM3A 5HOSA 3IJQA 1K9FA 3C2VA 1PIFA 1VHCA 3VD3A 1POKA 1K8CA 1H7NA 3QBUA 4F79A 2QYGA 1IEWA 4B3ZA 3O6CA 1H63A 1VEOA 5K2ZA 4F0LA 5CXPA 3RM4A 3DAQA 4O0KA 2OT1A 2DJLA 3T4WA 3LLXA 2Y70A 4C6KA 1PWLA 3AHYA 4HA1A 2AL2A 3NQAA 4ZB2A 1WDWA 4O28A 1UKSA 3BGGA 1B0IA 4LJ3A 4Q33A 4Z1CA 5AC8A 4LYQA 1EEXA 3T05A 3KP1A 2YCLB 4MNLA 4GJIA 4ZOCA 4HT3A 3WUFA 1KLYA 2C0HA 2FTPA 2WVUA 3O16A 5A3HA 3IPWA 4J4KA 1J2WA 1WX0A 4O1EA 2P76A 3GLCA 1RV8A 4LF2A 2FVLA 3BLOA 4Z1BA 5C7VA 1W17A 2JIEA 2WZEA 1DIDA 4IUGA 1KFEA 2P88A 3VNIA 4MZYA 4C6CA 2XZ7A 3NO3A 3RU8X 4QM1A 1K9TA 1PEZA 1RUSA 2EPKX 1RD6A 3VVGA 2WAGA 3U2CA 1HKKA 5BXPA 3FA5A 4GQ0A 2VI0A 4M6PA 1WB0A 1OF6A 2O9RA 4QTGA 4H8NA 1W9VA 1WDDA 1M03A 3BQ6A 4TR9A 4N02A 7TIMA 1PBGA 4AZ6A 4RE0A 3V5CA 4K7VA 2V81A 2QCDA 4CD8A 4GLEA 4JIEA 4S3KA 1EJUC 1E1FA 5CC6A 3BAIA 2BOEX 4N0RA 4ERIA 1XR2A 3REQB 3CMFA 3SECA 3H54A 1NOWA 3XIMA 2ZRUA 2C8NA 3TYCA 5CBJA 3GDBA 4AB4A 3W7CA 1HJWA 3R58A 3LPGA 3PZUA 2NWRA 4MJ2A 4CN1A 1AQ0A 2QPSA 1QI5A 4I7WA 3EA2A 4F4RA 1EEPA 2PWHA 3AHTA 3UG4A 1OABA 4LSBA 4K6AA 4XUYA 3C5QA 5MKGA 3H2OA 3VOCA 2CU0A 5HQLA 4A3QA 5CGMA 1J5TA 2GJPA 1S1RA 3T0CA 5BU9A 2D73A 3TC6A 4QE5A 4UR8A 5BU6A 4XD6A 1V3IA 4J3VA 3LX9A 3NTYA 3P60A 3MJMA 2FPVA 5F2MA 1IIHA 4FALA 1RZMA 5FF7A 4RE2A 4JTSA 2PDYA 3WQWA 1JYXA 3UG8A 3AIQA 1GGOA 1OG6A 2Z28A 3AUJA 5J8LA 2WCSA 2R1PA 1OBAA 1KBKA 1O7AA 3VX0A 2DSVA 2DUZA 4MY8A 4H00A 3RLUA 4UZUA 1QNRA 4ZMGA 4BQ2A 3QGVA 2I16A 2G3IA 2V3DA 4JQ3A 1XH1A 4NX5A 1EPXA 1YTKA 4HP5A 4MB3A 1R3RA 2FPTA 4AD2A 1V8EA 1M68A 2YXGA 1PJ9A 4DZ5A 4QP0A 3M6YA 5G4HC 3TZNA 3VZYA 1RBOB 3NZRA 1G4PA 4H9ZA 5F1UA 2CLFA 4YIWA 1O1ZA 1LQAA 3FDKA 2CIPA 4CD4A 2G95A 2Y88A 4JX6A 3SCUA 3DZ1A 2EG8A 2BOFX 4QG6A 1WZAA 4PZVA 4L1GA 5A6KA 3RXZA 4LYPA 3RPMA 4N4PA 3VFCA 2ZFAA 3HV8A 3UW6A 1A5NC 1R8LA 3W7LA 3TMQA 2WMJA 5FL0A 3TYEA 3WLJA 4D6HA 1UBPC 3EBVA 2OPJA 2QF7A 4ZFCA 2D1ZA 5T9CE 2A6NA 2QULA 5I2UA 2CBVA 1HJSA 3W7KA 2ATSA 2B0MA 3A6OA 1UWTA 1M53A 3PWGA 2I7GA 5GPRA 2ZZ1A 2XIQA 3N6JA 4B5VA 3VD5A 4IIDA 3R0DA 4B5NA 1B9ZA 2HE8A 1OWQA 3SADA 3MP4A 3IK2A 4JCMA 2BP1A 2PP3A 1E0UA 2DSWA 2GUBA 5T91A 3CUFA 1KV8A 2W3ZA 2WCGA 3WH7A 4HOWA 3RO8A 5HNTA 2PD9A 4YYCA 1GEHA 3KWXA 1M9HA 4A3YA 3MCMA 3W1AA 2YFNA 4E5TA 3IGHX 2Z4GA 2EG7A 1AH4A 4ACZA 5AYZA 3D3FA 3W3OA 2TMDA 4NYUA 3H24A 3QXBA 1NQ6A 4IUOA 3T55A 4AEFA 2ICSA 3EOEA 3RFAA 2IQTA 3GDTA 2DQWA 4ZBCA 4WUIA 1QI2A 3BAKA 2YYUA 3ZJ6A 4ERAA 1RA0A 3ARSA 4WDWA 3M5XA 1C8VA 1J2BA 4I8YA 1AODA 2CZFA 3A4JA 1KGWA 4WKFA 3PBUA 3WO8A 2EPHA 3UXIA 4TMCA 5A1AA 4O15A 1T8XA 4Q4KA 4M82A 1FRBA 2J77A 4W8AA 2G0WA 2ZRWA 1XS2A 3LHWA 3TIMA 3QGAC 1GVIA 1W5OA 4GKTA 5D05A 3CJPA 4HD5A 1ZCOA 3W70A 4AZCB 4QDMA 4DJFC 3ZT6A 4OFCA 1XYMA 4AW7A 3PTKA 3AWOA 4PTNA 4U4MA 3HPZA 3MV11 2VGIA 2XSBA 2ZADA 1OCBA 3KCLA 3AMGA 2G3JA 3QHOA 3M16A 1A0CA 5I5RA 3I6TA 4YU1A 3MP5A 5ABEA 4J35A 5A2BA 4CCCA 2WKLA 2QW5A 4L4PA 1H5VA 1AH3A 3SUUA 2GVJA 5LSMA 3KCJA 3LV6A 4M80A 1Z41A 1MSSA 3AOFA 3L65A 3F5JA 5JBDA 4ICCX 3URAA 5D03A 3GW0A 3WQEA 1C8YA 2B7NA 1S1PA 1U22A 1WV2A 4P7OA 4OTKA 1XKYA 1ZGDA 4LCSA 1HX0A 2DZVA 3T81A 4H83A 3QOMA 4UB9A 3VD4A 8CGTA 4I9MA 4R9XA 1WYIA 4FO4A 3W2JA 1UZDA 1F76A 2PWEA 3F5LA 3ZLFA 2CC0A 1XLDA 3OP2A 1E6SM 4OE7A 1N55A 2DGAA 3T0BA 2OXNA 3M07A 2PF8A 2LLEA 5EMJA 4CUCA 1LBLA 1VPQA 1UKQA 2VZOA 1UD6A 3QKZA 3N29A 3CLWA 5LIXX 3BZJA 4LS1A 3VMNA 3FX4A 3GG8A 4H9TA 1JNDA 1TUXA 5E9XA 1LLWA 2E8YA 3H2FA 1A5BA 4DO6A 3R0KA 4E3VA 3IWPA 4DBEA 2FPYA 3AMLA 1G1YA 5C5YA 1XICA 5E6ZA 3V0TA 1YW1A 4I6VA 3UNTA 1GHRA 4TTUA 1TMLA 4IP4A 4PBFA 3A5VA 4LTSA 4G1KA 5A6LA 2DW7A 2X0SA 3VC6A 3UP8A 1ZHAA 3CHFA 1P7TA 3KUMA 3L0GA 1AW1A 3KDOA 4QIUA 1TV5A 1RHCA 3K4DA 3AI0A 3UXLA 1K9DA 3KS6A 1UPPA 3A3XA 1DHKA 3L2LA 4GO9A 3GUWA 3PBMA 3WBEA 1JDFA 4XK2A 4L1XA 5AECA 1WUFA 1XLKA 3IIXA 1T99A 3FHQA 1IR1A 2DUXA 1TWZA 3GG0A 2XG9A 7A3HA 3PAJA 1EGVA 3TXVA 1R3WA 4L4OA 4Z17A 3MWCA 3WD3A 3ALFA 2C14A 3HGRA 3OW1A 1E9ZB 1ZAJA 4JIPA 2J6XA 1BYCA 2F61A 5FEWA 5D8WA 5A2CA 1R3QA 2BGQA 3TONA 2CERA 2WPBA 1R30A 4O13A 3OHMB 4UNKA 2BVDA 3VCNA 1EUAA 2GJXA 4PYSA 2R1NA 2G3NA 2V2HA 2RJGA 1E6PA 4KERA 4EPKA 1GTHA 3UYIA 3WL0A 1H5YA 2P3EA 3TYUA 5BROA 3ARTA 3KAOA 2V2DA 1QOXA 2ZZ3A 1ZQ5A 3OZYA 4L61A 2C3ZA 1PX4A 4ORMA 3CPGA 3GNXA 3VNLA 1IWAA 1DQUA 2HSAA 4WXYA 3PZ9A 3M4HA 1Q6LA 4Y8EA 2ZUWA 4KGLA 1KV5A 1TR1A 1G0CA 2WLZA 3WQ6A 4ZVJA 3N25A 2PLJA 1UCWA 2RKXA 2GUUA 4BEUA 1KFWA 1QI3A 4V2XA 3AXKA 3CTTA 1YPIA 4I6KA 2QS8A 2X1UA 4OGZA 3WQCA 1ML1A 4L1WA 4Y90A 1ZJBA 1E5NA 2GJRA 4TIMA 3VMPA 2BHZA 3AIRA 3OLDA 4OBSA 1R3TA 2G3MA 3QTPA 3KDNA 1OD8A 4S3DA 3WUBA 4M6QA 4MPKA 4RV3A 4IXHA 3LZ3A 1FA2A 3GDRA 3ID7A 4FS9A 4S1FA 3S5YA 1CT5A 3CU2A 3P3BA 3P67A 4HU4A 3W22A 5I02A 1R46A 1QNPA 3ERPA 1H7OA 2WQPA 3QR0A 3F7JA 4LPCA 4Q7BA 3QFWA 4GMEA 3UG5A 1W2VA 1V0NA 1ITXA 1TZ9A 3BCJA 3TX9A 4W86A 3QPZA 3G1RA 3AIUA 1JZ7A 4WF7A 2ZXQA 1W3JA 3K30A 1ODZA 3F4CA 4WLCA 4MKVA 2FH8A 4PTWA 1OCNA 3FOKA 5AOUA 4INFA 1ZRQA 1EJRC 1MDLA 1GVEA 3GR7A 2TAAA 1W1PA 1TG7A 2D2HA 4AZBA 2OZ0A 2XVGA 1EPVA 1FWIC 4DXVA 3P61A 1TPFA 2W61A 4UTLA 4GFIA 5D38A 2XN2A 2J7GA 1S2TA 1NDWA 3CWNA 4WKAA 2RFGA 3MVIA 5D04C 2RDWA 4Q8UA 3NPUA 1QWKA 4XZMX 1E6ZA 4BKNA 2WVTA 4Q8VA 1MFUA 4FR1A 3BAWA 3C2FA 2WBKA 4LAOA 3UJSA 5LGXA 1K6AA 2O9OA 3LTPA 2PDPA 2V68A 4PGLA 1KRMA 2MUCA 2QUUA 1A3WA 3L4YA 4UQDA 4I7UA 3DGRA 4JTDA 4Q6XA 2L5HA 5DO8A 4K1WA 2HRWA 3JU2A 3WY1A 4FA3A 3EGJA 3R6IA 1V3JA 1G6CA 3NWRA 2EEXA 4HPJA 1V0LA 1WKYA 2IQDA 3SCVA 1UD5A 3PVFA 2Q02A 1H11A 1UJPA 1W37A 1KM4A 2TRSA 4GK8A 2D69A 3G0UA 3CL6A 1VEPA 3B4UA 4PUEA 2EQDA 3CH9A 3MI6A 1GVFA 2FZ9A 1J11A 4O8AA 1AMKA 1W3TA 3YPIA 4DPPA 1YTDA 3F2DA 4HZ8A 1FXQA 2A79A 3PTMA 1ECEA 3AICA 1OT2A 3NPXA 2YDRA 1GQLA 6TAAA 4QSFA 3U9IA 1ADDA 3W7DA 1FFQA 1JPMA 3IARA 2ZWZA 3SY5A 2ISDA 3HG4A 2VRKA 4PUKA 3H2AA 3WH6A 2H90A 1RVKA 2YSWA 1VFLA 1W56A 1TV3A 1B57A 3CQHA 1TO3A 1DQWA 4KS0A 1W6TA 4D8LA 3NVDA 3HJEA 5XINA 1IHIA 2GPTA 3O0KA 3N9KA 3WQDA 2VCAA 1E9IA 2ISSA 3MUIA 2F6KA 1O94A 4I5XA 3S1VA 1C92A 3BVJA 4A8NA 3B3DA 2WJEA 2O92A 1C7TA 2FYMA 4K37A 5D2WA 1J6PA 1SU5A 4M56A 1R9YA 5IDZA 3UZWA 2DEPA 1H60A 3W84A 1BG9A 1XC4A 3SY1A 3IIZA 2V0TA 3UU0A 4AISA 1QPRA 3QV7A 4L5ZA 5C71A 2ZUUA 3PPHA 3CAVA 1S5MA 3I68A 1P4CA 2A3CA 1UWRA 4KGJA 3PPGA 2DZAA 3LY0A 1W91A 1XD1A 4ADTA 1CYGA 1YBQA 3AROA 2OT0A 2ABAA 1XUUA 5ABHA 1ITUA 5FOOA 1NWUA 4B5UA 3A4AA 4QE4A 2WKJA 1CLXA 1R85A 3AXMA 1FQ0A 2VM8A 2QIWA 1EGMA 3VI2A 1OYCA 5FF4A 3B04A 3TSDA 3WDIA 4QJ1A 5HANA 1S3TC 3VGDA 2C6QA 5D9NA 2BX7A 5M5DA 5MHBA 1W3HA 1OCQA 3VOGA 1D8CA 1CLVA 2Z24A 3UETA 4ZSTA 4UFIA 1VYPX 2PU1A 2CLEA 3M0MA 1TJPA 3SURA 4Y96A 1GVSA 1MMFA 1ZU8A 5ABTA 1XLJA 3S5NA 4ZXLA 2PDJA 2IKHA 4CQDA 1DKWA 1ME9A 4JIQA 1ITQA 4DX3A 1P0EA 1E0TA 5EGRA 2OKTA 1T8QA 2CXGA 4J3SA 2ZUNA 4UCFA 3HURA 4CCDA 1CXEA 1QNSA 4UUIA 1IR2A 4E4FA 1HZYA 4D9PA 3RCYA 3GD6A 3WIJA 2HJPA 1JZ8A 3BMVA 1XGDA 1XKJA 1LF1A 4GQBA 4WR3A 4WHBA 1ODUA 2X40A 4N7QA 5ABFB 1BSLA 1MQRA 1Y5VA 1WKFA 4TVCA 5BCAA 1V7AA 4ZGYA 2BHUA 3U2OA 1UMYA 3ARZA 2J62A 5EMKA 3H2NA 1A5MC 2WYSA 5HNUA 2Z2BA 3TK7A 3WMBA 3WH5A 4LAKA 3S6DA 4G7EB 1UD3A 5GJNA 1M6JA 4GXWA 1GONA 1PCWA 3KRBA 3C0QA 5IFTA 2FDSA 1JYWA 4DEFA 5AFDA 4BCEA 2A0NA 3UCQA 3KP0A 2YCEA 1ZAIA 2NXIA 1E73M 2JF7A 1VCFA 4I7VA 5FJIA 3SBFA 3ZS4A 3USZA 1B3OA 1VPYA 3LI0A 4LY8A 1US0A 1DWAM 1G4SA 3VNJA 1OFAA 2GGGA 3UBPC 1FHUA 4J5NA 1XLHA 3QMRA 3M0VA 3U7VA 4GH1A 3BICA 3MU7A 4HK7A 1US2A 3CV2A 2DZUA 4FNRA 4C6FA 4LBRA 5A8GA 3GUGA 3VGBA 2Q01A 4CVUA 2R8WA 4MADA 3Q94A 4POCA 3WLRA 4RLIA 1XLLA 1I1XA 3EDKA 3T1GA 4FI4A 1W1ZA 3K1DA 3PSVA 3O2LA 4DUWA 3TEVA 1E0WA 1O5KA