3W1AA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with 5-halogenated orotate derivatives
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with 5-halogenated orotate derivatives
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 108
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w1aA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w1aA01
4DELA 3BG5A 3PWAA 1OYAA 4UTLA 5EYWA 1JRBA 5HINA 1ME7A 4P61A 1TTIA 1K3UA 2H8XA 5G2HA 5KINA 1O95A 3EWYA 3O6CA 4MZ8A 2V5LA 4AXKA 2B4GA 3NQVA 3SY5A 2E09A 5HWMA 2E68A 1G7VA 4W9TA 1T0OA 1PHWA 1A5AA 4DO6A 4FX7A 1JCLA 5EMUA 2H3BA 1GEQA 3ATYA 4GUJA 3HGRA 1YTEA 2ZA2A 2OT0A 3EWUA 4R34A 5FEPA 3W88A 1Q6LA 3PS7A 2RKXA 3MWAA 4FIRA 1GPWA 3L68A 5F2MA 3YPIA 1KA9F 1TSIA 1U83A 1G4SA 1LCOA 3FYPA 1DV7A 1TO3A 4L4MA 3WJSA 4UFKA 1K8XA 3A24A 2ZZ7A 1GG1A 1UJPA 2R91A 3ZWTA 1KM0A 1QNVA 3LDVA 2CLEA 3R13A 5DELA 5I3IA 4B5NA 4K7VA 3GDRA 1I2OA 3W2NA 1KM4A 3MI3A 3GXNA 4MOZA 4UTTC 4Z1DA 1KLZA 4A2SA 4LVBA 3NPUA 3HJZA 2TPSA 1YXCA 1H7NA 3TFXA 3HG3A 6TIMA 2QCFA 4M19A 2V2DA 1P4CA 4XZ9A 3VE7A 3Q58A 3SR7A 5EL1A 4JN6A 1WOBA 4UFIA 1LORA 1RQBA 3W1MA 3L5MA 3OBKA 2YFNA 4GUGA 4NJHA 4OBTA 4HKPA 3Q2DA 3BV4A 5FF3A 4FNUA 1VYPX 4LTSA 1HO1A 4UFJA 1ICPA 1W54A 2AQWA 4DBEA 2P0OA 1EP3A 1GVFA 3PB0A 1S5WA 2FB2A 3MHUA 1ZFJA 3S1VA 2JBMA 1FX6A 1K03A 5FF2A 3KRUA 4GNJA 5FF7A 2Z6IA 3I65A 3UD6A 3B0UX 3P67A 2VFGA 2RDWA 1W5PA 1VLWA 5I3FA 1MEHA 1PIIA 3FJLA 4TX9A 5CSSA 1OJXA 1YADA 5DY3A 1CW2A 1YTKA 3AO0A 4O53A 3B8DA 1R47A 2FB3A 3LI1A 3B4UA 1KTBA 1H1YA 4QNWA 1JCXA 4ZMGA 2NWSA 4ZVJA 2FPTA 4O14A 4HHPA 2CFFA 2GPTA 1XUUA 4RR4A 5G1YA 1P5BA 4OV9A 1KFCA 3W9ZA 1W5NA 3RNDA 3W1LA 3C56A 3LXCA 3R89A 1V7YA 2ZRWA 3LI0A 3W7OA 3TW7A 1LOQA 3U8GA 4K36A 4AF0B 2H8ZA 3NPWA 3B05A 4RKAA 4JX5A 2PURA 1F6KA 3EKZA 4LC6A 5D33A 5LZLA 3TUUA 1QMLA 4PEKA 3QQ0A 4JNMA 5AYYA 4IUOA 3IIOA 5FEZA 2E6YA 4BI7A 2ZYFA 4HNUA 4JX6A 2NZLA 1YXDA 3RLVA 1EWEA 1VYRA 4I7UA 3HOJA 1THFD 3C2VA 3JS3A 4XTIA 3PUOA 1PCKA 2OMAA 3S9YA 3BGJA 1KTCA 4K8HA 4OT7A 4UTJA 2YR1A 3PG9A 3GVGA 3IIPA 4UNLA 4AMAA 1H7PA 1W3NA 5D2VA 2ZQ0A 3LHUA 2ATSA 3NQ8A 4IPIA 2CLLA 3VI2A 5K9XA 4TR9A 4QISA 2JKPA 5HNRA 5LSMA 4XKYA 1EB3A 1OF6A 1MXSA 1UB3A 2ZZ3A 3HGJA 3S1XA 1IXNA 4MUZA 4LU0A 1AMKA 3VCRA 1H60A 2X1RA 1VS1A 3DI1A 4S2CA 4WXZA 1SR9A 2Q8LA 1OFOA 1IXPA 5I3HA 4M6PA 2QUTA 4WY0A 3SI9A 3TQVA 5K3VA 1M5WA 1KBIA 1PE1A 3ABRA 4X3ZA 3CHVA 5E93A 2X16A 2ZRXA 2A7NA 1ZALA 3GR7A 1LTDA 1NVMA 5G4EA 2QCMA 2ZZ4A 1SW7A 1KFEA 3OVRA 3TV8A 3EX4A 2ABAA 5H2ZA 5LKYA 1TTJA 3G24A 5HUOA 5FI8A 2VOMA 3UWQA 3NAVA 3W1PA 1QPNA 3CEPA 3HGSA 5C54A 1ZHAA 3RFAA 3C2FA 3G0SA 3Q94A 3QMRA 2VFDA 2VEMA 3C52A 4O4VA 3O1NA 2ZRZA 3IGXA 1KTNA 1GVSA 1TQJA 2CLIA 3EXSA 3G8RA 3GX9A 3WJZA 1HFBA 1L9WA 1Z48A 3B0VC 2PRMA 1J5TA 3HF3A 1B3OA 4JICA 1X8FA 3A9IA 2YXGA 3DKLA 1QAPA 1O5KA 1OYCA 1TV8A 1FWNA 4IGHA 3P80A 4LVDA 4RK8A 2W0UA 5KMYA 3DKJA 1Q6RA 3P7YA 3HG4A 3MUXA 5AYXA 3NEVA 2B0MA 3F4NA 4H3DA 4NJJA 3M41A 3QC3A 1WQ5A 3E9AA 2Y7DA 3TU9A 4O11A 2WNZA 5KZMA 3IIXA 2ZRYA 2WJZA 4O57A 4GUHA 1OVDA 3NVTA 3P62A 5F1UA 5EA9A 3T40A 3R2GA 1W0MA 4JX4A 1V5XA 2X2GA 4IMCA 4XKYB 3PVFA 3SECA 3KVLA 4NT0A 1A5BA 3GKFA 2FPYA 2CZDA 4MIMA 4UTKA 5LHFA 4I7WA 4CQ8A 2E5CA 1KV5A 1OX4B 2Y7EA 2FIQA 1FCVA 4QIUA 3LV6A 3GAYA 2EAWA 3UWVA 3OIXA 4EIVA 5K4XA 3P74A 3HPZA 2NUWA 3INPA 2ZTKA 4A29A 2DZSA 3S6DA 5AHLA 5D30A 3KX6A 1LBMA 1R2RA 2I9EA 5I3KA 5D2YA 1FQ0A 4KKXA 3OEXA 5E0KA 3HBLA 3JR2A 1LZOA 3BLIA 1AW5A 5AYZA 2Y62A 3CIXA 1EPXA 4QJ1A 5HJLA 1KM2A 4CNOA 3LBCA 1DL3A 3PSWA 5D2WA 5BOOA 3P81A 1OFQA 1GOXA 1W31A 1AL7A 1H63A 4UTMA 3OVQA 2ZFAA 4ICNA 1L2UA 3HG2A 3NPVA 4XQ6A 3FIGA 3L0NA 4IMGA 1OFDA 4JXCA 4OQVA 2J6XA 2ATMA 4AWSA 1I2QA 5D38A 5HULA 1LOSA 2ZTJA 3GLCA 4ALDA 4IXHA 4LWWA 1TTPA 3V75A 4AHPA 4UTIA 4JIQA 4WXYA 3LTPA 3LTSA 1XDLA 2G97A 4Z1AA 4BF9A 3BLFA 3NQAA 2P1FA 1QCWA 4NJIA 3QYQA 3W7QA 4XWUA 1TPC1 3A5VA 2Q8ZA 3UXAA 1KM5A 5KZDA 1SW3A 3IV3A 3NYZA 3LERA 5IBXC 4WD0A 4I9AA 2PC4A 4JGDA 4UTHA 1BKSA 3R5EA 3BO9A 3P60A 2J27A 3T78A 1SFJA 1GT8A 2C19A 3L0KA 4JTFA 1EP2A 4RZ5A 5A5WA 3O6YX 3L66A 1NSJA 1TMHA 4LUJA 3TK7A 2CLFA 4EWND 5FEWA 5GVJA 3BK0A 3S5YA 1GQNA 2PE4A 4Y9AA 4AEOA 3G1VA 3WFAA 1ZENA 4LS0A 3NOEA 5FESA 5KITA 1E51A 3W7JA 1XBXA 3LCIA 3W07A 2H90A 1H7XA 2NX3A 1TRIA 4NJGA 5HMSA 4CQAA 4UR8A 1NEYA 2FPVA 1R2SA 3SZ8A 1B4KA 3DAQA 4EF9A 5HQEA 3SFKA 1CX9A 1GVQA 2Y63A 5G1TA 3ZS4A 2V0TA 2BWGA 4JR5A 3PUEA 2VFHA 4TMCA 1KFKA 3KVKA 4JYFA 3W7GA 1XBYA 3W7CA 4DF1A 1JR1A 4ADSA 4WJEA 3P61A 1ALDA 1MEIA 1JUBA 3QM3A 1F6PA 3DENA 2GJNA 3A5FA 2A7PA 1KM1A 2IQTA 3EWZA 3LCGA 1TB3A 3CWOX 5K9DA 3PAJA 1TPUA 3G1HA 5DBTA 1OX4A 2NXHA 3M5VA 4RLIA 3H55A 2A7RA 2QCDB 3I68A 5C5YA 4MYAA 4GBUA 2QUVA 1H5YA 1F5ZA 3W1TA 1H61A 3I7SA 3W2LA 1RQHA 4LV4A 1C9DA 3Q37A 4HT3A 2OJPA 5K7JA 5LGZA 1H1ZA 4Z1CA 2QJGA 3HPSA 1H7OA 1LM1A 3GDLA 3DI0A 4RXFA 1I2PA 3I6RA 1JJKA 3G3MA 3MJYA 3NQEA 3CB8A 4XTDA 4JTTA 5FF0A 3TKFA 3W75A 3EXRA 5FF4A 1IXQA 3F1QA 2WSRA 3SGUA 4JDBA 3TAOA 2QKFA 3U6WA 3B06A 4LS2A 2J88A 3GYEA 2WNQA 4POCA 2HS8A 4YMZA 5AHIA 5CSRA 4PTNA 4E2BA 4LVGA 4WZHA 2VEKA 3E02A 3C61A 3M9YA 1JRCA 1OABA 3P5ZA 2P10A 4CCEA 3N14A 1YYAA 3OA3A 1SZEA 2NXIA 2DZVA 4BFAA 2WPBA 1AW2A 4L4LA 1KV8A 2J9YA 4Z0JA 1FWTA 5AHMA 3EEGA 2Y7GA 4BI6A 4LC8A 2QEZA 4MY8A 5J5DA 1W3IA 3HQ1A 4K38A 1X1OA 4PODA 4ZQCA 3WK0A 1LBFA 3C2OA 3SGZA 4BK9A 2V81A 1Q45A 2DZTA 1I45A 1G4TA 4UMCA 3EX3A 5H91A 4WY0B 3CTLA 3R12A 1QPRA 2Z2UA 4O17A 3L5LA 3BW3A 3NM1A 3ELFA 3EX2A 5D2TA 3RU6A 1WDWA 1W1ZA 4DBDA 1FCBA 3W73A 2H6RA 4OE7A 4RV8A 4R53A 3C4UA 4IQLA 3TW6A 2EKCA 3L2IA 1JCJA 3DBPA 2V5BA 4O16A 4UIOA 5K4ZA 1TPFA 5ABTA 4MJZA 3F03K 1K8ZA 1GVOA 4AWUA 2F84A 1QPQA 3DU0A 1EX5A 2FTPA 3L0GA 3LGEA 4JEQA 2VELA 1QOQA 1QO5A 3O8AA 2ZCGA 2DP3A 1OFAA 1L6WA 3NL5A 4ONVA 5BRBA 3LCHA 2X1UA 3GIYA 4O0ZA 1BTMA 4NQ1A 2CLHA 3MP3A 3G18A 5EKYA 3EWXA 3FEMA 1DQWA 1M7OA 2OX1A 2RHGA 2FQIA 3FYOA 3VKJA 5F4WA 1SZNA 1TPB1 3O15A 4HN4A 2B7NA 3B03A 2NXGA 3FFSA 3G1AA 4U28A 3H54A 3G22A 4CCCA 4A3UA 1OK4A 1SSGA 2ZZ6A 5SWUA 2NV1A 4GXMA 1N8FA 4FO4A 1TPEA 3CT7A 3UWZA 4OWGA 4OU1A 3TMLA 3BLEA 3L65A 2NUYA 4JTJA 3MMTA 4N6EA 4CLMA 4AB4A 3W2JA 3TR2A 2GVGA 3M6YA 3NZRA 1M6JA 3LHVA 4JD4A 2PCQA 3M7WA 4UTUA 3W84A 3L67A 5I3GA 4R33A 3PG8A 3HPXA 3G3DA 1TREA 1B57A 1F74A 2PRLA 3STFA 4FNTA 3IEBA 1OF8A 1ME8A 4IX0A 2X1TA 3W7DA 2YCEA 3F4WA 2YX0A 1I4NA 3GZ3A 3DFSA 4N6FA 2C16A 2I1OA 2YDAA 2XN2A 4XUGA 3OG3A 1FWSA 4O18A 3VFLA 4RJEA 4DF2A 1LRTA 3DXIA 2NX9A 3DHDA 3ZFHA 1ZNNA 3PSVA 2OCZA 1SU5A 3UWYA 4N9BA 4BWLC 2D73A 1G6CA 1RD5A 4RX0A 4UFHA 3KAOA 2ABBA 1F73A 4MKNA 2GOUA 4UUIA 4O1CA 3UXDA 3K30A 3DGRA 1Q6QA 3LHTA 4YXGA 2BSLA 1A50A 1DKWA 2GQ9A 1KFJA 4DXVA 3DHFA 3S1UA 4LNYA 2QCNA 5AFDA 3W7LA 3A23A 3PF3A 2XN1A 4UTWC 3KFTA 3S5NA 2ZA3A 4XBSA 3N73A 3M5YA 4IXXA 2YYTA 1GTHA 5DXXA 4ZQPA 2RDUA 2C0AA 2R8WA 2B7QA 3HG5A 5LNUA 3W87A 2ZRUA 1IXOA 3PB2A 1FDZA 4E2DA 1LRNA 2CZ5A 3V1PA 5KTLA 2CLMA 3TA6A 1XUZA 4NVTA 5HWJA 5CG7A 4A21A 4O8RA 2NLIA 1FDYA 4UCGA 2E6FA 4ADTA 3VE9A 4FNRA 1ICQA 2YGYA 3TAKA 4DO5A 1LROA 4AAJA 2DZPA 2XN0A 4IMFA 1LYXA 4WY0F 4Z0SA 3PR2A 5BNKA 1O60A 3S0CA 1GTEA 4ZQOA 3S8HA 1TJPA 4AH7A 3WJWA 2Q3OA 2E6DA 3W76A 2FLIA 4NUWA 3QMSA 4O1BA 4OHQA 5DBUA 4MJMA 1WBJA 3IGUA 5K9CA 3M0ZA 3TQ0A 1YDVA 2PRHA 5D37A 4FEZA 1DOSA 1SPQA 2CU0A 3W7KA 1TYGA 1WA3A 2QDHA 1FWRA 5AC8A 5DCEA 4RZ4A 2V9DA 3S1WA 2BXVA 2Y85A 4JTGA 4JTIA 4ZQRA 2ZBTA 1YPIA 1GVRA 2RH9A 1RR2A 1EUAA 1YDOA 5E1QA 3TROA 1KFLA 4JYEA 3B0PA 4AWTA 4GFSA 5AOUA 1XM3A 2AAMA 1W5MA 3ABSA 2Y7FA 2QJIA 3TSDA 3W1RA 1H7WA 1SFLA 1UUMA 3PM6A 1MEWA 1RQEA 4HSNA 1QR7A 2ZZ2A 3BG9A 3EWWA 4M7SA 4MY1A 1WYIA 4AVFA 3NR0A 1IIGA 1OFRA 3WJXA 1W8SA 4UTTA 4EF8A 4E0CA 3C8FA 2V8ZA 4J9JA 1KFBA 1P1XA 1MSSA 3LHYA 5KZEA 3DH7A 3EXTA 4NZJA 1G69A 5BMWA 3B04A 1KLYA 1XFBA 1J2WA 1TTQA 1VZWA 4JTHA 2X30A 3IVTA 5CGQA 3LOTA 3M5ZA 3KHJA 3DFNA 3QH2A 1ME9A 1XBZA 4NX5A 4NXSA 1JCYA 1VCFA 4WOQA 4EVZA 3FA5A 3W1AA 4O15A 1ML1A 1W5QA 4ORIA 3WK3A 1LP6A 3RF9A 2VC6A 2WNNA 3GAKA 1ZY9A 2QF7A 2A1YA 4GUFA 2CLOA 1YPFA 1SUXA 3NPXA 3THAA 3USBA 1LDCA 3O6DA 3LXAA 2DORA 2DZWA 2H3DA 4H6KA 1GZGA 1O94A 1JQVA 4CQ9A 3ZR4A 4O19A 1X7FA 4O54A 1VR6A 2QUUA 5CPNA 3TIMA 3TXVA 4PCFA 4ML9A 2WSYA 1J4EA 3THQA 2G5WA 2XFWA 3CC1A 3W7RA 3PC0A 2B7OA 1AG1O 2DU2A 3NQ6A 4JTUA 1FWWA 2TMDA 3T4CA 4LVFA 3FKKA 1YLVA 3UWUA 3VNDA 1LOLA 3G8EA 2V2CA 2R14A 2QCDA 3TXZA 3N2MA 4PL1A 2R94A 4JS3A 3O05A 3W86A 1F2JA 3NQFA 3O63A 2GVLA 1F7BA 3QZEA 3W2UA 3N2XA 4HNVA 4LS1A 3W70A 1ZCOA 1C29A 1RV8A 2VFIA 3LRMA 3P82A 3O07A 1KM3A 5TBOA 1AL8A 3W7IA 4P2VA 1ONRA 1WAUA 2C3ZA 4IMEA 4AHOA 3UNDA 5LNVA 2JKEA 1T96A 1RZMA 3GDTA 3LTYA 4GUIA 1NAL1 3FOKA 2DJLA 4UFMA 1TCDA 3LX9A 4OV4A 1JUEA 3CM4A 1ZAJA 6ALDA 2NWRA 3W72A 3LLFA 1G4EA 3SJ3A 3T7VA 3IIZA 2BZNA 3R8RA 1B4EA 3SIZA 3FJ6A 2F7FA 4OGZA 4DO4A 5AHFA 3W83A 1UCWA 3MI2A 5CZJA 5DLCA 3D0CA 1FXPA 4WOZA 2WKJA 2ISWA 3LHZA 3TFCA 4LV9A 1FDJA 4Y8FA 3G1SA 5BMXA 1JVNA 1WV2A 5CKSA 4ORMA 4HPJA 1EUNA 3QQ1A 4DF0A 3HGOA 5BW6A 4HIBA 4O12A 5U7SA 3NL6A 3I7RA 4FNQA 3S5ZA 1HO4A 2WV8A 1G7UA 4Y6GA 4E38A 1SO3A 3E49A 1LLZA 3BPWA 2FFCA 1TRDA 3W22A 3LCXA 4LRTA 4YLWA 1VQTA 2GQ8A 3GNDA 4IOTA 1C8VA 4UMAA 3QSTA 1QO2A 3GDKA 3JRKA 4LVAA 3WK2A 3QRHA 2G96A 3DFOA 3P84A 2O7QA 3S5OA 4AF0A 2NUXA 3W85A 2JGYA 2OZ0A 4IJBA 3C3NA 1OYBA 1QWGA 3PBYA 4JTSA 4H4IA 1FBAA 3PBVA 3G0XA 3E0IA 3L5AA 3KVMA 3LCFA 2WO5A 1NF0A 5LNSA 4FXSA 2Q3RA 3MHGA 4YCOA 4GRSA 1W37A 3LCWA 4BR1A 5AHEA 1I2RA 1MO0A 2ZZ1A 4BWLA 4FX6M 1GYNA 3L9CA 4CNNA 5DY2A 4IMDA 1ZJIA 2GQAA 1UUOA 5LNWA 3NZ1A 5G2WA 3W7EA 2TSYA 3BG3A 1PS9A 4RCXA 4HPXA 4Q33A 1DVJA 2Z6JA 4Z08A 3KVJA 1PHQA 4LY8A 4K39A 4HSOA 2A5HA 3N34A 1VHCA 3CPRA 3CLMA 1Q3NA 3UZ5A 4JIPA 1DJNA 4GC4A 3IVSA 4TMBA 3LCLA 1S5TA 3N9SA 1S3HA 3EKLA 1A5SA 4TIMA 3W1UA 1YTDA 1BWLA 1K8YA 2V30A 1TIMA 1JCMP 3SSJA 3ANYA 3G1FA 4UMBA 1AK5A 3TCEA 4JTKA 2I14A 1R30A 3C2EA 4KWVA 4NNAA 4WX2A 5AN7A 4MY9A 3NL3A 2W6RA 3KRZA 5DN1A 3GXPA 1TV5A 4N4QA 4DQWA 1JUKA 2HS6A 2Y61A 3KXQA 2E5BA 4DPQA 3M1ZA 3QW4B 4I7VA 4N4PA 1TQXA 3GXTA 3LRKA 4GWEA 2G95A 3NQ2A 2RFGA 1D3HA 3EWBX 4Y96A 1VC4A 2VEPA 1PV8A 1VYSX 4NX0A 3BW4A 3P5YA 3NQCA 1NFBA 2Z0IA 5J5RA 4O1DA 4Q32A 1OFBA 1EWDA 4KFOA 2HMCA 4MFEA 5G5IA 1MZHA 3T44A 1I8JA 2QDGA 1I2NA 4C1LA 4N9DA 5LNRA 2CZEA 3KRSA 1LBLA 5U4NA 4PL2A 2EGZA 3RK8A 4RZ6A 1EA0A 3FS2A 4JDYA 1VHNA 3QMTA 1YXYA 3HB9A 3L21A 4X2RA 1IGSA 1KW1A 3QEZA 4LT9A 1OFEA 3OHIA 1X6UA 1W3TA 5D05A 2HTMA 5C6MA 3GK0A 4QNEA 1LRQA 4O4WA 5FEXA 3W7NA 4O13A 1F76A 4S1FA 2NX1A 3IIVA 1QPOA 3LRLA 1XI3A 3U2OA 2VEIA 4O28A 1OX6A 1SO4A 4K37A 2YW4A 4GE8A 1WXJA 2O7SA 3TMQA 3NA8A 1XL9A 2UV8G 4WQ6A 2FJKA 1A53A 2J9XA 3UWWA 5T26A 4PA8A 2C18A 2NV2A 2CLKA 2DZXA 3G1YA 4M6QA 4LW7A 4JY8A 1Z42A 3NG3A 2TRSA 3W2KA 2VENA 4YWIA 3UPBA 4O10A 1SZGA 4R7JA 2WQPA 3QPYA 1N7KA 1WOAA 1Z41A 2BTMA 3GB6A 3QJAA 3W74A 1FUYA 1OK6A 1Z44A 3S42A 2ISSA 5EPDA 1W56A 1H51A 2B7PA 4K6AA 1OG0A 2E1DA 4LRSA 3EB2A 5L6UA 1WBHA 2A4AA 3PULA 4K7YA 1EEPA 2OT1A 3A21A 5CZ0A 3W1QA 2CZFA 5MHBA 4LOCA 5DXYA 4ZL1A 5EY5A 4MZYA 1NF7A 3W3OA 5KSWA 3PBUA 1BEUA 4Z1BA 1XC4A 4O1AA 1XDMA 1IIHA 2HSAA 5AB3A 3W1NA 4JTLA 2QJHA 5I3JA 5AHNA 1DQXA 3E12A 3NQMA 2JK2A 3O06A 5L9FA 3W71A 1P0KA 3BVJA 2AGKA 1M7PA 5IBXA 3M43A 3W2MA 8TIMA 2VFEA 3NM3A 5A8GA 2C1HA 3QFEA 4HNTA 1K7FA 3M16A 4FNPA 3W23A 2CW6A 4UFLA 2C6QA 2WOQA 1QFEA 4MFDA 4O52A 1D3GA 3MYOA 3TH6A 3TJXA 3G0UA 3TC7A 3BW2A 1ICSA 1FY6A 3N3MA 1A5CA 3NQ7A 5HUPA 5D2XA 5LGXA 3MI6A 3AJXA 4QM1A 1X1ZA 4M7TA 2Y89A 5D02A 4NJKA 3SW6A 3W1XA 2QCHA 2GUUA 5C2XA 3TJLA 1OX5A 1SQ7A 1VCVA 2ISVA 2YYUA 2ZZ5A 3GDMA 4A22A 4M5PA 1P0NA 4IWWA 3DFQA 2C13A 5F2GA 1DHPA 1VGAA 3LBMA 3LB0A 3H53A 3CQ0A 3UZJA 1GYLA 1H50A 4U4MA 7TIMA 2YFOA 1OHLA 1TPH1 3QW3A 1YDNA 4FHAA 5IM51 5HR7A 3CIWA 2EF9A 3FLUA 3MW7A 1CI1A 4NNCA 4O0KA 1S5VA 2VFFA 2W79A 1VLIA 2Y70A 5CZSA 2E6AA 3MHFA 1Q6OA 1L6SA 2A21A 4NNBA 1R2TA 5D03A 1H7RA 5K2ZA 3PBWA 5D09A 3NXFA 4ADUA 3A22A 1TPDA 2VKZG 4UXDA 1UASA 4LUIA 4EOUA 3DZ1A 2ALDA 3TE9A 3TC6A 3IRDA 2A2IA 5AC6A 1ZAHA 3LV5A 4S2BA 3MBDA 1L6YA 4DEFA 1JCNA 3NDOA 1DORA 2ZDRA 3LHWA 5TQLA 2DJXA 1G4PA 3TQKA 2A6LA 1K02A 3RMJA 2E77A 4AHQA 1HUVA 4A2RA 4D2JA 3GR8A 4X22A 1D9EA 4JYDA 3I7QA 4O50A 3NL2A 5CZTA 2C14A 5G4WA 1SO5A 3NQGA 3MYPA 4YCPA 1TJRA 1HG3A 1U5JA 4GJ1A 1SZFA 3MP5A 1QDSA 1RVGA 1SW0A 4FNSA 1ZAIA 1G67A 1PCWA 4YL2A 3IVUA 2QAPA 3WK1A 4NU7A 4N9CA 3G1DA 1EIXA 2BLEA 3N19B 2A0NA 2RDTA 1KBJA 3DFPA 2CWNA 2J9ZA 4FIQA 1TPVA 3CEUA 5CPOA 4KWWA 4UR7A 1JQXA 4N9EA 1OFPA 1R46A 5CPMA 2KZHA 3TNOA 1KM6A 3PY2A 4PH6A 1VCGA 1VRDA 5F4SA 3P8JA 3STGA 3UQNA 4X9SA 4PC8A 2YW3A 4JTEA 5AC7A 5HWNA 4QITA 5F2LA 2Z1BA 5TIMA 5F4XA 1LLWA 1XCFA 2C15A 4FXRA 3HMJG 2QCLA 1SSDA 3TSMA 4C1KA 3MBFA 3NNTA 4N02A 5C55A 3E96A 1B9BA 2YSWA 4MLJA 4UTWA 2QR6A 3NGJA 4UNKA 4ZQMA 4G1KA 3EX6A 1K7XA 5EBUA 3LM7A 4KFNA 1DBTA 1W5OA 1BWKA 4JY9A 4BI5A 2Y6ZA 3CU2A 4IX2A 4UC5A 2GJLA 4N2YA 1WX0A 2QCEA 3C6CA 4MYXA 4ZZ9A 2LLEA 1PVNA 2YPIA 3CWNA 3FKRA 4PFMA 1PL9A 3MP4A 3G1XA 3LXBA 2QCGA 3TSBA 1EP1A 3QPZA 2TYSA 3DFTA 2X1SA 2JGQA 1DJQA 4KFPA 2DZUA 2J24A 3GKAA 1O4UA 5D04C 5F2IA 4FX8A 5DCBA 1SO6A 2YZRA 3C2RA 1GG0A 1ADOA 3NO5A 1T8XA 5LHEA 3P8IA 1Y0EA 1UBSA 3WJYA 4CCDA 3EX1A 3T55A 3UY7A 1VH7A 3M5XA 2QCCA 2EPHA 1F05A 1FCUA 3M47A 3IGSA 1TV7A 4MLRA 4QQ3A 2A85A 2ZRVA 3ABQA 3BGGA 4NXKA 3QSRA 2E5DA 3W7HA 1FCQA 5CPLA 4Q4KA 1QOPA 4QSHA 3STCA 3HO8A 4DPPA 4TU1A 3MO7A 3W7MA 1GJPA 3STEA 4FF7A 1GWJA 1FXQA 4RXGA 4ZQNA 5DCDA 4K8EA 1VPXA 2GVJA 2ZA1A 3UY8A 1T99A 4QAIA 2EHHA 3OVPA 1XBVA 4HNNA 4IPJA 2V2HA 4TO8A 4XBKA 3UPWA 3W7PA 2JKAA 1XXXA 3ATZA 2A6NA 4MZ1A 3ZWSA 2Y88A 2QAFA 2BX7A 3C0JA 5G2IA 3TDFA 2VXNA 2FDSA 3LLDA 1IF2A 4FB7A 3N9RA 1H62A 3BARA 3HIJA 5D32A 2V82A 1JULA 3KOFA 4WUIA 1HTIA 4NZFA 3UYCA 5HR6A 1HL2A 3QF0A 1TPWA 3ABOA 1K7EA 3NQDA 4M6VA 3TX9A 1XKYA 2WSQA 1RPXA 4MVAA 3GNNA 4Y90A 3M44A 3PUDA 1VJIA 5F1VA 1AW1A 1O5XA 4CNPA 3W6YA 4MPQA 3RLUA 1N55A 3O16A
chains in the Genus database with same CATH superfamily
4DELA 3M0YA 3EOSA 1JRBA 3TN5A 5HINA 3C3UA 4A3QA 2W63A 1RCOB 3LUTA 3MT1A 5KINA 1GJWA 3MUZ1 3KUMA 2G4FA 3NQVA 1VIWA 4QS5A 1U2YA 1CXLA 1CLVA 4HSHA 1JCLA 1RA5A 2CBUA 1EH9A 2XGIA 4LYRA 2WWDA 2H3BA 3BOFA 3RIKA 3HGRA 1GQKA 3EWUA 5F2MA 4L1GA 1U83A 1CDGA 4L4MA 2BHUA 4UFKA 3L23A 3LG3A 3SCRA 1QNVA 3LDVA 2GK1B 3VU2A 2CLEA 1ADSA 5I3IA 4TV5A 4H9YA 3W2NA 1KM4A 2PDBA 4MOZA 5DF0A 1TKKA 2P0IA 2VWTA 2X40A 4OIFA 4A2SA 1UKPA 4WGXA 4XD3A 1RY8A 5HQLA 1RJPA 1XCWA 2WMIB 3NPUA 1BF6A 2BXYA 6TIMA 1QK2A 3MJMA 2FGLA 2GUYA 3AXXA 4HMEA 4KH2A 5EL1A 1WOBA 1LORA 1EDTA 3W1MA 3WFZA 2PGFA 2YFNA 5HXMA 4NJHA 4IISA 1HO1A 3FY1A 4UFJA 1ICPA 1IEVA 2OR2A 2AQWA 1JYXA 1GOKA 4JIIX 1YPXA 1A0CA 4G7EA 3VD3A 1F3XA 3LQLA 2G3IA 2OWCA 1KC7A 3QHNA 2FDMA 1VBHA 1EJTC 4FF5A 2D0FA 3FJLA 2VZUA 4BQ4A 4KESA 4TX9A 4CNUA 1OJXA 1YADA 5DY3A 1RP9A 1YTKA 3DC8A 3B9DA 3V0SA 4F3HA 4GIEA 1R9ZA 3N18A 3ENLA 1MQPA 1BXBA 2FPTA 4O14A 4HHPA 2CFFA 3GG7A 5G1YA 1N82A 4TVDA 4OV9A 4JKKA 2DSKA 3EEZA 3RNDA 2BMBA 3N04A 2ICSA 4G8TA 4KRUA 3EOEA 4K36A 4AF0B 3B8WA 3A13A 2PDLA 1F6KA 3DHPA 5LIUX 3IANA 1JDEA 4PEKA 4JNMA 3LGDA 3SAZA 5AZ0A 4BI7A 5HAOA 4UZUA 1EJWC 4Q8TA 4LBSA 4NSBA 4JX6A 3CH9A 3RM9A 3APGA 4ZB0A 1Q6CA 3RLVA 1QBBA 4TX6A 3JS3A 4AY8A 4Z2IA 4LBUA 3S9YA 4LUTB 1HJWA 3B8TA 4K8HA 4GG9A 2NSOA 4UTJA 4QXIA 1TWSA 1H7PA 2ATSA 3NQ8A 3VMNA 2CLLA 1SYTA 1POJA 5HNRA 4FR1A 1EB3A 1OF6A 3PBGA 1IEWA 1BG4A 1UB3A 3AS1A 4HNCA 3MV11 4F40A 1H60A 3LYEA 1VS1A 3DI1A 2F2HA 4WXZA 3AS0A 4DZ5A 1ITXA 2PF8A 3ARQA 5I3HA 4IJCA 1FKWA 4P8WA 1KBIA 1PE1A 1Y65A 3ABRA 2OKOA 5E93A 3WBXA 1TMLA 1V0KA 2X16A 2ZRXA 2A7NA 2QUMA 4HK5A 1ZALA 2PDXA 3TV8A 2ABAA 1TTJA 4A6GA 1TJ1A 4DUOA 4M51A 3SY8A 4JQ4A 2FVLA 1QPNA 1Z89A 3WMSA 3G0SA 1QUMA 2QDDA 2VFDA 3LS9A 2FZMA 2VEMA 3C52A 1SR0A 2ZRZA 3WDRA 4L1XA 3IGXA 1KTNA 3R43A 5CC5A 4G6CA 2D24A 3GX9A 1T5AA 1HFBA 1Z48A 3B0VC 2FH6A 4ML4A 3NJ3A 1JPIA 1TV8A 1W9BM 2DZBA 1FWNA 4M1RA 1ZBWA 4FP1A 3P7YA 1RBOB 4IMAA 1F4HA 3NEVA 1CLXA 1MZRA 4YVXA 1XH0A 1XIFA 3I3BA 3QC3A 1GUVA 1KCKA 1Q6EA 3PBMA 3F2BA 1UH4A 3IIXA 4LGXA 3WLMA 4ATDA 2WJDA 3CUXA 2WJZA 4O57A 3P62A 1E5JA 5EA9A 2QMJA 4ZB2A 4JX4A 2X2GA 1W1YA 3ARRA 4H7ZA 1H09A 3SECA 4NT0A 4XZNX 3HU7A 1BG9A 2WVSA 2XJ7A 4B5UA 2J25A 3OQEA 4MIMA 3LZ5A 2CZVA 1OX4B 2D22A 1DHKA 4JTCA 1BXCA 4WR3A 4QIUA 4JFVA 5B80A 3UZZA 1IR2A 2X09A 4IFKA 4D6FA 4XK2A 2PSNA 3IJ9A 5FACA 3RO8A 5AC4A 4A29A 2DZSA 3S6DA 4V15A 3W37A 1DXIA 5D2YA 2AQOA 1E0XA 1EGVA 2GDVA 1NFPA 1Q85A 2VCBA 2HNHA 3V5OA 3BLIA 3NWRA 1AW5A 5AYZA 2E9MA 2VGGA 1EPXA 1UD8A 1KM2A 3WENA 4CNOA 4D6CA 5M03A 3PSWA 1OFQA 5FSEC 1AL7A 1H63A 1J6OA 1L2UA 4MJ2A 3BXWA 4XQ6A 4IF2A 3T0AA 4GY7A 4IMGA 3SUSA 4S3FA 1TE1A 1MNZA 1XG3A 4DAIA 1ZP3A 4IXHA 4K1GA 1BGAA 3WH8A 3LTPA 3LTSA 3BLFA 2GGJA 4PMJA 3D47A 1A47A 3QYQA 1YNYA 4XWUA 4GFIA 3CV7A 7A3HA 1KM5A 3UZYA 4O1EA 5E9AA 3U5YA 4GYKA 5KZDA 2UBPC 3S9ZA 4WD0A 4I9AA 5EGRA 3AALA 3BO9A 3P60A 2J27A 1RLDA 4RZ5A 2IPWA 1OT1A 4XD5A 1HX0A 3K13A 1BVNP 5A8QA 1W9VA 1WUEA 5GVJA 3BK0A 3S5YA 3VNKA 4AEOA 5ECUA 3G1VA 1WDSA 4PBGA 4NZ4A 3CLWA 3IUIA 4W4QA 5FESA 5KITA 1E51A 1GKPA 4E6MA 1EGMA 3KS5A 3LCIA 1H7XA 4FLSA 5AZ1A 3VIOA 1NEYA 1R2SA 3MMWA 4GYPA 1B4KA 4EF9A 3GM8A 3SFKA 1LL4A 4S3DA 5LA1A 1KFKA 1ITUA 3W7GA 1XBYA 3GFXA 3IAQA 1UKTA 4DF1A 3AC0A 1ALDA 2YCLA 2OSYA 5LIKX 3A5FA 3VNJA 1KM1A 4IL0A 3IUDA 3A4WA 4Q8MA 2YCIX 3GFYA 1MRQA 1TPUA 4IGMA 5GJNA 1IWPA 4L4OA 3M5VA 2ACUA 4AFYA 1WB0A 2POZA 3H55A 1RVKA 3KL3A 3VOCA 3WQCA 1UKSA 1TWWA 4RE2A 4MYAA 3KCJA 3BQ5A 2QUVA 1H5YA 4LV4A 2VCCA 4V1XA 4M56A 3VOJA 3HPSA 3OLGA 3TTOA 3DI0A 2EJAA 2EPKX 4RXFA 1JJKA 1P1MA 1P48A 1Z7AA 3NQEA 4XTDA 4JTTA 5ABFA 3GFZA 3EXRA 2R1LA 4HBKA 3DC0A 4KRTA 4GGHA 3SGUA 4RL3A 5IXEA 2QKFA 2W91A 3P14A 3GYEA 1A5LC 1KRAC 5CSRA 5A6AA 3WLNA 4E2BA 3K1DA 2VEKA 3E02A 3EPNA 1JRCA 2OGJA 1OABA 3N1AA 1RP8A 2P10A 1TWDA 3SQSA 3OA3A 2ZKMX 2OEKA 4YYFA 2XSAA 1JI2A 1UR8A 3MVIA 2ACSA 2G3NA 3VNYA 2VURA 2INEA 1OGGA 2OB3A 3EEGA 1E5NA 2VWSA 4YIWA 3JU2A 4KBXA 4P8UA 4MY8A 2PU1A 5J5DA 4K38A 1X1OA 4KRZA 4YTQA 1LBFA 2ZUWA 1L0PA 2FZNA 3EX3A 1ONEA 5LYRA 3QFWA 1RJQA 4O17A 3KOYA 3NM1A 3A3WA 3WNLA 1F61A 1DE5A 3RU6A 1W1ZA 3GW3A 1FCBA 4DBDA 1F3TA 2B31A 5DMNA 3UR2A 2WYSA 3CAKA 4U33A 1JCJA 3DBPA 5DRIA 5DANA 1US3A 3CAWA 2VGIA 4J5NA 2JF7A 4C1NA 4AWUA 4U3CA 1VFLA 5DMYA 3L0GA 3BICA 1QO5A 3GNOA 4WDUA 1S2VA 1WKDA 2OLAA 1UWUA 2EPOA 1QK0A 1I60A 3MP3A 4FI4A 1JYVA 1R7OA 3EWXA 5CPSA 3ITCA 4IG2A 1DQWA 3QV9A 3FYOA 4XBJA 3RN6A 3LD5A 2P8BA 2WVVB 2XZ7A 3WEZA 1XD0A 4YTTA 2TAAA 2HK0A 3S5SA 4EPBC 2F6XA 3VGHA 1UR3M 2PGWA 4UOJA 3MPGA 4LUSA 1POKA 3U2CA 3SDOA 5G4HC 3FHAA 2C91A 3ARWA 3CT7A 3UWZA 4JTJA 1SJCA 1QU4A 3W2JA 3TR2A 3T2QA 4JD4A 4QQUA 2C7FA 1KCLA 3L67A 3PG8A 3BSGA 3G3DA 5BU6A 1TREA 1F74A 2YKKA 4GXPA 4ROQA 3TVAA 3WF2A 3W7DA 3BLKA 1R6WA 4XUGA 3WQFA 2HROA 4IQEA 5BZAA 1DJYA 4RJEA 2J77A 4AMCA 4ACZA 1PZ0A 4GVIA 2OCZA 5A8NA 1H41A 3R1ZA 3UWYA 1JPHA 4N9BA 5CGMA 3PTMA 1G6CA 1RD5A 4RX0A 2PMQA 3V35A 4MKNA 4O1CA 3UXDA 2PDIA 3IK4A 3WH5A 4LPCA 1NQKA 1VEMA 1HKIA 3DGRA 2C0HA 1Q6QA 1Q7QA 3OBEA 6CGTA 1WXYA 2DUZA 4ZCWA 4J35A 4LNYA 2INZA 1DJIA 1QJWA 2REQB 2XN1A 3CYVA 3EMCA 4UTWC 3XINA 4GACA 2XGZA 2ZUTA 4JN8A 3M0JA 2GYIA 1IEIA 2ZRUA 1IXOA 3SCSA 2YLAA 1LRNA 2CZ5A 1BXNA 3AYRA 4DJFD 3NIYA 3MWCA 3FNDA 2V68A 5CG7A 4A21A 2NLIA 1FDYA 3FA3A 4UCGA 3OBAA 2G37A 4ADTA 5HMFA 3H2OA 3L4UA 2YGYA 1QT1A 4DO5A 1KWGA 4XAYA 4AAJA 2XN0A 4IMFA 1LYXA 2WZMA 1WDQA 1AUSL 1E72M 2E4TA 5CPTA 4GYJA 4AH7A 3WJWA 2QYGA 3W0KA 4MB3A 3ZVHB 1HNYA 3B9AA 4XSLA 4ZGYA 3ONBA 4O1BA 5DBUA 2GGIA 3TQ0A 1YDVA 1X96A 2Z2BA 1DOSA 3AS3A 3VC6A 3N6QA 2CU0A 1TYGA 3CL7A 2PDWA 4GISA 3TNBA 4JIEA 2AAAA 3MANA 2BXVA 3WYZA 2ZBTA 1YPIA 2ZADA 5FAJA 1KFLA 1NWSA 5AOUA 2WSKA 4HPGA 2AAMA 4J3XA 2Y7FA 3L12A 4D72A 2D0GA 1DIDA 1J18A 3PM6A 3E1F1 4MB1A 1IE7C 1C3FA 4XZHA 3PZNA 2ZZ2A 1CXEA 3I3DA 3EWWA 1WYIA 5AC5A 4ZO6A 2OFJA 1W8SA 1JAEA 1C90A 4J9JA 4NP7A 4K8GA 5KZEA 4HU0A 1GHSA 4TUFA 2YBUA 3V0TA 2CBVA 3EXTA 1XLCA 3CMGA 2X42A 4LAMA 5CGQA 4CN6A 3CAVA 2NQZA 1FWEC 3IV8A 3B9NA 1DJXA 3DFNA 1JIBA 1I0DA 3II1A 3GXDA 1LT7A 3ALGA 1ME9A 4NXSA 3FJNA 2OSXA 1VCFA 2O9OA 4YWSA 3RO6A 4WOQA 4DIAA 1ML1A 4ORIA 5I06A 3UCQA 5JBEA 3VA8A 4TQTA 5ENLA 3GAKA 2A1YA 2CLOA 4ZSTA 3WNMA 1YPFA 3T81A 4Q8VA 3VNMA 4WDWA 1LDCA 1PYFA 4RW5A 1LG2A 2DZWA 1GZGA 1M04A 3AZSA 1UC5A 1R85A 3ZR4A 1X7FA 2Y0FA 3TIMA 1CNVA 2VC9A 3RRXA 3THQA 5CSUA 1L8PA 5A8OA 3TP4A 3PC0A 2PP0A 1AG1O 2WM0A 4PGLA 2YDQA 3FKKA 1YLVA 2PWVA 3MY9A 3U57A 4LQ1A 2CKRA 1J0ZA 4GJJA 4QRNA 4BZYA 2DVXA 3MUIA 3CYJA 2Z4GA 3I6EA 1AMYA 3HM7A 3O63A 2O92A 2OEMA 4H9VA 2WJFA 4FOUA 2P53A 3DYMA 5HOSA 2GVLA 1V6XA 3WDHA 3N2XA 2IQDA 2X7VA 3W70A 1ZCOA 1TV4A 1VBUA 2HVNA 1JDFA 2VFIA 3H12A 2DV0A 1TVPA 1AL8A 3WSUA 1ONRA 4IMEA 1RUSA 1F07A 4H8HA 3ZT7A 1NAL1 4UFMA 3LX9A 4BQ5A 1W1TA 3ZQ9A 4JEJA 3W72A 3IIZA 3R8RA 4GJIA 3SIZA 4DO4A 1R5YA 3WUFA 5CZJA 1FXPA 1HZYA 3NEHA 4QE5A 2ISWA 1TJ2A 3GYCA 4L65A 5BMXA 1AH0A 1QHOA 5CKSA 4FMVA 4NKCA 3TN4A 7ENLA 5D8ZA 4S23A 5BW6A 2ZE0A 4GVHA 3KP1A 4DNMA 4FNQA 2YCJA 3S5ZA 3QHOA 4HYRA 4J40A 1MWOA 5FJIA 1DQUA 1KRMA 3KBJA 1GGOA 3U2ZA 1KRBC 1VQTA 1C8VA 3KZSA 4IM4A 3MZ2A 1M7XA 4LVAA 2OXNA 2XIIA 3WQWA 1QNOA 3LMZA 3GDBA 1E0VA 4DJDD 4KW2A 4AF0A 4C6DA 3C8NA 4GH3A 5C0QA 3W85A 1Q2SA 1Z8AA 3NO1A 2IKJA 3PZVA 4IJBA 1U33A 3C3NA 1OYBA 3VTRA 3AMKA 3PBYA 1EC9A 4FOKA 4JTSA 4H4IA 1FBAA 3M0MA 3G0XA 5D8WA 1XYBA 3N15A 1H2JA 2WZEA 4YCOA 3LCWA 5AYBA 5AHEA 1HGWA 1I2RA 3G2GA 2PDYA 1ONWA 2PLMA 1GYNA 5LNWA 3LPGA 1M65A 1RAKA 1PS9A 1V6WA 1DVJA 2Z6JA 3BUVA 3K4AA 1QNPA 4LY8A 1PHQA 5CZKA 3ANUA 4JNZA 1XINA 3LBOA 2FZBA 4MGGA 4HTYA 4GC3A 1VHCA 3CLMA 1Q3NA 2A3LA 1DJNA 4RNJA 4TMBA 3URQA 1WAWA 5C9UA 3LCLA 4HN8A 1KGWA 1S3HA 4RW3A 1B54A 5FL0A 1TIMA 1RBAA 4W84A 4ZO7A 3G1FA 4GZIA 4KWVA 4A8LA 3RM8A 4W93A 3U2EA 4MY9A 2AKMA 1B1YA 1XLGA 4N4PA 3GXTA 2MANA 3RR1A 1ITQA 1EEXA 3FXYA 1PIGA 2Z25A 3WFLA 4LF2A 5J5RA 2YIHA 4B9ZA 3AXKA 1EWDA 3A3HA 2J7EA 4KFOA 2HMCA 4MFEA 4EKJA 1I1XA 4C1LA 5LNRA 3KRSA 1LBLA 3DFHA 4NG3A 4RZ6A 3FS2A 1KBKA 3GZAA 3MKCA 4K68A 3UFYA 3QMTA 5HNNA 4NAEA 2WVUA 4X2RA 1KW1A 3S2MA 4LT9A 4J3WA 1X6UA 5D05A 4QAWA 3IJIA 3BANA 4LAOA 5C6MA 1XF0A 3GK0A 4QNEA 1MW1A 4JCLA 4MJ4A 4S1FA 3RX2A 4W8LA 3CZGA 3IIVA 1QPOA 3U2OA 4EANA 3VCCA 1L2QA 1OC7A 1NDVA 3TMQA 4FA3A 3NA8A 3L4XA 3QKZA 4QDPA 3UBPC 2V38A 4UR9A 1A53A 4YHGA 5TF0A 2VT0A 4J3ZA 4LW7A 4JY8A 4DXXA 4H8NA 3VKAA 1AODA 3BL3A 4REQA 4S38A 3CO8A 2I16A 4WKAA 1JF6A 3BE7A 3CZJA 4O10A 3QPYA 3SCQA 2EEXA 3GB6A 3NZGA 1VP5A 1DPMA 3A47A 3WD4A 1OK6A 1Z44A 2NQ9A 3S42A 3GNXA 4NHVA 5JU6A 1ISVA 1H0GA 3T42A 2B7PA 4K6AA 2E1DA 3N29A 5A6TC 2Y8KA 1E9LA 2A4AA 2D3NA 2DZAA 1LLOA 3W1QA 2CZFA 4AIEA 3H4XA 5EFDA 4ZL1A 1NF7A 1ECQA 2O0TA 1JZ6A 5KSWA 4HZ6A 4QG9A 1VFSA 4I9TA 4Z1BA 3ZOAA 5CC6A 1CWYA 2QJHA 3P6LA 1DQXA 4CGTA 4GKTA 1YHTA 3CHCA 4FALA 3AMLA 1M7PA 3B9OA 4Z2LA 8TIMA 3VINA 5CAHA 5B7YA 2C1HA 3F5KA 1EQCA 2BY2A 3D46A 4LANA 4PMOA 3TH6A 2QGHA 4H01A 3VX1A 4HYWA 3P3BA 4ACYA 3MI6A 2PTWA 3BAWA 4W8AA 1N2VA 1F9CA 4Q7IA 5DX7A 3W1XA 1QOXA 4L7ZA 3TYZA 4MKSA 3SGGA 4EXAA 1SQ7A 5A6SA 4A22A 1A3XA 4IWWA 3DFQA 2C13A 1W6TA 3F7JA 1M41A 3TOYA 5EMYA 4UQBA 1S2AA 3CQ0A 1EQPA 1GYLA 4PUUA 4U4MA 1ZPTA 1OHLA 1O5RA 6ENLA 3TQPA 3T08A 1TFVA 3WZ0E 5CBBA 4GBDA 4UQ9A 3WQGA 3FLUA 3MW7A 4KS0A 4NNCA 3V1HA 3AMGA 1VLIA 2HPIA 5CZSA 2O4QA 4UOZA 1Q6OA 5IOBA 1R2TA 1H7RA 1U30A 5DO8A 5K2ZA 4OKDA 5BROA 5D09A 4P7NA 1IEXA 4LUIA 3EWDA 2EXOA 2ALDA 4WK9A 2WBKA 3IRDA 2G3JA 3LV5A 1VJSA 3RCNA 4WEVX 5ABGA 3MBDA 4DEFA 3LHWA 5TQLA 1R7AA 1G4PA 4US5D 4PRRA 7CGTA 3TQKA 3RMJA 4QEEA 3T6CA 2E77A 4MWAA 4AHQA 3DN5A 3VKBA 5CJ5A 4X22A 4LXFA 4JYDA 4KCVA 4O50A 3H2EA 5XIAA 3KTCA 4G7FA 1ENUA 3SCPA 2WSPA 5G4WA 4KEUA 4I9MA 1U5JA 1L6GA 1SZFA 1V3HA 3MP5A 2PC8A 3ZMRA 2E3ZA 3MSGA 3V0UA 1V08A 1PXGA 1E0WA 1QW8A 5FOOA 3W01A 3PP7A 2QAPA 2W27A 4NU7A 4HZ7A 4IUGA 1QI2A 1EIXA 3UERA 2RDTA 3V7PA 2J78A 4JIRA 4NZ1A 3TZFA 2PTXA 3UYIA 4NZCA 3KS6A 3KOWA 3I6TA 3CS2A 1XP3A 2RGLA 3B40A 4N9EA 4J7RA 1QPKA 1R46A 4WSKA 1CPUA 4JOMA 4CUCA 3TNOA 4PMUA 2RAGA 4PH6A 1VRDA 5F4SA 3WQEA 4AZBA 1MUWA 1O12A 2PWHA 5F2LA 1EOKA 3WUGA 5F4XA 1LWJA 3N2TA 4QJ5B 1SSDA 3EYPA 3DX5A 4C1KA 3MBFA 3NNTA 4GVFA 1B9BA 4MLJA 4NZ5A 2QR6A 4ZQMA 3NGJA 8A3HA 1UIPA 4WKHA 4HA4A 4KFNA 2YZ5A 1GZJA 1L8NA 4HCDA 4GYPC 3HA1A 2GWGA 4UC5A 3EOLA 1WX0A 2QCEA 3WD1A 5C9RA 2DT1A 3GG8A 1PVNA 3MP4A 4HPNA 2TYSA 4S3GA 2JGQA 2PDGA 1DJQA 4KFPA 3GHRA 3ZSTA 3GKAA 1O4UA 5F2IA 4FX8A 5MKGB 3UZWA 3VAVA 5TAOA 3LNPA 1ADOA 3UA3A 5DT5A 3P8IA 4B4FA 4C91A 3FV9A 1HKMA 4HOXA 1FCUA 3GTHA 4QFUA 3DG3A 1OM0A 4NXKA 5T9CE 1XYFA 2CESA 4KCWA 4D1IA 1JI1A 3LK6A 3WBYA 1QOPA 4QSHA 4GZEA 3FX4A 3MO7A 4IICA 3W7MA 3STEA 4FF7A 1GWJA 4JL1A 5DCDA 3PZMA 3T0BA 1JPDX 4XB3A 1VPXA 5M5DA 4QAIA 4TOQA 2EHHA 3OVPA 2AQVA 2V2HA 2NW0A 2OPJA 3TYEA 3AIQA 3PTKA 1W9PA 3ZWSA 4K3ZA 2BX7A 1PZ3A 2VXNA 3LLDA 6REQB 3RJYA 3QGKC 5FSDC 1H62A 1O7AA 3VGEA 3T0DA 3UG3A 4L6HA 1O6IA 1SMAA 4GIYA 1H1NA 5HR6A 2VX7A 3QF0A 1TPWA 4V2XA 1J11A 1RPXA 4ZOAA 3PUDA 1O5XA 1EXBA 3RLUA 3QV7A 2YL8A 3O16A 4JL2A 3BG5A 4UTLA 1ME7A 1T7LA 6A3HA 5AVHA 4GD0A 4CVWA 1K3UA 1ISYA 4AQLA 3O6CA 4HGXA 1HJXA 1UP3A 4LUTA 2E09A 5HWMA 1G7VA 4V1YA 4DO6A 4GY1A 3ITOA 4FX7A 2EBNA 2ZUUA 3PTQA 3AIRA 1I1WA 1GEQA 3ATYA 4L5ZA 1L6FA 3CHFA 4GUJA 2YJQA 1WZLA 3WDPP 1RPKA 2ZA2A 2OT0A 5FEPA 3W88A 1Q6LA 4GO8A 2J6VA 3YPIA 1GPWA 2ONEA 1A5KC 3FYPA 1DV7A 1TO3A 3WJSA 1K8XA 2ZZ7A 1UJPA 4Q7NA 1JD7A 2I56A 2R91A 3ZWTA 4DM2A 1E40A 4B5NA 3GDRA 3FYYA 1I2OA 1IT7A 3GXNA 3PZOA 4UTTC 3S3GA 1KLZA 3VCNA 2MNRA 4LVBA 3TOPA 2CWXA 2UZ9A 4QP0A 3HJZA 4IGSA 4ES4A 3TFXA 5XIMA 5CBIA 4M19A 4XZMX 2V2DA 1LQAA 4OOUA 3KHDA 3TJIA 3W82A 2ZX5A 3UJSA 3VGFA 3SR7A 1RQBA 3MV01 3OYZA 3OBKA 1V3KA 2HWGA 4G9PA 4GUGA 5I0DA 4LYPA 4LTSA 1V3LA 1D2KA 1E56A 4DBEA 5I03A 2Z29A 3RYSA 3PB0A 1ECEA 1ZFJA 3S1VA 2JBMA 4B9YA 2BODX 5FF7A 3QTPA 2Z6IA 3I65A 4S3EA 2Q8XA 4J27A 1W5PA 3SN4A 5HDRA 1J2BA 4EP8C 5CSSA 1VBRA 1E6SM 3WELA 3QOMA 2Q01A 2FB3A 3B4UA 4WVXA 5HNUA 2WCAA 4ZMGA 4ZVJA 2NVAA 1XUUA 3PHAA 1QNRA 1Q6DA 2OOGA 3C56A 1Q63A 3LXCA 3W7OA 3TW7A 1XIJA 5TD4A 2JEPA 2PWUA 1Y7VA 1PO9A 2PURA 3UT0A 3FEQA 4KGLA 1FFRA 5AYYA 4PMRA 3IIOA 5FEZA 4F4RA 1JF5A 2E6YA 1EGZA 2ZYFA 4Q4OA 4J3VA 1MDLA 3CUFA 4P8XA 3GXMA 2NZLA 4H41A 2HNEA 4ERAA 1C7TA 1VYRA 4LAKA 4I7UA 4AIUA 3N2CA 4Q4RA 2PDQA 3PUOA 2O56A 4HA0A 1XGDA 3BOXA 4QJ3B 3PG9A 5D2VA 4O1FA 2ZQ0A 3CL8A 4IPIA 2JKPA 1JZ4A 3WDJA 5LSMA 4XKYA 1FWAC 4H2CA 3HGJA 4LU0A 4QDWA 3KZPA 3BAXA 1C92A 3MCMA 3E5PA 1OIFA 4GVGA 3AXHA 1EKOA 3ITGA 1OFOA 3H23A 2WPGA 4M6PA 1QBAA 1E6QM 3SI9A 3TQVA 1M5WA 4DUVA 3VX0A 3VDGA 1K6AA 5C70A 4GABA 4JAWA 3GG1A 4F0HA 3PJUA 3U4AA 5G4EA 3CV6A 1LUCA 3OW1A 3EX4A 3N3TA 1W9UA 4AIBA 5H2ZA 5LKYA 3G24A 3P0WA 5FI8A 2VOMA 2XM1A 4HJFA 2WC4A 3W1PA 3CEPA 4RUBA 4H7VA 2HDJA 3GH7A 2XPKA 3O1NA 4HNOA 2C8NA 1GVSA 4KMQA 2VDIA 1L9WA 4Q8WA 1X8FA 4F0SA 2VI0A 3A9IA 4HHMA 1QAPA 1Z9AA 3BC9A 4ZOCA 3VDCA 4IGHA 3WY1A 1IWBA 1AJ2A 3SUVA 3P80A 3XISA 4S39A 1O1ZA 4B15A 1M68A 3DKJA 4PUWA 1Q6RA 1DTNA 5JUVA 3HG4A 3MUXA 3PFRA 5AYXA 1JZ3A 1DP0A 4XIMA 1UG6A 1BFNA 4H3DA 2DGAA 1P6CA 2OYMA 4RNHA 5E70A 3TU9A 3FW6A 3SRDA 2W3ZA 5KZMA 3ARYA 3UR8A 5I5RA 4DJEA 1OVDA 3NVTA 1BTCA 3AIWA 4ZR8A 3WH7A 4KCUA 5A8MA 1A5UA 3T4WA 2X2YA 3I10A 4EXBA 3KVLA 2FPYA 4UTKA 4O8AA 5LHFA 4I7WA 4CQ8A 2E5CA 1KV5A 4I5RA 4MSSA 3LV6A 2EAWA 4LUYA 4R3UA 3OIXA 2J74A 1FRBA 3P74A 3HPZA 1PKNA 2NUWA 3WDQA 1REQB 4M1BA 3SSZA 4DNHA 1ODZA 3GC2A 2QPSA 5A6BA 3VM7A 1Y5XA 1REQA 3JR2A 4GCAA 4CD5A 4QBXA 4XX6A 3WLLA 3ZT6A 4QJ1A 3RUBL 4AC7C 3EPMA 3LBCA 5BOOA 1S2CA 3KRBA 1LL7A 3K4DA 4NRRA 3HG2A 4HOWA 1OFDA 1ZQ5A 1A4MA 2J6XA 4OQVA 4PEEA 2ATMA 4AWSA 1I2QA 3CUIA 3GLCA 4ALDA 4B16A 1ZBKA 3IJ8A 4B2DD 3V75A 1U5HA 3CZEA 4AHPA 4JTDA 4NJIA 4B5SA 3W7QA 3CQJA 1FOBA 1VFUA 3UXAA 3LERA 3UEQA 5IBXC 3ZJ6A 4EAYA 2PC4A 4HB7A 1XISA 3THUA 4MDOA 4YHEA 1TV2A 4L9ZA 1RH9A 1JZ7A 3GR4A 1VFMA 4JTAA 1NSJA 1A0DA 1J5SA 1JG9A 2R1MA 3TK7A 1XLBA 2CLFA 4EWND 5FEWA 2PE4A 1G5AA 3H2NA 4WLCA 1ZJHA 1VF8A 3MS8A 5C2CA 4NL1A 4FLOA 3DYPA 4BEUA 4PFHA 4DY1A 5JBFA 5F7UA 1V02E 2V5DA 3DAQA 5G1TA 3ZS4A 4CEUC 4MNKA 2BWGA 2UWFA 2VFHA 4TMCA 3KVKA 4V27A 9XIAA 1GOOA 4DJEC 1MI3A 4QHRA 3DENA 4KEVA 2NVDA 1T6MA 1SMDA 1KBBA 3W81A 2QPUA 4J3TA 1WKFA 1QASA 1GOWA 2V5KA 1OB0A 5DBTA 2W5FA 4RLIA 4RDYA 4K1WA 4OOZA 2A7RA 1EO7A 4CD7A 2Q02A 4TTGA 3AQUA 1M1BA 2CEQA 4GBUA 3W1TA 1VAHA 4LJ3A 1RQHA 4OECA 5K7JA 1Y8BA 2QJGA 3IWPA 4L61A 1ZP4A 4AD2A 3MJYA 2PP3A 1HT6A 3CB8A 2UY4A 4U3AA 3TKFA 3W75A 4XZIA 1E4LA 5LXXA 8CGTA 4C6OA 3WUBA 1UR1A 1XIHA 1KKRA 4HA3A 4AZ5A 4D6EA 2WNQA 4DWSC 4POCA 3BLDA 1S5NA 2YL6A 3R0UA 4LVGA 4LAZA 2G3FA 2V3DA 3P5ZA 3R7MA 1QI3A 1B90A 4ZXOA 1CGWA 2BFGA 2CKSA 5EU9A 2DZVA 1RSCA 1XKJA 1AW2A 4L4LA 2J9YA 4ZSUA 4UBPC 1FWTA 5AHMA 2PLJA 5CPQA 2Y7GA 4B90A 4A3HA 4PMYA 1DWFM 3SCOA 3SURA 3UZXA 1W3IA 4YYCA 3C2OA 3KLLA 4BK9A 4LUSB 2V81A 1Q45A 2DZTA 4AISA 2Y1HA 4U2YA 2PDFA 3BSHA 1QPRA 3EGJA 3BW3A 2CNCA 2IUZA 3K1GA 5LA0A 3EX2A 1FWFC 2AOSA 1Z32X 4C6BA 5D2TA 3FGCB 3FXGA 3CV2A 1WDWA 3MMDA 3RM4A 4A8NA 3BZGA 4R53A 2WXDM 1YE4A 5BXTA 2VGFA 1E9IA 3TTEA 4L64A 4GIRA 5K4ZA 1XLIA 1Y5VA 3ES7A 4DJED 2CIPA 1EX5A 3VOHA 1YMYA 2FTPA 3DBNA 3V4BA 3GC4A 2ZCGA 1CXKA 2DP3A 4OFCA 1OFAA 5BRBA 4IP5A 4O0ZA 2A3HA 4GQQA 2WHKA 3G18A 1CB7B 1KQZA 3VDAA 3FEMA 2F6KA 3LM3A 2HK1A 2DY3A 2FQIA 1TPB1 2VDGA 1F4AA 2B7NA 1H4PA 2NXGA 1ISXA 4U28A 4A4AA 4CCCA 3RLHA 1M01A 2FKPA 2PZNA 1OK4A 5CC7A 2ZICA 4CU8A 1ZZMA 4GXMA 1N8FA 1EJRC 4NIRA 4FO4A 4OWGA 3U0HA 1US0A 3AIUA 2OO6A 3PJTA 3L65A 3MMTA 4N6EA 4CLMA 2GVGA 3M6YA 2XSBA 2WZIA 2PCQA 3M7WA 4D1JA 3VUSA 3W84A 5I3GA 3T1GA 7REQA 3MB9A 4R33A 1OG6A 5JXQA 2G41A 2PRLA 1M3UA 4IIDA 1NDWA 2X1TA 4QEHA 2YX0A 1XC6A 2AL2A 3DFSA 4N6FA 2YDAA 1X6NA 1TIWA 3OG3A 3ZO9A 4O18A 4DF2A 1LRTA 3DHDA 3ZFHA 1ZNNA 4QTGA 5C7HA 1B3WA 3V36A 1HJSA 4B91A 1K70A 1SU5A 3VNIA 4D9PA 1GOIA 1TJ0A 4Q8UA 3W27A 1X8CA 1KCXA 4XAFA 4UFHA 4DWDA 3KAOA 4PMDA 4UUIA 2Y5SA 3G1RA 3K30A 2QUNA 1FWHC 2BSLA 2R24A 1KFJA 1UD2A 4L6OA 1K6WA 2QVHA 1I75A 3TTSA 4PUKA 5AFDA 3PF3A 3L4WA 3WMBA 1KO0A 2ZA3A 1V0NA 2PWFA 2YYTA 3FA4A 3NURA 1HKWA 1LF1A 1XR2A 2OOFA 1XV8A 4AG0A 1P6WA 4PUDA 4ZODA 1IYXA 4N7QA 3TYUA 4GXWA 1MW2A 3PB2A 4E3TA 1W3JA 3SY1A 5KTLA 2CLMA 1PZ2A 3POHA 3TA6A 2QJNA 3BMXA 5HWJA 2PBOA 1QNSA 1J0HA 3EBVA 4GX9A 4M8UA 2DT2A 3TAKA 1NQ6A 1HN1A 1OD0A 3NDYA 4WY0F 4AD4A 3MDWA 4C6EA 2AKZA 4PSRA 2IPJA 3VIHA 2FZ9A 1TJPA 2F8QA 3NUKA 3Q67A 1FH9A 3QMSA 3R79A 6TAAA 2FYMA 2NLYA 1GEHA 3RPMA 3IGUA 5K9CA 4EE9A 1HKKA 5IDIA 5D37A 4BCEA 1BF2A 3W7KA 5AC8A 5DCEA 4RZ4A 4LEQA 3P0XA 1MRAA 2WW5A 1UD5A 4R88A 2Y85A 2RH9A 1GVRA 1RR2A 1TX0A 3SADA 2CLPA 3TROA 1E6NA 3MKKA 3H2FA 1G01A 4WGHA 4BF5A 1XM3A 1EL3A 5E09A 3Q4DA 1PX3A 2PGEA 4R9OA 5CXPA 1XPGA 3TSDA 3D3FA 1SFLA 3SCNA 4D6GA 1MEWA 3ANVA 2OX4A 1WP6A 1RQEA 1UZDA 2DH3A 3DESA 1QR7A 2E1WA 1F8IA 3WQVA 3BG9A 5BRQA 4M7SA 3N25A 4MY1A 3SJNA 4AVFA 2D2HA 4UTTA 1A5MC 3S2LA 1KFBA 2ODOA 1MSSA 3LHYA 3ZLHA 5BRPA 3PJXA 2WZHA 2XUCA 5BMWA 1KLYA 1VZWA 3CHDA 2X30A 1GOQA 4MAVA 4FS9A 3A4JA 3CASA 1ZL1A 3MCOA 3QH2A 3C5QA 2GJXB 5TNVA 1M53A 3EMZA 2PUZA 3FAXA 4YVVA 1EJVC 1NWTA 2WNNA 5H8PA 4GUFA 4AZIA 4CKQA 2P88A 2XHYA 4H1ZA 2VL4A 4W88A 2D1ZA 3O6DA 3LXAA 2DORA 3XIMA 2CYGA 2H3DA 3N4AA 2WC7A 3EDFA 4H8UA 3PPFA 4O54A 1GVEA 1B3YA 2QUUA 4MM1A 4U31A 3WF3A 4IG2B 2DEPA 4N0RA 3NQ6A 4JTUA 1FWWA 4LVFA 1UA3A 3STPA 1E1EA 3VNDA 5C7VA 1S38A 3MUAA 4KETA 2R14A 2QCDA 3TXZA 1A5NC 3QY8A 4PL1A 2GSHA 1HP4A 3R10A 1ZSXA 3W86A 1F2JA 3NQFA 3RCYA 1TV3A 3M6DA 3WD3A 4BY3A 4M0XA 1RV8A 1Q65A 3LRMA 4AD0A 1UWIA 1BRLA 2FH8A 1KM3A 5TBOA 3WQ5A 3W7IA 2C3ZA 4AHOA 4HU4A 2JKEA 4Y8EA 1T96A 1SJBA 2EG6A 3NOYA 4GKLA 4GUIA 1TCDA 3NO3A 1ISZA 1XLLA 1EHNA 4CCZA 3OLIA 1ZAJA 6ALDA 3PN8A 1FWGC 3SN1A 1HJQA 3SJ3A 1G4EA 2VCAA 4ERIA 3WD2A 3N13A 4QX4A 1W2VA 1K1DA 3CAQA 3FJ6A 3A4XA 3W83A 1TUFA 3D0CA 3M0HA 1NELA 1VFHA 5H8MA 4Y8FA 3VKKA 3F4DA 4NI3A 1JDDA 1EUNA 3G77A 3O0FA 3HGOA 4AZCB 2E0PA 3NL6A 1UMYA 2D2JA 2WV8A 1G7UA 4E38A 5JVLA 3BPWA 4PCTA 1QATA 3W22A 4GI6A 4DUWA 2R6OA 2P8CA 4YLWA 3CGTA 3OGVA 2GQ8A 3GNDA 2PODA 1ZTVA 4D8AA 5GQBA 3QSTA 1QO2A 3JRKA 3M0KA 1KR1A 3QRHA 2O7QA 2NUXA 2OZ0A 4GLEA 2J7BA 1FHVA 1XLKA 1FH8A 3PJWA 1BYCA 1FHDA 3PTDA 3FN9A 3E0IA 3N6HA 4IT1A 3KVMA 4H8VA 1QI5A 5T8GA 2VVSA 4FX6M 4CNNA 1NU5A 1ZJIA 5A69A 4EPDC 3BAIA 1CT5A 1UUOA 1B31A 1EF2A 2TSYA 4DYJA 3WBAA 3COTA 2Y8UA 4Z08A 2VD9A 2JF6A 4K39A 1E6XM 1EJ7L 2A5HA 3N34A 4WF7A 3W24A 4UTFA 3UZ5A 1G1YA 3AHTA 4JIPA 4DWSD 1V6UA 3FCPA 3H4WA 2E67A 3IVSA 1B30A 3GUWA 4PTMA 3EKLA 1XRFA 2RDXA 1DEDA 2VP8A 1AK5A 1P7TB 3C2EA 2J7HA 1Y5WA 4WX2A 1TR9A 3UCDA 3WLPA 1IT8A 5AN7A 1VKFA 2I7GA 3WLIA 3GXPA 4N4QA 1PTDA 2Y61A 2E5BA 2XIOA 3M1ZA 4OUIA 3QW4B 4I7VA 3ARSA 3QQWA 6REQA 1K4GA 3LRKA 4GWEA 4IIFA 2RFGA 3MSRA 3B8UA 1D3HA 1VC4A 2VEPA 3MC5A 4NRSA 3BW4A 3NQCA 2FHFA 4Q32A 4GNKB 3VGBA 1E9YB 2VVNA 4M6UA 3T44A 1MZHA 1MMFA 1I8JA 3T05A 1I2NA 4N9DA 2D0HA 2CZEA 5U4NA 1U5VA 3ITTA 2O55A 4A3RA 1DXFA 2F9RA 3L21A 1J10A 1LQ0A 4LYQA 1IGSA 1E55A 3HFYA 1OFEA 1DXEA 4RDVA 5M1TA 5HPCA 2ZC1A 2HTMA 2AGTA 4W5UA 3ISIX 3EMQA 4DYEA 5FEXA 4Q4SA 6XIMA 1HL9A 1YNPA 2HV5A 3LRLA 1LWHA 4O28A 3CHEA 3VNLA 4TVCA 4K37A 3TTYA 2YW4A 1MUCA 3RILA 5DFAA 2O7SA 5KZ6A 1UPPA 2PB1A 4WQ6A 2FJKA 2J9XA 3UWWA 2QLYA 2TODA 2OZ3A 4ACZB 2OQHA 3VD9A 2C18A 1K9DA 2NV2A 1GONA 2DZXA 1NP0A 2WANA 1KKOA 4J4KA 3VOFA 1OGBA 2Y4SA 4PTDA 3AMCA 4AWEA 4FOJA 1N7KA 2I57A 1Z41A 3DEQA 1TCMA 2DT3A 4JFSA 3S6OA 3Q45A 1FUYA 3GBDA 1DWHM 5IDZA 4RE4A 5EPDA 2I5QA 1W56A 1GYMA 3N2BA 1AJZA 1UBPC 1O68A 3EB2A 3PULA 2I9UA 3UG4A 2JEQA 2OT1A 4LOCA 5DXYA 3RU8X 2QJJA 5XINA 3GH5A 1BEUA 1XH2A 2DIKA 1XDMA 2PA6A 4X61A 3IK2A 4PB5A 1PTAA 3W1NA 1XRSA 4JTLA 5AHNA 3K46A 1XYCA 3BZJA 3VO0A 5I77A 3E12A 4PRWA 2PD5A 1AQMA 1ZCCA 4Z2HA 1P0KA 3QBUA 2AGKA 2XU2A 3WNKA 4KERA 3PANA 2BNJA 3NM3A 4INFA 4FNPA 3W23A 2CITA 4UFLA 2WOQA 4IPLA 4MFDA 5EMKA 1V8EA 3TC7A 3RPTA 5HUPA 2SFPA 1E43A 2ZIDA 5LGXA 1XLFA 1EBHA 4JTRA 2Y89A 3GTIA 5D02A 2A3CA 1C8XA 3EDEA 2PWEA 4NJKA 5BXRA 3D5HA 4AIOA 1WE5A 2ISVA 4U5IA 5M2FX 1JZ5A 1ZRQA 4M5PA 4XVDA 2P76A 5F2GA 2W67A 1DHPA 3GTNA 1V6YA 1VGAA 4AD1A 3UPMA 1R8LA 3ZXWA 4UZSA 3CUJA 4PCSA 3UA4A 1XDJA 2OQLA 5IM51 5HR7A 2EF9A 4O0KA 3HQNA 3FDGA 3H8AA 2J7GA 2Y70A 4E4PA 2E6AA 1L6SA 3E3HA 3PBWA 3FDKA 4DO7A 3NXFA 4ADUA 1DIEA 1TPDA 5A94A 4UXDA 1PDZA 3NSNA 1SJDA 8RUCA 1CECA 4M24A 4GY0A 1L6YA 1OQFA 2IPFA 3NDOA 3THDA 5FCZA 3TR9A 2XWDA 3ERPA 2DJXA 1A0EA 4GZJA 4H7CA 2A6LA 1K02A 2PF0A 3TYBA 4P5UA 1D9EA 3I7QA 3C0LA 1VJZA 3KBVA 3NQGA 3MYPA 1TA3A 1S2WA 1TJRA 1HG3A 4CVUA 4A05A 1RVGA 1SW0A 3IS4A 1ZAIA 2I5IA 1G67A 4PUJA 2NQHA 1PCWA 1PX8A 3WNPA 2BY3A 1V79A 2J7FA 4M81A 7PTDA 4N9CA 3G1DA 3EDKA 4G1NA 2VD8A 2BV9A 4G56A 1KBJA 2WMHA 4CN1A 4QLJA 4PUNA 5A6JA 2CBJA 3ZVIA 2J9ZA 4ZB5A 1TPVA 4HA1A 4YJ5A 1V0MA 2E7FA 4PTVA 3KBSA 1FVPA 5I07A 2POTA 2KZHA 1Q8JA 1E4NA 1UH3A 1KM6A 3PY2A 4IP7A 3DIPA 3JUGA 3WQ4A 5FJTA 3UXKA 2Z7GA 1GKQA 4JTEA 2HJPA 3PZTA 5HWNA 2Z1BA 2ZXDA 1LLWA 2QCLA 4UCFA 3TSMA 1IWAA 3EB4A 4N02A 2FVKA 4UQDA 5C55A 3OU8A 4YVPA 1QI0A 4UNKA 3EX6A 4OVXA 2R1KA 1DBTA 2CETA 4LFYA 1BQCA 1UKQA 2IPGA 2Y6ZA 4IX2A 4GYFA 2WMKA 4QDMA 3C6CA 1F3EA 4D8ZA 2QJMA 2YPIA 2QIWA 3W29A 2QULA 3KLKA 2XTKA 3G1XA 3ECQA 2QCGA 3LXBA 3TSBA 3VYLA 3ONCA 3QPZA 3WF4A 2X1SA 3CUZA 3VD5A 3H2CA 4GX8A 5DCBA 2RGMA 3C2RA 4V33A 4PTXA 3NO5A 5LHEA 4F2UA 5KETA 1E0TA 1UBSA 1JGIA 3E0WA 3EX1A 2ANUA 4AD5A 1PPIA 3BQ6A 1VH7A 3N2OA 3M5XA 1EHAA 1PIFA 1W1B1 2QCCA 2EPHA 2Z1WA 2BHYA 3PK7A 1KD0A 1NOFA 3QSRA 3A6OA 4MWAC 2VYOA 4AY1A 3AZRA 4Q4KA 3HO8A 2IXUA 4TU1A 2GK1A 3WKZA 4AU0A 1FXQA 4ZQNA 1C7SA 4K8EA 3R8GA 3ZYZA 2GVJA 3UY8A 1T99A 4IPJA 1XBVA 4XBKA 1NOWA 4MWAB 3UPWA 1XXXA 3ATZA 2A6NA 4HHLA 4MZ1A 4ZE4A 2GDQA 1EZWA 5G2IA 3TDFA 2XFFA 4Q6XA 1IF2A 4FB7A 3QKEA 1R38A 3N9RA 2PS2A 1PSCA 2J66A 2WQDA 2ZXQA 1CGTA 1R3SA 3UR7A 1IQ8A 4US6A 5G1MA 4QG8A 1GHRA 3ABOA 3ALFA 1D8CA 1CGVA 1CXFA 2ZUNA 3PNZA 4CNPA 1NP2A 3W6YA 4MPQA 3BG3A 1N55A 1UWAA 3E2RA 3PWAA 3AICA 5EYWA 3AAMA 1TTIA 1O95A 2V5LA 2B4GA 2HISA 3FSUA 4BQ2A 2E68A 4ZE5A 2WCSA 2FMNA 5D9PA 2OLSA 1OWQA 4I8YA 4W9TA 1TR1A 1PHWA 1VFFA 9XIMA 1VEPA 2R9RA 1WZMA 4NY2A 2J75A 4RNIA 2QV5A 1WKYA 2RKXA 3ZR5A 1TSIA 4XZBA 4A8IA 3VGDA 3QZAA 3W00A 3A24A 1KM0A 1UOZA 3R13A 4JHZA 5DELA 4CU7A 1S1PA 3TN6A 1W3HA 1PAMA 3MI3A 4MTVA 2W62A 1K9FA 1E1FA 2WMJA 4Z1DA 3BAKA 4KEZA 3UJ2A 3ZLFA 2TPSA 1YXCA 1H7NA 4YNGA 4AX7A 3WQOA 4P8VA 4X9YA 5CG0A 3F5JA 3UF9A 2MUCA 4XZ9A 2WHLA 1PWLA 3BLLA 3Q58A 2XVLA 3L5MA 3P2VA 3Q2DA 4HKPA 3BV4A 5FF3A 4FNUA 3WF0A 3IJDA 2IKHA 1QW7A 1W54A 2G50A 3VK5A 1GVFA 1S5WA 2FB2A 1FX6A 5FF2A 4AYGA 3CPGA 3KRUA 5IFPA 3UD6A 1Q7ZA 3P67A 1HJUA 2HBXA 4KPLA 4B3ZA 3RHGA 4EWJA 3LSBA 1MEHA 1PIIA 3HPFA 4IFOA 1EDQA 1CW2A 4Q8OA 4O53A 1R47A 3L4TA 2AMXA 1KTBA 3WIJA 1H1YA 4PN2A 4QNWA 1JCXA 4EAMA 1BHGA 2O9TA 2GPTA 4R5EA 4RR4A 2XFYA 1HKVA 1KFCA 3W9ZA 1W5NA 2PBGA 1PBGA 3R89A 1V7YA 2ZRWA 1P7TA 1LOQA 3U8GA 3NPWA 4M80A 3OJGA 4JX5A 1A80A 4ZBCA 4PB3A 2XH2A 5D33A 5LZLA 4BS0A 3NVDA 1QHPA 3URAA 4Q4MA 3E38A 1RALA 2WM1A 4HNUA 1A3WA 1UR2A 2VX6A 4EK7A 3NZQA 1YXDA 1U1JA 3HOJA 1THFD 3C2VA 2XSXA 1ITCA 4XTIA 1PCKA 1TMQA 2WHJA 3BGJA 1W3KA 5FD0A 1KTCA 2Z24A 2YR1A 4UNLA 3GVGA 4WDTA 1W3NA 2REQA 2WWCA 1XQKA 1UPMB 4ZTYA 3VI2A 4XAGA 4F2BA 1SFSA 1H49A 3IPWA 3U5UA 4XKMA 2HZGA 4CQCA 3VD7A 2ZZ3A 3KL5A 1UW9A 4FXFA 2VX4A 4OJYA 1IXNA 3VIGA 1FWCC 3CV1A 2PTZA 3DG7A 2X1RA 3WH9A 1VFOA 2HBVA 1DJZA 3QXBA 5PTDA 1TUXA 1IXPA 1GPFA 2CC0A 5K3VA 1LWIA 3CUHA 4IFKB 3N11A 3GR7A 1LTDA 1NVMA 3VZZA 4X0NA 3RJXA 3OVRA 1KFEA 4UQCA 4CNTA 4WDXA 3ZJKA 1OY0A 2O9RA 4QR6A 5HUOA 3TA9A 4F2TA 2GSEA 2FZDA 1W9DM 3TCSA 2WVVA 2J7CA 3UWQA 1CIUA 2WZTA 5C54A 1ZHAA 3NTYA 8XIAA 3JW7A 2NVCA 2XISA 4O4VA 1PZ1A 4XIAA 1R0MA 3SEPA 5FJJA 3EXSA 2CBIA 2PDPA 4M29A 3WJZA 1NWUA 2DIEA 3H26A 2XDFA 1JCTA 1XYZA 4JICA 3F5LA 3LEPA 1OYCA 3DG6A 3EOOA 4AC1X 4LVDA 1D8WA 4RK8A 2W0UA 4PR4A 2B0MA 1TVNA 3W02A 5JBDA 4NJJA 3PPCA 3M41A 2BXZA 1WQ5A 3E9AA 3ABZA 2Y7DA 3L4VA 2WNZA 3HPAA 3OZOA 3AHXA 4GUHA 2VR5A 3WQ8A 3WLTA 2O4MA 2OQYA 5BCAA 3R2GA 1W0MA 4WJXA 2QVNA 4CQDA 1B2YA 4DUXA 4IMCA 3PVFA 5EBAA 1A5BA 5CGTA 4AUBA 2CZDA 1JYNA 2Z1SA 5ABHA 1F6YA 4DBWA 3R11A 2C79A 2Y7EA 2FIQA 3WCZA 3GAYA 3VZXA 4Y9PA 1GW1A 2ASHA 4EIVA 1QRQA 5LIXX 5AHLA 5D30A 4DI9A 3KX6A 3MCNA 1R2RA 5I3KA 1FQ0A 1JNDA 1A4LA 4RDZA 3W6LA 3E6EA 1EJSC 3HBLA 4IIEA 5C8BB 1LZOA 1ADDA 3UXIA 4F0MA 3CIXA 5HJLA 1FWIC 1XSJA 3DUGA 1DL3A 4DLMA 1GOXA 2ZFAA 2VR4A 5ABFB 3CXOA 2JQXA 4JXCA 1PB0A 2WMFA 1IZCA 5HULA 1LOSA 1XX1A 1TTPA 4D6IA 2ZC8A 4UTIA 4JIQA 4R27A 4Z1AA 4BF9A 4LAUA 2P1FA 3VIJA 1QCWA 5BXSA 1TPC1 3A5VA 4C5YA 4X60A 5FJPA 3I3EA 1SW3A 1OEPA 4Q8NA 3NYZA 3AOFA 3OP2A 4JGDA 1BKSA 4CN4A 2HXTA 2EJ1A 3O0KA 4PMQA 2C19A 3Q65A 4D6HA 2PI6A 2Y8VA 3IARA 3T9PA 1E1CB 4KT2A 4LUJA 4ICCX 4HNLA 1W1IE 3JVAA 1ZENA 3W53A 3ITLA 1XYLA 3W7JA 1XBXA 1HGYA 3W07A 3SQLA 1EPVA 1TRIA 5HMSA 2GOKA 4CQAA 3SZ8A 1C9WA 1CX9A 2Y63A 1EYEA 4JR5A 3UVIA 4AY7A 4H19A 4HMCA 3K8KA 1E6ZA 1Q66A 1MVYA 4JPGA 4ADSA 4WJEA 1MEIA 3U3HA 4B2DA 3QM3A 5BXPA 1G9HA 2VM8A 2GJNA 2A7PA 4GI9A 2WMIA 3EWZA 3VOIA 3CWOX 3QVQA 3G1HA 3WL1A 1DWIM 5DT7A 1TE6A 4WIWA 4CU6A 3I68A 4J1OA 4R85A 4WJ8A 3I7SA 3W2LA 1D3CA 2VC7A 1C9DA 4HT3A 1C8QA 2OJPA 3HMCA 2PFHA 3SRFA 1H1ZA 3LENA 1H7OA 3U7VA 4CD4A 1YQ2A 3I6RA 3A4AA 4DX3A 5LA2A 3R6IA 3F1QA 3H2MA 2WSRA 2QIIA 1VIZA 3RRAA 3U6WA 3CWHA 3TEVA 4RV3A 3VMPA 4E2VA 2XVGA 4PTNA 5D4YA 3QR1A 1NDZA 4PBFA 3M9YA 1ZLPA 2BGSA 1W9XA 3N14A 4JCMA 2J7DA 4RPPA 3HZ3A 1SZEA 2NXIA 5REQA 1MNSA 2ZX7A 2Z1KA 2YXXA 3UU0A 3MSYA 4KGJA 4QG6A 2ZX8A 4LC8A 3ARVA 1OCJA 2V3EA 2QEZA 3R0KA 1O5QA 3GXIA 3HQ1A 4IJRA 3KCLA 4PODA 4ZQCA 3WK0A 1NARA 3ES8A 3EWCA 4CD8A 1I45A 1G4TA 4DN1A 4UMCA 2NV9A 2BY1A 3CTLA 3R12A 2ZE3A 2Z2UA 5A2AA 3ELFA 4HJWA 2WBGA 3UG5A 4UQAA 3TYCA 2WVTA 2H6RA 2HPMA 1NIUA 4IQLA 3TW6A 3L2IA 3THCA 4HYVA 2VZOA 2NQ5A 2V5BA 4O16A 2A79A 3PZ9A 4UIOA 1XQLA 1DYSA 2I17A 1TPFA 5ABTA 3A9BA 3F03K 3EPOA 1BAGA 3QY7A 3DU0A 5ABEA 4QCEA 3LGEA 1TWZA 5A1AA 3AROA 3O8AA 4Q8QA 1K9TA 2WLYA 4ONVA 1AFSA 2X1UA 1BTMA 4NQ1A 2DQXA 5EKYA 2Z1VA 3ARXA 1KB3A 3BAJA 2RHGA 5F4WA 3GHTA 3ME3A 3B03A 3WG6A 3G1AA 3H54A 2FHCA 5M3WA 5CJMA 2ZDSA 2X7WA 3TZNA 1SSGA 1UP2A 1RA0A 2KX9A 2A3BA 5GPRA 4OBSA 1TPEA 4JQAA 4OU1A 3BLEA 4J3SA 4W7UA 4DWSA 3B8VA 3MSDA 1Q2RA 5JH1A 2NUYA 4NAFB 3UWEA 2XVKA 3WEOA 3GWQA 4IH3A 4GQ0A 4A35A 4HZ8A 4GO9A 3GY1A 3VIKA 4Y7EA 3E5BA 3HPXA 2HQAA 2D20A 3ARPA 3AIVA 3STFA 3IEBA 7TAAA 3TONA 4IX0A 1AH4A 1J79A 2XN2A 1FWSA 2X05A 1XH1A 4IPPA 3DXIA 3ZJ8A 1CYGA 3E74A 4LCRA 3SIMA 4E4UA 1HQTA 4PMNA 3QC0A 1J8VA 4KIRA 2BG5A 4C60A 1F73A 1UR4A 3AJ7A 4LH8A 4QE4A 3LHTA 4YXGA 1A50A 1DKWA 2V69A 4DXVA 1VFTA 1PYMA 3BMWA 5RUBA 3S6TA 1PWMA 3GBEA 3KTSA 3S1UA 2QCNA 1KRCC 3L7RA 3KFTA 1GW9A 5IFTA 3FVMA 5BYWA 4XBSA 1EX1A 3PZIA 2BVYA 5DXXA 4ZQPA 4GCXA 2C0AA 2R8WA 2B7QA 2OYKA 1T41A 3HG5A 2PDHA 4AEFA 4HK6A 1KNWA 3W87A 2D3LA 4XO6A 1HIZA