3W1AA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with 5-halogenated orotate derivatives
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with 5-halogenated orotate derivatives
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
total genus 108
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w1aA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w1aA01
4KFNA 4MY9A 4L4LA 3ZR4A 1YTKA 1W5NA 3CWOX 4O54A 1I8JA 3PUEA 2FPYA 2VFFA 5I3KA 1I4NA 1PCKA 1S3HA 3LCLA 2E1DA 5AHLA 3WK1A 1JR1A 4ZQPA 3H54A 3MUXA 1N7KA 1BEUA 1ZAIA 3OBKA 2Y7GA 3ZFHA 4O12A 5LNWA 4PL2A 3GKFA 1TMHA 1P5BA 4A22A 1RQHA 1L6YA 1W5MA 1LCOA 2EAWA 1JCMP 1QOPA 2EGZA 2Y63A 3SGUA 3HG4A 4OV9A 2IQTA 1GG0A 1QR7A 3NQEA 3F03K 4JX6A 4U4MA 5CZTA 4FHAA 4NNCA 5FF2A 1AL8A 1Q6LA 4M19A 1KV5A 4PC8A 1DL3A 4DF1A 5HINA 3STCA 2ZBTA 3O6CA 3TA6A 1FWRA 4JTTA 3E96A 2DJLA 5D2XA 1D3GA 1YYAA 4M5PA 1EX5A 4RXFA 3EKZA 3N9SA 4R7JA 1F6PA 3E9AA 4AXKA 3WJYA 3USBA 1B3OA 4AB4A 5DELA 1K7XA 4I7WA 2C3ZA 1Q3NA 3B05A 3CB8A 3C2FA 1JUKA 4OT7A 4RZ6A 1R47A 1TJRA 2NXIA 1XI3A 4H4IA 2NXGA 1MEWA 2JGQA 4KWWA 2GUUA 4WX2A 2X2GA 1KM0A 3OEXA 3L66A 1VYRA 1ZJIA 5F2MA 1NEYA 2P1FA 1XFBA 4LV4A 3K30A 4UNLA 2ZQ0A 2AGKA 3CPRA 1LYXA 2WSYA 2V9DA 3F1QA 3STGA 3GNNA 1GYLA 1U5JA 1S5VA 3HPZA 4NXSA 4ZQMA 5CSRA 3M5ZA 4JN6A 3S8HA 4MJMA 1G6CA 4MY8A 3T44A 4OBTA 3W1TA 3W7LA 1FQ0A 4PL1A 3W7CA 3C52A 3PULA 1X1ZA 3W1AA 4RLIA 3JS3A 3A23A 4O18A 1D9EA 2Y61A 3MYPA 2DORA 3UZJA 3C0JA 4DXVA 1RV8A 1VJIA 4IPIA 4PA8A 2V81A 3BW2A 3U8GA 4E38A 3FFSA 4OV4A 1GZGA 1VR6A 1FDJA 4O14A 1TPC1 1EP3A 1CX9A 4UTTC 3EWUA 3LRMA 4JTSA 3TC6A 1OYBA 3TV8A 4NVTA 4XWUA 3W87A 2GOUA 4N9DA 1VQTA 2OCZA 2CU0A 5C5YA 3UQNA 4XBKA 3LTPA 2V30A 3S42A 1M5WA 2OT0A 2XFWA 3NEVA 1EB3A 1KM6A 4R53A 1YDNA 2A1YA 3LCGA 4QITA 2BWGA 1FUYA 5BNKA 3TSBA 1TRIA 1YXDA 2OMAA 1W5OA 4N4QA 3DGRA 5DBTA 1OABA 1EA0A 1MZHA 3NL2A 1SW0A 1CW2A 4QM1A 4LY8A 3TU9A 3VFLA 4DO6A 4JTUA 5U7SA 4BF9A 3W2LA 2A2IA 4MPQA 4S1FA 1KM2A 4ZL1A 3P82A 1PV8A 2CFFA 2VFDA 3UXDA 3PVFA 3SJ3A 4Z08A 1SZGA 2CLEA 2GVLA 3QH2A 3HPXA 1QFEA 1TTJA 2QCDB 5AYZA 1TQXA 4A3UA 4ALDA 1KM1A 3O07A 3ABSA 3L67A 4FEZA 4AF0A 3S1UA 1QCWA 3EEGA 4O53A 5LGZA 4O8RA 1SPQA 1L9WA 1JUEA 3MI3A 3BLIA 2ZZ2A 3NG3A 1UBSA 1RVGA 1FDZA 3BG5A 5T26A 1ZHAA 4AHQA 4JNMA 1WXJA 2YZRA 4WOQA 2LLEA 4MVAA 4R34A 2E5CA 5EYWA 1OFQA 5C6MA 4LWWA 1JJKA 1YTDA 1TB3A 3BK0A 3C56A 3HPSA 3R89A 2FB2A 1ONRA 2Y7DA 3S1VA 2WNQA 4I7VA 1TJPA 1LRNA 3IVUA 3FS2A 3WK2A 4AHOA 4A2SA 3AO0A 3HO8A 5KINA 3A9IA 1ZFJA 2QEZA 4NZFA 3M5VA 3GDMA 5LNSA 4AHPA 4FNRA 4JYFA 1TQJA 5E93A 1UASA 1H51A 3GZ3A 1SO3A 1ZY9A 5G5IA 2CZDA 3U2OA 4UTLA 3L0GA 2J27A 2RKXA 3W71A 2QAPA 3ABRA 1IXOA 1QPRA 3JRKA 1EP2A 4JTKA 2C13A 3TSMA 1XBYA 1AG1O 1A50A 5CZSA 5IM51 4P61A 5D30A 4UXDA 1J2WA 3WK0A 4JDBA 4IXXA 5LZLA 1OX6A 1YPFA 4HN4A 3T4CA 3W7MA 2ZA3A 5F1UA 5H91A 4WQ6A 1N55A 2QJIA 1CI1A 3MP3A 4E2BA 4I7UA 1DKWA 3RU6A 4J9JA 3LCXA 2A7NA 4BWLA 1TPB1 1IXPA 6TIMA 5KTLA 3W7EA 1P4CA 3VNDA 1GVSA 2V0TA 2VEMA 3A5FA 2V2DA 3CEPA 5D04C 3M0ZA 2E5DA 3A5VA 1IF2A 4XKYB 4CNNA 3U6WA 4RR4A 3FJLA 5FF4A 1TRDA 4ZQRA 2B4GA 3RFAA 1LROA 3W85A 3W7IA 4JY8A 5G1TA 3NA8A 1GT8A 3EXRA 1PE1A 1B9BA 3B8DA 3FIGA 5D33A 1NSJA 4O1DA 3P80A 1QDSA 1QOQA 1JVNA 3STFA 2WSRA 3BW3A 3B0UX 4JEQA 1W3IA 1YADA 4TMBA 1G7VA 1KBIA 1VLWA 2Z0IA 3IIPA 3S1XA 1LOLA 3L5LA 3RF9A 2ZTKA 3TQVA 1C9DA 4IMDA 5EA9A 2XN2A 1TPUA 2HS8A 4IXHA 4S2CA 2W6RA 3R8RA 3S1WA 1K02A 2H6RA 5CGQA 4PH6A 2E5BA 4XZ9A 2AAMA 2EKCA 3EXTA 5I3FA 3RNDA 4G1KA 1SUXA 4O11A 5AB3A 2W79A 4TO8A 3GKAA 1TPFA 1DQXA 1KFKA 3LLFA 5AHMA 3C3NA 2VFGA 4QQ3A 5EMUA 4WY0B 3TCEA 3LCWA 3NQ2A 1EPXA 1TV8A 3RLVA 3OHIA 5HNRA 1P0KA 5G2IA 1TPWA 4PFMA 3PB2A 4DF2A 4UFHA 4A21A 4O52A 3PBVA 1SW3A 2Y6ZA 4NUWA 3DI1A 3L0KA 2YR1A 1QO2A 2BTMA 4Z1DA 5LGXA 3LCHA 3TROA 3L5MA 1JCYA 5F2IA 3C2OA 4OHQA 3HQ1A 5HUPA 4GRSA 3BLFA 3NL5A 2WPBA 1QAPA 1FCVA 2Y85A 5BMXA 2A6LA 1OF6A 3L2IA 2JK2A 1G4TA 1GOXA 3ELFA 3FYPA 4LS1A 4JICA 3IEBA 3ABOA 3NAVA 3I7SA 4NJIA 3M47A 3LV6A 1L2UA 4HNTA 2VXNA 3TFXA 4O1BA 3HGSA 3T7VA 3MW7A 1NVMA 2NV2A 3W7JA 4RJEA 1XKYA 3CU2A 3NQ8A 2QCLA 1NF7A 5F1VA 4N6EA 4B5NA 2DZSA 4MFEA 5DY3A 3L9CA 1VYPX 4NNBA 4HNVA 1L6SA 2NX1A 2C0AA 5L9FA 5D2VA 3QSRA 4PODA 5K2ZA 1AL7A 1MSSA 1QWGA 3WJWA 4WOZA 5LKYA 1BWLA 1TREA 1E51A 5EKYA 1SR9A 2DP3A 2RHGA 4O17A 3ATZA 4BR1A 2D73A 3VE7A 4ZQNA 2X1TA 3W3OA 3ZS4A 3HG5A 5LSMA 3KRUA 1ML1A 1PL9A 1R30A 2XN0A 3QYQA 4R33A 1VCGA 3W73A 4DBDA 4N6FA 1F76A 3OVRA 1XM3A 3G1XA 2J9XA 4GUFA 3FLUA 4WY0F 2WKJA 3PBUA 1XUZA 3KVKA 3IGSA 1XXXA 4Y96A 4KFPA 3GIYA 3LX9A 3MMTA 4M6QA 3O1NA 5DCDA 3GB6A 1J4EA 2JBMA 1I2RA 3QF0A 2Q8ZA 3UWWA 1W5PA 3LOTA 3HMJG 3HF3A 2ZRUA 1ZNNA 1TPVA 3NVTA 1GTEA 1KFBA 1QPQA 1SSDA 2ZRVA 4O0KA 5FF3A 4Z1CA 4K37A 2Q8LA 3W88A 2E09A 5D02A 1X7FA 3MBFA 3EWZA 3WJSA 5CPLA 2Z6JA 4WUIA 4P2VA 2FFCA 3KOFA 3KVJA 1ZALA 2GQ9A 2GJLA 4OWGA 4YCPA 3G1HA 1DVJA 3G0XA 4MYXA 3MI6A 3NPVA 5FF7A 3NPWA 1WYIA 4X9SA 3G3MA 1G7UA 3GR7A 1AMKA 5I3JA 2VELA 3TFCA 3QJAA 3W6YA 4AF0B 2ZRWA 3LRLA 4NJHA 4XTDA 2QUTA 3H53A 4K8HA 2QCFA 4CNOA 1WOAA 3L5AA 3NQ6A 3HGJA 1IXNA 4JD4A 1K8XA 5SWUA 4WD0A 1EP1A 3CWNA 3LRKA 4XBSA 3S0CA 4LV9A 1A53A 1O5KA 4KWVA 4NNAA 1RD5A 2ZA1A 3T78A 3RMJA 3SFKA 1O4UA 1SZEA 1R46A 3FKKA 5AOUA 2A7PA 5AFDA 4AEOA 4O0ZA 3G1AA 2E6AA 2VEKA 1KFJA 5HUOA 1RZMA 1VS1A 1LZOA 3SY5A 3BARA 5KZDA 1H50A 5LNRA 3EX6A 4AVFA 2BZNA 2CWNA 3G1DA 4GUJA 2QAFA 4OQVA 3DH7A 3I68A 1AW1A 4ADSA 3EXSA 4K39A 3PAJA 1BTMA 3LI0A 3SW6A 1ICSA 1T0OA 4LU0A 3QPZA 4A2RA 4QNWA 1DBTA 4E2DA 1UJPA 2JKPA 1ZAJA 4W9TA 4TMCA 2ZRZA 3W76A 3E0IA 1UUOA 3SSJA 1OFEA 2H8ZA 1RQBA 1VCVA 3G8RA 5A8GA 4O16A 2QDGA 4FNTA 1G69A 1K8ZA 3PBWA 3HGRA 2ZRYA 1NF0A 1JCJA 3SZ8A 4JTGA 4UFLA 5U4NA 5AHIA 3LXBA 4UR8A 1VPXA 5AC7A 3DFQA 4DO4A 4IMFA 4YLWA 3KRSA 3EWYA 3MBDA 2VEPA 4AMAA 2A21A 3W1NA 3HG2A 2CLLA 2QF7A 2G5WA 3SECA 1H1ZA 4JDYA 1VCFA 4NX0A 5BOOA 1F73A 1G4EA 3W7NA 1ICPA 3NYZA 5K7JA 3W1RA 3D0CA 3I65A 2ZZ4A 1WV2A 2WOQA 3R12A 5CPOA 1GJPA 3GX9A 3TMQA 1YTEA 1A5AA 1SW7A 4N9EA 3LHZA 3QFEA 4O1AA 3BLEA 1M7OA 2YFOA 4HNNA 2UV8G 3VKJA 3EWXA 4UTMA 3LTYA 4JR5A 5AHFA 2DU2A 3IGXA 3LM7A 5AHNA 3NM1A 3LDVA 1JQXA 1KTNA 4DELA 5HWJA 3S6DA 2C15A 4MZ1A 4I9AA 3EX4A 1LTDA 4C1KA 5TBOA 4NJKA 3TJXA 3N9RA 4ZZ9A 1PVNA 3W7DA 2OT1A 3I7RA 5HWNA 4MZYA 1YLVA 1OFPA 1I2PA 2YXGA 2QCCA 5EY5A 2CW6A 2V2CA 1C29A 4HIBA 4Z0JA 5CG7A 3TR2A 1TV7A 1EWDA 1PIIA 4UR7A 4K38A 1Z48A 4LVGA 3FYOA 1JUBA 3O8AA 3NPXA 3M1ZA 3LBMA 4UTUA 1I2OA 3ZWSA 3OA3A 1RPXA 1TSIA 4N02A 2YCEA 3PSWA 4NT0A 4Z1AA 3ATYA 4MFDA 3UNDA 3TK7A 2AQWA 5DXYA 6ALDA 3W07A 4BFAA 3PWAA 4GJ1A 1Q6RA 2A6NA 4BI6A 1L6WA 4IMCA 1HUVA 2NWSA 3GNDA 2CLIA 3HJZA 2H8XA 2FJKA 3LTSA 4KFOA 2V5LA 1RR2A 2HTMA 4MOZA 3DBPA 2VC6A 3W74A 1LM1A 3GAKA 5G4WA 5HR6A 2JKAA 3A22A 1JULA 3FKRA 1WBJA 4LVDA 1A5BA 2B7NA 1ZAHA 4Z1BA 4UCGA 5F4SA 1I2NA 3GVGA 1LP6A 2YDAA 4FNQA 3G0SA 4WJEA 5D32A 1T8XA 3KAOA 4JX4A 3G0UA 2C6QA 5HWMA 2X1SA 2CLOA 3QZEA 3TNOA 3LERA 1F5ZA 2QCNA 1Z42A 1GVRA 4RCXA 5F2LA 5C2XA 3W22A 2CLFA 5LNVA 3GDKA 3QQ0A 2TPSA 1GG1A 3QMTA 3MHUA 3NQCA 3LB0A 4FF7A 4GBUA 3AJXA 4PCFA 1OVDA 4DPPA 2O7QA 3M6YA 3TQ0A 4UFKA 4Y8FA 2PC4A 3GYEA 1K7FA 3DFNA 4CCEA 3VI2A 2QCEA 4N2YA 2H3BA 2QKFA 3CLMA 4UMBA 4LC8A 3ABQA 1GVQA 3P7YA 1NAL1 1T99A 1U83A 2A4AA 2KZHA 4IMGA 3BV4A 3C61A 3IV3A 3M44A 4BWLC 3TUUA 1ICQA 4IUOA 1OJXA 4OE7A 1KFLA 4E0CA 3N3MA 3IIXA 3DKLA 3P67A 2ZYFA 3DU0A 1H7OA 3LGEA 4MKNA 4O1CA 2NUXA 5LNUA 2YSWA 4EWND 3ANYA 2J9ZA 1YPIA 3Q58A 4Z0SA 3EX1A 4JIQA 3C2VA 2EF9A 3GAYA 3MI2A 3N2XA 2J88A 4PEKA 2O7SA 3TSDA 3F4NA 4Q4KA 2VFHA 2HMCA 3YPIA 2ZDRA 3LBCA 3GLCA 1Q6QA 2VENA 4MLJA 3KRZA 3S5NA 3P8JA 3HIJA 4AWTA 3P74A 2PCQA 4Y6GA 3P84A 4UTKA 2XN1A 1JRBA 3HBLA 4CNPA 1FWWA 3UXAA 4JYEA 4IGHA 1EEPA 1SSGA 2HS6A 1FCQA 2OZ0A 3T40A 2R94A 1R2RA 5C55A 5FEXA 4IQLA 4X3ZA 5AYXA 2ZFAA 4LUIA 4MIMA 1HO1A 1KFEA 1R2SA 3LCFA 3UY8A 4EIVA 2EHHA 2Z6IA 5DCEA 1ZCOA 2YPIA 1B57A 4ICNA 1W54A 4RKAA 3FA5A 1Z44A 1IIGA 3PR2A 5GVJA 1VHNA 1K3UA 2CLKA 5J5RA 3M7WA 5HMSA 3G24A 3P81A 3PF3A 1B4KA 2WNNA 2ZZ6A 3BO9A 1FY6A 2DZUA 5FI8A 4RZ4A 1KTBA 1C8VA 4AWUA 2E6DA 3W86A 3GK0A 2YW3A 1IIHA 1HTIA 4FX8A 3CHVA 4S2BA 1H7NA 2J24A 2X30A 1MEIA 3EKLA 1EUNA 3B4UA 1KM4A 4ORIA 3UYCA 4L4MA 5EL1A 2A5HA 3W72A 8TIMA 3GDRA 3IVSA 2J9YA 1PHQA 1FBAA 4IMEA 2PRMA 3RK8A 5DCBA 1UCWA 5KITA 1VYSX 4MY1A 4TR9A 1LOQA 3QW3A 3NPUA 1UUMA 1F6KA 3LHTA 2QCDA 2YFNA 2BSLA 3M5XA 3NR0A 4NZJA 3NQ7A 1PCWA 4CQAA 3TXVA 2NUYA 3IIVA 4CQ9A 4MJZA 3PUDA 3W7GA 1BWKA 2NLIA 3W7QA 4MYAA 4M6PA 1SO4A 3TIMA 3ZWTA 1O5XA 4UNKA 1SFLA 1SZNA 1GPWA 1K03A 2H3DA 2TYSA 4GUIA 4NJGA 2DZVA 5F4WA 3W1UA 1OFDA 1VGAA 2JGYA 3UWVA 4UTHA 4UTWC 1LLZA 3C8FA 3B0VC 3LHUA 3P5ZA 5G2WA 1H7PA 1Y0EA 2NWRA 3DAQA 3BGJA 4DPQA 2CZEA 1OYAA 4H3DA 1H61A 2DZXA 4GFSA 3DHDA 2QCHA 2E6FA 4JS3A 4O19A 2CZFA 2BX7A 3BVJA 2ZZ5A 3KVMA 2QCMA 3KHJA 4TU1A 4O15A 4UTWA 3GDLA 1TYGA 1ZENA 4WXZA 2I1OA 3MHGA 3NQGA 4LS0A 3QRHA 5D03A 2FLIA 3E12A 3N14A 4JTEA 1TTPA 2TSYA 3OVQA 1XDLA 4FXRA 4JX5A 4AWSA 1QNVA 2QUUA 5FEPA 1OFRA 5G4EA 3W84A 1W1ZA 2PRLA 1LBFA 4ZVJA 2VOMA 1GTHA 2V82A 1H7RA 2G96A 1JCNA 3W1PA 2QJGA 3DENA 3S5ZA 1TCDA 4EVZA 2ZCGA 2P10A 2GPTA 2GQ8A 2QR6A 3TC7A 3W1QA 3L0NA 2Y7FA 3W75A 4LW7A 4K7YA 2ALDA 1PS9A 2YX0A 3IIOA 2NUWA 4LVAA 2ZZ7A 2RDTA 4X22A 2P0OA 1FWTA 2PURA 3SGZA 1W31A 3IIZA 4RZ5A 1FWNA 3DFPA 2B7QA 4DBEA 5F4XA 1W37A 3A24A 1A5SA 4BK9A 3HB9A 1SU5A 1G67A 3P61A 4GNJA 3IGUA 3C2EA 4K8EA 3MP4A 2V5BA 4RX0A 1XBVA 2Y7EA 1IGSA 3S5OA 4M7SA 3LCIA 1XBZA 5DBUA 2QDHA 4NU7A 2FQIA 5TIMA 1FWSA 2R14A 4JTHA 1HO4A 1X1OA 3KXQA 4EOUA 3TAKA 2CLHA 3TE9A 1KBJA 1WQ5A 3GXNA 3NOEA 1WX0A 1WOBA 1OX5A 3DFTA 1H5YA 3EX3A 3PG9A 3MP5A 3Q94A 3SR7A 1MO0A 2GVJA 2WO5A 3V1PA 4XQ6A 2Y88A 4TX9A 4EF8A 4IOTA 1DOSA 3O6DA 4IPJA 3NZRA 5EPDA 2DJXA 3OIXA 2DZPA 3W1MA 3UZ5A 1SFJA 4FIRA 2A0NA 3PUOA 3NQAA 3CIWA 3PBYA 3PM6A 2I9EA 4POCA 1YXCA 2H90A 3TJLA 1KV8A 1O95A 3CEUA 1GYNA 5G2HA 4HPJA 4HSNA 1ME7A 4Q33A 1W56A 5K9CA 2ISSA 2NZLA 5AHEA 3N73A 3W2NA 5LHEA 4GE8A 5FEZA 3PS7A 5D05A 4AAJA 3BG9A 4WY0A 5K4ZA 2GQAA 3NQDA 4LOCA 2YGYA 5CZJA 4FNUA 3SI9A 1XC4A 3DHFA 4IWWA 5KSWA 1LOSA 4O28A 1THFD 3TDFA 5TQLA 3WFAA 3LHVA 3UWQA 5DN1A 1Q45A 2OX1A 2ATSA 3B06A 3G1YA 3R13A 3PSVA 2WJZA 2VKZG 1HFBA 3M16A 3O05A 3LXCA 1A5CA 2GJNA 4UFJA 2FTPA 4HKPA 4M7TA 5HR7A 2NX3A 3B04A 4FX7A 5J5DA 4ML9A 5K3VA 3DZ1A 3HG3A 4GUHA 5BW6A 1SO6A 3Q2DA 4RV8A 1RQEA 3M5YA 3UWZA 1OFAA 1X6UA 1EIXA 1OHLA 4K6AA 3DI0A 3N34A 1M6JA 1TPH1 5I3GA 1S5WA 2JKEA 3V75A 2TMDA 3EWWA 1AW2A 5CKSA 3WJZA 1UB3A 4O4VA 5I3IA 3QSTA 3W1XA 7TIMA 2B7OA 3MO7A 3QEZA 3THQA 2CZ5A 4LTSA 1KTCA 3W83A 4UC5A 5KMYA 4LRTA 5C54A 1M7PA 3QPYA 4C1LA 1JQVA 1KW1A 3STEA 2FPVA 3TH6A 3L21A 2WV8A 1S5TA 4U28A 2FDSA 4UFIA 2C16A 4XTIA 1J5TA 3P60A 5K9XA 5L6UA 2VFIA 3LHWA 1OX4A 3FEMA 2ISVA 4NX5A 3H55A 3UPBA 2X1UA 4QIUA 4ZQOA 3DFOA 2E68A 5D09A 1LRTA 3PY2A 1DORA 3BG3A 4DO5A 1H60A 1XUUA 3PG8A 1R2TA 1LBLA 4YWIA 4ADUA 4N9BA 3C2RA 5HJLA 4H6KA 4Y90A 1LDCA 1KM3A 1O60A 2C19A 4A29A 3WK3A 3NM3A 1FXPA 1D3HA 3RLUA 4JTIA 1GEQA 1FCUA 2F84A 4ONVA 5IBXC 3CQ0A 4O50A 4UTTA 5E0KA 3W7KA 3DKJA 1P0NA 2OJPA 1I2QA 5K4XA 1OF8A 1KM5A 1XL9A 5D38A 3DXIA 3W2KA 2ATMA 2J6XA 3P8IA 4CCDA 3NQVA 2Z1BA 4JY9A 3R2GA 4CLMA 4UMCA 4O10A 4LT9A 3TQKA 5IBXA 1IXQA 3P62A 2ISWA 1GVFA 4NXKA 3EX2A 4FNPA 3IVTA 3P5YA 4UMAA 1JRCA 2QCGA 1OFOA 1P1XA 2E77A 3W7RA 5D2YA 1H7XA 2DZTA 4XUGA 4IX2A 1W3NA 1EUAA 4JTJA 4IX0A 3W7PA 3W1LA 1F05A 3CIXA 3QM3A 3N2MA 2G95A 5AC6A 1GVOA 1K7EA 3TW7A 1TV5A 4GWEA 2R91A 3G1VA 3QMRA 1XDMA 4QJ1A 4M6VA 4O57A 5G1YA 4CQ8A 4NQ1A 5DLCA 3LLDA 1OG0A 4OU1A 3G22A 4JIPA 4UUIA 1W8SA 1OK6A 1H63A 4LUJA 3O6YX 5CZ0A 3W9ZA 5A5WA 1VH7A 3NZ1A 3EWBX 2TRSA 3NQMA 1OFBA 3O06A 3BW4A 3NL3A 4HT3A 3B03A 2W0UA 4QSHA 2X1RA 2YW4A 1KLYA 3W2UA 1W0MA 2ZZ3A 4ADTA 4DQWA 3BGGA 4JTLA 1TPEA 4MZ8A 3Q37A 3NL6A 2B0MA 3NQFA 5FESA 3DFSA 4YCOA 2Y70A 5F2GA 5E1QA 1VLIA 3L65A 4QAIA 1H7WA 2X16A 1H1YA 3I7QA 4JYDA 4FX6M 4UIOA 1WDWA 2C18A 3HGOA 2B7PA 1MXSA 3MJYA 3QW4B 3G1FA 2YYUA 3E49A 4JTFA 3SIZA 4GC4A 5I3HA 1OK4A 1W5QA 3LI1A 1V5XA 4GUGA 4UFMA 1FX6A 2C1HA 3B0PA 2Q3RA 4YMZA 3CM4A 5LHFA 3M41A 2A85A 4MLRA 3KX6A 1MEHA 2GVGA 2ZZ1A 5FEWA 3E02A 4LNYA 2PE4A 1DJNA 3CT7A 4KKXA 1B4EA 3W7HA 5MHBA 1DQWA 3N19B 2Y89A 4EF9A 3G8EA 1VRDA 3M9YA 1VZWA 1W3TA 1GQNA 2V2HA 5FF0A 2BXVA 3FOKA 3TKFA 1G4PA 4YXGA 4HPXA 1K8YA 3S5YA 2WNZA 2RH9A 3O63A 5HULA 1NFBA 1QPOA 3EB2A 4UTIA 3A21A 4JGDA 3UWUA 4DF0A 2ZA2A 1QO5A 5D2WA 3FJ6A 3O15A 3OG3A 4WXYA 1LLWA 3W23A 1JCLA 1N8FA 4BI7A 2NX9A 5HQEA 1AK5A 2ZRXA 2CLMA 2VFEA 2I14A 4LRSA 4CCCA 1WA3A 3L68A 4PTNA 3W2JA 1FCBA 3NNTA 5DXXA 1KA9F 4X2RA 3UWYA 2ZTJA 2RDWA 1TPDA 1EWEA 4RK8A 4N9CA 3KVLA 3JR2A 1Z41A 4JXCA 3VE9A 3NDOA 1F7BA 3QQ1A 4WZHA 2F7FA 2A7RA 3PC0A 3T55A 3M43A 4UTJA 1LRQA 2NXHA 3LXAA 1WAUA 5KZMA 3PB0A 1SO5A 1TTQA 1YXYA 1ADOA 4LVFA 2HSAA 4GXMA 3MYOA 5D2TA 3NXFA 5BRBA 2FB3A 2NV1A 3UPWA 2BLEA 1SZFA 2RFGA 4RXGA 4ZQCA 1DV7A 4BI5A 3TW6A 1QPNA 4HSOA 2YYTA 1WBHA 3QC3A 3TXZA 1XCFA 1KLZA 2FIQA 3GXPA 1FXQA 3CTLA 3O16A 1V7YA 3QMSA 5EBUA 4N4PA 1ALDA 3THAA 1F74A 4Y9AA 5D37A 3W2MA 1SQ7A 4K36A 3IRDA 2WSQA 3NO5A 2Q3OA 4Q32A 5CSSA 1YDVA 3G3DA 1BKSA 3F4WA 5DY2A 4FO4A 1X8FA 1VC4A 2C14A 2G97A 1H62A 3BPWA 3CC1A 3C4UA 5CPNA 4MUZA 5KZEA 1Q6OA 4HHPA 1VHCA 4IJBA 4O4WA 4LVBA 1JCXA 4LC6A 3R5EA 5CPMA 5ABTA 3UD6A 4OGZA 1F2JA 1ME8A 2E6YA 3MHFA 4AH7A 4O13A 3S9YA 3G1SA 3NGJA 2R8WA 4QISA 4FXSA 2VEIA 1TO3A 1KFCA 1OX4B 3VCRA 3GDTA 4ZMGA 4NJJA 2ABAA 2QUVA 1AW5A 1XBXA 1TIMA 3W7OA 1LORA 3W70A 1QMLA 5AN7A 3OVPA 2V8ZA 4FB7A 4FIQA 3INPA 2Y62A 1O94A 2RDUA 2FPTA 1HG3A 4D2JA 1DJQA 1GWJA 5H2ZA 1YDOA 4DEFA 3TMLA 1I45A 2DZWA 3GXTA 3GR8A 1LBMA 3UY7A 4K7VA 1T96A 4FNSA 2QJHA 3HOJA 1DHPA 3KFTA 3WJXA 3I6RA 3MWAA 5K9DA 3LHYA 4TIMA 5AC8A 4HNUA 1OYCA 3C6CA 2PRHA 1PHWA 4ORMA 1HL2A 2EPHA 4LS2A 4YL2A 4QNEA 5AYYA 3LV5A 3TX9A 1ME9A 1FDYA 1TTIA 5BMWA 3TAOA 2ABBA 2Z2UA 4XKYA 2WQPA 1G4SA 3G18A
chains in the Genus database with same CATH superfamily
4MY9A 1AH0A 4L4LA 1JG9A 4QDWA 4MNMA 1YTKA 2HBXA 2Y5EA 1FWJC 4KBXA 1EOMA 3KP0A 5BCAA 1I4NA 3LD5A 1PCKA 4ZFMA 1R3TA 2E1DA 3LCLA 1UWAA 2QGYA 2HXUA 3H54A 1QT1A 2V3EA 1BEUA 1ZAIA 3ZFHA 1ODZA 3CAKA 1VFMA 1P5BA 1UR3M 4JNZA 2EAWA 1E70M 4QCFA 2FZMA 2Y63A 3SGUA 1GQIA 4IICA 2A3LA 4OV9A 2AQVA 7XIMA 4Z17A 4AZ6A 4XKMA 3DG7A 3U7VA 1OGGA 5CZTA 1KCLA 1YBQB 4FHAA 3WQEA 2XYLA 1E9ZB 4QE5A 4XD3A 4M19A 1KV5A 2X42A 4DF1A 3GW0A 3O6CA 3KZSA 3LGGA 3E96A 2DJLA 4WF7A 1Q4WA 1D3GA 1YYAA 4M5PA 3WO8A 1EX5A 4R7JA 4AXKA 1YRRA 4B4HA 1VFHA 3USBA 1UD5A 2VMFA 2GYIA 3B97A 4XO6A 3CB8A 1K6WA 3BMXA 2XTKA 3C0QA 2I57A 3VNIA 1P1MA 4H4IA 3BAJA 3VVGA 3JW7A 2PDUA 2DT0A 1KM0A 3L66A 4TX8A 1VYRA 1EO5A 7CGTA 4J35A 3ZOAA 1NEYA 3MWCA 1CLXA 1EGZA 4LV4A 3K30A 3MDUA 3STGA 5FJPA 4DZHA 3HPZA 4NXSA 4OUIA 3VOJA 4AZCA 1V79A 4ZQMA 1ZQ5A 5CSRA 3M5ZA 1GZJA 4MJMA 4L80A 3KP1A 1ZJAA 5EB8A 3GS6A 1WDPA 2PDXA 2QJJA 4QR6A 1BF6A 2ZOXA 3CZKA 3PULA 4O0QA 3KL3A 1C91A 2PDBA 1Y5VA 3C0SA 1VBGA 1U5HA 1AUSL 1FOBA 4ROQA 3UZJA 4DXVA 1RV8A 3CV2A 2QVNA 2BVDA 3FFSA 3GH7A 4B5XA 2IKIA 4UTTC 5TNVA 2VT0A 1OYBA 1KGXA 3W87A 2FZBA 1T8QA 4G56A 3VOGA 2CU0A 5C5YA 4C6NA 2V30A 2GJXA 1XKJA 1W3KA 1NWRA 2GGEA 1EB3A 1KM6A 4KWUA 1ELSA 5HQMA 4R53A 3LCGA 3VD3A 3ARWA 2WAGA 1EYWA 1NY1A 2D2GA 3WZ0E 1EJTC 4PMDA 4KESA 3TSBA 4G7EB 4MGGA 1TRIA 1YXDA 1H49A 4N4QA 3DGRA 5GNZA 1CW2A 3ES7A 3MSYA 3LQLA 4BF9A 2WHLA 2QF8A 1HX0A 4LQ1A 5LIUX 2VFDA 5A2AA 1RCXB 3SJ3A 4Z08A 2CLEA 2GVLA 2O4QA 1UP2A 1V4YA 5H8UA 1XLFA 2A79A 3RPMA 4A3UA 1KM1A 2D0FA 4FEZA 3EEGA 4O53A 2GZXA 4O8RA 3DYMA 4QDMA 3KBWA 1JUEA 3MI3A 2ACSA 3NG3A 1UBSA 1RVGA 3UG8A 4CD5A 1WXJA 4WOQA 1TMLA 4PRTA 1DEDA 1IYXA 1OFQA 4LWWA 1JJKA 3E0VA 3H2AA 2W9MA 1P43A 3C56A 3SN1A 2Q71A 1KKOA 3IVUA 3DFHA 1RLCL 4CU7A 2AMXA 4A3HA 4HGXA 4LEQA 3HO8A 2OQYA 2DEPA 2CEQA 3GDMA 1CXLA 1TQJA 1UASA 4JQ1A 1XWYA 5G5IA 2ZKMX 1S5NA 4UTLA 1Y7VA 4IQJA 1Q7ZA 2QAPA 4A05A 3VCNA 1I0DA 4L6HA 4MNLA 2C13A 4DUVA 5JXQA 4EACA 1LQAA 1UD6A 5CZSA 1R3SA 5IM51 3A13A 4P61A 4UXDA 5I23A 1J2WA 2IW0A 3A64A 1ADDA 4JDBA 5LZLA 3W7MA 2ZA3A 3KM8A 5FJTA 5A8PA 3DERA 2E9LA 2PDGA 2QJIA 3M0MA 5I79A 3WD3A 4AVNA 4I7UA 4JFTA 1DIOA 3RU6A 2PDNA 1JYXA 1IXPA 1XICA 6TIMA 4R85A 3W7EA 3VNDA 2VEMA 2CBUA 4CNTA 3V4BA 5D04C 1NWUA 2E4TA 4BJHA 3UEQA 3VK5A 1IF2A 1EOKA 4CNNA 1XYMA 3FJLA 2BY3A 2J7FA 4ZQRA 1N2VA 2B4GA 2OEJA 3W85A 1V3MA 1XLCA 3NA8A 2PDLA 2PU1A 3IRSA 5JVLA 3I6EA 4US5A 3B8DA 5EFFA 3MUAA 1QDSA 4GCAA 1JVNA 3UZXA 4TMBA 1O6IA 1G7VA 1KBIA 1D7FA 1VLWA 3M0XA 1NQKA 1VFOA 2VQUA 3IJ8A 4CD4A 2ZTKA 1E71M 1PTGA 4LAZA 3TYUA 4FS9A 2XUCA 2V6AA 3CQHA 3RITA 4S2CA 3S1WA 3NVDA 1JPMA 4XZ9A 3AYRA 1XFCA 1XLGA 4LUSA 1OBAA 3WDQA 5I3FA 2A3CA 3RNDA 1XYZA 4G1KA 2FZ9A 5AB3A 5AZ1A 2R1NA 2J7GA 1W9DM 1KFKA 4GHRA 5AHMA 3C3NA 4DLMA 5EMUA 3TCEA 1MDRA 1EBHA 1TR1A 1P0KA 4PFMA 3PB2A 4DF2A 4UFHA 1GUVA 2WANA 2QJNA 3SCWA 1SW3A 2Y6ZA 3RXZA 4NUWA 1D8WA 1QO2A 3ARRA 4Z1DA 4A4AA 3TROA 3GH5A 3D3AA 1I1WA 3BZJA 2Y0FA 1XP3A 5HUPA 1HP4A 4JQ3A 3UYIA 3KOWA 1GOXA 5H8PA 1WZKA 4IPLA 4DB7A 2Y4SA 2VXNA 4O1BA 3T7VA 4ILSA 3MW7A 2NV2A 4NIRA 4U5IA 3NQ8A 4HBKA 5DY3A 1VYPX 4TTGA 4NNBA 4V1XA 1R9YA 5L9FA 3AU2A 4Q4PA 3QSRA 1GGOA 1P7TA 4KH2A 1MSSA 3R58A 3WJWA 3FA3A 2WYSA 1QW7A 4PMQA 2DP3A 1CECA 4ZQNA 3IUHA 2HE5A 5A6BD 4KRZA 1O5RA 3KRUA 1ML1A 1NOFA 1PL9A 1R30A 2XN0A 4R33A 3H8AA 2IPFA 4NAEA 1BTCA 1I0BA 4GUFA 1RSCA 3PBUA 3FVDA 1CXFA 3IGSA 3FAXA 1V6WA 4B90A 3MMTA 4M6QA 3ID7A 3O1NA 3DG6A 5AKQA 1I2RA 1T40A 3UWWA 1W5PA 3LOTA 3HMJG 1MQRA 3M0IA 1JDEA 2XVGA 4Z1CA 3VOHA 3HQOA 1E9IA 3AIWA 3B8VA 5D02A 1B30A 4CQDA 3WJSA 4AMCA 5CPLA 4GQQA 3KOFA 2PTYA 1OADA 4PMXA 2DY3A 4GI6A 1EDGA 2VX6A 1DVJA 3AIVA 4PMNA 1MQPA 4LX4A 1N82A 3MI6A 1I60A 1KD0A 3RDKA 3PJWA 3TONA 2VHLA 5XIAA 2QYGA 4YN5A 1Q4NX 2VELA 3TFCA 4PE8A 1UR8A 1DE6A 2ZRWA 4NJHA 2QUTA 2QCFA 4CNOA 3GG0A 4UNIA 3L5AA 1IXNA 3BGAA 2QUNA 1EP1A 1O5KA 2XZ7A 1QI5A 4KEZA 4HHLA 4PFHA 3SFKA 1O4UA 4DJED 1SZEA 1TUFA 5AOUA 5AFDA 4AEOA 3VX1A 1KFJA 1MRQA 4LAOA 2W4XA 4XD5A 4V28A 2PDMA 3MMDA 3B9NA 5XIMA 3E1F1 2BZNA 5ABEA 4GUJA 1C7SA 3DH7A 3I68A 4L9ZA 4ADSA 1NJJA 2XFFA 3EXSA 4K39A 2EO7A 3BQ6A 4AY1A 3CQJA 3LI0A 3PJXA 4CU6A 1MNZA 1ICSA 4H8UA 1T0OA 4A2RA 1DBTA 4E2DA 1PZ3A 1ZAJA 9XIAA 4W9TA 3PWGA 3WY1A 4L9XA 3SSJA 1OFEA 2IKGA 1CXHA 2PDJA 3CQIA 3H2OA 4XBJA 1VCVA 3K46A 1MW3A 1M04A 4MWAE 4Q4QA 5A8GA 1K8ZA 3HGRA 2ZRYA 3AISA 1A5LC 4EXQA 4RNJA 4UR8A 1QBAA 1YX1A 3KBSA 3PFMA 5AC7A 1ONXA 5BROA 2Q6ZA 2DSVA 4YLWA 1MQQA 3MBDA 1BG4A 2WMIB 4AU0A 3W1NA 3LBOA 1WAWA 3I4KA 1FKWA 3UESA 1VCFA 3KS6A 1N8WA 1UKQA 1MMFA 3WNOA 3IJ6A 2PDIA 3AOFA 2WVVA 3UU0A 1J0KA 1B3XA 3R12A 4S3GA 3TMQA 4PN2A 1YTEA 1A5AA 4N0RA 4O1AA 1M7OA 2YFOA 1GVEA 1EJVC 2VYOA 2GGGA 3EWXA 3Q67A 2DU2A 5A2CA 2WZHA 2WB5A 3LDVA 1JQXA 3T0BA 5REQA 3CB3A 3SN0A 4ZZ9A 1PVNA 3W7DA 1HJVA 2OT1A 2BNJA 4KF1A 2DV0A 1I2PA 1HT6A 2YXGA 4ZTYA 1DP0A 1RA5A 1Y5WA 5CG7A 3IUIA 2L5HA 1PIIA 2PPGA 5ABFA 4I5UA 1ZJBA 1GOWA 3FYOA 1JUBA 3LY0A 3NPXA 3O8AA 4ECLA 1K70A 3BXWA 1I2OA 1NFGA 1RPXA 1TSIA 2YCEA 2CKSA 4NT0A 4WKAA 6REQB 2V63A 1A47A 1X96A 3BLPX 4BFAA 4H8VA 4PMZA 1XW8A 4GX8A 4GJ1A 1ZGDA 4BI6A 4IMCA 3VAVA 2ZUNA 1E3ZA 3CUXA 4QSFA 5JBFA 2H8XA 4YWSA 5DMLA 2HTMA 3LSBA 3WQPA 3CGTA 3W74A 4ERAA 3V16A 1JDAA 4DUWA 4HVXA 1ZBCA 1A5BA 4QEHA 3HPFA 2JE8A 1KQZA 1N8IA 4PR4A 3GVGA 1BYAA 3H7RA 4TX6A 3G0SA 4JX4A 1XLDA 3G0UA 4FPSA 4L1GA 3E0WA 2HPIA 3QZEA 3LERA 4KT2A 4EAMA 1Z42A 1GVRA 2J78A 3CTTA 4MUPA 4RCXA 5C2XA 3CPGA 4KEUA 1BQCA 1GG1A 3FXGA 3KWSA 3NQCA 2OU4A 3MT1A 4WDXA 4OFCA 3AJXA 3LPOA 1OVDA 3PWIA 3GYEA 4PBGA 3VI2A 1XCWA 2NVDA 4N2YA 2QKFA 2XFYA 5AVNA 1XYBA 3CLMA 1GW9A 3CT2A 4FXFA 2O56A 1TV3A 1GVQA 3RHGA 2WLYA 2GWNA 4IMGA 1W1IE 2EPMX 3PZMA 4ZB0A 3BV4A 2DW7A 4BWLC 3M44A 1DJZA 4UOQA 3N3MA 1EHAA 4MKNA 2ZYFA 3LGEA 4W7WA 3FHAA 3ZR5A 1QNOA 1ISZA 5CBIA 1FVPA 3CNYA 1I6NA 3Q58A 4ACYA 3TYEA 3MI2A 3GAYA 3N25A 2J88A 2VX7A 3T1GA 5C2CA 2HMCA 4MLJA 4OZOA 2GL5A 3P8JA 3HIJA 2XVLA 2FH8A 1B9ZA 2WHJA 3TJIA 1JRBA 5CSYA 1XH2A 1NP2A 3OJGA 3H24A 1FCQA 1R2RA 2VD9A 1NP0A 4X3ZA 4A8IA 4BQ4A 4H7VA 1WUEA 4EIVA 1F61A 2VWSA 1W1YA 1ZCOA 5CJ5A 4ICNA 1KFWA 1W54A 3FA5A 3DOPA 3PR2A 3O0FA 3H12A 3DCPA 1J11A 2E0PA 3P81A 3PF3A 3GO2A 1FY6A 3HU7A 1UR4A 4AWUA 4X61A 3WSUA 4AFYA 3EPMA 2WMKA 4OVXA 3UJFA 1K4GA 4OTKA 2J74A 4PMJA 2X30A 3CJPA 1MEIA 1A5NC 1KM4A 3RCNA 4OOUA 3UYCA 1M3UA 4C6JA 4L4MA 4ASTA 3PPHA 3CHDA 1UWUA 3WQWA 4ZE4A 1ITQA 4AIBA 1XRFA 5I77A 2XVPA 3GDRA 4D1IA 4PMRA 5CJNA 3EB3A 5DCBA 1FKXA 2P3ZA 4TR9A 4S3EA 1TVNA 1UUMA 3LHTA 2YFNA 3M5XA 3VIJA 3CH9A 3NR0A 3NQ7A 3OLDA 4CQAA 4Q8QA 4RNIA 1R7OA 1PB0A 1VBJA 4D71A 1BWKA 2CZVA 4M6PA 1SO4A 3AALA 3M0VA 3A4JA 4F2BA 3VZXA 1K03A 3ISIX 1RD6A 2OTDA 4AZ5A 3UWVA 4UTHA 1V02E 3OZOA 2WNWA 3C8FA 4DY1A 3TJ4A 4WHBA 3T6CA 2V38A 3WL1A 3DAQA 1B0IA 3SCOA 3V0SA 1H61A 3FSUA 3SJNA 1F4HA 3BUVA 1AMYA 4Q6XA 3TYZA 1JDDA 3ZLFA 2YCIX 3GDBA 1UC4A 3S2LA 3OZMA 5FKYA 4WXZA 4WKFA 1GJUA 3AIEA 4NRRA 4JTEA 1NDYA 4IL2A 4J3VA 2VNCA 4LPCA 2EBNA 4JX5A 4D6JA 4YNGA 3RM4A 2QUUA 5FEPA 4UZSA 3L4WA 4MADA 4X60A 3A4WA 4I3GA 3O0KA 1EJWC 2HNHA 3FEQA 4RE0A 2QJGA 4DNMA 4EKJA 2EG8A 1BRLB 1TCDA 2PWDA 1VD6A 3L0NA 4FR6A 4XZHA 2Y24A 2Y7FA 2J8FA 2GDQA 4LW7A 2ALDA 1PS9A 2YX0A 3IIOA 4DN1A 4X22A 3VINA 1YW1A 2X41A 2VJXA 1Q2RA 1TWSA 1W37A 3A24A 1A5SA 5EMYA 1F3XA 4K8EA 4JQ4A 3GUWA 3QGAC 2V5BA 2VURA 3APTA 1J8VA 5GQBA 3VABA 4RPQA 1XBZA 4NU7A 1UOZA 2FQIA 2J4GA 2Z2AA 1HO4A 1VEOA 1X1OA 4GI4A 4DWSD 4WDUA 3TE9A 2CLHA 1PXGA 1F07A 4IIBA 1KBJA 3GXNA 3MV01 4MKVA 4LBUA 3DFTA 1H5YA 5PTDA 4B15A 4FOUA 3C0LA 2GVJA 3L2MA 3QQWA 4IOTA 3S6TA 4ZB2A 4GNKB 2ZUSA 5FL0A 3G6MA 1DXFA 5AC5A 3PUOA 4CD7A 3ITYA 4Q8OA 1M53A 4RDYA 3MV11 4A6GA 1C8YA 3CEUA 2RUSA 1S2TA 3ITXA 4QE1A 3VZYA 4C5ZA 3GTFA 3V0TA 1TUXA 1PKLA 4LB3A 3VKKA 4HSNA 4Q33A 4LAUA 2CIPA 2NZLA 2OKOA 1OCJA 5FEZA 1XQKA 4WY0A 5AC4A 3DFYA 2QUMA 3NQDA 3AU6A 4AEFA 2DT1A 3NYDA 4IMAA 1H2JA 3SI9A 1ADSA 1XJBA 3WNKA 3K13A 4D1JA 2BHUA 3LHVA 4W5ZA 4C5YA 5DN1A 2Z7GA 2QGHA 4AW7A 3PSVA 2WJZA 1HFBA 3O05A 2W61A 1TVPA 3B04A 4MG4A 4NZ1A 4PB5A 3UVIA 3HG3A 5BW6A 2V3DA 2XM2A 3BOXA 1RQEA 1OFAA 4H1ZA 4B92A 3IK4A 5I3GA 4LF1A 3ARVA 1J0HA 2TMDA 3B9EA 4FMVA 1AW2A 2DQXA 3WJZA 1EEXA 5BU9A 3QZ6A 3TC3A 3DG3A 4PRWA 3W1XA 4HZMA 3QEZA 1M01A 1H11A 2CZ5A 4ROPA 5CAKA 3CL8A 4UC5A 4LCQA 4PULA 5C54A 1YDYA 2DW6A 2FPVA 4GH1A 5EU9A 3ABXA 1UWQA 1BG9A 2WV8A 2E8YA 2HJPA 4XTIA 4HOXA 3ARSA 3OLGA 4HCDA 3BV7A 3BURA 1GOQA 5HA7A 4H19A 3DFOA 5FAGA 2E68A 2BVWA 5I06A 5D09A 1AQHA 3GNRA 1RCOB 1H60A 1XUUA 2IQ0A 3VUSA 1DYSA 3PNUA 1V3IA 3URAA 4ADUA 4N9BA 4FSAA 1OZQA 1JZ6A 5HJLA 1U2YA 1LDCA 2C19A 1O60A 4DJEC 2CBVA 4ZOBA 4QJ4B 3ZM8A 5GJPA 4EE9A 1JPDX 2XSXA 1AH3A 2GJPA 3CQ0A 4O50A 4UTTA 5I09A 3A3HA 2NV9A 1I2QA 2OODA 5K4XA 3ARXA 1OF8A 1XL9A 4IIFA 5D38A 3P8IA 3KLLA 5DEZA 3NQVA 5B7YA 1EJ7L 4JHOA 2Z1BA 4UMCA 4LT9A 3P62A 1FH7A 4TV6A 1E4LA 2X09A 2OB3A 3WUGA 5FSEC 1H7XA 2V5JA 4IX2A 3OBAA 4GMEA 1EJSC 1Z9AA 1ODUA 3TW7A 1TV5A 2R91A 3G1VA 1XDMA 1DIEA 3GYCA 5G1YA 4CQ8A 3HFYA 5DLCA 4OU1A 1NOWA 1E1FA 2WSPA 3UVAA 2C71A 4Q4SA 4JIPA 1MXGA 2QLYA 2FHFA 2W66A 1S2UA 4ICMA 5A5WA 2FZNA 3GU2A 3AMGA 3EWBX 1YBQA 3WFZA 3NQMA 2ZX9A 1OFBA 3W28A 3BW4A 1J93A 3QY8A 1JD9A 3HM7A 3GHRA 3OQ8A 1XPYA 4HT3A 4H41A 1U1UA 3KE0A 3DUGA 2E3ZA 1CDGA 1KLYA 2ZZ3A 1XYFA 3BGGA 4DQWA 4JTLA 4V27A 2VVNA 3OU8A 3LU2A 1HZYA 3NQFA 5F2GA 1DWFM 1H7WA 4AD4A 3MKVA 3VIMA 4JYDA 4UIOA 3SSZA 2B7PA 2WCGA 3VDCA 4XZBA 3SIZA 4F66A 2AL1A 5H6HA 4CN4A 1OK4A 1P0EA 1W5QA 1J5SA 1DXIA 3IACA 1FX6A 3B0PA 4MMWA 5DX7A 4W8LA 3M41A 1JZ4A 1MW0A 3G5EA 3TWAA 4DM2A 2ZXDA 2OOFA 4D6GA 2GVGA 3WF0A 5HOSA 3P2VA 4V1YA 4M8UA 1RBLA 3PN8A 4JQ2A 4XVEA 2VUYA 3H2MA 3WH9A 3E74A 5E70A 3F2BA 4B9YA 4LB4A 3W25A 3G8EA 4U2YA 2VUNA 3GTHA 1BPLB 3M9YA 1WKYA 5HQLA 1XQLA 2BXVA 5A2BA 4HPXA 1J0IA 1XIFA 1IZJA 2XIQA 2RH9A 4P7OA 1NFBA 4D6HA 4UTIA 3SCPA 3A21A 4JGDA 3C2YA 2ZA2A 1QO5A 3O15A 2UY4A 1LLWA 3SCTA 3K4DA 3W23A 1JCLA 2NX9A 3VX0A 1AK5A 3ZJ7A 2CBIA 2ZRXA 1QHPA 2I14A 3EOUA 4LRSA 2J8TA 4CCCA 4XVDA 2TAAA 3OGSA 5DXXA 5BWAA 4QJ3B 3UWYA 3NEHA 3VC6A 1TPDA 3I10A 3PZGA 4RK8A 2TODA 3KVLA 4G7EA 4N9CA 2QPSA 4W88A 1Q6FA 3I6TA 3WF1A 3S83A 4JXCA 3VE9A 3U0HA 2VTFA 2MNRA 3QQ1A 1Y5XA 4WZHA 1EF3A 3DGBA 1P0DA 3EA2A 4BY3A 2P76A 4X0VA 4AZHA 3AYTA 3NUKA 3VC5A 1D3CA 1JF5A 4Y2WA 1HJXA 3LXAA 3R25A 3PTMA 4NG3A 4XAYA 3PB0A 4ATLA 1TE6A 2V3FA 2ODOA 4WSJA 3WLSA 4F3HA 4UQAA 2PLJA 4HK7A 3V36A 1SZFA 4ZQCA 1ZRQA 3TLLA 1DV7A 3CO8A 4AZIA 1EC9A 4CNUA 1UC5A 1FXQA 3ZQ9A 1QASA 4L6DA 3QMSA 5XINA 5D37A 3IAQA 4ENLA 3KRBA 4Q32A 5CSSA 4C60A 5IHRA 1YDVA 3G3DA 5C0QA 1XHGA 4FO4A 1X8FA 2ZE3A 1VC4A 4AIUA 2OFJA 5I5RA 4PTDA 1JDCA 3EYPA 3R79A 1AODA 4CKQA 6A3HA 5BXTA 4K1GA 4Q4MA 3ZT7A 5HBFA 4O4WA 4LVBA 2FMNA 1OG6A 4LC6A 1R8LA 3R5EA 5ABTA 3AHXA 4BF7A 5FL1A 2BGNE 3MHFA 5FJOA 3S9YA 4FALA 4KCUA 5LA2A 4GABA 3NGJA 3GVQA 2XZ9A 4S3AA 4CEXC 3CUFA 1AQMA 3GDTA 1L8PA 5LXXA 4HA1A 1XBXA 1LORA 1QMLA 1PYMA 1R6WA 3OVPA 4FB7A 2PUZA 1HG3A 1V6YA 3PBGA 1GWJA 4DXXA 3O9NA 4DEFA 4DRSA 2DZWA 4GKTA 1T5AA 4DWSB 2CHRA 3SDOA 1T96A 2RAGA 3WJXA 3I6RA 4Y9NA 5BOEA 1E40A 5AC8A 2Z00A 2QV5A 1WE5A 4IIHA 3TX9A 3BOLA 4HTBA 1E72M 1Q8JA 1TTIA 1Q8AA 4F48A 3FN9A 2Y5JA 2PWEA 3ECQA 1W5NA 3PUEA 3CAVA 5I3KA 2VCAA 1K77A 5B80A 4F0LA 1S3HA 2ACQA 5AHLA 1CGWA 4W7UA 3CPUA 4ZOEA 2ISDA 4ZQPA 3W27A 3MUXA 2EG6A 5CBBA 3GD6A 3VDBA 3A3WA 4QQUA 5ECVA 2Y2WA 2Y7GA 3BMVA 4O12A 5LNWA 4LY4A 4PL2A 5IFTA 4A22A 4ZOCA 1RQHA 3OBEA 1M7XA 2F38A 1CT5A 4HK6A 2X05A 3UT0A 3EMCA 2EG7A 2POTA 1QR7A 4GH3A 3F03K 3S1GA 2WMHA 1UZ1A 3DN5A 8CGTA 3EDJA 4PC8A 3FX4A 3STCA 3WDIA 3TA6A 3TVAA 1ZUAX 1C7TA 1CGXA 4JTTA 3OQEA 3ITLA 4UZUA 2BY1A 2D3LA 3EKZA 3MO4A 3N9SA 3E9AA 3WJYA 2PTXA 4AISA 3MPGA 1VFFA 1E1EA 4AB4A 4FR1A 5DELA 1K7XA 3B05A 3IS4A 3C2FA 4BHYA 1WNOA 1TJRA 2NXIA 3QV8A 1XI3A 5KETA 4C1NB 2GWGA 3DESA 1XSKA 1QBBA 4RL3A 2OYKA 1ISWA 5HJXA 3EOEA 4KWWA 4WX2A 3BL3A 3QLDA 4WJ8A 3WLIA 1ZJIA 1TJ0A 4G9PA 2EJ1A 1H4PA 1CTNA 1XFBA 3H2NA 4HMDA 2VZSA 1S2VA 4YTQA 2HWGA 3WQ4A 1AD1A 1U5JA 1MDLA 2WMJA 2DZBA 1G6CA 3KBMA 4NI3A 1XLMA 4DBSA 1FQ0A 1ZPTA 1XH1A 4ZO6A 1B90A 3W7CA 3LSCA 1X1ZA 1RA0A 4RLIA 3HPAA 4JFSA 4Q8UA 3B8WA 3A23A 4O18A 3L23A 2BS9A 3C0JA 2V81A 3CAQA 3JZUA 3AZRA 3BW2A 4E38A 3OIHA 2E8ZA 3AUOA 1BHGA 3UR5A 1GZGA 2C1IA 1FDJA 1VBUA 1EP3A 1HP5A 1CX9A 2OO0A 3TC6A 3TV8A 4XWUA 2GOUA 1VQTA 3UQNA 4XBKA 2HXTA 3RR4A 3S42A 1M5WA 3T4WA 1ZS2A 1YDNA 2A1YA 3M0KA 1FUYA 2J79A 1O12A 3GHTA 4DLFA 3KOZA 2OMAA 1W5OA 3WMCA 1EA0A 3NL2A 4NKCA 3TU9A 2NQ5A 3VFLA 5I02A 4DO6A 1TZ7A 1XRTA 2PDFA 1JCTA 1PV8A 4IPPA 3E2QA 3UXDA 3LMYA 4H9VA 3GHUA 3GBEA 3GW3A 1QOXA 3QH2A 3HPXA 3VNJA 4DI8A 5E6ZA 2DVUA 1TTJA 5AYZA 3O07A 3L67A 5LGZA 5CLTA 1SMDA 4B5UA 1SPQA 2INEA 1L9WA 3AHVA 1NIUA 1TG7A 3BG5A 5T26A 1ZHAA 2LLEA 4MVAA 4ZCWA 4W89A 1CNVA 1AJZA 1TB3A 1DIDA 3R89A 2VZVA 3W38A 4I7VA 1J10A 3WQOA 1K9DA 2JF6A 4KWSA 4JEJA 4GQBA 1MWOA 3M5VA 3FSTA 4ZTXA 5LNSA 4FNRA 4JYFA 3THCA 3VIPA 5E93A 4PUNA 3GZ3A 1FWDC 1G01A 3MMWA 3T8LA 3U2OA 3L0GA 1SR0A 2IKJA 1LUCB 1XPGA 2OLSA 1XBYA 1XLBA 1JI1A 1XGZA 3OO2A 4MDOA 4S23A 3ANVA 4IXXA 2WLZA 1XLEA 1YPFA 4KEVA 1GPFA 2WMIA 5H91A 4F4RA 4ZSTA 1CBGA 4FXJA 3TTQA 4E2BA 3RRXA 4J9JA 1K6AA 3WLTA 2A7NA 4BWLA 1TPB1 5KTLA 3AS0A 1P4CA 1X38A 2V2DA 1RALA 2E5DA 2JFEX 1UZ4A 1Q63A 3V18A 5IDZA 4ERIA 2OQHA 4GJJA 3ZJ6A 1LROA 4YHGA 4Z2IA 1PE1A 3E5BA 1P6CA 4CEUC 5CG0A 5D33A 1NSJA 2BOEX 2XDFA 1PO9A 2SFPA 4IIDA 4JEQA 1W3IA 1YADA 3SB0A 3GU1A 2Z0IA 4S3CA 2BMBA 2E7FA 4HYWA 2IS7A 3MZ2A 1V77A 3L5LA 3N6HA 4W85A 2YL8A 4IG2B 2XN2A 4BF5A 1TPUA 4UQDA 4UQBA 5CGQA 4PH6A 2VX5A 1IT7A 4GBDA 2AAMA 2XVNA 4IZGA 3ARYA 3D5HA 6REQA 3LLFA 1VIWA 1R7AA 4QQ3A 3AXXA 1UKTA 3RLVA 2R24A 3HZ3A 3PBVA 4QRNA 4NP7A 3A12A 1NDWA 4R7WA 3L0KA 2ZUMA 3B8TA 1J6OA 3L5MA 4YVPA 3HQ1A 4GRSA 2HEJA 3BLFA 5DQPA 4XIAA 1FCVA 1V93A 3VOFA 1OF6A 3L2IA 4LALA 2VRQA 5A6KA 4LS1A 2OVLA 3IUDA 3I7SA 4NJIA 3BLOA 1BGGA 3M47A 4AY8A 3E2VA 1L2UA 4A3QA 4HNTA 3TFXA 4ATWA 4FLOA 1AQFA 4HN8A 4EXBA 2IUZA 3G77A 3ZMRA 5A6MA 3WNNA 4MKSA 2QCLA 2D69A 1NF7A 4GGHA 1HF6A 4HNCA 4U31A 2DZSA 4KRUA 4NAFB 4HNVA 1L6SA 2C0AA 4E4FA 3NGFA 5K2ZA 2BG5A 3SN4A 1C8XA 2WCAA 1KBKA 3MSDA 1E51A 1R3QA 5EKYA 1NDVA 1SR9A 1WZLA 2D73A 4DYKA 2X1TA 3W3OA 3WBXA 2XFRA 3HG5A 4GNVA 5LSMA 1KQYA 1ZZMA 4GIAA 4PSPA 1VCGA 1S2WA 3MU7A 3T09A 4EPKA 3OVRA 3G1XA 4B5SA 4IIGA 1VFUA 4CQCA 1QW9A 3QPEA 1XXXA 4Y96A 4KFPA 1J6PA 3HV8A 4C6OA 1W2PA 8XIMA 5FSDC 3ITOA 2OR2A 3GB6A 1M65A 1J4EA 2JBMA 3RYSA 4DZ5A 5A3HA 2ZRVA 2J7BA 2Q8LA 3W88A 1OWQA 2E09A 3N17A 2VRKA 3SUVA 2GVEA 3MBFA 4C6PA 4WUIA 4P2VA 2FFCA 5CAHA 1EPVA 1TA3B 5BRQA 5TAOA 2CITA 4X0NA 2GJLA 4OWGA 4MYXA 1PTAA 2VDGA 4DBUA 3EOSA 1OD8A 2G8ZA 2R1PA 1AJ2A 4I6KA 3G3MA 3JUGA 1XISA 3GR7A 2PWVA 1SVDA 3T08A 3QJAA 4DIAA 3H2EA 4AF0B 3LRLA 2PWFA 4K8HA 8XIAA 3NQ6A 2PDKA 3CL6A 2HRWA 1K8XA 5FIPA 5SWUA 4WD0A 7REQB 3CWNA 3LRKA 3OG2A 3S0CA 4LV9A 1A53A 2ZA1A 1MFVA 3RMJA 3COTA 1ZP4A 1F8IA 4GZ7A 3QHOA 1B1YA 1B3WA 5HK4A 2NSXA 2A7PA 3H26A 1LWJA 2VEKA 5HUOA 4ZXLA 2BOGX 4RE3A 1VS1A 3SY5A 3BARA 4B5VA 1H50A 1AH4A 1HJUA 2YBVA 4OBSA 3UJSA 1JYWA 1DQUA 2CWNA 3V5OA 3G1DA 2QAFA 3B8SA 3W00A 3M07A 2R82A 3AICA 3KDNA 3C5QA 1BTMA 3SW6A 4PMVA 4HB7A 3QR3A 1XDJA 3AYVA 1GORA 1LF1A 5BZAA 2I5QA 2H8ZA 1RQBA 4IISA 2RGLA 3G8RA 4O16A 2QDGA 4FNTA 1G69A 1I9CB 3CZ8A 4B3ZA 1NF0A 3B8UA 4JTGA 4UFLA 4PYSA 1GOIA 3I4EA 3K8KA 1VPXA 2FJUB 3AIUA 3MVTA 1WDQA 5E9XA 5A6BA 3KRSA 1QK2A 3CHEA 1VAHA 4AMAA 2X40A 2CLLA 4DJFC 1W9XA 3SECA 1H1ZA 1V3HA 4XZNX 1F73A 4KW2A 3WELA 3ZYZA 4YU1A 3U3HA 3NCOA 3SCNA 1QNPA 3D0CA 3I65A 1WV2A 5CPOA 4UOZA 5BRPA 1GJPA 3GX9A 1IWPA 2Z2BA 3R0KA 1SW7A 2PLKA 4N9EA 3EBVA 5T8GA 3VKJA 3N3TA 1Q13A 1TZZA 3LTYA 5M5DA 2FTYA 1FHUA 1RY8A 3N4EA 1KTNA 5A6TC 5D8ZA 1Y8BA 1VPQA 1AVAA 1HNYA 3PPGA 1QJWA 1RAKA 1FH8A 4L5ZA 4NZ5A 3BE7A 1CWYA 1BRLA 3WUBA 5HWNA 1DJGA 1YEYA 3R94A 4PUUA 2QCCA 3EPOA 1B3VA 1SJAA 1TV7A 2BXYA 4K38A 4LVGA 2YCLB 2EXOA 3M1ZA 1Z69A 3LBMA 4UTUA 3WQGA 4AY7A 4XAFA 3PSWA 4Z1AA 5JQ9A 4G7FA 4MFDA 3UNDA 3QN3A 5DXYA 3TA9A 6ALDA 2DIKA 3PZUA 3GG1A 3W07A 3PWAA 1PZ1A 1Q6RA 4Z2JA 4WKHA 3TZNA 4DJEA 2NWSA 2CLIA 2F61A 3HJZA 3LPPA 4KFOA 1RR2A 1E0TA 3CK5A 2OZTA 4DJDD 2V3GA 1LM1A 2WM1A 2ZC8A 2JKAA 3A22A 1WKEA 1WP6A 5ENLA 4Y9MA 5E0CA 1E15A 1SJCA 2B7NA 5FAJA 4Z1BA 1KXQA 4UQCA 3M4HA 1I2NA 1LP6A 2PBOA 4NSBA 4YYFA 3VXGA 2WZEA 5HPOA 2VDHA 3VIFA 2DSWA 2X1SA 2CLOA 3D46A 4CCZA 5A6LA 5CPTA 1AZ1A 3W22A 2CLFA 3FAWA 4IPNB 1M41A 3KLKA 4GBUA 4DPPA 3UP8A 2Y5SA 2HQAA 4UFKA 3U9IA 3UR7A 1ZB5A 4UMBA 4LC8A 2PAJA 1CZ1A 2EEXA 3U4FA 1NAL1 4NI8A 1AFSA 3RLHA 1VJZA 3TUUA 4WEVX 1ICQA 1ZTVA 3T07A 1X6LA 3KEHA 4NZCA 4GI9A 4OE7A 4NYYA 4AC7C 3AWOA 1QK0A 3PTQA 4D72A 3GXMA 3LA4A 3P67A 4O1CA 1PDYA 2NUXA 2YSWA 4PCNA 4XSMA 3UA3A 5JH2A 2ON3A 3FY1A 4OECA 2ZXQA 4DXKA 3ALFA 4W93A 3C2VA 3L4VA 4Y7EA 4PEKA 2QVHA 5AYIA 4ZOAA 3DDMA 2VZUA 1KCZA 3CO4A 1BYCA 3EGJA 4AWTA 3F5KA 3P74A 5GNXA 3B8IA 3BWWA 4Y6GA 4UTKA 2XN1A 3W6LA 3HBLA 2XGBA 3P3BA 2J47A 1JYVA 1EEPA 1QNQA 1SSGA 3OHMB 2PGWA 3KOXA 5C7HA 2J7HA 5AYXA 1KFEA 3LCFA 3T0DA 4XZWA 3N2CA 3F4VA 2YPIA 4PBFA 3T0AA 1B57A 2BDQA 1OEPA 4ZEPA 4RKAA 1T7LA 2PBGA 5A94A 1VHNA 3E6EA 1K3UA 4FLRA 1FTXA 3MUY1 1W1PA 3VGBA 1W8GA 4HZ7A 1KKRA 3BO9A 3CUIA 1F4AA 1K1DA 5IDIA 3AMDA 5FI8A 2DUZA 4RZ4A 4M29A 3WX7A 4O1FA 4IQDA 2E6DA 4GX9A 3W86A 4XB3A 5D9PA 4FX8A 2J24A 4GIRA 1JPHA 4DI9A 4GYKA 3OP2A 3ERPA 1B2YA 3W0KA 3BSHA 3H23A 4DM1A 3A6OA 3IVSA 2J9YA 1UA7A 2PS2A 1FBAA 1GQKA 4IMEA 3RM9A 1C8QA 2YDQA 4GZIA 4MY1A 1LOQA 3K1GA 1EKOA 2NT1A 3NPUA 3SIMA 1F6KA 2QCDA 1ZL1A 1PCWA 2ZIDA 3IIVA 3L4UA 4W86A 2PC8A 5CXPA 2BY2A 3WFLA 3RX2A 1RUSA 3WLKX 3TIMA 4H2CA 3H7UA 1GPWA 3HV9A 2Q02A 2DZVA 5F4WA 1NWTA 1OFDA 3KTCA 2XVKA 2OWWA 3RR1A 5T9BG 1ITXA 4INFA 1Y0EA 3AXIA 3TYDA 2QT3A 3BGJA 3GUGA 4H3DA 2PTWA 3O3RA 1BD0A 3FDGA 4K3ZA 2F2KA 2QCHA 2DSUA 2UBPC 4B2DD 1K9TA 2CZFA 2BX7A 3KVMA 2QCMA 1KRAC 3KHJA 4TU1A 4O15A 4Q8WA 2CESA 3GDLA 1ZENA 1XC6A 3NQGA 4LS0A 3E12A 5T9CE 4B3KA 4QXIA 1YMYA 1TTPA 1E5NA 1LL6A 2DQWA 3ENLA 1XDLA 3H22A 4AWSA 1QNVA 2Z1KA 3BC9A 3L4TA 1OFRA 3W84A 2PRLA 4FA3A 1LBFA 5LIYX 2VOMA 4H9UA 3UG4A 2ZCGA 1QI4A 2GPTA 1OT1A 3B0YA 4PTXA 1FWGC 1DPMA 2DT2A 2YOCA 4K7YA 3CMJA 2NUWA 2ZZ7A 2PDHA 1LQ0A 1FWTA 3IIZA 1FWNA 1FWFC 3FV9A 4DBEA 4BK9A 2VQTA 3VNZA 3MP4A 4ES4A 4GACA 3BICA 4E3TA 3UJRA 3GIQA 1IGSA 4B16A 2QDHA 3STPA 2G0WA 2XIOA 5TIMA 2XGIA 1VJSA 2Z1SA 1AZ2A 3ZVHB 3KXQA 4QJ5B 3TAKA 1WQ5A 2XHYA 2WK2A 1WX0A 3EX3A 4G1NA 4XZLX 2YXXA 4E8CA 4WK9A 1QI0A 4TX9A 1O1ZA 3VYLA 1ITUA 1DOSA 1TV4A 2DZPA 3OIXA 1LT8A 2A0NA 1VPYA 1A80A 3UXIA 1W91A 1GYMA 1OT2A 2XWEA 4M56A 3TN4A 3VIIA 2AL2B 3NSMA 2AMGA 2I9EA 2H9AB 1IHIA 3TJLA 4Z2HA 1S2CA 1A4MA 1CENA 4HPJA 2KX9A 2IXUA 1W56A 5K9CA 1U1HA 2PWGA 4IP5A 4DBWA 3OOQA 5GNYA 4H6QA 2A3BA 3VNYA 2GQAA 3GC2A 4L1XA 5CZJA 1OQFA 4GIYA 4FNUA 2I17A 1ZJHA 3WEZA 4O28A 5EMMA 3RLGA 4KGLA 1Q45A 2J6VA 3T2OA 2ATSA 3B06A 5HAOA 2VKZG 4JTQA 2UWFA 1A5CA 2GJNA 1D2KA 4HKPA 4M7TA 2NX3A 4JIRA 1PKYA 1BGAA 4L7ZA 3UERA 4Q6JA 4U2ZA 4ML9A 4IFOA 3DZ1A 4GUHA 3R0DA 3N12A 3Q2DA 2PGFA 1LL4A 3SCUA 2REQB 1BYBA 3VIGA 4K6AA 3DI0A 4B91A 4GOAA 3VMPA 1S5WA 1TJ1A 2FGBA 5HANA 3ANUA 3EWWA 3DYOA 1M03A 3V0UA 3A47A 3LZ3A 2CYGA 4G6CA 2R1LA 1QNSA 2MUCA 2WJDA 3REQB 4LRTA 3QPYA 4C1LA 5LA0A 2P3EA 3QY6A 3N6JA 2HK1A 2FDSA 2C16A 1QTWA 1IWBA 1MYRA 5GJNA 3AI0A 3H55A 3UPBA 2X1UA 3WLJA 3RO6A 1DORA 3BG3A 8A3HA 4DO5A 3NDZA 3TWBA 3VKBA 5FACA 3C2RA 4L1WA 4Y90A 3UA4A 4DWSA 3PZVA 4LUSB 2W91A 4A29A 3WK3A 3NM3A 4KQNA 5M17A 1FXPA 3EWDA 3E0LA 4Q7BA 1DXEA 1TCMA 2BXZA 1FCUA 4NY2A 1HJSA 1P0NA 3AMCA 2OJPA 1KRCC 1JZ3A 1ECQA 4OIFA 3W2KA 3WLHA 1L6FA 5MKGB 1JFXA 5JMUA 4RW5A 5LXEA 3SY8A 3IK2A 4OUEA 4F2UA 3TQKA 2GDVA 5IBXA 3SURA 2ISWA 4NXKA 3EX2A 1KNWA 4UMAA 4HK5A 2QCGA 3KCLA 1OFOA 2W27A 2VX4A 3N11A 5JBDA 1W3NA 1EUAA 4JTJA 3W7PA 1F05A 1RH9A 2E9BA 1X39A 1K7EA 2YA1A 2OPJA 4J1OA 4GWEA 3N1AA 3ABZA 3QMRA 4F0RA 4NQ1A 3WLNA 1FWAC 2QIIA 4FLSA 4UUIA 3VGGA 1H63A 3O6YX 1VH7A 1W1VA 1EDTA 4G5DA 3NOYA 1P48A 4Q8VA 3GVVA 1P7TB 3NL3A 4JL2A 4QP0A 1I1XA 3B03A 1BFNA 4D9PA 3B3DA 4ADTA 3T0CA 3VGFA 4J27A 5IOBA 2A3HA 1TPEA 3Q37A 3NL6A 2B0MA 5FESA 3DFSA 3SRFA 4UOJA 2QMKA 2R1MA 2X16A 4GISA 4XAGA 2WZIA 4FX6M 4NZ3A 1MXSA 3MJYA 3QW4B 3G1FA 3E49A 4C1NA 1UMLA 4GC4A 5I3HA 1E4MM 1B54A 2XU2A 4UFMA 4NRSA 2C1HA 4YMZA 3BCDA 2J25A 5LHFA 1WXZA 3CH0A 3KX6A 4EWJA 2CCRA 2PP1A 1EL3A 3AXMA 1EJXC 2Y1HA 2ZZ1A 1Q6GA 4G2DA 4YHEA 4H8HA 1DJNA 2AKMA 5BWFA 3CT7A 1CGTA 3TN5A 1B4EA 2JEPA 5MHBA 4HOZA 3ZT6A 1XYCA 3R8HA 4F9JA 3N19B 2PMQA 2Y89A 1XLAA 3WQVA 3UR2A 4EF9A 3IANA 3AXKA 3WLOA 2YA0A 5FF0A 3QC0A 2F2HA 1G4PA 2PB1A 4YXGA 2YBTA 3GG8A 4WVXA 1DHKA 3FGCA 4DJDC 2VWTA 3O63A 5HULA 3CZJA 1RK5A 4L6OA 3N29A 3KZPA 4GVIA 3P6LA 5HQEA 2VZOA 5M3WA 3QLLA 2VFEA 9CGTA 4OOZA 3P0WA 1UR1A 3BMWA 4PTNA 2YXOA 1FCBA 2DIEA 3MUIA 3CL7A 1EWEA 2AKZA 4WDTA 4QG8A 1GHRA 3WMLA 3CZLA 3BCFA 1X7IA 1TMQA 2E1WA 4J5NA 2DPEA 3NDOA 1E6NA 2BGSA 1F7BA 1A5UA 2A7RA 1XGDA 3VIHA 4EPEC 4LEFA 5I3DA 2CBJA 2O92A 3M43A 3BH4A 4FLQA 3PANA 2HBVA 3WG6A 3N4FA 2PFHA 5KZMA 2DVXA 2HROA 1SO5A 4GG9A 3MYOA 3URQA 5D2TA 3NXFA 5E09A 5JIWA 1SJBA 2BLEA 3IPWA 3T0TA 1POKA 3TW6A 1WBHA 3UZYA 4OKDA 1IV8A 1KLZA 1XD1A 3F2DA 3GXPA 3QHNA 3CTLA 1PEZA 3O16A 1V7YA 4N4PA 3VO0A 1ALDA 3THAA 5BYWA 1F74A 3W2MA 3IRDA 2WSQA 3NO5A 2Q3OA 1PYFA 5ABHA 3BPWA 2AOSA 4E6MA 3C4UA 5CPNA 3R4IA 4MUZA 4C6QA 1Q6OA 3LEPA 1GKQA 1H0GA 1VHCA 5CC3A 3GQYA 1F2JA 3PZQA 1ME8A 2E6YA 3T8QA 4JQAA 4LYKA 4AH7A 3NSXA 1LUCA 5I24A 3G1SA 3VGDA 4MWAD 3KL5A 5REQB 2GLKA 4FXSA 2VEIA 1OX4B 1EHNA 4ZMGA 5AECA 4R3UA 2Q8XA 1UIPA 2BY0A 1AW5A 3W7OA 4W7VA 5AN7A 2FHBA 3HTWA 4FIQA 1DJWA 2VC7A 4D2JA 1DJQA 4GQ0A 4AD5A 5H2ZA 3TMLA 1I45A 3IV8A 3NSNA 3CUZA 1H0IA 1OCQA 1JFHA 2CERA 3AHYA 3UY7A 3F2CA 3UNTA 3UXKA 1DHPA 1T6MA 3FHQA 5K9DA 3DC0A 9RUBA 3C6CA 4DAFA 3LYEA 4ORMA 3VD9A 3WLPA 1M9HA 3LV5A 1ME9A 1FDYA 5BMWA 2D22A 4O8AA 4A8LA 4EXAA 2Z2UA 1TWDA 4TVCA 3UXLA 4JL1A 1FHDA 3ZR4A 1UKPA 3G1RA 3N04A 1VEMA 4MB3A 4O54A 1I8JA 4HQVA 4RE4A 3V5CA 4PMYA 2VFFA 4PMOA 3MS8A 1S5MA 1CXKA 2EPKX 3NTYA 3N13A 1JR1A 3VDGA 1S38A 3OBKA 4E4PA 3SCRA 4JPGA 3GKFA 1R3YA 1HW6A 3QTPA 2XIBA 4XSLA 1L6YA 1LCOA 3GNPA 3I3DA 3D6NA 1QOPA 4IG2A 1EGVA 3ITVA 2WCSA 2Z25A 3E2RA 1KR0A 3HG4A 1J0YA 4BZYA 1GG0A 3NQEA 5M03A 2XIJA 4MNJA 2BVYA 4U4MA 5FF2A 4C7DA 3NXLA 2W5FA 4GYPC 5HINA 3AWNA 3AAMA 9XIMA 4Q8PA 4KCTA 1V08A 1UH2A 4RXFA 1F6PA 3BLLA 2OO6A 1HKIA 1XLHA 1MNSA 2XJ7A 4PTWA 4GKLA 1B3OA 3ME3A 1GHSA 1K8CA 4I7WA 3SM0A 3ITTA 2C3ZA 1FA2A 1JUKA 1SMAA 4OT7A 4PSRA 1H5VA 2VR2A 1W9BM 4RZ6A 3QYSA 4GO8A 5ABGA 5IFPA 1MEWA 3GTXA 2ICSA 4CD8A 4GLEA 3U5YA 2X2GA 3OEXA 2XINA 2QDEA 2FZDA 4EPDC 5F2MA 1PTDA 2P1FA 2DT3A 4UNLA 1GCYA 4I9TA 2AGKA 3FYYA 3GNNA 1S5VA 4S3BA 1V7AA 1BQGA 3EDDA 4NAFA 4JN6A 3S8HA 1REQA 4MY8A 3GRIA 3T44A 3W1TA 1LG1A 1GEHA 1XX1A 4DJFA 1TR9A 4HP5A 1D9EA 2DORA 1QVBA 3W01A 3U8GA 5G1MA 4JTDA 4BQ2A 4OV4A 1VR6A 1TPC1 3R8GA 4KS0A 2VVSA 3EWUA 5CH9A 1XV8A 4IFKB 1E0WA 1KWKA 5MF5A 4QLKA 2OCZA 4LBRA 1E6QM 1UP3A 1JNDA 1OGBA 3Q65A 4GZEA 3NZPA 2DIJA 2XFWA 5CGTA 3NEVA 1NELA 4GO9A 1MI3A 5HNTA 2V5DA 4KMQA 5E0FA 1JEZA 4QITA 4G8TA 3SRHA 1JIBA 3AYSA 1KWGA 1F9CA 3VD7A 1MZHA 3BTNA 1SW0A 4QM1A 4LY8A 1S3TC 1JZ5A 3THUA 4QFUA 1TA3A 1L2QA 3W2LA 4MPQA 3FVMA 3OTRA 1KM2A 4WSHA 3CMFA 2CFFA 2OSXA 1ISYA 3GTIA 5FJUA 4GY0A 3EB4A 5HNUA 2GK1A 3OYXA 1SZGA 1QFEA 4W4QA 3IAPA 1G9HA 1TQXA 4ALDA 4AF0A 3ABSA 3S1UA 1QCWA 1PPIA 2QXWA 3DHUA 3BJSA 4AD0A 3F4DA 2ZZ2A 7REQA 4AYGA 1FDZA 3WEMA 1DWHM 3PFRA 3MKCA 2YZRA 4D8AA 2DVTA 1Q85A 2XIMA 1DWAM 4R34A 2O9TA 2E5CA 3J7HA 3QGKC 1YTDA 3TTYA 3BK0A 3HPSA 1RK6A 4Z2LA 3LZ5A 2FB2A 2Y7DA 2WNQA 2D1ZA 2YZ5A 1LRNA 3FS2A 2NQLA 2GGIA 3WK2A 5C70A 4A2SA 3AO0A 4DHGA 2P50A 1ZFJA 2QEZA 1RBOB 2VI0A 4AHPA 2FHCA 1QI3A 3D3FA 2JIEA 4QE4A 5HMFA 1SO3A 3L4ZA 1U22A 4K8GA 2OZ8A 5I00A 3RG6A 1S39A 3ABRA 3UCCA 3BSMA 2ANUA 4E3VA 4KWOA 1JAEA 1UOKA 3RIKA 3LN3A 1AG1O 1YIXA 3VIOA 3VKDA 1MUMA 3B40A 3SAZA 5D30A 3WIJA 3TOPA 5M1TA 3S6OA 2D24A 1B5TA 2HZGA 2P88A 4MB1A 1CI1A 4CGTA 4H7CA 5T91A 3II1A 2X8RA 1HJQA 1DKWA 3LCXA 1XYAA 3IJDA 1ONEA 4GINA 1GVSA 1DE5A 2V0TA 4YIWA 3A5FA 3CEPA 3L2LA 3M0ZA 3CASA 3A5VA 3U6WA 1W1A1 5FF4A 4MSSA 4HCHA 3E2SA 3GIPA 3W7IA 4JY8A 5G1TA 3S2CA 1GT8A 1UP0A 2G4JA 3W02A 3FIGA 3LK6A 1PJ9A 4O1DA 3A4XA 2WJEA 2WSRA 8RUCA 3B0UX 4XZIA 1HGYA 4XX6A 3IIPA 3S1XA 3PZNA 5FJIA 3CZEA 4LCRA 3RF9A 3AXHA 1CGUA 1C9DA 2MANA 2EPOA 3WD4A 2P5NA 2HS8A 4IXHA 2W6RA 3R8RA 1K02A 1CLKA 2HK0A 3DECA 2GVYA 1U33A 1XYLA 2E5BA 3UFYA 2EKCA 3EXTA 1HXJA 1WPCA 1IE7C 2YCLA 4HNOA 3W82A 2GSHA 4O11A 3FDKA 3VOCA 2W79A 4TO8A 3SY1A 4HD5A 4BCEA 1A0EA 1LLOA 5CPSA 4WY0B 1VFTA 3LCWA 1EPXA 2BVTA 3OHIA 3U57A 1OGSA 2NVCA 4YTTA 1CXEA 1HKKA 4O52A 1K9FA 1ZCCA 3DI1A 2BTMA 2YB4A 3BJTA 4QG6A 2VM8A 1LL7A 4U5KA 5LIWX 3LCHA 3QKEA 4IFRA 2FFIA 2A3AA 4JN8A 3DIPA 3NL5A 3CV7A 5CEWA 2Y85A 1JZ8A 2A6LA 3AS1A 3ELFA 1VBRA 5EBAA 3RCMA 4GXPA 1VBHA 3FYPA 4AUBA 4QAWA 4JICA 3IEBA 3TCSA 3TN3A 4A8NA 3LM3A 2Z1WA 1IWAA 1M7JA 1NVMA 4RJEA 4MWAB 1EC8A 4XAZA 1LG2A 4CNSA 2DUXA 4ATDA 4MJ4A 3GSMA 5AYBA 3K1DA 4U10A 4PODA 2Z7KA 1AL7A 1SYTA 5LKYA 3AHTA 1BWLA 4JHMA 2RHGA 4AD2A 1G5AA 1WO2A 2Z1VA 2OSWA 2HE8A 1Q66A 3VE7A 2XWDA 3FK4A 1PKNA 2Z4GA 4B9ZA 2CNCA 3VD5A 3T81A 2X7WA 1OB0A 3QYQA 4E2OA 3W73A 4N6FA 1F76A 3PZ9A 1XM3A 3AZSA 3FLUA 2O9PA 3OA5A 1EJRC 2WKJA 2VO5A 3VUPA 1GQJA 2F8QA 5CSUA 3D47A 3GIYA 3LX9A 4JBRA 4HJWA 5AY7A 4QLLA 4TV5A 3RRAA 5DCDA 4KETA 1HKVA 2J7EA 3OLIA 3QF0A 2Q8ZA 1T41A 3N18A 3LNMA 3HF3A 4C91A 2ZRUA 2X0YA 5AVHA 1ZNNA 1GTEA 1KFBA 1QPQA 1SSDA 5FF3A 2AAAA 4K37A 3DC8A 1JXKA 4C6KA 4K2SA 1H1NA 2NQJA 4REQB 1TX2A 4XZMX 2Z6JA 3U2CA 1I75A 1ITCA 4XAPA 2PODA 4YCPA 3NPVA 5FF7A 3NPWA 3TTOA 1WYIA 4X9SA 1BSIA 1E9YB 1OZMA 1G7UA 2WZMA 1AMKA 5I3JA 2V5CA 2CHOA 3CUHA 7ENLA 1ZU8A 3GVRA 1UWTA 1W1B1 3W6YA 3VM5A 4C6LA 1WOAA 3VU2A 4I8YA 4WIWA 3HGJA 1Z6KA 4B3LA 4JD4A 2G3MA 2I5IA 1B3YA 4UR9A 3IJLA 4YVXA 4XBSA 3WF2A 4H00A 2OQLA 4KWVA 1RD5A 3T78A 1ZBWA 1GVYA 1TVLA 4GXWA 1R3RA 4H6EA 2VC9A 1XD0A 3KW3A 4AXNA 1UHVA 4OQVA 4JFUA 3EZ4A 3RN6A 4MHBA 3QKZA 2ZE0A 3PAJA 4LCSA 4WGHA 4LU0A 4F40A 3QPZA 4QNWA 1TIWA 1E1CB 3SUUA 1UJPA 2JKPA 2YBUA 4GPNA 4TMCA 2ZRZA 1K4HA 4IHCA 2VD8A 4MWAC 2PLMA 1UUOA 2RJGA 1D7KA 1Z3NA 2Z27A 3R10A 1HVQA 3WF3A 2X0SA 3BAXA 3AIQA 3PBWA 4M0XA 1JCJA 3SZ8A 3CV6A 3RILA 5CC7A 4K1WA 5U4NA 3LXBA 2OOGA 2VEFA 3DFQA 4HCLA 4IMFA 1RP8A 1F8MA 2VEPA 2A21A 2DH3A 3E0FA 5BU6A 3HG2A 2QF7A 2G5WA 4RNFA 4Q7IA 6XIAA 4NX0A 5BOOA 1CGVA 2F9RA 4LGXA 3WBAA 4D6CA 3M46A 2CWXA 3ZO9A 3NYZA 4XISA 3VM7A 3EAUA 5EFDA 1R38A 2WSKA 2J7DA 3CUJA 3W37A 1XH0A 2FZ8A 5JBEA 1B3ZA 4DO7A 1XRVA 1OCNA 1RJRA 4HNNA 3GM8A 3GNOA 1BVWA 2ZXAA 3PZIA 4UTMA 5AHFA 1KBLA 3IGXA 4PB4A 2OELA 1O1HA 5AHNA 1E56A 4FZIA 2ZVRA 3NM1A 1QXLA 1R86A 3S6DA 4MZ1A 4I9AA 4J3WA 1LTDA 3HMCA 1IEXA 3M0LA 3TJXA 4NYUA 3GWQA 3H4XA 3I7RA 1RJQA 1YLVA 1OFPA 5EY5A 1RBAA 3MZNA 4HIBA 4Z0JA 3TR2A 4AD1A 3W4RA 1Z48A