3W1GA

Crystal structure of human dna ligase iv-artemis complex (native)
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
599
structure length
583
Chain Sequence
TSQTVASHVPFADLCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHKDVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTGDFAMIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISITLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKGTKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNEAIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEYVSMDELDILIVGGYWGKGSGMMSHFLCAVAEKPPPSVFHTLSRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILCGTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLEQLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the catalytic region of DNA ligase IV in complex with an artemis fragment sheds light on double-strand break repair
pubmed doi rcsb
molecule keywords DNA ligase 4
molecule tags Ligase
source organism Homo sapiens
total genus 175
structure length 583
sequence length 599
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF04675 DNA_ligase_A_N DNA ligase N terminus
A PF04679 DNA_ligase_A_C ATP dependent DNA ligase C terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3260.10 Mainly Alpha Orthogonal Bundle DNA ligase i, domain 1 DNA ligase, ATP-dependent, N-terminal domain 3w1gA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3w1gA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3w1gA02
4HIMA 2KHJA 1YJNA 1VQLA 3J7A5 2JK8A 4HJ9A 1AH9A 5GAHC 4B3MQ 4A3LG 1EYGA 2B63H 1DGSA 1KD1C 1PH7A 2R92G 1X65A 1NE3A 3OTOL 4A93H 3JAMi 3S17H 1L1OC 2RF4A 1BVSA 2HHHL 5IY0A 1VQIA 2I5HA 5EAYA 1T9HA 5M5YH 4X62L 1HR0L 3S14H 3K81C 1GKHA 1XPRA 5JJLA 1U0LA 1J5EL 1OXXK 2ZM6L 3M4OH 4DV4Q 4UP8A 2IX1A 5C4XG 3BU2A 3HKZE 1QZGA 1CKNA 1V9PA 1Z9FA 4JI1Q 5M3FG 3HOVH 3S1NH 3F2BA 5IT9c 1YHQA 4JI2L 4DR1L 1B8AA 2JEBI 2ES2A 2B63G 2C35B 1KXLA 4DV5Q 1OXVA 1N32Q 3ZJYC 2B29A 3D31A 4LWCA 3U50C 4B3SL 4JOIA 4UP9A 4A93G 1K73C 5BR8Q 1K8GA 1KC8C 3UE0A 1NY4A 1HNZQ 4B3RL 3F1ZA 1PH3A 2K75A 3KDFB 3KLWA 3M3YH 1VQ9A 3BAAA 1A62A 3K7AH 1Q46A 1E7ZA 4PG3A 3UDXA 3J81i 4GOPB 4C2MH 1CSQA 3GTGH 4LUVA 1YNXA 4JI0Q 3W1GA 5LMUQ 4A3FH 4JYAL 3CP0A 4HIDA 3CC4A 1P16A 4NPSA 1WJJA 3NC0B 3PCOB 2WAQG 3NENA 3I2ZA 4JCVE 3TEHB 2QA4A 3HOVG 3PO3G 2A8VA 3DM3A 1TWHH 2B3GA 5LMNW 3BABA 4GN5A 1X6OA 5JEAG 1UE7A 1YBYA 1IZ6A 4AQYQ 3BZKA 1YJWA 1HNXL 3A74A 4IFDG 2Z0SA 4GLXA 4NXNQ 2R6GA 1TAEA 1X3EA 2IT1A 4BY7H 4DKAC 2QEXA 4HJAA 3GTJH 2MO0A 4AIMA 5AJ3L 3RZDH 1OTCA 3PV0A 4JI8Q 5M5WH 1JMCA 4POGA 1UE1A 4A3FG 4R4TA 3KJOA 2Q2HA 3AFPA 3G71A 2WB1E 1S72A 1PH9A 5GAEC 3BA9A 3TRZA 4IOCA 1IBLL 3T1HQ 3A5ZB 4LH6A 1Q81C 1GO3E 3W1BA 4O2DA 3TY5A 1TWFH 2DUDA 5IWAQ 3LGJA 1EQRA 1N8RC 4YHHQ 3TREA 1HZAA 3I4MG 4GKKQ 1EWIA 4P75A 4DUYL 2UUAQ 3S16H 4BY7G 2HIXA 3AFQA 4IJLA 2JA5H 1VQKA 5FPRA 1HNWL 2PNHA 1GVPA 2VQFL 3CC7A 3NEMA 4YY3L 4JI7Q 1PH8A 2A1AA 4UP7A 1I3QH 1VQFA 2ZJQA 3HKSA 3F2DA 4JI4Q 4Y52H 2VUGA 5FPOA 1PA6A 3NELA 3I4OA 4LF4L 4GNXA 4IPHA 3HOYH 4XTCS 1XMOQ 3JC66 1WOCA 1YITA 2VS1A 1Y1WH 4JG2A 1I94Q 3L0OA 2MQHA 3M4PA 4X64Q 4LF7Q 1OXSC 3H3VI 3NBYB 4UFZA 4KHPQ 2BA1A 3S1RH 3KJPA 2ZTCA 4A75A 2Y0SE 1PH4A 4YWLA 1XMQL 2E5LL 4A3BH 1N9WA 1PFSA 2BA0A 4OXPA 1XPOA 1PV4A 2KCTA 5M5XH 2F3IA 1C7YA 2JA5G 3GTLH 4DR6Q 4JV5Q 1H95A 4DV2L 4UCUA 1VQ8A 5D1OB 4L5QA 2I5LX 4OX9L 4DV1L 4DV6L 4LF9L 3HOUH 2N78A 1VCIA 2ZTDA 3CCJA 4X66L 4B3TL 4JI6Q 5C0XI 3GJXB 1UE5A 2WFWA 3PUVA 3ER0A 4DUZQ 2VNUD 5GQOA 3HOYG 5IYCH 2OCEA 3MEFA 1VQAA 3GTKH 1Y1WG 4BY1H 4A3JH 1VQ4A 2I0QA 1XK5A 3ULLA 1Q12A 2V1CC 1B04A 2CQOA 2YV5A 3STBC 2UUCQ 1QZHA 4A3BG 1SRUA 4A3IH 3PIOA 1KQSA 4DV7L 2PMZE 4DR7L 1YEZA 4BA1I 4PZ6A 2LXKA 3CCVA 2NVYH 4A3MH 5JJKA 4LF5L 5FJ8H 4GNXC 2ATWA 3U4VA 2E8GA 1TXYA 4J15A 2E2HH 2UU9Q 4A3EH 3HOUG 2KHIA 4HIOA 4DR3Q 1W2BA 1IBML 2UUBL 1E1TA 1N33L 4KI0A 4QL5A 4FDBA 5IYCG 1YZ6A 2F4VQ 3EIVA 3AYHB 5M3MH 1VQPA 1PVOA 2NN6I 4BY1G 3RLFA 4A3JG 2JA7H 3HOZG 3S15H 2R7FA 1Z47A 3GTOH 1OXUA 2GVAA 1E22A 4LF6Q 5FLMH 4P73A 2YTYA 1PH2A 4A3IG 4LFBL 2UXDQ 2RCNA 3GDEA 1SMXA 1HH2P 1RIPA 2VL6A 4YWKA 2VY3A 3J80c 2ZM6Q 4A3MG 1G291 4R4CA 2FXQA 2UXCQ 5FJ8G 1VQEA 4LNQA 4GLAC 4A3EG 4JI2Q 2I5MX 4UCTA 2PQAA 1XTDA 1BBUA 1N34L 4YWMA 3E0EA 3TY9A 4B3ML 3H0GH 4B3SQ 4BBRH 3A5UA 1EIYB 5M3MG 4A3DH 5JJIA 1X56A 2KCMA 2GN5A 4MTNA 2ZJRA 2JA7G 4A3CH 3ULJA 4WJ4A 3L2PA 4POFA 1IBKQ 4C3IH 1D8LA 5FLMG 2HIVA 3CD6A 5K36G 3CMEA 5C3EG 4OO1G 4CC5A 1UWVA 2QGQA 4DPGA 5GAGC 1JB7A 1QVCA 5J3BA 3UE1A 1XNQL 2CCZA 2JA8H 4DV4L 3RZOH 3AQQA 4R4QA 3UDFA 1QUQA 1VQ5A 4JBMA 4A3GH 1FJGQ 1XDNA 2NVQH 4JI1L 4UCOA 1HNXQ 4MNOA 3MXNB 4EX5A 1VQMA 1VQCA 3PIPA 3H0GG 4BBRG 1EIFA 3PGZA 4DK3C 1SLJA 1VQOA 4DV5L 3I4MH 4A3DG 4A3CG 4TVAB 3Q8DA 1N32L 3CCQA 5BR8L 3D0FA 4IPGA 4C3JH 2OTLA 4X6AH 4IPDA 3RR5A 2MO1A 3CCUA 3PUWA 4UY8C 1EOVA 3UDIA 2ZJPA 2YTXA 3BJUA 4JI0L 4LF8Q 4LFCL 5LMUL 3RNUA 1MKHA 2VQEQ 1WCMH 5IP7H 2JA8G 2CWPA 1RL2A 1GD7A 3K8AA 4L5TA 3M7NA 2AWOA 1PHJA 4A3GG 2D0OA 1L2FA 3K7UC 1S40A 1L1OB 3QWUA 4A4IA 3PSIA 3VNNA 1E24A 3KF6A 2R7ZH 1WYDA 4RG1A 1KL9A 4AYBG 4AQYL 1N36Q 2JA6H 1M1KC 4WJ3M 2K5NA 2VZAA 4NXNL 4NXMQ 1HNWQ 4BA2I 2VQFQ 2E2JH 1V43A 4ME3A 5LMNL 1FGUA 3HKZG 4UCRA 1PYBA 4UCSA 3J81j 1AE2A 4JI8L 5C0XJ 2ASBA 1A63A 4DRFA 2HQLA 1NMFA 3J80i 2ID0A 4JI3Q 2LXJA 4LF4Q 4DR2L 3CW2C 1WCMG 1OXTA 3KDFA 5IP7G 1KHIA 1YI2A 1IXRA 2YYZA 1QVFA 5IYBH 3PUZA 3GTPH 4BBSH 1WFQA 4K0KL 1X3GA 1HJPA 4A3KH 3JAMc 4DR5L 3ERSX 2CFMA 3T1HL 2H5XA 4EQ5A 2OTJA 4R4OA 4KHZA 3KFUA 2R7ZG 4IOAA 3NBZB 5IWAL 1XMQQ 1G51A 2JA6G 4OONA 3STBD 4YHHL 3I56A 3RN2A 1XJVA 4GKKL 3JSNA 1MJCA 4APVA 2UUAL 4DV0Q 3HOZH 4DV2Q 5C4JH 1O7IA 2XTIA 1X9NA 3CCRA 4GKJQ 4DV1Q 4YCVA 2EQSA 4LF9Q 4DR4L 2D0PA 3T1YQ 1VQ6A 4B3TQ 4DV3Q 2GVBA 1IL2A 2UXBQ 4JI4L 1YIJA 1V1QA 3OYYA 4GLVB 5IYBG 4QGUA 1Y1VH 3ULPA 1XNRL 4A3KG 4JI5L 1NBWA 2JEAI 1HZ9A 1PYSB 2ZTEA 3RLNA 1I94L 2ALYB 1TA8A 1JJ2A 1VQGA 1JJGA 1VQBA 2MNAA 4KHPL 5DLQE 2VW9A 4QIWE 2E2IH 3I55A 1CKNB 3BZCA 1YJ9A 3H3VH 4DR7Q 4EEQA 4X65Q 4AH6A 2A19A 2PQAB 3IRBA 1B7YB 3F2CA 1MIUA 5JEAJ 4JBKA 1SROA 4LF5Q 1I6HH 4LH7A 1HZCA 3HOXH 3I4NH 3WWVA 3AEVA 4DR6L 3E9HA 2F52A 4GOPC 2UUBQ 4HTPA 3W5OA 1CKMA 1ASYA 4R4IA 4GS3A 5IYDH 2JE6I 3G4SA 3GD7A 1TWGH 2N3SA 1G6PA 2RHSB 2NZHA 1M90C 1PH5A 1Y1VG 1TWAH 4UPAA 3OTOQ 1K9MC 2WAQE 1D7QA 4HJ7A 1WI5A 5DISC 4NB3A 2HHHQ 4P74A 1PH6A 3TQYA 4DAMA 1CSPA 3B6YA 4UCVA 1TWCH 1VS0A 1KAWA 2MFIA 3SGIA 4X62Q 1HR0Q 4LFBQ 1FL0A 1QUQB 2LSSA 1VQDA 4LFAL 3S2HH 3U58A 5C3EH 4OWTB 1J5EQ 4LUZA 1Q8KA 1Q1BA 3K0XA 3HOXG 3I4NG 3M9BA 5GROA 3KOJA 2UU9L 3CCLA 2K50A 3CPFA 3F8TA 2VUMH 5IYDG 1N34Q 4DR3L 4IFDI 3UQ8A 3JSLA 1KIXA 4ALPA 1YHBA 2Y0SG 1K0RA 4DR1Q 3VDYA 3CAMA 5D1OA 1B70B 2F4VL 2AMCB 2K14A 5C0XG 3S24A 2EXDA 4B3RQ 4EFEA 1E3PA 1C9OA 5H1SE 4HJ5A 1Q7YC 4O0AA 4PZ7A 3S1QH 2KENA 1XPUA 2OWOA 3BA8A 2OQ0A 4LF6L 4JYAQ 3PF4A 3KYHC 1HZBA 4AYBE 2UXDL 4QQBX 1XNQQ 1W3SA 3KF6B 2Z6KC 3I7FA 4XIGS 2NZOA 1J6QA 4H02A 2UXCL 3KF8B 1SN8A 2KBNA 5HY6A 1ASZA 2VUMG 2CKZB 3HOWH 5IP9H 4A76A 1K83H 4DNIA 4IJHA 1P8LA 4GN4B 1VQHA 5HGQA 3PUYA 5AJ3Q 3TS0A 1X54A 2IX0A 2AHOB 1HNZL 4GNXB 1S68A 2NVXH 1IBKL 3EBEA 3PO2H 2NN6G 3PO3H 2CWAA 4PZ8A 1X55A 4LFCQ 2IY5B 1Q86C 1IYJB 2N8NA 1MJEA 4BXXH 3HFZB 1X3FA 2K4KA 3G48A 3PUXA 4P71A 4PMWA 4GN3B 1FVIA 2YTVA 3H15A 1E1OA 1UEBA 1VQ7A 1IBLQ 3GTQH 1UE6A 1VQJA 2HVSA 3UDGA 1FJGL 5ELNA 1Y14B 1VQNA 2R7DA 3CPWA 2RHQB 5IP9G 2WP8J 3HOWG 4IO9A 4HIKA 4DUYQ 2K5VA 3DLLA 1NTGA 4QY7A 5LMNQ 3OW2A 3GTMH 2BH2A 4YY3Q 3CMAA 5C44H 2JQOA 4DK6C 2N49A 3PO2G 3L7ZC 3CC2A 2D62A 1EFWA 1LUZA 4BXXG 4DR2Q 3TS2A 4LF8L 3GO5A 2K5HA 1KRTA 2Q2TA 2IHFA 4K0KQ 2VQEL 1JJCB 4DR5Q 4GOPA 4IPCA 1BBWA 1KRSA 4JOIC 1R9TH 3ICEA 3S2DH 3CQZH 5ELOA 1EUJA 3G6EA 2HVRA 3E9IA 2Q2IA 5E7NA 3M4QA 3PF5A 2E5LQ 1A8VA 1N36L 1YHAA 3FKIH 4EFBA 2YU9H 3PN1A 3EN2A 5FLXc 1NMGA 4NXML 3RN5A 3NBHB 5C44G 4JBJA 2Q2UA 4DR4Q 4OX9Q 3K80C 4DV6Q 3A0JA 4QJFA 1GM5A 4CC6A 4L5SA 4BBSG 5IE8A 4HTOA 4JI7L 3RLOA 3CXCA 4OWXB 1I50H 4X66Q 2K52A 4JBWA 4R1JA 4JI3L 1AE3A 1SE8A 1XNRQ 3M85A 4TQUS 4JI5Q 2DGYA 2R93H 2HVQA 5D1PA 1EQQA 1C0AA 1LYLA 1XMOL 2L15A 3U4ZA 1LTLA 4LF7L 2JJQA 4LW1A 4X64L 1YVCA 2HT1A 3J81c 3CF5A 1K3RA 4DV7Q 3FKIG 1QVGA 2WB1G 1Q82C 3RTXA 5GADC 3J7ZC 4LUOA 4MZ9A 1L1OA 2OQKA 4Y7NH 4DV0L 1PH1A 3GB8B 4JV5L 1NJIC 4HJ8A 1SFOH 4P72A 4GKJL 4IFDJ 4C3HH 1IBMQ 3T1YL 3FHWA 1N33Q 4YCUA 4DV3L 1K8AC 2PI2E 2Z6KA 4JI6L 4A3LH 2UXBL 3CCMA 2PI2A 3CCSA 1SR3A 2IHEA 2BH8A 4DUZL 4OWWB 1HR0W 2R93G 2R92H 1I5FA 1CKOA 3TY8A 1A0IA 2AKWB 2JA9A 4OO1I 4E6NA 4LFAQ 1LM0A 1BKBA 2UUCL 1S3OA 1U5KA 4JC0A 3S1MH 4YCWA 4DAYB 1JT8A 2XGTA 4X65L 1CUKA 1Q1EA 2AWNA 4L5RC 2NVTH 4KLKA 4RMFA 2EIFA 5C4XH 3CCEA 1L0WA 1JE5A 3FP9A 5M3FH
chains in the Genus database with same CATH superfamily
5C4HA 1YJNA 4K8JA 2D5DA 1EU3A 2B63H 1KD1C 3TMEA 1M0TA 1PH7A 5CORA 3ETHA 3OTOL 1NE3A 3Q2OA 2Z04A 1UNSA 3MXUA 5IY0A 2I5HA 2JA5B 3N6RA 2E2JB 1T9HA 2GPSA 3K81C 1D5XC 1U0LA 1OXXK 1LTAD 2ZDHA 1K8MA 4DV4Q 5C4XG 3IAYA 3HKZE 4CJ0B 3PO3H 4JI1Q 4BBSB 3T7AA 4B08A 4M9UA 3DAAA 4IWXA 4JI2L 2ES2A 2JEBI 2C35B 4WBNF 5JQGF 1KABA 3ZJYC 3WOFA 4IFDH 2B29A 4OHJA 5IGEA 5BR8Q 1MD2D 4IHJF 2A68D 1PH3A 3BAAA 2EZVA 1Q46A 3UDXA 3K58A 4GOPB 1RTOA 1LV9A 5F2DA 3GTGH 3BACA 1DV1A 1GUNA 4YAKB 3OW7A 4A3FH 3CP0A 3AX6A 1E0BA 3HOUB 2ENBA 4IZ8A 2H4OA 4NPSA 3HB9A 2F3VA 3U54A 3VR4A 4JCVE 3TEHB 4FFPA 3WWIA 4R9WA 3DM3A 4KKSA 2B3GA 1X6OA 5JVG3 4AQYQ 3JZ6A 3Q22A 2IJ0A 1IYVA 2Z0SA 4GLXA 3AW8A 1BQQT 4DKAC 5KGUA 2V59A 4QMGA 4JXUA 1FNWA 3TN2A 1F9PA 1OTCA 3PV0A 4JI8Q 5M5WH 1UE1A 3BYTB 1YNND 3KJOA 2NTTA 4DN4M 3AFPA 4IOCA 1RTNA 1TWGB 3T9DA 1IBLL 3BVGA 1TIID 3HGBA 3W1BA 3TY5A 1FD7D 1UC9A 3LGJA 1GUSA 4YHHQ 3KF8A 3UZBA 1EWIA 4P75A 4DUYL 2UUAQ 2HCIA 2XVSA 2JA5H 1VQKA 1GVPA 1MGSA 2VQFL 3CC7A 3NEMA 4HMJA 4YY3L 2R82A 4KY5A 1PH8A 1TY0A 1T5XD 2L1BA 1HTLD 3ND8A 5DAUA 1VQFA 2ZJQA 4HSPA 3UYYA 1EEFD 1LTRD 1RCVD 4Y52H 2CNUA 4LF4L 3NELA 4ZQIA 3MWDA 1DJRD 1LT4D 5D3DA 1Y1WH 3M4YA 3L0OA 4LF7Q 2Z4IA 2PZTA 4QUFA 4KHPQ 3KJPA 5KYLA 1Q3LA 2Y0SE 5I2YA 3S1QB 1PFSA 3JZFA 1XPOA 3HS0C 5HBRB 1PV4A 2F3IA 1AFPA 4DV2L 2RQXA 3BDOA 4O4JF 5D1OB 2I5LX 1WD1A 2BDOA 4OX9L 3HOUH 2HQEA 3K5MA 1U4MA 1S5DD 4C56C 4DUZQ 3ER0A 3PQIA 3JRXA 3HOYG 2PYKA 3HOWB 1C30A 3NK9A 1B04A 2V1CC 4PMBA 4C3JB 2A69D 1SRUA 5D3IB 3HKZB 2F0KA 3VYRA 3NE5B 1D5MC 1D6EC 1A6XA 5BWRA 3FPUB 2ATWA 3S9WA 4J15A 4TKOB 4X3KA 4DXGA 2WIIB 4IUVA 4N9PA 4HIOA 1W2BA 1IBML 3I4LA 5IYCG 2R7ZB 5KS8A 2NN6I 4Z9CB 2VB3X 5I4DA 3JRWA 4QF4A 2PNRC 3OUUA 1DAAA 3DTGA 4LF6Q 4J6HA 4P73A 3TBIB 2UXDQ 4OO1H 1HH2P 3J80c 3CRKC 3KLRA 4HCSA 4R4CA 2UXCQ 2JN4A 3CRLC 4OIJA 3GTPB 4JI2Q 1XTDA 4IUNA 4A3KB 5K3WA 3TY9A 5I5TA 3H0GH 5BWVA 1EIYB 3A5UA 5M3MG 5JJIA 1KJ9A 3TEKA 3W3AA 1I2LA 2RDFA 2Z8LA 3L2PA 4QUCA 1TKWB 4C3IH 3ERQA 2R7LA 5KNDA 3LNNA 5C3EG 1KJIA 2QGQA 2F3WA 4Q4CA 1EL0A 4K2LA 2QCPX 2L4NA 3UDFA 1JOOA 1VQ5A 4UCOA 3R8BA 4DGZA 3MXNB 1VQCA 4G7ZC 4V190 2SOBA 3D0FA 4IPGA 1ENCA 4C3JH 1XTCD 4IPDA 1JQYD 2GA4B 4RGOS 1D2BA 5A35A 4UY8C 2W71A 1AP0A 1SDFA 2YTXA 4JI0L 1B2TA 4LFCL 2WACA 2KQ3A 5KNCA 3V4ZA 4IZOA 2JA8G 2F0UA 4L5TA 1HUMA 2Y0SB 1ZEQX 2AWOA 1PHJA 4A3GG 2D0OA 1S40A 1SBBB 4P2CB 3KF6A 2R7ZH 3EJIA 1W6KA 1KJJA 1N36Q 2JA6H 2YZMA 5EZYF 4NXMQ 4K14A 2VQFQ 4HN2A 4XZ3B 5BMVF 1PYBA 2XN9C 1I4PA 1CQFA 1BCPC 1E2ZA 1QB5D 4HEDA 2EYHA 4S3SA 4WHXA 4LF4Q 2LXJA 2VUMB 3KDFA 1QVFA 3GTPH 3PUZA 4A3KH 1HJPA 2ZXOA 4DR5L 4LAAA 2H5XA 1EWCA 5CV7A 4R4OA 3WOEA 5IGCA 4IOAA 3T9FA 4OONA 3STBD 2XSCA 3VYUA 2CW0C 3KALA 4APVA 3URYA 4DV0Q 4DV2Q 3K5LA 3S14B 2ABJA 4RZQA 4DR4L 4EQNA 3UZOA 1ZAUA 2D0PA 3T1YQ 1VQ6A 1D5ZC 2GVBA 2EY5A 1IL2A 3CSWA 4JI4L 1PRTF 2CHBD 5JPNC 2F0FA 2K5WA 1AN8A 4JI5L 1NBWA 3LQSA 1HZ9A 3OIQA 1M0WA 3RLNA 1K8OA 3A54A 3KBGA 1V1PA 3I55A 3BZCA 3H3VH 3HOZG 2A19A 4C2MB 4LH7A 1JOKA 5JEAJ 3EROA 4XYQA 1RDPD 1GUWA 3AEVA 3E9HA 3JAME 2P5ZX 3SDZA 2R3ZA 2B39A 4GS3A 1KDBA 1G6PA 1AZPA 1KLUD 2NZHA 2NU9B 1PTOB 5DNFA 2HHHQ 1PH6A 1TWCH 1VS0A 4F87A 4PNYA 1SNMA 1BCPB 1HR0Q 2OXPA 4GLWA 3RZDB 4X3TA 4LFAL 5C3EH 4OWTB 4LUZA 1Q8KA 2K01A 3K0XA 4XXEA 3H94A 3M9BA 3I4NG 3SK4A 5BYBA 2KOLA 2VUMH 2PZWA 2Z02A 5IYDG 4O81A 4DR3L 3GIDA 4ALPA 5LP6F 4DR1Q 1SYDA 1I1KA 4N8X1 4RWSC 2C5CA 1B70B 2F4VL 1AUXA 1VMPA 4B3RQ 1EU4A 1E3PA 3R9RA 3MXPA 3AB9A 1Q7YC 5JVH3 5T1GA 4PZ7A 1SE4A 4JYAQ 4NW2A 2F0IA 1W3SA 1I3QB 4F8MA 4DQNA 1DM0B 1PRTD 4XIGS 4RAUC 1BXTA 3HEJA 3KF8B 4O2BF 3SR1A 5BPFA 3VR6A 1WR2A 1UEAB 1FYCA 5IP9H 1B4OA 4A76A 1EFID 4DNIA 4KY6A 4TV9F 4RA8A 5JQWA 3NSWA 5AJ3Q 1HNZL 2IX0A 1S68A 4KN4C 5M5XB 1IBKL 4Y7NB 4XX0B 2OEOA 4LFCQ 1Q86C 4BXXH 1ENAA 3HFZB 4FXKC 2Z9HA 4P71A 3MEHA 1VBGA 1VQJA 3D4WA 2E76C 4O7YA 4CJ2C 1JICA 1FJGL 5ELNA 3OHXC 1EKFA 4BY1B 2K5VA 3OIPA 1IYEA 1KEEA 3CMAA 3SE0A 1MSHA 2B2WC 3PO2G 1EZ6A 1EFWA 3KLSX 2E2HB 4A3EB 2K5HA 1B9MA 1AEXA 4DAPA 2K28A 1GOZA 4J8QA 1FNUA 1JWMD 2E74C 1WTVA 4DR5Q 4GOPA 1DIKA 3LULA 1KRSA 1ESFA 2RVLA 1WTXA 3ICEA 4NZNA 1SAPA 1ESRA 2EYOA 1Y8PB 2RKSA 3S15B 2DLNA 2Q2IA 1TQOA 4K5XA 5FK9C 3J7YW 1A8VA 2YU9H 2B2VA 3ONAB 5FLXc 2K6AA 4DR4Q 3KAKA 4FO2A 3K80C 4IURA 5ELEA 4DV6Q 4QJFA 1GM5A 1ZYRD 2BCOA 4JI7L 3OWEB 1KLGD 2Z6BA 5C5MA 3OPOA 5FNVF 5DM63 4JI5Q 2HVQA 5D1PA 5JJZA 1EQQA 1C0AA 1XMOL 3U4ZA 3QOLA 3T13A 2JJQA 4X64L 1YVCA 3TP7A 4RGTA 4RGNA 5J39A 3J81c 1I1MA 1I1LA 4KK7A 5IYZF 1B3AA 3P75A 5BWTA 3TQTA 1QVGA 3K7AB 1Q82C 4FF2A 4MZ9A 1PH1A 2MHVA 4Y7NH 4IFDJ 4P72A 1I4GA 3R5XA 2M2LA 4C3HH 1O7ZA 4ZQ3A 3RZOB 1NCVA 3IFDA 3TW7A 1LT3D 2MJ8A 2Z6KA 4A3LH 2PI2A 1PZJD 5FR9A 2O5IC 4FXDA 5EKLA 2JA9A 4PBCA 2NUAB 1BBXC 4LFAQ 2VQDA 3TP5A 2W6OA 2XGTA 4X65L 2EDGA 2M00A 2EJMA 4KLKA 3CCEA 1FGUA 1DD2A 4ZI7F 1VQLA 1HUNA 4G4KA 4IUQA 4HJ9A 2EYMA 2MP1A 2YYAA 2R92G 5BWXA 2PZUA 1L1OC 1O78A 3S16B 1S5ED 1LO5D 1DYQA 4X62L 1JB3A 2F0LA 4RFBA 1GKHA 5JJLA 1J5EL 1SMYD 4K6NA 3L9AX 1QZGA 5CBAE 3S1NH 2YL2A 5IT9c 1B50A 1YHQA 5D8DA 2B2TA 4DAAA 2B63G 1B8AA 5JEAH 5JVLA 1N32Q 1W6JA 3U50C 1A9XA 2YZNA 2FJ2A 4KKTA 1KC8C 1HNZQ 1NY4A 1ET0A 4CMFA 3ETJA 2K75A 3KDFB 3KLWA 3K7AH 2KA7A 4O7SA 4XYMB 2O2LD 5I9OA 2RSNA 1HHVA 3CC4A 1P16A 2HJWA 1SYEA 1ET6A 2EYFA 2WAQG 3NENA 3PCOB 1HTPA 1T5EA 3PO3G 5IGDA 1HFNA 1E4EB 5COYA 1Y1VB 1M6VA 2XWJB 3GTKB 1G6ZA 5BYAA 4GN5A 4IWYA 4UHVA 3BZKA 4IFDG 1H9SA 2ZXPA 4NXNQ 3T99A 1X3EA 1EY9A 2QEXA 2E2IB 1C4QA 2NU6B 2J9GA 1EWHA 1JMCA 4A3FG 1LACA 1B6SA 2Q2HA 3IL8A 3NBIA 1S72A 5GAEC 1Z6HA 3TRZA 4FE2A 1OBDA 2X6LA 3T1HQ 3A5ZB 3MVVA 4LH6A 3K57A 1TS3A 1Q81C 4O2DA 2DUDA 2ZXRA 5IWAQ 2JA7B 2BDNA 1EQRA 4GKKQ 3TREA 3I4MG 3S16H 3VYTA 4FGRA 1CA5A 3AFQA 1G2TA 1B1ZA 3P7JA 1VBHA 5HGTA 2FMMA 3MXNA 4JI7Q 2A1AA 2SDFA 4K6DA 3U0GA 1KJ8A 3HKSA 3F2DA 4DXFA 1E2WA 2HUGA 3OUZA 3DEPA 1PA6A 3I4OA 3GV6A 2F0OA 1XMOQ 3VR2A 4JG2A 1I94Q 4X64Q 1OXSC 2BA1A 1X3PA 4MV3A 1PH4A 1DOMA 3HBLA 1STHA 2BA0A 3V4SA 2KCTA 2WKCA 1C7YA 2JA5G 3GTLH 4DR6Q 3P1HA 1OBGA 1VQ8A 4L5QA 1WVLA 1R4QB 4DV1L 4LF9L 5CM0A 5C0XI 1UE5A 4L6TB 2Q8IB 3MEFA 2NYZD 3GTKH 1Y1WG 1I7LA 1LTSD 3ULLA 2YV5A 3T51B 2VPQA 4A3IH 2NVXB 4FFMA 2DIKA 4A3MH 2LXKA 2GQSA 1PTOF 5FJ8H 3SNOA 2UU9Q 3HOUG 2KHIA 4HMIA 1E1TA 1FNVA 4FDBA 1YZ6A 5FO7B 1YNJD 3AYHB 3KLSA 3RLFA 3TDQA 1Q90A 2JA7H 1K28A 2R7FA 1Z47A 1MSGA 3GTOH 2GVAA 3NQIA 4FVMA 5C3XA 1QNKA 5K36H 1PH2A 4LFBL 1SMXA 5FO8B 2VL6A 2ODTX 5ELBA 1GJXA 1G291 2FXQA 1VQEA 4LNQA 1KNAA 2ICIA 4JVZA 4V0BA 2DWCA 2QF7A 3EQLC 1BBUA 4I50F 4B3ML 4BBRH 4A3DH 3DF7A 1EY5A 4A3CH 2GPWA 1SCUB 4POFA 1BO0A 5C4ZA 5C4JB 1CA6A 3CMEA 5LYJF 5E25A 1ICWA 1TS2A 1PFMA 4OO1G 4DPGA 5J3BA 1A3TA 3AU7A 2CCZA 3J7AV 4R4QA 4JBMA 3N8DA 1KBLA 2BE5C 2KUMA 1GSHA 4MNOA 1EIGA 1CHQD 4MA0A 4EX5A 4MHEA 3PIPA 1VQMA 3H0GG 1WD0A 1BUVT 3I4MH 3J80E 4DV5L 4O86A 4TVAB 3T9EA 1Y69U 4TSSA 1PTOD 4C3IG 5I60A 1SE3A 3T4AC 3PUWA 4F7XA 1ILPA 1BCPD 2ZJPA 5LMUL 3H6MA 1WCMH 4LMQD 4FYDA 3K8AA 1RL2A 4K6LA 3SHLA 3QWUA 3KK7A 3PSIA 3E3XA 4A4IA 4O7LA 5JVDF 3A8JE 5DM73 1M1KC 2K5NA 1DV2A 4MV7A 4BA2I 4C3JG 2E2JH 3S2HB 3HKZG 2F0MA 4YBZB 2DABA 1O80A 4DRFA 5C4XB 3J80i 4JI3Q 3TZUA 1J8IA 2R85A 4DR2L 1OXTA 2MGSA 4BBSH 4MA5A 1KUTA 3ERSX 1JDBB 2PBZA 5CB4F 2R7ZG 3NBZB 4M1UB 2JA6G 1Z2OX 5C4JH 2A5HA 4DV1Q 4LF9Q 3SEBA 4X3UA 1SXTA 3M4OB 3MA2B 3TZDA 5T1IA 3V2TA 2PO4A 4HAEA 1I2KA 4H13C 1A48A 1LTGD 5C8YF 1L0YB 1SNDA 1V1QA 4GLVB 5FOBB 4QGUA 3ULPA 4A3KG 4DK1A 1JJGA 1VQGA 1QG7A 4FFOA 4G7OC 2PN1A 1I4XA 2VW9A 4QIWE 1YJ9A 2PQAB 1HQRD 2F0SA 4J1MA 2K32A 1CTMA 1MI2A 1PFBA 5EGTA 4HTPA 1B44D 3W5OA 3K0YA 1U9RA 2IL8A 2FMCA 3GD7A 1TWGH 2N3SA 2A1HA 5ISRA 3OTOQ 4UPAA 2D2CC 1F2MA 3VA7A 1D7QA 4HJ7A 3R5FA 5DISC 2EPBA 2QB5A 4LK1C 3B6YA 4LFBQ 1KAWA 2MFIA 4ZK9B 1WRVA 3JAML 1FL0A 1QUQB 2Z4HA 5C44B 3QO2A 2WINB 3S2HH 3U58A 1DONA 1CI3M 5CYUA 3QIAA 4ZUIA 1Q1BA 1SYFA 3HT5A 4O7NA 4OIKA 1H9SB 3GLKA 3CCLA 2K50A 5LL6S 3JSLA 3NWSA 1R9TB 1YHBA 2Y0SG 1K0RA 3VDYA 3CAMA 1LTBD 3CQZB 4K8IA 4OELB 3PFFA 2Z1CA 3TIIA 1TS4A 1EKPA 5H1SE 4MIUA 4O0AA 3S1QH 2KENA 1XPUA 3BA8A 2NN6H 3QFFA 3PF4A 5CV9A 4CKEA 4I7AA 3U9SA 5I47A 2A6EC 1SE2A 5HY6A 2VUMG 3HOYB 4PQXA 2B2UC 4FNFA 1DCZA 3HOWH 3BVZA 3ND9A 2R86A 3A8KE 5BWUA 3S1RB 1SNQA 4IJHA 1JDEA 4GN4B 1VQHA 3WO0A 1JKJB 1GSAA 2K04A 4UDUC 1GUOA 4JK1C 1H9RA 3EBEA 2QW7A 5J22A 4PZ8A 1SFOB 2M9VA 2IY5B 4F88A 3PUXA 1JOQA 4PMWA 1JLLB 4GN3B 1FVIA 2YTVA 1E1OA 1VQ7A 1IBLQ 3Q6SA 3V05A 1VQNA 2R7DA 1PZKD 2Q8TA 4DU9A 2WP8J 5IP9G 4DUYQ 1BR9A 3DLLA 1NTGA 2A68C 3HP3A 2FB9A 4YY3Q 5C44H 2N49A 2DN8A 3DXJC 3CC2A 1Y8OB 2NVTB 2X69A 4BXXG 4DR2Q 4LF8L 5IODA 3MJFA 5M3FB 5I2XA 2VQEL 4X3SA 1RJTA 1SNOA 2K1BA 1R9TH 4QIWB 1EHIA 4RGMA 4FP5D 3CQZH 5M3MB 1U4RA 2KVMA 4A93B 3K5NA 2HVRA 2J4XA 3PF5A 3M4QA 1U4LA 4EFBA 3KUPA 1E4EA 4CGYB 2B8FA 2Q2UA 4OX9Q 3A0JA 5LA6F 1YNNC 1EY4A 2HHFA 3RLOA 3CXCA 4OWXB 4O7WA 2HDLA 1SNCA 3HOVB 3T16A 1SE8A 3GQBA 3A7AB 5E3FA 4MN3A 1LTLA 4LW1A 4HQ6A 2SNMA 2DZDA 4RCNA 1HXYD 3M3YB 1DZ1A 2WB1G 2NB0A 1L1OA 2OQKA 3KREA 1A15A 1EUDB 3T54A 3NWTA 4HJ8A 1SFOH 4GKJL 1NSNS 1IBMQ 2JA8B 1A3GA 3FHWA 2KEEA 4RCOA 4DV3L 1IKMA 4KV6A 2UXBL 4EQOA 4JI6L 5BN4A 1TWHB 3HRZC 4IIJF 1SR3A 2BH8A 5FLXE 1I5FA 2PW7A 4BY7B 2F0GA 3M7GA 4CHTB 1BKBA 1EYAA 1S3OA 4HNTA 1U5KA 4YCWA 2CNQA 4XYOA 1CUKA 2V58A 1DXMA 3OOCA 2NVTH 2EIFA 4CDDC 1L0WA 4C3HG 5M3FH 1GHKA 3J7A5 2RSOA 1I4QA 3J81E 2CVRA 5GAHC 4A3LG 1WTRA 1J9OA 1TWFB 1A3VA 4TVIA 1X65A 4A93H 4CJ1B 3JAMi 1BVSA 3RFCA 3BDCA 2EY2A 4TM5A 2A69C 2PCFB 2F0NA 5EAYA 1JC7A 1BNZA 1T36A 3S14H 2HGWA 2K03A 3EFXD 1EYZA 2ZM6L 3BU2A 3HOVH 1V9PA 1Z9FA 2C00A 3NP8A 3QWNA 1PLFA 1KXLA 3ORRA 1OXVA 1STGA 4LWCA 2DNCA 4B3SL 4JOIA 4RHSA 4UP9A 4A3BB 1K8GA 3BYYB 3F1ZA 3I70A 3HOZB 3M3YH 2SCUB 3J81i 1UC8A 4C2MH 3X3MA 4IQZA 1C8CA 4JI0Q 3K5HA 3KAJA 4O4IF 2XD4A 4HIDA 4B9XA 3DMUA 4CKCA 1A0GA 3IFTA 4WJWA 4XDXA 1TWHH 2A6HD 5LMNW 2CNVA 3BABA 1ONLA 4A3JB 3RD4A 5JEAG 1YBYA 1IZ6A 3R2TA 4Q0FA 4FFNA 4ODGA 1PTOH 2R6GA 4WORA 3Q24A 2IT1A 4BY7H 5IGBA 1AW7A 3OMGA 2YZGA 3VOTA 3RZDH 1I6HB 1IW7C 5C3WA 5IT9E 2L55A 1PZID 4POGA 3I4NB 2E75C 3LWEA 1UUPA 1F2ZA 1PH9A 4HSVA 3K5OA 3BA9A 1F9SA 2QDBA 4E4TA 4YJ3F 2NWGA 4C1NK 1TWAB 1TWFH 1I4HA 4KY7A 5DAAA 1B6RA 3C2PA 4YIJA 1N8RC 1WTHA 4MV8A 5CE8A 5FO9B 4I55F 2HIXA 1II3A 5EQ0A 4IJLA 2I8CA 2RCFA 1AZQA 1R4PB 1CZWA 1MBYA 5I6WA 3K5IA 4UP7A 1I3QH 2AQ2B 2FPPB 4JI4Q 5I5UA 2VUGA 1GUGA 3UI2A 2L12A 4XTCS 3C3LA 1YITA 2MQHA 3NBYB 3G8DA 4UFZA 3BZDB 2NZ1D 2ZTCA 5KX5F 4A75A 4A3BH 4YWLA 1XMQL 2E5LL 5ELFA 5M5XH 4N9TA 5CBEE 2N78A 5NUCA 2W70A 1VCIA 3CCJA 4MAMA 5E1FA 4X66L 4JI6Q 4R8NA 2F1MA 2WFWA 2EOTA 2NVQB 2OCEA 4MV6A 4BY1H 4A3JH 2I0QA 2EYJA 4XT1B 2CQOA 5EPJA 3STBC 1STNA 4KJNA 4DLKA 3H91A 5LXTF 3D4DA 5EPKA 4C1NI 2DJGC 1KQSA 1B9NA 1CHPD 1A2TA 4DV7L 2PMZE 3PO2B 4DR7L 1PMRA 4PZ6A 4U673 5JJKA 1KTAA 4GNXC 2E8GA 2E2HH 3DM1A 4A3EH 5C1PA 2VR1A 2XIWA 5CR5A 4DR3Q 2BOSA 1N33L 4KI0A 2EVBA 2HDMA 2F4VQ 2R84A 5DGIA 1VQPA 2EY6A 3S15H 3DWPA 3RV4A 5EJWA 4MTKA 2AUKA 3GTMB 1E22A 1EY6A 3MTSA 4PV1C 5E4WC 5FLMH 2YTYA 4A3IG 4IALA 2LKVA 4DNRB 4ZAIA 2ZM6Q 4A3MG 3BS1A 3TW6A 5FJ8G 3TSSA 5BN3A 1EEID 5M9OA 1ET9A 3E6ZX 4PMCA 2PQAA 1N34L 4L8JA 4NKLA 5BPHA 2CQAA 4B3SQ 1CT1D 2KCMA 2GN5A 4MTNA 3E5SA 2JA7G 1IOWA 5EKKA 4WJ4A 1NR2A 2XWBB 1IBKQ 2HIVA 3CD6A 5K36G 2PPBC 2RBMA 3LWUA 5GAGC 1QVCA 4OL7A 3UE1A 3U9TA 5TSSA 1CFMA 1PK8A 4EG0A 3DWAA 1VDZA 2C9OA 4DV4L 3RZOH 4O2AF 1QUQA 1EQTA 1FJGQ 1EYDA 2NVQH 4JI1L 2EIYA 4TUYF 4O4LF 3A7LA 4BBRG 3PGZA 4A3DG 2HHFB 1SLJA 2B2YC 4A3CG 3Q8DA 5BR8L 1I6VC 5JAVA 2EXZA 1O7YA 2TMPA 4DF7A 2IP4A 3HOXB 5CA1F 4L63B 4DFAA 1PRTC 4EQPA 3RNUA 5IP7H 3U9OA 1GD7A 4CBVA 2COGA 4KMUC 3J80L 2P0AA 1L2FA 2JYOA 1L1OB 1S5CD 2F0HA 4DNTB 2R92B 3VNNA 1E2VA 1WYDA 2F0DA 5E4XA 4AYBG 4AQYL 4WJ3M 3X3NA 4WFN3 2VZAA 2WKDA 3OMCA 5LOVF 1BDOA 2DJFC 1V43A 4ME3A 1ILQA 1S4ZA 3KBXA 5LHY1 4ZOLF 3MWYW 1BXRA 1IOVA 4JI8L 1A63A 1RHPA 2V4DA 3LP8A 1WCMG 1YI2A 1IXRA 5IYBH 5CC4A 1X3GA 4ULLA 4HN7A 2X6GA 2CFMA 4XQNA 2PMZB 3I73A 3KFUA 4FU0A 1XMQQ 1F77A 1Z2NX 4RHRA 4YHHL 3I56A 1XJVA 3JSNA 1A3UA 3G8CA 2W6QA 1MJCA 2UUAL 2Q8RE 5CA0F 1O7IA 4Y8VB 2XTIA 1IYDA 4C5AA 4NZOA 4ID6A 2VXWA 4B9WA 3PO3B 3VR5A 2EJ3A 4BBSG 3RV3A 5KEEA 5KRUA 1Y1VH 5JOBA 4ZHQF 1PYSB 2ZTEA 2NUCA 1BOSA 2EYPA 1K83B 3HO8A 1JJ2A 1VQBA 2MNAA 4KHPL 5DLQE 3CKIB 3SK6A 5J2UF 2LY7A 2E2IH 4FF1A 1Z2PX 4DR7Q 4EEQA 4K5WA 4X65Q 4AH6A 3F2CA 3IRBA 1NAPA 3NTHA 1FR3A 1MIUA 2COIA 1SROA 4A3FB 1HZCA 3HOXH 3WWVA 1H9KA 4GOPC 2TSSA 4E6IA 1BCPF 3Q1KA 3FRPB 2YZLA 4R4IA 3NTKA 1IL8A 2RHSB 1M90C 1LT6D 3K3PA 1EUCB 4EVOA 3CEBA 4XT3B 4Q5VA 5C0XH 3NUCA 2RDGA 3D6WA 1PX2A 4P74A 3TQYA 4DAMA 4UCVA 3SGIA 4X62Q 3RUPA 1J5EQ 3I72A 1SJED 1CQVA 2F03A 4UUGA 3E5NA 2A6ED 4ZCKA 3KOJA 4IFDI 2YWVA 5I9PA 1N34Q 5I5WA 5IOCA 2XCLA 1G2WA 3SK5A 3U55A 2K14A 1C9OA 3FKIB 3SK8A 4RKLA 4OGQC 2OQ0A 4M8AA 4LF6L 1F9QA 2UXDL 4O7VA 3GP7A 2Z6KC 1LLRD 3K6OA 1I50B 2NZOA 1J6QA 4H02A 2UXCL 2KBNA 3O13A 4YJ2F 2CKZB 2R93B 1Y1WB 3LWBA 4FF4A 1PDQA 1K83H 1DOKA 2O5JC 1KDCA 5HGQA 5I5VA 2AHOB 2NVXH 3PIO3 3R5HA 2NN6G 2CWAA 5AFWA 1X55A 3Q0AA 1GHJA 1IYJB 2N8NA 3DEOA 1MJEA 1G8ZD 1X3FA 1TU2B 2K4KA 1SMYC 3H15A 1UEBA 2K05A 1UE6A 4KD3A 3QQMA 2HGXA 3UDGA 4EGVA 3HOWG 3I8ZA 3CPWA 2RHQB 3R93A 4IO9A 4HIKA 1WTWA 1LTTD 2PVPA 4O7TA 2KEDA 4KD4A 2CW0D 3OW2A 1JWUD 2BH2A 5C5LA 2JQOA 4DK6C 1QJOA 5FKAC 3L7ZC 2D62A 2KHSA 1STAA 2H1EA 4O4HF 2EJFC 1A2UA 2B2TC 1KRTA 2Q2TA 2AQ3B 2IHFA 4NDXA 4FXGC 3FVQA 1XXGA 1SSOA 1EUJA 3S17B 5E7NA 1N36L 1UAPA 1YHAA 3FKIH 3NTIA 2L5TA 3WWHA 1NMGA 4ZRZA 4NXML 5M5YB 2YW2A 5C44G 4JBJA 1ZXTA 4HR7A 2JP1A 4G57A 1QILA 2RA4A 1S5FD 1I50H 4CDFC 2K52A 4IUUA 3DHQA 2HD3A 4R1JA 3T56B 4TQUS 2DGYA 2R93H 5J1ZA 1HFGA 3H0GB 1LYLA 2ZT9C 3C46A 2G5DA 2QKIC 3CF5A 1K3RA 3DUZA 4C3IB 3VR3A 3L3OC 2L9HA 4LUOA 4DV0L 4CMDA 3T9CA 1M8AA 3GB8B 4JV5L 1SJHD 3TINA 3T1YL 4YCUA 5A2QE 1PXUA 5H80A 2V5AA 4OWWB 1HR0W 3TY8A 2AKWB 4OO1I 1QNUA 5EBDA 2EY1A 4I4TF 1LM0A 2UUCL 3GTJB 4JC0A 1U4PA 5CV8A 1MHWC 5BN5A 4UAIA 1QWYA 3H3VC 3NPPA 2KECA 1V1OA 3VPDA 5C4XH 2SNSA 1JE5A 3FP9A 5FPOA 2MUYA 5FLXL 4HIMA 2KHJA 3P20A 2JK8A 1AH9A 4B3MQ 1EYGA 4NP5A 4FFRA 1DGSA 2DY7A 3S17H 2JA6B 1TY2A 2RF4A 3I3CA 2HHHL 3TP8A 1G2SA 1GUTA 1KTKA 1VQIA 5CV6A 2IX3A 4FF3A 3D4RA 5M5YH 1HR0L 1EZ1A 1XPRA 4U68A 3W2DA 3J81L 3M4OH 4C5BA 1S5BD 4UP8A 2B2WA 2IX1A 4CHIA 1CKNA 5M3FG 3F2BA 1I7NA 4NZMA 1YNJC 4M0JA 4DR1L 3ITPA 2K5QA 2A73B 2FHTA 3R2IA 4DV5Q 3D31A 1TS5A 4A93G 1K73C 1KNEA 1WTOA 3UE0A 1WTQA 1KC7A 4B3RL 2YS6A 1VQ9A 1EY8A 4ZUJA 1A62A 4PG3A 2DAAA 1E7ZA 4CC5A 2OT2A 4ZLTF 1CSQA 1IW7D 4LUVA 1YNXA 1LTID 3W1GA 5LMUQ 4JYAL 3Q23A 2L0CA 3MHBA 1KDAA 1IKLA 1WJJA 3NC0B 1SEBD 3I2ZA 2D9UA 2QA4A 1BNCA 3HOVG 1SYCA 2A8VA 5KNBA 2AUJD 4IN3A 1HNXL 1UE7A 1IHZA 2QK4A 1YJWA 3WNZA 3A74A 1TAEA 1RD9D 4HJAA 4DIMA 3GTJH 2MO0A 4AIMA 5AJ3L 2NVYB 5EKIA 5CMDA 4R4TA 1F2LA 3G71A 2WB1E 4N8FA 3NHHA 4XQJA 2DY8A 1NNXA 5ELDA 4CE5A 2G9DA 1GO3E 1SNPA 4H0LC 3RUZA 2ZGIA 3R23A 1EQVA 2EE1A 2K33A 1CM9A 1HZAA 2NBFA 3UFXB 1LABA 1W96A 1TWCB 5IT9L 4BY7G 1EKVA 4QCLA 2ZDQA 1PTOC 5FPRA 1HNWL 2PNHA 5CR3A 1KJQA 5C3EB 3MC0B 5C1OA 3BVMA 4CDEC 1TR5A 1QE6A 2F4IA 3F2UA 1JWSD 2XRSD 3HOYH 2I46A 4IPHA 4GNXA 5EPLA 5CGKA 3JC66 1WOCA 2VS1A 4O1NA 3H3VI 3T9BA 2FINB 1JR0D 3M4PA 3MWEA 1XX8A 3GV3A 3S1RH 2VB2X 1ENFA 1GGOA 4KKUA 2QILA 1N9WA 4OXPA 5BWWA 4JV5Q 1H95A 1AUVA 4UCUA 4DV6L 2RDHA 3G7LA 2ZTDA 5IIFA 4B3TL 1VKZA 4A3GB 3GJXB 3PUVA 2VNUD 5GQOA 3WO1A 2EJGC 5IYCH 3WWJA 1PFNA 1VQAA 5IGGA 1QCBD 3I91A 1H9MA 1VQ4A 1TT2A 1XK5A 1Q12A 2WV6D 2R7NA 2KJXA 2AQ1B 2UUCQ 1QZHA 4A3BG 3N52A 3PIOA 2CZGA 2GLTA 1YEZA 4BA1I 3CCVA 2EJ0A 2NVYH 4LF5L 1I4RA 3U4VA 2YRXA 1TXYA 2ICEC 4O83A 1ICFB 2UUBL 4IUTA 4O7ZA 2WYOA 3NBHA 4QL5A 3ZYYX 3DWQA 3EIVA 2NTSA 2XNAC 5M3MH 1PVOA 4BY1G 4A3JG 1VMCA 1C48A 1IYUA 3QG1A 1NR4A 1OXUA 2F0JA 2LFNA 2B2YA 2RCNA 3GDEA 1RIPA 2B8GA 4YWKA 2VY3A 3WDNA 4ZKCB 1L0XB 3AMUA 2MPMA 4GLAC 4A3EG 1WTPA 3EVQA 4O42A 2I5MX 4UCTA 2E2DC 4YWMA 3E0EA 4H44C 5KKNB 1CE8A 2COJA 2DNEA 2OLSA 1X56A 2ZJRA 3ULJA 4NMZA 2YU9B 2WB1B 4JPBW 3VPBA 4K5VA 1D8LA 2FPIB 5FLMG 1JCKB 4MV1A 5CV5A 3PMFA 2J7ZA 1UWVA 1JB7A 2F0PA 4C5CA 1XNQL 4BWGB 2JA8H 5DGHA 3JZIA 3AQQA 3OSOA 4A3GH 1XDNA 1X3QA 1CQIB 1ZKOA 4DAYA 1HNXQ 3V96A 5JPMC 1ML0D 4HR7B 3SVMA 3BG3A 1EIFA 4ABNA 4DK3C 1VQOA 1N32L 3VPCA 3CCQA 4DA2A 3T9AA 2OF1A 4X6AH 2YS7A 3E0JA 2OTLA 3RR5A 2MO1A 3CCUA 1EOVA 3UDIA 4LF8Q 3BJUA 4C3HB 1MKHA 1SYBA 2VQEQ 4O82A 2CWPA 3M7NA 4WRDA 5JH7F 4YAJB 2FP4B 3D8GA 3K7UC 1D1KA 1E24A 4BS9A 5LL6X 4EGJA 4RG1A 1KL9A 2Y4RA 3CU7A 4NXNL 2R7MA 3QJYA 1H9JA 1HNWQ 3C1FA 3BG5A 5LMNL 3VMMA 4UCRA 4UCSA 2EJ2A 3J81j 2F0QA 1AE2A 5C0XJ 2ASBA 1G91A 5EBCA 1STYA 1Y8NB 2HQLA 4HNUA 1NMFA 3TIGA 2ID0A 3CW2C 5IP7G 1KHIA 2YYZA 1WFQA 4K0KL 4JW0A 2N55A 3JAMc 1ULZA 3T1HL 4EQ5A 3FEWX 2OTJA 4ME6A 4KHZA 4GZYC 2W6NA 5DMXA 2Q7DA 2X0SA 5IWAL 1G51A 4GKKL 1O7LA 4KTAA 3RN2A 4QB4A 1EY0A 3A55A 3HOZH 4YB8B 3CCRA 1X9NA 4GKJQ 5I5YA 4YCVA 2EQSA 4KHVA 4RKBA 1XWEA 4O7RA 1C3OA 4MV9A 4XYLB 4QSHA 4B3TQ 4DV3Q 4XQQA 2IPKD 2UXBQ 2ZDGA 3S1NB 2LS01 1YIJA 3OYYA 5IYBG 2HG8A 1XNRL 2JEAI 1EZ8A 1TVXA 1EOTA 4ILWA 5K5PA 4KJOA 1B53A 5L37A 1I94L 2ALYB 3PIP3 1TA8A 1VF7A 2FPGB 1Z7TA 1KAAA 3QB3A 1CS0A 1CKNB 3RTXA 3ORQA 3BDLA 4JBKA 1I6HH 2KCCA 1B7YB 1QOHA 4LF5Q 5HV6A 5G3LF 3RMHA 4DK0A 3I4NH 4DR6L 4FFLA 1NUCA 2F52A 3SXHA 1K3BC 3QR8A 5I6YA 2UUBQ 4ZKBB 1CKMA 1ASYA 5IYDH 3GTQB 1GXDC 2JE6I 1GLVA 2F0TA 3G4SA 1W93A 1PH5A 1Y1VG 1JORA 1TWAH 1K9MC 2X5RA 3IKJA 2WAQE 1WI5A 4NB3A 5GONF 1CSPA 2SEBD 3MAQA 3I12A 4H7BA 2LSSA 2I07B 1VQDA 2IW3A 2QDLA 2JSOA 3HOXG 1SYGA 5GROA 2K5DA 2UU9L 4I65A 3CPFA 3F8TA 3UQ8A 2R87A 1F2YA 3S2DB 1KIXA 5HURA 2BE5D 5K2MA 5D1OA 2LMCB 3VA5A 3NXWA 2PQEA 2AMCB 2JXMB 5ELCA 5C0XG 3S24A 2EXDA 4TRDA 4EFEA 4HJ5A 1GSOA 2OWOA 3C1EA 3KYHC 1HZBA 4AYBE 5DEHA 1HPCA 1RF2D 4QQBX 1XNQQ 3KF6B 3TP6A 3I7FA 4HNVA 5CAEB 3MXGA 3G6JB 1SN8A 1KT8A 1ASZA 2I80A 1JE4A 2IWHA 5D14A 3FDTA 5I5XA 2HCCA 4K2KA 1P8LA 3LX0A 3PUYA 2R61A 3TS0A 1X54A 5G3LD 4GNXB 3GTLB 3PO2H 2F0WA 1CK1A 3G48A 1VF5C 4OEMB 4CKBA 2EYLA 3HZXA 4DAVA 3GTQH 2I87A 2PW5A 2QEJC 2HVSA 1Y14B 1CZGA 1K0SA 4CDCC 5KIXA 2F0VA 1FGBD 4QY7A 5LMNQ 3GTMH 4A3IB 5KYIA 3S1MB 4A3MB 5I5SA 3QOJA 1LUZA 3TS2A 2F0EA 3A8IE 3GO5A 3J7AF 1F9RA 1EY7A 1RODA 1V1PB 2G9HD 5D65A 3SE7A 4IUPA 2K7VA 4K0KQ 1JJCB 3S2DH 4IPCA 1BBWA 2A6HC 2L11A 4JOIC 4R8IA 2B63B 1HRJA 2YRWA 5ELOA 1LT5D 2HGSA 2W6MA 3G6EA 1CQJB 1BF4A 3E9IA 2E5LQ 4LJZC 3GTOB 4ME5A 2N88A 5HNEA 2J0TD 3EN2A 3PN1A 3RN5A 3NBHB 4CC6A 1V8QA 3T53B 4L5SA 5IE8A 4TV8F 4HTOA 3EA6A 2WAQB 4X66Q 2W6PA 4JBWA 3FPPA 4JI3L 1AE3A 1M4VA 2XRQD 1XNRQ 3M85A 2O4XA 1HCZA 2NU7B 3NUAA 1RKNA 3D3RA 3OWFA 1STEA 4BBRB 2L15A 3A56A 4A3DB 1OO9B 4LF7L 2CH4W 2HT1A 4MV4A 4EGQA 5J2TF 1HA5A 1D1IA 4DV7Q 3FKIG 4HCEA 2NU8B 5CV4A 5GADC 3J7ZC 3GTGB 1PRTB 2HDKA 1HQMC 2A74C 3MFYA 4ZYSA 1NJIC 3MFGA 1ZYRC 1XYIA 2R7KA 4Q4DA 1HA6A 1N33Q 1PYWD 1K8AC 2W6ZA 2PI2E 3K59A 2CH4A 4I7ZC 3CCMA 1B3QA 3CHBD 2IHEA 1EYCA 3CCSA 4DUZL 2R93G 4L1KA 3D6CA 2R92H 1CKOA 3I90A 4HTHA 2B2VC 2FFKB 4AYBB 3R3OA 1A0IA 1DOLA 3MZ5A 2B2UA 3I4MB 1EIHA 3FMCA 4E6NA 4RH6A 2KCNA 3DTFA 2GQRA 5IGFA 3NQTA 3S1MH 4NYEA 1X32A 3VYSA 4DAYB 4G7HC 1Q8IA 5M5WB 1JT8A 1Q1EA 2AWNA 5C6AA 5A2QL 4L5RC 1STBA 4KN7C 3H09A 4RMFA 4O84A 3HG9A 1WCMB
chains in the Genus database with same CATH topology
4HIMA 2KHJA 1YJNA 1VQLA 3J7A5 2JK8A 4HJ9A 1AH9A 5GAHC 4B3MQ 4A3LG 1EYGA 2B63H 1DGSA 1KD1C 1PH7A 2R92G 1X65A 1NE3A 3OTOL 4A93H 3JAMi 3S17H 1L1OC 2RF4A 1BVSA 2HHHL 5IY0A 1VQIA 2I5HA 5EAYA 1T9HA 5M5YH 4X62L 1HR0L 3S14H 3K81C 1GKHA 1XPRA 5JJLA 1U0LA 1J5EL 1OXXK 2ZM6L 3M4OH 4DV4Q 4UP8A 2IX1A 5C4XG 3BU2A 3HKZE 1QZGA 1CKNA 1V9PA 1Z9FA 4JI1Q 5M3FG 3HOVH 3S1NH 3F2BA 5IT9c 1YHQA 4JI2L 4DR1L 1B8AA 2JEBI 2ES2A 2B63G 2C35B 1KXLA 4DV5Q 1OXVA 1N32Q 3ZJYC 2B29A 3D31A 4LWCA 3U50C 4B3SL 4JOIA 4UP9A 4A93G 1K73C 5BR8Q 1K8GA 1KC8C 3UE0A 1NY4A 1HNZQ 4B3RL 3F1ZA 1PH3A 2K75A 3KDFB 3KLWA 3M3YH 1VQ9A 3BAAA 1A62A 3K7AH 1Q46A 1E7ZA 4PG3A 3UDXA 3J81i 4GOPB 4C2MH 1CSQA 3GTGH 4LUVA 1YNXA 4JI0Q 3W1GA 5LMUQ 4A3FH 4JYAL 3CP0A 4HIDA 3CC4A 1P16A 4NPSA 1WJJA 3NC0B 3PCOB 2WAQG 3NENA 3I2ZA 4JCVE 3TEHB 2QA4A 3HOVG 3PO3G 2A8VA 3DM3A 1TWHH 2B3GA 5LMNW 3BABA 4GN5A 1X6OA 5JEAG 1UE7A 1YBYA 1IZ6A 4AQYQ 3BZKA 1YJWA 1HNXL 3A74A 4IFDG 2Z0SA 4GLXA 4NXNQ 2R6GA 1TAEA 1X3EA 2IT1A 4BY7H 4DKAC 2QEXA 4HJAA 3GTJH 2MO0A 4AIMA 5AJ3L 3RZDH 1OTCA 3PV0A 4JI8Q 5M5WH 1JMCA 4POGA 1UE1A 4A3FG 4R4TA 3KJOA 2Q2HA 3AFPA 3G71A 2WB1E 1S72A 1PH9A 5GAEC 3BA9A 3TRZA 4IOCA 1IBLL 3T1HQ 3A5ZB 4LH6A 1Q81C 1GO3E 3W1BA 4O2DA 3TY5A 1TWFH 2DUDA 5IWAQ 3LGJA 1EQRA 1N8RC 4YHHQ 3TREA 1HZAA 3I4MG 4GKKQ 1EWIA 4P75A 4DUYL 2UUAQ 3S16H 4BY7G 2HIXA 3AFQA 4IJLA 2JA5H 1VQKA 5FPRA 1HNWL 2PNHA 1GVPA 2VQFL 3CC7A 3NEMA 4YY3L 4JI7Q 1PH8A 2A1AA 4UP7A 1I3QH 1VQFA 2ZJQA 3HKSA 3F2DA 4JI4Q 4Y52H 2VUGA 5FPOA 1PA6A 3NELA 3I4OA 4LF4L 4GNXA 4IPHA 3HOYH 4XTCS 1XMOQ 3JC66 1WOCA 1YITA 2VS1A 1Y1WH 4JG2A 1I94Q 3L0OA 2MQHA 3M4PA 4X64Q 4LF7Q 1OXSC 3H3VI 3NBYB 4UFZA 4KHPQ 2BA1A 3S1RH 3KJPA 2ZTCA 4A75A 2Y0SE 1PH4A 4YWLA 1XMQL 2E5LL 4A3BH 1N9WA 1PFSA 2BA0A 4OXPA 1XPOA 1PV4A 2KCTA 5M5XH 2F3IA 1C7YA 2JA5G 3GTLH 4DR6Q 4JV5Q 1H95A 4DV2L 4UCUA 1VQ8A 5D1OB 4L5QA 2I5LX 4OX9L 4DV1L 4DV6L 4LF9L 3HOUH 2N78A 1VCIA 2ZTDA 3CCJA 4X66L 4B3TL 4JI6Q 5C0XI 3GJXB 1UE5A 2WFWA 3PUVA 3ER0A 4DUZQ 2VNUD 5GQOA 3HOYG 5IYCH 2OCEA 3MEFA 1VQAA 3GTKH 1Y1WG 4BY1H 4A3JH 1VQ4A 2I0QA 1XK5A 3ULLA 1Q12A 2V1CC 1B04A 2CQOA 2YV5A 3STBC 2UUCQ 1QZHA 4A3BG 1SRUA 4A3IH 3PIOA 1KQSA 4DV7L 2PMZE 4DR7L 1YEZA 4BA1I 4PZ6A 2LXKA 3CCVA 2NVYH 4A3MH 5JJKA 4LF5L 5FJ8H 4GNXC 2ATWA 3U4VA 2E8GA 1TXYA 4J15A 2E2HH 2UU9Q 4A3EH 3HOUG 2KHIA 4HIOA 4DR3Q 1W2BA 1IBML 2UUBL 1E1TA 1N33L 4KI0A 4QL5A 4FDBA 5IYCG 1YZ6A 2F4VQ 3EIVA 3AYHB 5M3MH 1VQPA 1PVOA 2NN6I 4BY1G 3RLFA 4A3JG 2JA7H 3HOZG 3S15H 2R7FA 1Z47A 3GTOH 1OXUA 2GVAA 1E22A 4LF6Q 5FLMH 4P73A 2YTYA 1PH2A 4A3IG 4LFBL 2UXDQ 2RCNA 3GDEA 1SMXA 1HH2P 1RIPA 2VL6A 4YWKA 2VY3A 3J80c 2ZM6Q 4A3MG 1G291 4R4CA 2FXQA 2UXCQ 5FJ8G 1VQEA 4LNQA 4GLAC 4A3EG 4JI2Q 2I5MX 4UCTA 2PQAA 1XTDA 1BBUA 1N34L 4YWMA 3E0EA 3TY9A 4B3ML 3H0GH 4B3SQ 4BBRH 3A5UA 1EIYB 5M3MG 4A3DH 5JJIA 1X56A 2KCMA 2GN5A 4MTNA 2ZJRA 2JA7G 4A3CH 3ULJA 4WJ4A 3L2PA 4POFA 1IBKQ 4C3IH 1D8LA 5FLMG 2HIVA 3CD6A 5K36G 3CMEA 5C3EG 4OO1G 4CC5A 1UWVA 2QGQA 4DPGA 5GAGC 1JB7A 1QVCA 5J3BA 3UE1A 1XNQL 2CCZA 2JA8H 4DV4L 3RZOH 3AQQA 4R4QA 3UDFA 1QUQA 1VQ5A 4JBMA 4A3GH 1FJGQ 1XDNA 2NVQH 4JI1L 4UCOA 1HNXQ 4MNOA 3MXNB 4EX5A 1VQMA 1VQCA 3PIPA 3H0GG 4BBRG 1EIFA 3PGZA 4DK3C 1SLJA 1VQOA 4DV5L 3I4MH 4A3DG 4A3CG 4TVAB 3Q8DA 1N32L 3CCQA 5BR8L 3D0FA 4IPGA 4C3JH 2OTLA 4X6AH 4IPDA 3RR5A 2MO1A 3CCUA 3PUWA 4UY8C 1EOVA 3UDIA 2ZJPA 2YTXA 3BJUA 4JI0L 4LF8Q 4LFCL 5LMUL 3RNUA 1MKHA 2VQEQ 1WCMH 5IP7H 2JA8G 2CWPA 1RL2A 1GD7A 3K8AA 4L5TA 3M7NA 2AWOA 1PHJA 4A3GG 2D0OA 1L2FA 3K7UC 1S40A 1L1OB 3QWUA 4A4IA 3PSIA 3VNNA 1E24A 3KF6A 2R7ZH 1WYDA 4RG1A 1KL9A 4AYBG 4AQYL 1N36Q 2JA6H 1M1KC 4WJ3M 2K5NA 2VZAA 4NXNL 4NXMQ 1HNWQ 4BA2I 2VQFQ 2E2JH 1V43A 4ME3A 5LMNL 1FGUA 3HKZG 4UCRA 1PYBA 4UCSA 3J81j 1AE2A 4JI8L 5C0XJ 2ASBA 1A63A 4DRFA 2HQLA 1NMFA 3J80i 2ID0A 4JI3Q 2LXJA 4LF4Q 4DR2L 3CW2C 1WCMG 1OXTA 3KDFA 5IP7G 1KHIA 1YI2A 1IXRA 2YYZA 1QVFA 5IYBH 3PUZA 3GTPH 4BBSH 1WFQA 4K0KL 1X3GA 1HJPA 4A3KH 3JAMc 4DR5L 3ERSX 2CFMA 3T1HL 2H5XA 4EQ5A 2OTJA 4R4OA 4KHZA 3KFUA 2R7ZG 4IOAA 3NBZB 5IWAL 1XMQQ 1G51A 2JA6G 4OONA 3STBD 4YHHL 3I56A 3RN2A 1XJVA 4GKKL 3JSNA 1MJCA 4APVA 2UUAL 4DV0Q 3HOZH 4DV2Q 5C4JH 1O7IA 2XTIA 1X9NA 3CCRA 4GKJQ 4DV1Q 4YCVA 2EQSA 4LF9Q 4DR4L 2D0PA 3T1YQ 1VQ6A 4B3TQ 4DV3Q 2GVBA 1IL2A 2UXBQ 4JI4L 1YIJA 1V1QA 3OYYA 4GLVB 5IYBG 4QGUA 1Y1VH 3ULPA 1XNRL 4A3KG 4JI5L 1NBWA 2JEAI 1HZ9A 1PYSB 2ZTEA 3RLNA 1I94L 2ALYB 1TA8A 1JJ2A 1VQGA 1JJGA 1VQBA 2MNAA 4KHPL 5DLQE 2VW9A 4QIWE 2E2IH 3I55A 1CKNB 3BZCA 1YJ9A 3H3VH 4DR7Q 4EEQA 4X65Q 4AH6A 2A19A 2PQAB 3IRBA 1B7YB 3F2CA 1MIUA 5JEAJ 4JBKA 1SROA 4LF5Q 1I6HH 4LH7A 1HZCA 3HOXH 3I4NH 3WWVA 3AEVA 4DR6L 3E9HA 2F52A 4GOPC 2UUBQ 4HTPA 3W5OA 1CKMA 1ASYA 4R4IA 4GS3A 5IYDH 2JE6I 3G4SA 3GD7A 1TWGH 2N3SA 1G6PA 2RHSB 2NZHA 1M90C 1PH5A 1Y1VG 1TWAH 4UPAA 3OTOQ 1K9MC 2WAQE 1D7QA 4HJ7A 1WI5A 5DISC 4NB3A 2HHHQ 4P74A 1PH6A 3TQYA 4DAMA 1CSPA 3B6YA 4UCVA 1TWCH 1VS0A 1KAWA 2MFIA 3SGIA 4X62Q 1HR0Q 4LFBQ 1FL0A 1QUQB 2LSSA 1VQDA 4LFAL 3S2HH 3U58A 5C3EH 4OWTB 1J5EQ 4LUZA 1Q8KA 1Q1BA 3K0XA 3HOXG 3I4NG 3M9BA 5GROA 3KOJA 2UU9L 3CCLA 2K50A 3CPFA 3F8TA 2VUMH 5IYDG 1N34Q 4DR3L 4IFDI 3UQ8A 3JSLA 1KIXA 4ALPA 1YHBA 2Y0SG 1K0RA 4DR1Q 3VDYA 3CAMA 5D1OA 1B70B 2F4VL 2AMCB 2K14A 5C0XG 3S24A 2EXDA 4B3RQ 4EFEA 1E3PA 1C9OA 5H1SE 4HJ5A 1Q7YC 4O0AA 4PZ7A 3S1QH 2KENA 1XPUA 2OWOA 3BA8A 2OQ0A 4LF6L 4JYAQ 3PF4A 3KYHC 1HZBA 4AYBE 2UXDL 4QQBX 1XNQQ 1W3SA 3KF6B 2Z6KC 3I7FA 4XIGS 2NZOA 1J6QA 4H02A 2UXCL 3KF8B 1SN8A 2KBNA 5HY6A 1ASZA 2VUMG 2CKZB 3HOWH 5IP9H 4A76A 1K83H 4DNIA 4IJHA 1P8LA 4GN4B 1VQHA 5HGQA 3PUYA 5AJ3Q 3TS0A 1X54A 2IX0A 2AHOB 1HNZL 4GNXB 1S68A 2NVXH 1IBKL 3EBEA 3PO2H 2NN6G 3PO3H 2CWAA 4PZ8A 1X55A 4LFCQ 2IY5B 1Q86C 1IYJB 2N8NA 1MJEA 4BXXH 3HFZB 1X3FA 2K4KA 3G48A 3PUXA 4P71A 4PMWA 4GN3B 1FVIA 2YTVA 3H15A 1E1OA 1UEBA 1VQ7A 1IBLQ 3GTQH 1UE6A 1VQJA 2HVSA 3UDGA 1FJGL 5ELNA 1Y14B 1VQNA 2R7DA 3CPWA 2RHQB 5IP9G 2WP8J 3HOWG 4IO9A 4HIKA 4DUYQ 2K5VA 3DLLA 1NTGA 4QY7A 5LMNQ 3OW2A 3GTMH 2BH2A 4YY3Q 3CMAA 5C44H 2JQOA 4DK6C 2N49A 3PO2G 3L7ZC 3CC2A 2D62A 1EFWA 1LUZA 4BXXG 4DR2Q 3TS2A 4LF8L 3GO5A 2K5HA 1KRTA 2Q2TA 2IHFA 4K0KQ 2VQEL 1JJCB 4DR5Q 4GOPA 4IPCA 1BBWA 1KRSA 4JOIC 1R9TH 3ICEA 3S2DH 3CQZH 5ELOA 1EUJA 3G6EA 2HVRA 3E9IA 2Q2IA 5E7NA 3M4QA 3PF5A 2E5LQ 1A8VA 1N36L 1YHAA 3FKIH 4EFBA 2YU9H 3PN1A 3EN2A 5FLXc 1NMGA 4NXML 3RN5A 3NBHB 5C44G 4JBJA 2Q2UA 4DR4Q 4OX9Q 3K80C 4DV6Q 3A0JA 4QJFA 1GM5A 4CC6A 4L5SA 4BBSG 5IE8A 4HTOA 4JI7L 3RLOA 3CXCA 4OWXB 1I50H 4X66Q 2K52A 4JBWA 4R1JA 4JI3L 1AE3A 1SE8A 1XNRQ 3M85A 4TQUS 4JI5Q 2DGYA 2R93H 2HVQA 5D1PA 1EQQA 1C0AA 1LYLA 1XMOL 2L15A 3U4ZA 1LTLA 4LF7L 2JJQA 4LW1A 4X64L 1YVCA 2HT1A 3J81c 3CF5A 1K3RA 4DV7Q 3FKIG 1QVGA 2WB1G 1Q82C 3RTXA 5GADC 3J7ZC 4LUOA 4MZ9A 1L1OA 2OQKA 4Y7NH 4DV0L 1PH1A 3GB8B 4JV5L 1NJIC 4HJ8A 1SFOH 4P72A 4GKJL 4IFDJ 4C3HH 1IBMQ 3T1YL 3FHWA 1N33Q 4YCUA 4DV3L 1K8AC 2PI2E 2Z6KA 4JI6L 4A3LH 2UXBL 3CCMA 2PI2A 3CCSA 1SR3A 2IHEA 2BH8A 4DUZL 4OWWB 1HR0W 2R93G 2R92H 1I5FA 1CKOA 3TY8A 1A0IA 2AKWB 2JA9A 4OO1I 4E6NA 4LFAQ 1LM0A 1BKBA 2UUCL 1S3OA 1U5KA 4JC0A 3S1MH 4YCWA 4DAYB 1JT8A 2XGTA 4X65L 1CUKA 1Q1EA 2AWNA 4L5RC 2NVTH 4KLKA 4RMFA 2EIFA 5C4XH 3CCEA 1L0WA 1JE5A 3FP9A 5M3FH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HIM A;  2KHJ A;  1YJN A;  1VQL A;  3J7A 5;  2JK8 A;  4HJ9 A;  1AH9 A;  5GAH C;  4B3M Q;  4A3L G;  1EYG A;  2B63 H;  1DGS A;  1KD1 C;  1PH7 A;  2R92 G;  1X65 A;  1NE3 A;  3OTO L;  4A93 H;  3JAM i;  3S17 H;  1L1O C;  2RF4 A;  1BVS A;  2HHH L;  5IY0 A;  1VQI A;  2I5H A;  5EAY A;  1T9H A;  5M5Y H;  4X62 L;  1HR0 L;  3S14 H;  3K81 C;  1GKH A;  1XPR A;  5JJL A;  1U0L A;  1J5E L;  1OXX K;  2ZM6 L;  3M4O H;  4DV4 Q;  4UP8 A;  2IX1 A;  5C4X G;  3BU2 A;  3HKZ E;  1QZG A;  1CKN A;  1V9P A;  1Z9F A;  4JI1 Q;  5M3F G;  3HOV H;  3S1N H;  3F2B A;  5IT9 c;  1YHQ A;  4JI2 L;  4DR1 L;  1B8A A;  2JEB I;  2ES2 A;  2B63 G;  2C35 B;  1KXL A;  4DV5 Q;  1OXV A;  1N32 Q;  3ZJY C;  2B29 A;  3D31 A;  4LWC A;  3U50 C;  4B3S L;  4JOI A;  4UP9 A;  4A93 G;  1K73 C;  5BR8 Q;  1K8G A;  1KC8 C;  3UE0 A;  1NY4 A;  1HNZ Q;  4B3R L;  3F1Z A;  1PH3 A;  2K75 A;  3KDF B;  3KLW A;  3M3Y H;  1VQ9 A;  3BAA A;  1A62 A;  3K7A H;  1Q46 A;  1E7Z A;  4PG3 A;  3UDX A;  3J81 i;  4GOP B;  4C2M H;  1CSQ A;  3GTG H;  4LUV A;  1YNX A;  4JI0 Q;  3W1G A;  5LMU Q;  4A3F H;  4JYA L;  3CP0 A;  4HID A;  3CC4 A;  1P16 A;  4NPS A;  1WJJ A;  3NC0 B;  3PCO B;  2WAQ G;  3NEN A;  3I2Z A;  4JCV E;  3TEH B;  2QA4 A;  3HOV G;  3PO3 G;  2A8V A;  3DM3 A;  1TWH H;  2B3G A;  5LMN W;  3BAB A;  4GN5 A;  1X6O A;  5JEA G;  1UE7 A;  1YBY A;  1IZ6 A;  4AQY Q;  3BZK A;  1YJW A;  1HNX L;  3A74 A;  4IFD G;  2Z0S A;  4GLX A;  4NXN Q;  2R6G A;  1TAE A;  1X3E A;  2IT1 A;  4BY7 H;  4DKA C;  2QEX A;  4HJA A;  3GTJ H;  2MO0 A;  4AIM A;  5AJ3 L;  3RZD H;  1OTC A;  3PV0 A;  4JI8 Q;  5M5W H;  1JMC A;  4POG A;  1UE1 A;  4A3F G;  4R4T A;  3KJO A;  2Q2H A;  3AFP A;  3G71 A;  2WB1 E;  1S72 A;  1PH9 A;  5GAE C;  3BA9 A;  3TRZ A;  4IOC A;  1IBL L;  3T1H Q;  3A5Z B;  4LH6 A;  1Q81 C;  1GO3 E;  3W1B A;  4O2D A;  3TY5 A;  1TWF H;  2DUD A;  5IWA Q;  3LGJ A;  1EQR A;  1N8R C;  4YHH Q;  3TRE A;  1HZA A;  3I4M G;  4GKK Q;  1EWI A;  4P75 A;  4DUY L;  2UUA Q;  3S16 H;  4BY7 G;  2HIX A;  3AFQ A;  4IJL A;  2JA5 H;  1VQK A;  5FPR A;  1HNW L;  2PNH A;  1GVP A;  2VQF L;  3CC7 A;  3NEM A;  4YY3 L;  4JI7 Q;  1PH8 A;  2A1A A;  4UP7 A;  1I3Q H;  1VQF A;  2ZJQ A;  3HKS A;  3F2D A;  4JI4 Q;  4Y52 H;  2VUG A;  5FPO A;  1PA6 A;  3NEL A;  3I4O A;  4LF4 L;  4GNX A;  4IPH A;  3HOY H;  4XTC S;  1XMO Q;  3JC6 6;  1WOC A;  1YIT A;  2VS1 A;  1Y1W H;  4JG2 A;  1I94 Q;  3L0O A;  2MQH A;  3M4P A;  4X64 Q;  4LF7 Q;  1OXS C;  3H3V I;  3NBY B;  4UFZ A;  4KHP Q;  2BA1 A;  3S1R H;  3KJP A;  2ZTC A;  4A75 A;  2Y0S E;  1PH4 A;  4YWL A;  1XMQ L;  2E5L L;  4A3B H;  1N9W A;  1PFS A;  2BA0 A;  4OXP A;  1XPO A;  1PV4 A;  2KCT A;  5M5X H;  2F3I A;  1C7Y A;  2JA5 G;  3GTL H;  4DR6 Q;  4JV5 Q;  1H95 A;  4DV2 L;  4UCU A;  1VQ8 A;  5D1O B;  4L5Q A;  2I5L X;  4OX9 L;  4DV1 L;  4DV6 L;  4LF9 L;  3HOU H;  2N78 A;  1VCI A;  2ZTD A;  3CCJ A;  4X66 L;  4B3T L;  4JI6 Q;  5C0X I;  3GJX B;  1UE5 A;  2WFW A;  3PUV A;  3ER0 A;  4DUZ Q;  2VNU D;  5GQO A;  3HOY G;  5IYC H;  2OCE A;  3MEF A;  1VQA A;  3GTK H;  1Y1W G;  4BY1 H;  4A3J H;  1VQ4 A;  2I0Q A;  1XK5 A;  3ULL A;  1Q12 A;  2V1C C;  1B04 A;  2CQO A;  2YV5 A;  3STB C;  2UUC Q;  1QZH A;  4A3B G;  1SRU A;  4A3I H;  3PIO A;  1KQS A;  4DV7 L;  2PMZ E;  4DR7 L;  1YEZ A;  4BA1 I;  4PZ6 A;  2LXK A;  3CCV A;  2NVY H;  4A3M H;  5JJK A;  4LF5 L;  5FJ8 H;  4GNX C;  2ATW A;  3U4V A;  2E8G A;  1TXY A;  4J15 A;  2E2H H;  2UU9 Q;  4A3E H;  3HOU G;  2KHI A;  4HIO A;  4DR3 Q;  1W2B A;  1IBM L;  2UUB L;  1E1T A;  1N33 L;  4KI0 A;  4QL5 A;  4FDB A;  5IYC G;  1YZ6 A;  2F4V Q;  3EIV A;  3AYH B;  5M3M H;  1VQP A;  1PVO A;  2NN6 I;  4BY1 G;  3RLF A;  4A3J G;  2JA7 H;  3HOZ G;  3S15 H;  2R7F A;  1Z47 A;  3GTO H;  1OXU A;  2GVA A;  1E22 A;  4LF6 Q;  5FLM H;  4P73 A;  2YTY A;  1PH2 A;  4A3I G;  4LFB L;  2UXD Q;  2RCN A;  3GDE A;  1SMX A;  1HH2 P;  1RIP A;  2VL6 A;  4YWK A;  2VY3 A;  3J80 c;  2ZM6 Q;  4A3M G;  1G29 1;  4R4C A;  2FXQ A;  2UXC Q;  5FJ8 G;  1VQE A;  4LNQ A;  4GLA C;  4A3E G;  4JI2 Q;  2I5M X;  4UCT A;  2PQA A;  1XTD A;  1BBU A;  1N34 L;  4YWM A;  3E0E A;  3TY9 A;  4B3M L;  3H0G H;  4B3S Q;  4BBR H;  3A5U A;  1EIY B;  5M3M G;  4A3D H;  5JJI A;  1X56 A;  2KCM A;  2GN5 A;  4MTN A;  2ZJR A;  2JA7 G;  4A3C H;  3ULJ A;  4WJ4 A;  3L2P A;  4POF A;  1IBK Q;  4C3I H;  1D8L A;  5FLM G;  2HIV A;  3CD6 A;  5K36 G;  3CME A;  5C3E G;  4OO1 G;  4CC5 A;  1UWV A;  2QGQ A;  4DPG A;  5GAG C;  1JB7 A;  1QVC A;  5J3B A;  3UE1 A;  1XNQ L;  2CCZ A;  2JA8 H;  4DV4 L;  3RZO H;  3AQQ A;  4R4Q A;  3UDF A;  1QUQ A;  1VQ5 A;  4JBM A;  4A3G H;  1FJG Q;  1XDN A;  2NVQ H;  4JI1 L;  4UCO A;  1HNX Q;  4MNO A;  3MXN B;  4EX5 A;  1VQM A;  1VQC A;  3PIP A;  3H0G G;  4BBR G;  1EIF A;  3PGZ A;  4DK3 C;  1SLJ A;  1VQO A;  4DV5 L;  3I4M H;  4A3D G;  4A3C G;  4TVA B;  3Q8D A;  1N32 L;  3CCQ A;  5BR8 L;  3D0F A;  4IPG A;  4C3J H;  2OTL A;  4X6A H;  4IPD A;  3RR5 A;  2MO1 A;  3CCU A;  3PUW A;  4UY8 C;  1EOV A;  3UDI A;  2ZJP A;  2YTX A;  3BJU A;  4JI0 L;  4LF8 Q;  4LFC L;  5LMU L;  3RNU A;  1MKH A;  2VQE Q;  1WCM H;  5IP7 H;  2JA8 G;  2CWP A;  1RL2 A;  1GD7 A;  3K8A A;  4L5T A;  3M7N A;  2AWO A;  1PHJ A;  4A3G G;  2D0O A;  1L2F A;  3K7U C;  1S40 A;  1L1O B;  3QWU A;  4A4I A;  3PSI A;  3VNN A;  1E24 A;  3KF6 A;  2R7Z H;  1WYD A;  4RG1 A;  1KL9 A;  4AYB G;  4AQY L;  1N36 Q;  2JA6 H;  1M1K C;  4WJ3 M;  2K5N A;  2VZA A;  4NXN L;  4NXM Q;  1HNW Q;  4BA2 I;  2VQF Q;  2E2J H;  1V43 A;  4ME3 A;  5LMN L;  1FGU A;  3HKZ G;  4UCR A;  1PYB A;  4UCS A;  3J81 j;  1AE2 A;  4JI8 L;  5C0X J;  2ASB A;  1A63 A;  4DRF A;  2HQL A;  1NMF A;  3J80 i;  2ID0 A;  4JI3 Q;  2LXJ A;  4LF4 Q;  4DR2 L;  3CW2 C;  1WCM G;  1OXT A;  3KDF A;  5IP7 G;  1KHI A;  1YI2 A;  1IXR A;  2YYZ A;  1QVF A;  5IYB H;  3PUZ A;  3GTP H;  4BBS H;  1WFQ A;  4K0K L;  1X3G A;  1HJP A;  4A3K H;  3JAM c;  4DR5 L;  3ERS X;  2CFM A;  3T1H L;  2H5X A;  4EQ5 A;  2OTJ A;  4R4O A;  4KHZ A;  3KFU A;  2R7Z G;  4IOA A;  3NBZ B;  5IWA L;  1XMQ Q;  1G51 A;  2JA6 G;  4OON A;  3STB D;  4YHH L;  3I56 A;  3RN2 A;  1XJV A;  4GKK L;  3JSN A;  1MJC A;  4APV A;  2UUA L;  4DV0 Q;  3HOZ H;  4DV2 Q;  5C4J H;  1O7I A;  2XTI A;  1X9N A;  3CCR A;  4GKJ Q;  4DV1 Q;  4YCV A;  2EQS A;  4LF9 Q;  4DR4 L;  2D0P A;  3T1Y Q;  1VQ6 A;  4B3T Q;  4DV3 Q;  2GVB A;  1IL2 A;  2UXB Q;  4JI4 L;  1YIJ A;  1V1Q A;  3OYY A;  4GLV B;  5IYB G;  4QGU A;  1Y1V H;  3ULP A;  1XNR L;  4A3K G;  4JI5 L;  1NBW A;  2JEA I;  1HZ9 A;  1PYS B;  2ZTE A;  3RLN A;  1I94 L;  2ALY B;  1TA8 A;  1JJ2 A;  1VQG A;  1JJG A;  1VQB A;  2MNA A;  4KHP L;  5DLQ E;  2VW9 A;  4QIW E;  2E2I H;  3I55 A;  1CKN B;  3BZC A;  1YJ9 A;  3H3V H;  4DR7 Q;  4EEQ A;  4X65 Q;  4AH6 A;  2A19 A;  2PQA B;  3IRB A;  1B7Y B;  3F2C A;  1MIU A;  5JEA J;  4JBK A;  1SRO A;  4LF5 Q;  1I6H H;  4LH7 A;  1HZC A;  3HOX H;  3I4N H;  3WWV A;  3AEV A;  4DR6 L;  3E9H A;  2F52 A;  4GOP C;  2UUB Q;  4HTP A;  3W5O A;  1CKM A;  1ASY A;  4R4I A;  4GS3 A;  5IYD H;  2JE6 I;  3G4S A;  3GD7 A;  1TWG H;  2N3S A;  1G6P A;  2RHS B;  2NZH A;  1M90 C;  1PH5 A;  1Y1V G;  1TWA H;  4UPA A;  3OTO Q;  1K9M C;  2WAQ E;  1D7Q A;  4HJ7 A;  1WI5 A;  5DIS C;  4NB3 A;  2HHH Q;  4P74 A;  1PH6 A;  3TQY A;  4DAM A;  1CSP A;  3B6Y A;  4UCV A;  1TWC H;  1VS0 A;  1KAW A;  2MFI A;  3SGI A;  4X62 Q;  1HR0 Q;  4LFB Q;  1FL0 A;  1QUQ B;  2LSS A;  1VQD A;  4LFA L;  3S2H H;  3U58 A;  5C3E H;  4OWT B;  1J5E Q;  4LUZ A;  1Q8K A;  1Q1B A;  3K0X A;  3HOX G;  3I4N G;  3M9B A;  5GRO A;  3KOJ A;  2UU9 L;  3CCL A;  2K50 A;  3CPF A;  3F8T A;  2VUM H;  5IYD G;  1N34 Q;  4DR3 L;  4IFD I;  3UQ8 A;  3JSL A;  1KIX A;  4ALP A;  1YHB A;  2Y0S G;  1K0R A;  4DR1 Q;  3VDY A;  3CAM A;  5D1O A;  1B70 B;  2F4V L;  2AMC B;  2K14 A;  5C0X G;  3S24 A;  2EXD A;  4B3R Q;  4EFE A;  1E3P A;  1C9O A;  5H1S E;  4HJ5 A;  1Q7Y C;  4O0A A;  4PZ7 A;  3S1Q H;  2KEN A;  1XPU A;  2OWO A;  3BA8 A;  2OQ0 A;  4LF6 L;  4JYA Q;  3PF4 A;  3KYH C;  1HZB A;  4AYB E;  2UXD L;  4QQB X;  1XNQ Q;  1W3S A;  3KF6 B;  2Z6K C;  3I7F A;  4XIG S;  2NZO A;  1J6Q A;  4H02 A;  2UXC L;  3KF8 B;  1SN8 A;  2KBN A;  5HY6 A;  1ASZ A;  2VUM G;  2CKZ B;  3HOW H;  5IP9 H;  4A76 A;  1K83 H;  4DNI A;  4IJH A;  1P8L A;  4GN4 B;  1VQH A;  5HGQ A;  3PUY A;  5AJ3 Q;  3TS0 A;  1X54 A;  2IX0 A;  2AHO B;  1HNZ L;  4GNX B;  1S68 A;  2NVX H;  1IBK L;  3EBE A;  3PO2 H;  2NN6 G;  3PO3 H;  2CWA A;  4PZ8 A;  1X55 A;  4LFC Q;  2IY5 B;  1Q86 C;  1IYJ B;  2N8N A;  1MJE A;  4BXX H;  3HFZ B;  1X3F A;  2K4K A;  3G48 A;  3PUX A;  4P71 A;  4PMW A;  4GN3 B;  1FVI A;  2YTV A;  3H15 A;  1E1O A;  1UEB A;  1VQ7 A;  1IBL Q;  3GTQ H;  1UE6 A;  1VQJ A;  2HVS A;  3UDG A;  1FJG L;  5ELN A;  1Y14 B;  1VQN A;  2R7D A;  3CPW A;  2RHQ B;  5IP9 G;  2WP8 J;  3HOW G;  4IO9 A;  4HIK A;  4DUY Q;  2K5V A;  3DLL A;  1NTG A;  4QY7 A;  5LMN Q;  3OW2 A;  3GTM H;  2BH2 A;  4YY3 Q;  3CMA A;  5C44 H;  2JQO A;  4DK6 C;  2N49 A;  3PO2 G;  3L7Z C;  3CC2 A;  2D62 A;  1EFW A;  1LUZ A;  4BXX G;  4DR2 Q;  3TS2 A;  4LF8 L;  3GO5 A;  2K5H A;  1KRT A;  2Q2T A;  2IHF A;  4K0K Q;  2VQE L;  1JJC B;  4DR5 Q;  4GOP A;  4IPC A;  1BBW A;  1KRS A;  4JOI C;  1R9T H;  3ICE A;  3S2D H;  3CQZ H;  5ELO A;  1EUJ A;  3G6E A;  2HVR A;  3E9I A;  2Q2I A;  5E7N A;  3M4Q A;  3PF5 A;  2E5L Q;  1A8V A;  1N36 L;  1YHA A;  3FKI H;  4EFB A;  2YU9 H;  3PN1 A;  3EN2 A;  5FLX c;  1NMG A;  4NXM L;  3RN5 A;  3NBH B;  5C44 G;  4JBJ A;  2Q2U A;  4DR4 Q;  4OX9 Q;  3K80 C;  4DV6 Q;  3A0J A;  4QJF A;  1GM5 A;  4CC6 A;  4L5S A;  4BBS G;  5IE8 A;  4HTO A;  4JI7 L;  3RLO A;  3CXC A;  4OWX B;  1I50 H;  4X66 Q;  2K52 A;  4JBW A;  4R1J A;  4JI3 L;  1AE3 A;  1SE8 A;  1XNR Q;  3M85 A;  4TQU S;  4JI5 Q;  2DGY A;  2R93 H;  2HVQ A;  5D1P A;  1EQQ A;  1C0A A;  1LYL A;  1XMO L;  2L15 A;  3U4Z A;  1LTL A;  4LF7 L;  2JJQ A;  4LW1 A;  4X64 L;  1YVC A;  2HT1 A;  3J81 c;  3CF5 A;  1K3R A;  4DV7 Q;  3FKI G;  1QVG A;  2WB1 G;  1Q82 C;  3RTX A;  5GAD C;  3J7Z C;  4LUO A;  4MZ9 A;  1L1O A;  2OQK A;  4Y7N H;  4DV0 L;  1PH1 A;  3GB8 B;  4JV5 L;  1NJI C;  4HJ8 A;  1SFO H;  4P72 A;  4GKJ L;  4IFD J;  4C3H H;  1IBM Q;  3T1Y L;  3FHW A;  1N33 Q;  4YCU A;  4DV3 L;  1K8A C;  2PI2 E;  2Z6K A;  4JI6 L;  4A3L H;  2UXB L;  3CCM A;  2PI2 A;  3CCS A;  1SR3 A;  2IHE A;  2BH8 A;  4DUZ L;  4OWW B;  1HR0 W;  2R93 G;  2R92 H;  1I5F A;  1CKO A;  3TY8 A;  1A0I A;  2AKW B;  2JA9 A;  4OO1 I;  4E6N A;  4LFA Q;  1LM0 A;  1BKB A;  2UUC L;  1S3O A;  1U5K A;  4JC0 A;  3S1M H;  4YCW A;  4DAY B;  1JT8 A;  2XGT A;  4X65 L;  1CUK A;  1Q1E A;  2AWN A;  4L5R C;  2NVT H;  4KLK A;  4RMF A;  2EIF A;  5C4X H;  3CCE A;  1L0W A;  1JE5 A;  3FP9 A;  5M3F H; 
#chains in the Genus database with same CATH topology
 5C4H A;  1YJN A;  4K8J A;  2D5D A;  1EU3 A;  2B63 H;  1KD1 C;  3TME A;  1M0T A;  1PH7 A;  5COR A;  3ETH A;  3OTO L;  1NE3 A;  3Q2O A;  2Z04 A;  1UNS A;  3MXU A;  5IY0 A;  2I5H A;  2JA5 B;  3N6R A;  2E2J B;  1T9H A;  2GPS A;  3K81 C;  1D5X C;  1U0L A;  1OXX K;  1LTA D;  2ZDH A;  1K8M A;  4DV4 Q;  5C4X G;  3IAY A;  3HKZ E;  4CJ0 B;  3PO3 H;  4JI1 Q;  4BBS B;  3T7A A;  4B08 A;  4M9U A;  3DAA A;  4IWX A;  4JI2 L;  2ES2 A;  2JEB I;  2C35 B;  4WBN F;  5JQG F;  1KAB A;  3ZJY C;  3WOF A;  4IFD H;  2B29 A;  4OHJ A;  5IGE A;  5BR8 Q;  1MD2 D;  4IHJ F;  2A68 D;  1PH3 A;  3BAA A;  2EZV A;  1Q46 A;  3UDX A;  3K58 A;  4GOP B;  1RTO A;  1LV9 A;  5F2D A;  3GTG H;  3BAC A;  1DV1 A;  1GUN A;  4YAK B;  3OW7 A;  4A3F H;  3CP0 A;  3AX6 A;  1E0B A;  3HOU B;  2ENB A;  4IZ8 A;  2H4O A;  4NPS A;  3HB9 A;  2F3V A;  3U54 A;  3VR4 A;  4JCV E;  3TEH B;  4FFP A;  3WWI A;  4R9W A;  3DM3 A;  4KKS A;  2B3G A;  1X6O A;  5JVG 3;  4AQY Q;  3JZ6 A;  3Q22 A;  2IJ0 A;  1IYV A;  2Z0S A;  4GLX A;  3AW8 A;  1BQQ T;  4DKA C;  5KGU A;  2V59 A;  4QMG A;  4JXU A;  1FNW A;  3TN2 A;  1F9P A;  1OTC A;  3PV0 A;  4JI8 Q;  5M5W H;  1UE1 A;  3BYT B;  1YNN D;  3KJO A;  2NTT A;  4DN4 M;  3AFP A;  4IOC A;  1RTN A;  1TWG B;  3T9D A;  1IBL L;  3BVG A;  1TII D;  3HGB A;  3W1B A;  3TY5 A;  1FD7 D;  1UC9 A;  3LGJ A;  1GUS A;  4YHH Q;  3KF8 A;  3UZB A;  1EWI A;  4P75 A;  4DUY L;  2UUA Q;  2HCI A;  2XVS A;  2JA5 H;  1VQK A;  1GVP A;  1MGS A;  2VQF L;  3CC7 A;  3NEM A;  4HMJ A;  4YY3 L;  2R82 A;  4KY5 A;  1PH8 A;  1TY0 A;  1T5X D;  2L1B A;  1HTL D;  3ND8 A;  5DAU A;  1VQF A;  2ZJQ A;  4HSP A;  3UYY A;  1EEF D;  1LTR D;  1RCV D;  4Y52 H;  2CNU A;  4LF4 L;  3NEL A;  4ZQI A;  3MWD A;  1DJR D;  1LT4 D;  5D3D A;  1Y1W H;  3M4Y A;  3L0O A;  4LF7 Q;  2Z4I A;  2PZT A;  4QUF A;  4KHP Q;  3KJP A;  5KYL A;  1Q3L A;  2Y0S E;  5I2Y A;  3S1Q B;  1PFS A;  3JZF A;  1XPO A;  3HS0 C;  5HBR B;  1PV4 A;  2F3I A;  1AFP A;  4DV2 L;  2RQX A;  3BDO A;  4O4J F;  5D1O B;  2I5L X;  1WD1 A;  2BDO A;  4OX9 L;  3HOU H;  2HQE A;  3K5M A;  1U4M A;  1S5D D;  4C56 C;  4DUZ Q;  3ER0 A;  3PQI A;  3JRX A;  3HOY G;  2PYK A;  3HOW B;  1C30 A;  3NK9 A;  1B04 A;  2V1C C;  4PMB A;  4C3J B;  2A69 D;  1SRU A;  5D3I B;  3HKZ B;  2F0K A;  3VYR A;  3NE5 B;  1D5M C;  1D6E C;  1A6X A;  5BWR A;  3FPU B;  2ATW A;  3S9W A;  4J15 A;  4TKO B;  4X3K A;  4DXG A;  2WII B;  4IUV A;  4N9P A;  4HIO A;  1W2B A;  1IBM L;  3I4L A;  5IYC G;  2R7Z B;  5KS8 A;  2NN6 I;  4Z9C B;  2VB3 X;  5I4D A;  3JRW A;  4QF4 A;  2PNR C;  3OUU A;  1DAA A;  3DTG A;  4LF6 Q;  4J6H A;  4P73 A;  3TBI B;  2UXD Q;  4OO1 H;  1HH2 P;  3J80 c;  3CRK C;  3KLR A;  4HCS A;  4R4C A;  2UXC Q;  2JN4 A;  3CRL C;  4OIJ A;  3GTP B;  4JI2 Q;  1XTD A;  4IUN A;  4A3K B;  5K3W A;  3TY9 A;  5I5T A;  3H0G H;  5BWV A;  1EIY B;  3A5U A;  5M3M G;  5JJI A;  1KJ9 A;  3TEK A;  3W3A A;  1I2L A;  2RDF A;  2Z8L A;  3L2P A;  4QUC A;  1TKW B;  4C3I H;  3ERQ A;  2R7L A;  5KND A;  3LNN A;  5C3E G;  1KJI A;  2QGQ A;  2F3W A;  4Q4C A;  1EL0 A;  4K2L A;  2QCP X;  2L4N A;  3UDF A;  1JOO A;  1VQ5 A;  4UCO A;  3R8B A;  4DGZ A;  3MXN B;  1VQC A;  4G7Z C;  4V19 0;  2SOB A;  3D0F A;  4IPG A;  1ENC A;  4C3J H;  1XTC D;  4IPD A;  1JQY D;  2GA4 B;  4RGO S;  1D2B A;  5A35 A;  4UY8 C;  2W71 A;  1AP0 A;  1SDF A;  2YTX A;  4JI0 L;  1B2T A;  4LFC L;  2WAC A;  2KQ3 A;  5KNC A;  3V4Z A;  4IZO A;  2JA8 G;  2F0U A;  4L5T A;  1HUM A;  2Y0S B;  1ZEQ X;  2AWO A;  1PHJ A;  4A3G G;  2D0O A;  1S40 A;  1SBB B;  4P2C B;  3KF6 A;  2R7Z H;  3EJI A;  1W6K A;  1KJJ A;  1N36 Q;  2JA6 H;  2YZM A;  5EZY F;  4NXM Q;  4K14 A;  2VQF Q;  4HN2 A;  4XZ3 B;  5BMV F;  1PYB A;  2XN9 C;  1I4P A;  1CQF A;  1BCP C;  1E2Z A;  1QB5 D;  4HED A;  2EYH A;  4S3S A;  4WHX A;  4LF4 Q;  2LXJ A;  2VUM B;  3KDF A;  1QVF A;  3GTP H;  3PUZ A;  4A3K H;  1HJP A;  2ZXO A;  4DR5 L;  4LAA A;  2H5X A;  1EWC A;  5CV7 A;  4R4O A;  3WOE A;  5IGC A;  4IOA A;  3T9F A;  4OON A;  3STB D;  2XSC A;  3VYU A;  2CW0 C;  3KAL A;  4APV A;  3URY A;  4DV0 Q;  4DV2 Q;  3K5L A;  3S14 B;  2ABJ A;  4RZQ A;  4DR4 L;  4EQN A;  3UZO A;  1ZAU A;  2D0P A;  3T1Y Q;  1VQ6 A;  1D5Z C;  2GVB A;  2EY5 A;  1IL2 A;  3CSW A;  4JI4 L;  1PRT F;  2CHB D;  5JPN C;  2F0F A;  2K5W A;  1AN8 A;  4JI5 L;  1NBW A;  3LQS A;  1HZ9 A;  3OIQ A;  1M0W A;  3RLN A;  1K8O A;  3A54 A;  3KBG A;  1V1P A;  3I55 A;  3BZC A;  3H3V H;  3HOZ G;  2A19 A;  4C2M B;  4LH7 A;  1JOK A;  5JEA J;  3ERO A;  4XYQ A;  1RDP D;  1GUW A;  3AEV A;  3E9H A;  3JAM E;  2P5Z X;  3SDZ A;  2R3Z A;  2B39 A;  4GS3 A;  1KDB A;  1G6P A;  1AZP A;  1KLU D;  2NZH A;  2NU9 B;  1PTO B;  5DNF A;  2HHH Q;  1PH6 A;  1TWC H;  1VS0 A;  4F87 A;  4PNY A;  1SNM A;  1BCP B;  1HR0 Q;  2OXP A;  4GLW A;  3RZD B;  4X3T A;  4LFA L;  5C3E H;  4OWT B;  4LUZ A;  1Q8K A;  2K01 A;  3K0X A;  4XXE A;  3H94 A;  3M9B A;  3I4N G;  3SK4 A;  5BYB A;  2KOL A;  2VUM H;  2PZW A;  2Z02 A;  5IYD G;  4O81 A;  4DR3 L;  3GID A;  4ALP A;  5LP6 F;  4DR1 Q;  1SYD A;  1I1K A;  4N8X 1;  4RWS C;  2C5C A;  1B70 B;  2F4V L;  1AUX A;  1VMP A;  4B3R Q;  1EU4 A;  1E3P A;  3R9R A;  3MXP A;  3AB9 A;  1Q7Y C;  5JVH 3;  5T1G A;  4PZ7 A;  1SE4 A;  4JYA Q;  4NW2 A;  2F0I A;  1W3S A;  1I3Q B;  4F8M A;  4DQN A;  1DM0 B;  1PRT D;  4XIG S;  4RAU C;  1BXT A;  3HEJ A;  3KF8 B;  4O2B F;  3SR1 A;  5BPF A;  3VR6 A;  1WR2 A;  1UEA B;  1FYC A;  5IP9 H;  1B4O A;  4A76 A;  1EFI D;  4DNI A;  4KY6 A;  4TV9 F;  4RA8 A;  5JQW A;  3NSW A;  5AJ3 Q;  1HNZ L;  2IX0 A;  1S68 A;  4KN4 C;  5M5X B;  1IBK L;  4Y7N B;  4XX0 B;  2OEO A;  4LFC Q;  1Q86 C;  4BXX H;  1ENA A;  3HFZ B;  4FXK C;  2Z9H A;  4P71 A;  3MEH A;  1VBG A;  1VQJ A;  3D4W A;  2E76 C;  4O7Y A;  4CJ2 C;  1JIC A;  1FJG L;  5ELN A;  3OHX C;  1EKF A;  4BY1 B;  2K5V A;  3OIP A;  1IYE A;  1KEE A;  3CMA A;  3SE0 A;  1MSH A;  2B2W C;  3PO2 G;  1EZ6 A;  1EFW A;  3KLS X;  2E2H B;  4A3E B;  2K5H A;  1B9M A;  1AEX A;  4DAP A;  2K28 A;  1GOZ A;  4J8Q A;  1FNU A;  1JWM D;  2E74 C;  1WTV A;  4DR5 Q;  4GOP A;  1DIK A;  3LUL A;  1KRS A;  1ESF A;  2RVL A;  1WTX A;  3ICE A;  4NZN A;  1SAP A;  1ESR A;  2EYO A;  1Y8P B;  2RKS A;  3S15 B;  2DLN A;  2Q2I A;  1TQO A;  4K5X A;  5FK9 C;  3J7Y W;  1A8V A;  2YU9 H;  2B2V A;  3ONA B;  5FLX c;  2K6A A;  4DR4 Q;  3KAK A;  4FO2 A;  3K80 C;  4IUR A;  5ELE A;  4DV6 Q;  4QJF A;  1GM5 A;  1ZYR D;  2BCO A;  4JI7 L;  3OWE B;  1KLG D;  2Z6B A;  5C5M A;  3OPO A;  5FNV F;  5DM6 3;  4JI5 Q;  2HVQ A;  5D1P A;  5JJZ A;  1EQQ A;  1C0A A;  1XMO L;  3U4Z A;  3QOL A;  3T13 A;  2JJQ A;  4X64 L;  1YVC A;  3TP7 A;  4RGT A;  4RGN A;  5J39 A;  3J81 c;  1I1M A;  1I1L A;  4KK7 A;  5IYZ F;  1B3A A;  3P75 A;  5BWT A;  3TQT A;  1QVG A;  3K7A B;  1Q82 C;  4FF2 A;  4MZ9 A;  1PH1 A;  2MHV A;  4Y7N H;  4IFD J;  4P72 A;  1I4G A;  3R5X A;  2M2L A;  4C3H H;  1O7Z A;  4ZQ3 A;  3RZO B;  1NCV A;  3IFD A;  3TW7 A;  1LT3 D;  2MJ8 A;  2Z6K A;  4A3L H;  2PI2 A;  1PZJ D;  5FR9 A;  2O5I C;  4FXD A;  5EKL A;  2JA9 A;  4PBC A;  2NUA B;  1BBX C;  4LFA Q;  2VQD A;  3TP5 A;  2W6O A;  2XGT A;  4X65 L;  2EDG A;  2M00 A;  2EJM A;  4KLK A;  3CCE A;  1FGU A;  1DD2 A;  4ZI7 F;  1VQL A;  1HUN A;  4G4K A;  4IUQ A;  4HJ9 A;  2EYM A;  2MP1 A;  2YYA A;  2R92 G;  5BWX A;  2PZU A;  1L1O C;  1O78 A;  3S16 B;  1S5E D;  1LO5 D;  1DYQ A;  4X62 L;  1JB3 A;  2F0L A;  4RFB A;  1GKH A;  5JJL A;  1J5E L;  1SMY D;  4K6N A;  3L9A X;  1QZG A;  5CBA E;  3S1N H;  2YL2 A;  5IT9 c;  1B50 A;  1YHQ A;  5D8D A;  2B2T A;  4DAA A;  2B63 G;  1B8A A;  5JEA H;  5JVL A;  1N32 Q;  1W6J A;  3U50 C;  1A9X A;  2YZN A;  2FJ2 A;  4KKT A;  1KC8 C;  1HNZ Q;  1NY4 A;  1ET0 A;  4CMF A;  3ETJ A;  2K75 A;  3KDF B;  3KLW A;  3K7A H;  2KA7 A;  4O7S A;  4XYM B;  2O2L D;  5I9O A;  2RSN A;  1HHV A;  3CC4 A;  1P16 A;  2HJW A;  1SYE A;  1ET6 A;  2EYF A;  2WAQ G;  3NEN A;  3PCO B;  1HTP A;  1T5E A;  3PO3 G;  5IGD A;  1HFN A;  1E4E B;  5COY A;  1Y1V B;  1M6V A;  2XWJ B;  3GTK B;  1G6Z A;  5BYA A;  4GN5 A;  4IWY A;  4UHV A;  3BZK A;  4IFD G;  1H9S A;  2ZXP A;  4NXN Q;  3T99 A;  1X3E A;  1EY9 A;  2QEX A;  2E2I B;  1C4Q A;  2NU6 B;  2J9G A;  1EWH A;  1JMC A;  4A3F G;  1LAC A;  1B6S A;  2Q2H A;  3IL8 A;  3NBI A;  1S72 A;  5GAE C;  1Z6H A;  3TRZ A;  4FE2 A;  1OBD A;  2X6L A;  3T1H Q;  3A5Z B;  3MVV A;  4LH6 A;  3K57 A;  1TS3 A;  1Q81 C;  4O2D A;  2DUD A;  2ZXR A;  5IWA Q;  2JA7 B;  2BDN A;  1EQR A;  4GKK Q;  3TRE A;  3I4M G;  3S16 H;  3VYT A;  4FGR A;  1CA5 A;  3AFQ A;  1G2T A;  1B1Z A;  3P7J A;  1VBH A;  5HGT A;  2FMM A;  3MXN A;  4JI7 Q;  2A1A A;  2SDF A;  4K6D A;  3U0G A;  1KJ8 A;  3HKS A;  3F2D A;  4DXF A;  1E2W A;  2HUG A;  3OUZ A;  3DEP A;  1PA6 A;  3I4O A;  3GV6 A;  2F0O A;  1XMO Q;  3VR2 A;  4JG2 A;  1I94 Q;  4X64 Q;  1OXS C;  2BA1 A;  1X3P A;  4MV3 A;  1PH4 A;  1DOM A;  3HBL A;  1STH A;  2BA0 A;  3V4S A;  2KCT A;  2WKC A;  1C7Y A;  2JA5 G;  3GTL H;  4DR6 Q;  3P1H A;  1OBG A;  1VQ8 A;  4L5Q A;  1WVL A;  1R4Q B;  4DV1 L;  4LF9 L;  5CM0 A;  5C0X I;  1UE5 A;  4L6T B;  2Q8I B;  3MEF A;  2NYZ D;  3GTK H;  1Y1W G;  1I7L A;  1LTS D;  3ULL A;  2YV5 A;  3T51 B;  2VPQ A;  4A3I H;  2NVX B;  4FFM A;  2DIK A;  4A3M H;  2LXK A;  2GQS A;  1PTO F;  5FJ8 H;  3SNO A;  2UU9 Q;  3HOU G;  2KHI A;  4HMI A;  1E1T A;  1FNV A;  4FDB A;  1YZ6 A;  5FO7 B;  1YNJ D;  3AYH B;  3KLS A;  3RLF A;  3TDQ A;  1Q90 A;  2JA7 H;  1K28 A;  2R7F A;  1Z47 A;  1MSG A;  3GTO H;  2GVA A;  3NQI A;  4FVM A;  5C3X A;  1QNK A;  5K36 H;  1PH2 A;  4LFB L;  1SMX A;  5FO8 B;  2VL6 A;  2ODT X;  5ELB A;  1GJX A;  1G29 1;  2FXQ A;  1VQE A;  4LNQ A;  1KNA A;  2ICI A;  4JVZ A;  4V0B A;  2DWC A;  2QF7 A;  3EQL C;  1BBU A;  4I50 F;  4B3M L;  4BBR H;  4A3D H;  3DF7 A;  1EY5 A;  4A3C H;  2GPW A;  1SCU B;  4POF A;  1BO0 A;  5C4Z A;  5C4J B;  1CA6 A;  3CME A;  5LYJ F;  5E25 A;  1ICW A;  1TS2 A;  1PFM A;  4OO1 G;  4DPG A;  5J3B A;  1A3T A;  3AU7 A;  2CCZ A;  3J7A V;  4R4Q A;  4JBM A;  3N8D A;  1KBL A;  2BE5 C;  2KUM A;  1GSH A;  4MNO A;  1EIG A;  1CHQ D;  4MA0 A;  4EX5 A;  4MHE A;  3PIP A;  1VQM A;  3H0G G;  1WD0 A;  1BUV T;  3I4M H;  3J80 E;  4DV5 L;  4O86 A;  4TVA B;  3T9E A;  1Y69 U;  4TSS A;  1PTO D;  4C3I G;  5I60 A;  1SE3 A;  3T4A C;  3PUW A;  4F7X A;  1ILP A;  1BCP D;  2ZJP A;  5LMU L;  3H6M A;  1WCM H;  4LMQ D;  4FYD A;  3K8A A;  1RL2 A;  4K6L A;  3SHL A;  3QWU A;  3KK7 A;  3PSI A;  3E3X A;  4A4I A;  4O7L A;  5JVD F;  3A8J E;  5DM7 3;  1M1K C;  2K5N A;  1DV2 A;  4MV7 A;  4BA2 I;  4C3J G;  2E2J H;  3S2H B;  3HKZ G;  2F0M A;  4YBZ B;  2DAB A;  1O80 A;  4DRF A;  5C4X B;  3J80 i;  4JI3 Q;  3TZU A;  1J8I A;  2R85 A;  4DR2 L;  1OXT A;  2MGS A;  4BBS H;  4MA5 A;  1KUT A;  3ERS X;  1JDB B;  2PBZ A;  5CB4 F;  2R7Z G;  3NBZ B;  4M1U B;  2JA6 G;  1Z2O X;  5C4J H;  2A5H A;  4DV1 Q;  4LF9 Q;  3SEB A;  4X3U A;  1SXT A;  3M4O B;  3MA2 B;  3TZD A;  5T1I A;  3V2T A;  2PO4 A;  4HAE A;  1I2K A;  4H13 C;  1A48 A;  1LTG D;  5C8Y F;  1L0Y B;  1SND A;  1V1Q A;  4GLV B;  5FOB B;  4QGU A;  3ULP A;  4A3K G;  4DK1 A;  1JJG A;  1VQG A;  1QG7 A;  4FFO A;  4G7O C;  2PN1 A;  1I4X A;  2VW9 A;  4QIW E;  1YJ9 A;  2PQA B;  1HQR D;  2F0S A;  4J1M A;  2K32 A;  1CTM A;  1MI2 A;  1PFB A;  5EGT A;  4HTP A;  1B44 D;  3W5O A;  3K0Y A;  1U9R A;  2IL8 A;  2FMC A;  3GD7 A;  1TWG H;  2N3S A;  2A1H A;  5ISR A;  3OTO Q;  4UPA A;  2D2C C;  1F2M A;  3VA7 A;  1D7Q A;  4HJ7 A;  3R5F A;  5DIS C;  2EPB A;  2QB5 A;  4LK1 C;  3B6Y A;  4LFB Q;  1KAW A;  2MFI A;  4ZK9 B;  1WRV A;  3JAM L;  1FL0 A;  1QUQ B;  2Z4H A;  5C44 B;  3QO2 A;  2WIN B;  3S2H H;  3U58 A;  1DON A;  1CI3 M;  5CYU A;  3QIA A;  4ZUI A;  1Q1B A;  1SYF A;  3HT5 A;  4O7N A;  4OIK A;  1H9S B;  3GLK A;  3CCL A;  2K50 A;  5LL6 S;  3JSL A;  3NWS A;  1R9T B;  1YHB A;  2Y0S G;  1K0R A;  3VDY A;  3CAM A;  1LTB D;  3CQZ B;  4K8I A;  4OEL B;  3PFF A;  2Z1C A;  3TII A;  1TS4 A;  1EKP A;  5H1S E;  4MIU A;  4O0A A;  3S1Q H;  2KEN A;  1XPU A;  3BA8 A;  2NN6 H;  3QFF A;  3PF4 A;  5CV9 A;  4CKE A;  4I7A A;  3U9S A;  5I47 A;  2A6E C;  1SE2 A;  5HY6 A;  2VUM G;  3HOY B;  4PQX A;  2B2U C;  4FNF A;  1DCZ A;  3HOW H;  3BVZ A;  3ND9 A;  2R86 A;  3A8K E;  5BWU A;  3S1R B;  1SNQ A;  4IJH A;  1JDE A;  4GN4 B;  1VQH A;  3WO0 A;  1JKJ B;  1GSA A;  2K04 A;  4UDU C;  1GUO A;  4JK1 C;  1H9R A;  3EBE A;  2QW7 A;  5J22 A;  4PZ8 A;  1SFO B;  2M9V A;  2IY5 B;  4F88 A;  3PUX A;  1JOQ A;  4PMW A;  1JLL B;  4GN3 B;  1FVI A;  2YTV A;  1E1O A;  1VQ7 A;  1IBL Q;  3Q6S A;  3V05 A;  1VQN A;  2R7D A;  1PZK D;  2Q8T A;  4DU9 A;  2WP8 J;  5IP9 G;  4DUY Q;  1BR9 A;  3DLL A;  1NTG A;  2A68 C;  3HP3 A;  2FB9 A;  4YY3 Q;  5C44 H;  2N49 A;  2DN8 A;  3DXJ C;  3CC2 A;  1Y8O B;  2NVT B;  2X69 A;  4BXX G;  4DR2 Q;  4LF8 L;  5IOD A;  3MJF A;  5M3F B;  5I2X A;  2VQE L;  4X3S A;  1RJT A;  1SNO A;  2K1B A;  1R9T H;  4QIW B;  1EHI A;  4RGM A;  4FP5 D;  3CQZ H;  5M3M B;  1U4R A;  2KVM A;  4A93 B;  3K5N A;  2HVR A;  2J4X A;  3PF5 A;  3M4Q A;  1U4L A;  4EFB A;  3KUP A;  1E4E A;  4CGY B;  2B8F A;  2Q2U A;  4OX9 Q;  3A0J A;  5LA6 F;  1YNN C;  1EY4 A;  2HHF A;  3RLO A;  3CXC A;  4OWX B;  4O7W A;  2HDL A;  1SNC A;  3HOV B;  3T16 A;  1SE8 A;  3GQB A;  3A7A B;  5E3F A;  4MN3 A;  1LTL A;  4LW1 A;  4HQ6 A;  2SNM A;  2DZD A;  4RCN A;  1HXY D;  3M3Y B;  1DZ1 A;  2WB1 G;  2NB0 A;  1L1O A;  2OQK A;  3KRE A;  1A15 A;  1EUD B;  3T54 A;  3NWT A;  4HJ8 A;  1SFO H;  4GKJ L;  1NSN S;  1IBM Q;  2JA8 B;  1A3G A;  3FHW A;  2KEE A;  4RCO A;  4DV3 L;  1IKM A;  4KV6 A;  2UXB L;  4EQO A;  4JI6 L;  5BN4 A;  1TWH B;  3HRZ C;  4IIJ F;  1SR3 A;  2BH8 A;  5FLX E;  1I5F A;  2PW7 A;  4BY7 B;  2F0G A;  3M7G A;  4CHT B;  1BKB A;  1EYA A;  1S3O A;  4HNT A;  1U5K A;  4YCW A;  2CNQ A;  4XYO A;  1CUK A;  2V58 A;  1DXM A;  3OOC A;  2NVT H;  2EIF A;  4CDD C;  1L0W A;  4C3H G;  5M3F H;  1GHK A;  3J7A 5;  2RSO A;  1I4Q A;  3J81 E;  2CVR A;  5GAH C;  4A3L G;  1WTR A;  1J9O A;  1TWF B;  1A3V A;  4TVI A;  1X65 A;  4A93 H;  4CJ1 B;  3JAM i;  1BVS A;  3RFC A;  3BDC A;  2EY2 A;  4TM5 A;  2A69 C;  2PCF B;  2F0N A;  5EAY A;  1JC7 A;  1BNZ A;  1T36 A;  3S14 H;  2HGW A;  2K03 A;  3EFX D;  1EYZ A;  2ZM6 L;  3BU2 A;  3HOV H;  1V9P A;  1Z9F A;  2C00 A;  3NP8 A;  3QWN A;  1PLF A;  1KXL A;  3ORR A;  1OXV A;  1STG A;  4LWC A;  2DNC A;  4B3S L;  4JOI A;  4RHS A;  4UP9 A;  4A3B B;  1K8G A;  3BYY B;  3F1Z A;  3I70 A;  3HOZ B;  3M3Y H;  2SCU B;  3J81 i;  1UC8 A;  4C2M H;  3X3M A;  4IQZ A;  1C8C A;  4JI0 Q;  3K5H A;  3KAJ A;  4O4I F;  2XD4 A;  4HID A;  4B9X A;  3DMU A;  4CKC A;  1A0G A;  3IFT A;  4WJW A;  4XDX A;  1TWH H;  2A6H D;  5LMN W;  2CNV A;  3BAB A;  1ONL A;  4A3J B;  3RD4 A;  5JEA G;  1YBY A;  1IZ6 A;  3R2T A;  4Q0F A;  4FFN A;  4ODG A;  1PTO H;  2R6G A;  4WOR A;  3Q24 A;  2IT1 A;  4BY7 H;  5IGB A;  1AW7 A;  3OMG A;  2YZG A;  3VOT A;  3RZD H;  1I6H B;  1IW7 C;  5C3W A;  5IT9 E;  2L55 A;  1PZI D;  4POG A;  3I4N B;  2E75 C;  3LWE A;  1UUP A;  1F2Z A;  1PH9 A;  4HSV A;  3K5O A;  3BA9 A;  1F9S A;  2QDB A;  4E4T A;  4YJ3 F;  2NWG A;  4C1N K;  1TWA B;  1TWF H;  1I4H A;  4KY7 A;  5DAA A;  1B6R A;  3C2P A;  4YIJ A;  1N8R C;  1WTH A;  4MV8 A;  5CE8 A;  5FO9 B;  4I55 F;  2HIX A;  1II3 A;  5EQ0 A;  4IJL A;  2I8C A;  2RCF A;  1AZQ A;  1R4P B;  1CZW A;  1MBY A;  5I6W A;  3K5I A;  4UP7 A;  1I3Q H;  2AQ2 B;  2FPP B;  4JI4 Q;  5I5U A;  2VUG A;  1GUG A;  3UI2 A;  2L12 A;  4XTC S;  3C3L A;  1YIT A;  2MQH A;  3NBY B;  3G8D A;  4UFZ A;  3BZD B;  2NZ1 D;  2ZTC A;  5KX5 F;  4A75 A;  4A3B H;  4YWL A;  1XMQ L;  2E5L L;  5ELF A;  5M5X H;  4N9T A;  5CBE E;  2N78 A;  5NUC A;  2W70 A;  1VCI A;  3CCJ A;  4MAM A;  5E1F A;  4X66 L;  4JI6 Q;  4R8N A;  2F1M A;  2WFW A;  2EOT A;  2NVQ B;  2OCE A;  4MV6 A;  4BY1 H;  4A3J H;  2I0Q A;  2EYJ A;  4XT1 B;  2CQO A;  5EPJ A;  3STB C;  1STN A;  4KJN A;  4DLK A;  3H91 A;  5LXT F;  3D4D A;  5EPK A;  4C1N I;  2DJG C;  1KQS A;  1B9N A;  1CHP D;  1A2T A;  4DV7 L;  2PMZ E;  3PO2 B;  4DR7 L;  1PMR A;  4PZ6 A;  4U67 3;  5JJK A;  1KTA A;  4GNX C;  2E8G A;  2E2H H;  3DM1 A;  4A3E H;  5C1P A;  2VR1 A;  2XIW A;  5CR5 A;  4DR3 Q;  2BOS A;  1N33 L;  4KI0 A;  2EVB A;  2HDM A;  2F4V Q;  2R84 A;  5DGI A;  1VQP A;  2EY6 A;  3S15 H;  3DWP A;  3RV4 A;  5EJW A;  4MTK A;  2AUK A;  3GTM B;  1E22 A;  1EY6 A;  3MTS A;  4PV1 C;  5E4W C;  5FLM H;  2YTY A;  4A3I G;  4IAL A;  2LKV A;  4DNR B;  4ZAI A;  2ZM6 Q;  4A3M G;  3BS1 A;  3TW6 A;  5FJ8 G;  3TSS A;  5BN3 A;  1EEI D;  5M9O A;  1ET9 A;  3E6Z X;  4PMC A;  2PQA A;  1N34 L;  4L8J A;  4NKL A;  5BPH A;  2CQA A;  4B3S Q;  1CT1 D;  2KCM A;  2GN5 A;  4MTN A;  3E5S A;  2JA7 G;  1IOW A;  5EKK A;  4WJ4 A;  1NR2 A;  2XWB B;  1IBK Q;  2HIV A;  3CD6 A;  5K36 G;  2PPB C;  2RBM A;  3LWU A;  5GAG C;  1QVC A;  4OL7 A;  3UE1 A;  3U9T A;  5TSS A;  1CFM A;  1PK8 A;  4EG0 A;  3DWA A;  1VDZ A;  2C9O A;  4DV4 L;  3RZO H;  4O2A F;  1QUQ A;  1EQT A;  1FJG Q;  1EYD A;  2NVQ H;  4JI1 L;  2EIY A;  4TUY F;  4O4L F;  3A7L A;  4BBR G;  3PGZ A;  4A3D G;  2HHF B;  1SLJ A;  2B2Y C;  4A3C G;  3Q8D A;  5BR8 L;  1I6V C;  5JAV A;  2EXZ A;  1O7Y A;  2TMP A;  4DF7 A;  2IP4 A;  3HOX B;  5CA1 F;  4L63 B;  4DFA A;  1PRT C;  4EQP A;  3RNU A;  5IP7 H;  3U9O A;  1GD7 A;  4CBV A;  2COG A;  4KMU C;  3J80 L;  2P0A A;  1L2F A;  2JYO A;  1L1O B;  1S5C D;  2F0H A;  4DNT B;  2R92 B;  3VNN A;  1E2V A;  1WYD A;  2F0D A;  5E4X A;  4AYB G;  4AQY L;  4WJ3 M;  3X3N A;  4WFN 3;  2VZA A;  2WKD A;  3OMC A;  5LOV F;  1BDO A;  2DJF C;  1V43 A;  4ME3 A;  1ILQ A;  1S4Z A;  3KBX A;  5LHY 1;  4ZOL F;  3MWY W;  1BXR A;  1IOV A;  4JI8 L;  1A63 A;  1RHP A;  2V4D A;  3LP8 A;  1WCM G;  1YI2 A;  1IXR A;  5IYB H;  5CC4 A;  1X3G A;  4ULL A;  4HN7 A;  2X6G A;  2CFM A;  4XQN A;  2PMZ B;  3I73 A;  3KFU A;  4FU0 A;  1XMQ Q;  1F77 A;  1Z2N X;  4RHR A;  4YHH L;  3I56 A;  1XJV A;  3JSN A;  1A3U A;  3G8C A;  2W6Q A;  1MJC A;  2UUA L;  2Q8R E;  5CA0 F;  1O7I A;  4Y8V B;  2XTI A;  1IYD A;  4C5A A;  4NZO A;  4ID6 A;  2VXW A;  4B9W A;  3PO3 B;  3VR5 A;  2EJ3 A;  4BBS G;  3RV3 A;  5KEE A;  5KRU A;  1Y1V H;  5JOB A;  4ZHQ F;  1PYS B;  2ZTE A;  2NUC A;  1BOS A;  2EYP A;  1K83 B;  3HO8 A;  1JJ2 A;  1VQB A;  2MNA A;  4KHP L;  5DLQ E;  3CKI B;  3SK6 A;  5J2U F;  2LY7 A;  2E2I H;  4FF1 A;  1Z2P X;  4DR7 Q;  4EEQ A;  4K5W A;  4X65 Q;  4AH6 A;  3F2C A;  3IRB A;  1NAP A;  3NTH A;  1FR3 A;  1MIU A;  2COI A;  1SRO A;  4A3F B;  1HZC A;  3HOX H;  3WWV A;  1H9K A;  4GOP C;  2TSS A;  4E6I A;  1BCP F;  3Q1K A;  3FRP B;  2YZL A;  4R4I A;  3NTK A;  1IL8 A;  2RHS B;  1M90 C;  1LT6 D;  3K3P A;  1EUC B;  4EVO A;  3CEB A;  4XT3 B;  4Q5V A;  5C0X H;  3NUC A;  2RDG A;  3D6W A;  1PX2 A;  4P74 A;  3TQY A;  4DAM A;  4UCV A;  3SGI A;  4X62 Q;  3RUP A;  1J5E Q;  3I72 A;  1SJE D;  1CQV A;  2F03 A;  4UUG A;  3E5N A;  2A6E D;  4ZCK A;  3KOJ A;  4IFD I;  2YWV A;  5I9P A;  1N34 Q;  5I5W A;  5IOC A;  2XCL A;  1G2W A;  3SK5 A;  3U55 A;  2K14 A;  1C9O A;  3FKI B;  3SK8 A;  4RKL A;  4OGQ C;  2OQ0 A;  4M8A A;  4LF6 L;  1F9Q A;  2UXD L;  4O7V A;  3GP7 A;  2Z6K C;  1LLR D;  3K6O A;  1I50 B;  2NZO A;  1J6Q A;  4H02 A;  2UXC L;  2KBN A;  3O13 A;  4YJ2 F;  2CKZ B;  2R93 B;  1Y1W B;  3LWB A;  4FF4 A;  1PDQ A;  1K83 H;  1DOK A;  2O5J C;  1KDC A;  5HGQ A;  5I5V A;  2AHO B;  2NVX H;  3PIO 3;  3R5H A;  2NN6 G;  2CWA A;  5AFW A;  1X55 A;  3Q0A A;  1GHJ A;  1IYJ B;  2N8N A;  3DEO A;  1MJE A;  1G8Z D;  1X3F A;  1TU2 B;  2K4K A;  1SMY C;  3H15 A;  1UEB A;  2K05 A;  1UE6 A;  4KD3 A;  3QQM A;  2HGX A;  3UDG A;  4EGV A;  3HOW G;  3I8Z A;  3CPW A;  2RHQ B;  3R93 A;  4IO9 A;  4HIK A;  1WTW A;  1LTT D;  2PVP A;  4O7T A;  2KED A;  4KD4 A;  2CW0 D;  3OW2 A;  1JWU D;  2BH2 A;  5C5L A;  2JQO A;  4DK6 C;  1QJO A;  5FKA C;  3L7Z C;  2D62 A;  2KHS A;  1STA A;  2H1E A;  4O4H F;  2EJF C;  1A2U A;  2B2T C;  1KRT A;  2Q2T A;  2AQ3 B;  2IHF A;  4NDX A;  4FXG C;  3FVQ A;  1XXG A;  1SSO A;  1EUJ A;  3S17 B;  5E7N A;  1N36 L;  1UAP A;  1YHA A;  3FKI H;  3NTI A;  2L5T A;  3WWH A;  1NMG A;  4ZRZ A;  4NXM L;  5M5Y B;  2YW2 A;  5C44 G;  4JBJ A;  1ZXT A;  4HR7 A;  2JP1 A;  4G57 A;  1QIL A;  2RA4 A;  1S5F D;  1I50 H;  4CDF C;  2K52 A;  4IUU A;  3DHQ A;  2HD3 A;  4R1J A;  3T56 B;  4TQU S;  2DGY A;  2R93 H;  5J1Z A;  1HFG A;  3H0G B;  1LYL A;  2ZT9 C;  3C46 A;  2G5D A;  2QKI C;  3CF5 A;  1K3R A;  3DUZ A;  4C3I B;  3VR3 A;  3L3O C;  2L9H A;  4LUO A;  4DV0 L;  4CMD A;  3T9C A;  1M8A A;  3GB8 B;  4JV5 L;  1SJH D;  3TIN A;  3T1Y L;  4YCU A;  5A2Q E;  1PXU A;  5H80 A;  2V5A A;  4OWW B;  1HR0 W;  3TY8 A;  2AKW B;  4OO1 I;  1QNU A;  5EBD A;  2EY1 A;  4I4T F;  1LM0 A;  2UUC L;  3GTJ B;  4JC0 A;  1U4P A;  5CV8 A;  1MHW C;  5BN5 A;  4UAI A;  1QWY A;  3H3V C;  3NPP A;  2KEC A;  1V1O A;  3VPD A;  5C4X H;  2SNS A;  1JE5 A;  3FP9 A;  5FPO A;  2MUY A;  5FLX L;  4HIM A;  2KHJ A;  3P20 A;  2JK8 A;  1AH9 A;  4B3M Q;  1EYG A;  4NP5 A;  4FFR A;  1DGS A;  2DY7 A;  3S17 H;  2JA6 B;  1TY2 A;  2RF4 A;  3I3C A;  2HHH L;  3TP8 A;  1G2S A;  1GUT A;  1KTK A;  1VQI A;  5CV6 A;  2IX3 A;  4FF3 A;  3D4R A;  5M5Y H;  1HR0 L;  1EZ1 A;  1XPR A;  4U68 A;  3W2D A;  3J81 L;  3M4O H;  4C5B A;  1S5B D;  4UP8 A;  2B2W A;  2IX1 A;  4CHI A;  1CKN A;  5M3F G;  3F2B A;  1I7N A;  4NZM A;  1YNJ C;  4M0J A;  4DR1 L;  3ITP A;  2K5Q A;  2A73 B;  2FHT A;  3R2I A;  4DV5 Q;  3D31 A;  1TS5 A;  4A93 G;  1K73 C;  1KNE A;  1WTO A;  3UE0 A;  1WTQ A;  1KC7 A;  4B3R L;  2YS6 A;  1VQ9 A;  1EY8 A;  4ZUJ A;  1A62 A;  4PG3 A;  2DAA A;  1E7Z A;  4CC5 A;  2OT2 A;  4ZLT F;  1CSQ A;  1IW7 D;  4LUV A;  1YNX A;  1LTI D;  3W1G A;  5LMU Q;  4JYA L;  3Q23 A;  2L0C A;  3MHB A;  1KDA A;  1IKL A;  1WJJ A;  3NC0 B;  1SEB D;  3I2Z A;  2D9U A;  2QA4 A;  1BNC A;  3HOV G;  1SYC A;  2A8V A;  5KNB A;  2AUJ D;  4IN3 A;  1HNX L;  1UE7 A;  1IHZ A;  2QK4 A;  1YJW A;  3WNZ A;  3A74 A;  1TAE A;  1RD9 D;  4HJA A;  4DIM A;  3GTJ H;  2MO0 A;  4AIM A;  5AJ3 L;  2NVY B;  5EKI A;  5CMD A;  4R4T A;  1F2L A;  3G71 A;  2WB1 E;  4N8F A;  3NHH A;  4XQJ A;  2DY8 A;  1NNX A;  5ELD A;  4CE5 A;  2G9D A;  1GO3 E;  1SNP A;  4H0L C;  3RUZ A;  2ZGI A;  3R23 A;  1EQV A;  2EE1 A;  2K33 A;  1CM9 A;  1HZA A;  2NBF A;  3UFX B;  1LAB A;  1W96 A;  1TWC B;  5IT9 L;  4BY7 G;  1EKV A;  4QCL A;  2ZDQ A;  1PTO C;  5FPR A;  1HNW L;  2PNH A;  5CR3 A;  1KJQ A;  5C3E B;  3MC0 B;  5C1O A;  3BVM A;  4CDE C;  1TR5 A;  1QE6 A;  2F4I A;  3F2U A;  1JWS D;  2XRS D;  3HOY H;  2I46 A;  4IPH A;  4GNX A;  5EPL A;  5CGK A;  3JC6 6;  1WOC A;  2VS1 A;  4O1N A;  3H3V I;  3T9B A;  2FIN B;  1JR0 D;  3M4P A;  3MWE A;  1XX8 A;  3GV3 A;  3S1R H;  2VB2 X;  1ENF A;  1GGO A;  4KKU A;  2QIL A;  1N9W A;  4OXP A;  5BWW A;  4JV5 Q;  1H95 A;  1AUV A;  4UCU A;  4DV6 L;  2RDH A;  3G7L A;  2ZTD A;  5IIF A;  4B3T L;  1VKZ A;  4A3G B;  3GJX B;  3PUV A;  2VNU D;  5GQO A;  3WO1 A;  2EJG C;  5IYC H;  3WWJ A;  1PFN A;  1VQA A;  5IGG A;  1QCB D;  3I91 A;  1H9M A;  1VQ4 A;  1TT2 A;  1XK5 A;  1Q12 A;  2WV6 D;  2R7N A;  2KJX A;  2AQ1 B;  2UUC Q;  1QZH A;  4A3B G;  3N52 A;  3PIO A;  2CZG A;  2GLT A;  1YEZ A;  4BA1 I;  3CCV A;  2EJ0 A;  2NVY H;  4LF5 L;  1I4R A;  3U4V A;  2YRX A;  1TXY A;  2ICE C;  4O83 A;  1ICF B;  2UUB L;  4IUT A;  4O7Z A;  2WYO A;  3NBH A;  4QL5 A;  3ZYY X;  3DWQ A;  3EIV A;  2NTS A;  2XNA C;  5M3M H;  1PVO A;  4BY1 G;  4A3J G;  1VMC A;  1C48 A;  1IYU A;  3QG1 A;  1NR4 A;  1OXU A;  2F0J A;  2LFN A;  2B2Y A;  2RCN A;  3GDE A;  1RIP A;  2B8G A;  4YWK A;  2VY3 A;  3WDN A;  4ZKC B;  1L0X B;  3AMU A;  2MPM A;  4GLA C;  4A3E G;  1WTP A;  3EVQ A;  4O42 A;  2I5M X;  4UCT A;  2E2D C;  4YWM A;  3E0E A;  4H44 C;  5KKN B;  1CE8 A;  2COJ A;  2DNE A;  2OLS A;  1X56 A;  2ZJR A;  3ULJ A;  4NMZ A;  2YU9 B;  2WB1 B;  4JPB W;  3VPB A;  4K5V A;  1D8L A;  2FPI B;  5FLM G;  1JCK B;  4MV1 A;  5CV5 A;  3PMF A;  2J7Z A;  1UWV A;  1JB7 A;  2F0P A;  4C5C A;  1XNQ L;  4BWG B;  2JA8 H;  5DGH A;  3JZI A;  3AQQ A;  3OSO A;  4A3G H;  1XDN A;  1X3Q A;  1CQI B;  1ZKO A;  4DAY A;  1HNX Q;  3V96 A;  5JPM C;  1ML0 D;  4HR7 B;  3SVM A;  3BG3 A;  1EIF A;  4ABN A;  4DK3 C;  1VQO A;  1N32 L;  3VPC A;  3CCQ A;  4DA2 A;  3T9A A;  2OF1 A;  4X6A H;  2YS7 A;  3E0J A;  2OTL A;  3RR5 A;  2MO1 A;  3CCU A;  1EOV A;  3UDI A;  4LF8 Q;  3BJU A;  4C3H B;  1MKH A;  1SYB A;  2VQE Q;  4O82 A;  2CWP A;  3M7N A;  4WRD A;  5JH7 F;  4YAJ B;  2FP4 B;  3D8G A;  3K7U C;  1D1K A;  1E24 A;  4BS9 A;  5LL6 X;  4EGJ A;  4RG1 A;  1KL9 A;  2Y4R A;  3CU7 A;  4NXN L;  2R7M A;  3QJY A;  1H9J A;  1HNW Q;  3C1F A;  3BG5 A;  5LMN L;  3VMM A;  4UCR A;  4UCS A;  2EJ2 A;  3J81 j;  2F0Q A;  1AE2 A;  5C0X J;  2ASB A;  1G91 A;  5EBC A;  1STY A;  1Y8N B;  2HQL A;  4HNU A;  1NMF A;  3TIG A;  2ID0 A;  3CW2 C;  5IP7 G;  1KHI A;  2YYZ A;  1WFQ A;  4K0K L;  4JW0 A;  2N55 A;  3JAM c;  1ULZ A;  3T1H L;  4EQ5 A;  3FEW X;  2OTJ A;  4ME6 A;  4KHZ A;  4GZY C;  2W6N A;  5DMX A;  2Q7D A;  2X0S A;  5IWA L;  1G51 A;  4GKK L;  1O7L A;  4KTA A;  3RN2 A;  4QB4 A;  1EY0 A;  3A55 A;  3HOZ H;  4YB8 B;  3CCR A;  1X9N A;  4GKJ Q;  5I5Y A;  4YCV A;  2EQS A;  4KHV A;  4RKB A;  1XWE A;  4O7R A;  1C3O A;  4MV9 A;  4XYL B;  4QSH A;  4B3T Q;  4DV3 Q;  4XQQ A;  2IPK D;  2UXB Q;  2ZDG A;  3S1N B;  2LS0 1;  1YIJ A;  3OYY A;  5IYB G;  2HG8 A;  1XNR L;  2JEA I;  1EZ8 A;  1TVX A;  1EOT A;  4ILW A;  5K5P A;  4KJO A;  1B53 A;  5L37 A;  1I94 L;  2ALY B;  3PIP 3;  1TA8 A;  1VF7 A;  2FPG B;  1Z7T A;  1KAA A;  3QB3 A;  1CS0 A;  1CKN B;  3RTX A;  3ORQ A;  3BDL A;  4JBK A;  1I6H H;  2KCC A;  1B7Y B;  1QOH A;  4LF5 Q;  5HV6 A;  5G3L F;  3RMH A;  4DK0 A;  3I4N H;  4DR6 L;  4FFL A;  1NUC A;  2F52 A;  3SXH A;  1K3B C;  3QR8 A;  5I6Y A;  2UUB Q;  4ZKB B;  1CKM A;  1ASY A;  5IYD H;  3GTQ B;  1GXD C;  2JE6 I;  1GLV A;  2F0T A;  3G4S A;  1W93 A;  1PH5 A;  1Y1V G;  1JOR A;  1TWA H;  1K9M C;  2X5R A;  3IKJ A;  2WAQ E;  1WI5 A;  4NB3 A;  5GON F;  1CSP A;  2SEB D;  3MAQ A;  3I12 A;  4H7B A;  2LSS A;  2I07 B;  1VQD A;  2IW3 A;  2QDL A;  2JSO A;  3HOX G;  1SYG A;  5GRO A;  2K5D A;  2UU9 L;  4I65 A;  3CPF A;  3F8T A;  3UQ8 A;  2R87 A;  1F2Y A;  3S2D B;  1KIX A;  5HUR A;  2BE5 D;  5K2M A;  5D1O A;  2LMC B;  3VA5 A;  3NXW A;  2PQE A;  2AMC B;  2JXM B;  5ELC A;  5C0X G;  3S24 A;  2EXD A;  4TRD A;  4EFE A;  4HJ5 A;  1GSO A;  2OWO A;  3C1E A;  3KYH C;  1HZB A;  4AYB E;  5DEH A;  1HPC A;  1RF2 D;  4QQB X;  1XNQ Q;  3KF6 B;  3TP6 A;  3I7F A;  4HNV A;  5CAE B;  3MXG A;  3G6J B;  1SN8 A;  1KT8 A;  1ASZ A;  2I80 A;  1JE4 A;  2IWH A;  5D14 A;  3FDT A;  5I5X A;  2HCC A;  4K2K A;  1P8L A;  3LX0 A;  3PUY A;  2R61 A;  3TS0 A;  1X54 A;  5G3L D;  4GNX B;  3GTL B;  3PO2 H;  2F0W A;  1CK1 A;  3G48 A;  1VF5 C;  4OEM B;  4CKB A;  2EYL A;  3HZX A;  4DAV A;  3GTQ H;  2I87 A;  2PW5 A;  2QEJ C;  2HVS A;  1Y14 B;  1CZG A;  1K0S A;  4CDC C;  5KIX A;  2F0V A;  1FGB D;  4QY7 A;  5LMN Q;  3GTM H;  4A3I B;  5KYI A;  3S1M B;  4A3M B;  5I5S A;  3QOJ A;  1LUZ A;  3TS2 A;  2F0E A;  3A8I E;  3GO5 A;  3J7A F;  1F9R A;  1EY7 A;  1ROD A;  1V1P B;  2G9H D;  5D65 A;  3SE7 A;  4IUP A;  2K7V A;  4K0K Q;  1JJC B;  3S2D H;  4IPC A;  1BBW A;  2A6H C;  2L11 A;  4JOI C;  4R8I A;  2B63 B;  1HRJ A;  2YRW A;  5ELO A;  1LT5 D;  2HGS A;  2W6M A;  3G6E A;  1CQJ B;  1BF4 A;  3E9I A;  2E5L Q;  4LJZ C;  3GTO B;  4ME5 A;  2N88 A;  5HNE A;  2J0T D;  3EN2 A;  3PN1 A;  3RN5 A;  3NBH B;  4CC6 A;  1V8Q A;  3T53 B;  4L5S A;  5IE8 A;  4TV8 F;  4HTO A;  3EA6 A;  2WAQ B;  4X66 Q;  2W6P A;  4JBW A;  3FPP A;  4JI3 L;  1AE3 A;  1M4V A;  2XRQ D;  1XNR Q;  3M85 A;  2O4X A;  1HCZ A;  2NU7 B;  3NUA A;  1RKN A;  3D3R A;  3OWF A;  1STE A;  4BBR B;  2L15 A;  3A56 A;  4A3D B;  1OO9 B;  4LF7 L;  2CH4 W;  2HT1 A;  4MV4 A;  4EGQ A;  5J2T F;  1HA5 A;  1D1I A;  4DV7 Q;  3FKI G;  4HCE A;  2NU8 B;  5CV4 A;  5GAD C;  3J7Z C;  3GTG B;  1PRT B;  2HDK A;  1HQM C;  2A74 C;  3MFY A;  4ZYS A;  1NJI C;  3MFG A;  1ZYR C;  1XYI A;  2R7K A;  4Q4D A;  1HA6 A;  1N33 Q;  1PYW D;  1K8A C;  2W6Z A;  2PI2 E;  3K59 A;  2CH4 A;  4I7Z C;  3CCM A;  1B3Q A;  3CHB D;  2IHE A;  1EYC A;  3CCS A;  4DUZ L;  2R93 G;  4L1K A;  3D6C A;  2R92 H;  1CKO A;  3I90 A;  4HTH A;  2B2V C;  2FFK B;  4AYB B;  3R3O A;  1A0I A;  1DOL A;  3MZ5 A;  2B2U A;  3I4M B;  1EIH A;  3FMC A;  4E6N A;  4RH6 A;  2KCN A;  3DTF A;  2GQR A;  5IGF A;  3NQT A;  3S1M H;  4NYE A;  1X32 A;  3VYS A;  4DAY B;  4G7H C;  1Q8I A;  5M5W B;  1JT8 A;  1Q1E A;  2AWN A;  5C6A A;  5A2Q L;  4L5R C;  1STB A;  4KN7 C;  3H09 A;  4RMF A;  4O84 A;  3HG9 A;  1WCM B; 
#chains in the Genus database with same CATH homology
 4HIM A;  2KHJ A;  1YJN A;  1VQL A;  3J7A 5;  2JK8 A;  4HJ9 A;  1AH9 A;  5GAH C;  4B3M Q;  4A3L G;  1EYG A;  2B63 H;  1DGS A;  1KD1 C;  1PH7 A;  2R92 G;  1X65 A;  1NE3 A;  3OTO L;  4A93 H;  3JAM i;  3S17 H;  1L1O C;  2RF4 A;  1BVS A;  2HHH L;  5IY0 A;  1VQI A;  2I5H A;  5EAY A;  1T9H A;  5M5Y H;  4X62 L;  1HR0 L;  3S14 H;  3K81 C;  1GKH A;  1XPR A;  5JJL A;  1U0L A;  1J5E L;  1OXX K;  2ZM6 L;  3M4O H;  4DV4 Q;  4UP8 A;  2IX1 A;  5C4X G;  3BU2 A;  3HKZ E;  1QZG A;  1CKN A;  1V9P A;  1Z9F A;  4JI1 Q;  5M3F G;  3HOV H;  3S1N H;  3F2B A;  5IT9 c;  1YHQ A;  4JI2 L;  4DR1 L;  1B8A A;  2JEB I;  2ES2 A;  2B63 G;  2C35 B;  1KXL A;  4DV5 Q;  1OXV A;  1N32 Q;  3ZJY C;  2B29 A;  3D31 A;  4LWC A;  3U50 C;  4B3S L;  4JOI A;  4UP9 A;  4A93 G;  1K73 C;  5BR8 Q;  1K8G A;  1KC8 C;  3UE0 A;  1NY4 A;  1HNZ Q;  4B3R L;  3F1Z A;  1PH3 A;  2K75 A;  3KDF B;  3KLW A;  3M3Y H;  1VQ9 A;  3BAA A;  1A62 A;  3K7A H;  1Q46 A;  1E7Z A;  4PG3 A;  3UDX A;  3J81 i;  4GOP B;  4C2M H;  1CSQ A;  3GTG H;  4LUV A;  1YNX A;  4JI0 Q;  3W1G A;  5LMU Q;  4A3F H;  4JYA L;  3CP0 A;  4HID A;  3CC4 A;  1P16 A;  4NPS A;  1WJJ A;  3NC0 B;  3PCO B;  2WAQ G;  3NEN A;  3I2Z A;  4JCV E;  3TEH B;  2QA4 A;  3HOV G;  3PO3 G;  2A8V A;  3DM3 A;  1TWH H;  2B3G A;  5LMN W;  3BAB A;  4GN5 A;  1X6O A;  5JEA G;  1UE7 A;  1YBY A;  1IZ6 A;  4AQY Q;  3BZK A;  1YJW A;  1HNX L;  3A74 A;  4IFD G;  2Z0S A;  4GLX A;  4NXN Q;  2R6G A;  1TAE A;  1X3E A;  2IT1 A;  4BY7 H;  4DKA C;  2QEX A;  4HJA A;  3GTJ H;  2MO0 A;  4AIM A;  5AJ3 L;  3RZD H;  1OTC A;  3PV0 A;  4JI8 Q;  5M5W H;  1JMC A;  4POG A;  1UE1 A;  4A3F G;  4R4T A;  3KJO A;  2Q2H A;  3AFP A;  3G71 A;  2WB1 E;  1S72 A;  1PH9 A;  5GAE C;  3BA9 A;  3TRZ A;  4IOC A;  1IBL L;  3T1H Q;  3A5Z B;  4LH6 A;  1Q81 C;  1GO3 E;  3W1B A;  4O2D A;  3TY5 A;  1TWF H;  2DUD A;  5IWA Q;  3LGJ A;  1EQR A;  1N8R C;  4YHH Q;  3TRE A;  1HZA A;  3I4M G;  4GKK Q;  1EWI A;  4P75 A;  4DUY L;  2UUA Q;  3S16 H;  4BY7 G;  2HIX A;  3AFQ A;  4IJL A;  2JA5 H;  1VQK A;  5FPR A;  1HNW L;  2PNH A;  1GVP A;  2VQF L;  3CC7 A;  3NEM A;  4YY3 L;  4JI7 Q;  1PH8 A;  2A1A A;  4UP7 A;  1I3Q H;  1VQF A;  2ZJQ A;  3HKS A;  3F2D A;  4JI4 Q;  4Y52 H;  2VUG A;  5FPO A;  1PA6 A;  3NEL A;  3I4O A;  4LF4 L;  4GNX A;  4IPH A;  3HOY H;  4XTC S;  1XMO Q;  3JC6 6;  1WOC A;  1YIT A;  2VS1 A;  1Y1W H;  4JG2 A;  1I94 Q;  3L0O A;  2MQH A;  3M4P A;  4X64 Q;  4LF7 Q;  1OXS C;  3H3V I;  3NBY B;  4UFZ A;  4KHP Q;  2BA1 A;  3S1R H;  3KJP A;  2ZTC A;  4A75 A;  2Y0S E;  1PH4 A;  4YWL A;  1XMQ L;  2E5L L;  4A3B H;  1N9W A;  1PFS A;  2BA0 A;  4OXP A;  1XPO A;  1PV4 A;  2KCT A;  5M5X H;  2F3I A;  1C7Y A;  2JA5 G;  3GTL H;  4DR6 Q;  4JV5 Q;  1H95 A;  4DV2 L;  4UCU A;  1VQ8 A;  5D1O B;  4L5Q A;  2I5L X;  4OX9 L;  4DV1 L;  4DV6 L;  4LF9 L;  3HOU H;  2N78 A;  1VCI A;  2ZTD A;  3CCJ A;  4X66 L;  4B3T L;  4JI6 Q;  5C0X I;  3GJX B;  1UE5 A;  2WFW A;  3PUV A;  3ER0 A;  4DUZ Q;  2VNU D;  5GQO A;  3HOY G;  5IYC H;  2OCE A;  3MEF A;  1VQA A;  3GTK H;  1Y1W G;  4BY1 H;  4A3J H;  1VQ4 A;  2I0Q A;  1XK5 A;  3ULL A;  1Q12 A;  2V1C C;  1B04 A;  2CQO A;  2YV5 A;  3STB C;  2UUC Q;  1QZH A;  4A3B G;  1SRU A;  4A3I H;  3PIO A;  1KQS A;  4DV7 L;  2PMZ E;  4DR7 L;  1YEZ A;  4BA1 I;  4PZ6 A;  2LXK A;  3CCV A;  2NVY H;  4A3M H;  5JJK A;  4LF5 L;  5FJ8 H;  4GNX C;  2ATW A;  3U4V A;  2E8G A;  1TXY A;  4J15 A;  2E2H H;  2UU9 Q;  4A3E H;  3HOU G;  2KHI A;  4HIO A;  4DR3 Q;  1W2B A;  1IBM L;  2UUB L;  1E1T A;  1N33 L;  4KI0 A;  4QL5 A;  4FDB A;  5IYC G;  1YZ6 A;  2F4V Q;  3EIV A;  3AYH B;  5M3M H;  1VQP A;  1PVO A;  2NN6 I;  4BY1 G;  3RLF A;  4A3J G;  2JA7 H;  3HOZ G;  3S15 H;  2R7F A;  1Z47 A;  3GTO H;  1OXU A;  2GVA A;  1E22 A;  4LF6 Q;  5FLM H;  4P73 A;  2YTY A;  1PH2 A;  4A3I G;  4LFB L;  2UXD Q;  2RCN A;  3GDE A;  1SMX A;  1HH2 P;  1RIP A;  2VL6 A;  4YWK A;  2VY3 A;  3J80 c;  2ZM6 Q;  4A3M G;  1G29 1;  4R4C A;  2FXQ A;  2UXC Q;  5FJ8 G;  1VQE A;  4LNQ A;  4GLA C;  4A3E G;  4JI2 Q;  2I5M X;  4UCT A;  2PQA A;  1XTD A;  1BBU A;  1N34 L;  4YWM A;  3E0E A;  3TY9 A;  4B3M L;  3H0G H;  4B3S Q;  4BBR H;  3A5U A;  1EIY B;  5M3M G;  4A3D H;  5JJI A;  1X56 A;  2KCM A;  2GN5 A;  4MTN A;  2ZJR A;  2JA7 G;  4A3C H;  3ULJ A;  4WJ4 A;  3L2P A;  4POF A;  1IBK Q;  4C3I H;  1D8L A;  5FLM G;  2HIV A;  3CD6 A;  5K36 G;  3CME A;  5C3E G;  4OO1 G;  4CC5 A;  1UWV A;  2QGQ A;  4DPG A;  5GAG C;  1JB7 A;  1QVC A;  5J3B A;  3UE1 A;  1XNQ L;  2CCZ A;  2JA8 H;  4DV4 L;  3RZO H;  3AQQ A;  4R4Q A;  3UDF A;  1QUQ A;  1VQ5 A;  4JBM A;  4A3G H;  1FJG Q;  1XDN A;  2NVQ H;  4JI1 L;  4UCO A;  1HNX Q;  4MNO A;  3MXN B;  4EX5 A;  1VQM A;  1VQC A;  3PIP A;  3H0G G;  4BBR G;  1EIF A;  3PGZ A;  4DK3 C;  1SLJ A;  1VQO A;  4DV5 L;  3I4M H;  4A3D G;  4A3C G;  4TVA B;  3Q8D A;  1N32 L;  3CCQ A;  5BR8 L;  3D0F A;  4IPG A;  4C3J H;  2OTL A;  4X6A H;  4IPD A;  3RR5 A;  2MO1 A;  3CCU A;  3PUW A;  4UY8 C;  1EOV A;  3UDI A;  2ZJP A;  2YTX A;  3BJU A;  4JI0 L;  4LF8 Q;  4LFC L;  5LMU L;  3RNU A;  1MKH A;  2VQE Q;  1WCM H;  5IP7 H;  2JA8 G;  2CWP A;  1RL2 A;  1GD7 A;  3K8A A;  4L5T A;  3M7N A;  2AWO A;  1PHJ A;  4A3G G;  2D0O A;  1L2F A;  3K7U C;  1S40 A;  1L1O B;  3QWU A;  4A4I A;  3PSI A;  3VNN A;  1E24 A;  3KF6 A;  2R7Z H;  1WYD A;  4RG1 A;  1KL9 A;  4AYB G;  4AQY L;  1N36 Q;  2JA6 H;  1M1K C;  4WJ3 M;  2K5N A;  2VZA A;  4NXN L;  4NXM Q;  1HNW Q;  4BA2 I;  2VQF Q;  2E2J H;  1V43 A;  4ME3 A;  5LMN L;  1FGU A;  3HKZ G;  4UCR A;  1PYB A;  4UCS A;  3J81 j;  1AE2 A;  4JI8 L;  5C0X J;  2ASB A;  1A63 A;  4DRF A;  2HQL A;  1NMF A;  3J80 i;  2ID0 A;  4JI3 Q;  2LXJ A;  4LF4 Q;  4DR2 L;  3CW2 C;  1WCM G;  1OXT A;  3KDF A;  5IP7 G;  1KHI A;  1YI2 A;  1IXR A;  2YYZ A;  1QVF A;  5IYB H;  3PUZ A;  3GTP H;  4BBS H;  1WFQ A;  4K0K L;  1X3G A;  1HJP A;  4A3K H;  3JAM c;  4DR5 L;  3ERS X;  2CFM A;  3T1H L;  2H5X A;  4EQ5 A;  2OTJ A;  4R4O A;  4KHZ A;  3KFU A;  2R7Z G;  4IOA A;  3NBZ B;  5IWA L;  1XMQ Q;  1G51 A;  2JA6 G;  4OON A;  3STB D;  4YHH L;  3I56 A;  3RN2 A;  1XJV A;  4GKK L;  3JSN A;  1MJC A;  4APV A;  2UUA L;  4DV0 Q;  3HOZ H;  4DV2 Q;  5C4J H;  1O7I A;  2XTI A;  1X9N A;  3CCR A;  4GKJ Q;  4DV1 Q;  4YCV A;  2EQS A;  4LF9 Q;  4DR4 L;  2D0P A;  3T1Y Q;  1VQ6 A;  4B3T Q;  4DV3 Q;  2GVB A;  1IL2 A;  2UXB Q;  4JI4 L;  1YIJ A;  1V1Q A;  3OYY A;  4GLV B;  5IYB G;  4QGU A;  1Y1V H;  3ULP A;  1XNR L;  4A3K G;  4JI5 L;  1NBW A;  2JEA I;  1HZ9 A;  1PYS B;  2ZTE A;  3RLN A;  1I94 L;  2ALY B;  1TA8 A;  1JJ2 A;  1VQG A;  1JJG A;  1VQB A;  2MNA A;  4KHP L;  5DLQ E;  2VW9 A;  4QIW E;  2E2I H;  3I55 A;  1CKN B;  3BZC A;  1YJ9 A;  3H3V H;  4DR7 Q;  4EEQ A;  4X65 Q;  4AH6 A;  2A19 A;  2PQA B;  3IRB A;  1B7Y B;  3F2C A;  1MIU A;  5JEA J;  4JBK A;  1SRO A;  4LF5 Q;  1I6H H;  4LH7 A;  1HZC A;  3HOX H;  3I4N H;  3WWV A;  3AEV A;  4DR6 L;  3E9H A;  2F52 A;  4GOP C;  2UUB Q;  4HTP A;  3W5O A;  1CKM A;  1ASY A;  4R4I A;  4GS3 A;  5IYD H;  2JE6 I;  3G4S A;  3GD7 A;  1TWG H;  2N3S A;  1G6P A;  2RHS B;  2NZH A;  1M90 C;  1PH5 A;  1Y1V G;  1TWA H;  4UPA A;  3OTO Q;  1K9M C;  2WAQ E;  1D7Q A;  4HJ7 A;  1WI5 A;  5DIS C;  4NB3 A;  2HHH Q;  4P74 A;  1PH6 A;  3TQY A;  4DAM A;  1CSP A;  3B6Y A;  4UCV A;  1TWC H;  1VS0 A;  1KAW A;  2MFI A;  3SGI A;  4X62 Q;  1HR0 Q;  4LFB Q;  1FL0 A;  1QUQ B;  2LSS A;  1VQD A;  4LFA L;  3S2H H;  3U58 A;  5C3E H;  4OWT B;  1J5E Q;  4LUZ A;  1Q8K A;  1Q1B A;  3K0X A;  3HOX G;  3I4N G;  3M9B A;  5GRO A;  3KOJ A;  2UU9 L;  3CCL A;  2K50 A;  3CPF A;  3F8T A;  2VUM H;  5IYD G;  1N34 Q;  4DR3 L;  4IFD I;  3UQ8 A;  3JSL A;  1KIX A;  4ALP A;  1YHB A;  2Y0S G;  1K0R A;  4DR1 Q;  3VDY A;  3CAM A;  5D1O A;  1B70 B;  2F4V L;  2AMC B;  2K14 A;  5C0X G;  3S24 A;  2EXD A;  4B3R Q;  4EFE A;  1E3P A;  1C9O A;  5H1S E;  4HJ5 A;  1Q7Y C;  4O0A A;  4PZ7 A;  3S1Q H;  2KEN A;  1XPU A;  2OWO A;  3BA8 A;  2OQ0 A;  4LF6 L;  4JYA Q;  3PF4 A;  3KYH C;  1HZB A;  4AYB E;  2UXD L;  4QQB X;  1XNQ Q;  1W3S A;  3KF6 B;  2Z6K C;  3I7F A;  4XIG S;  2NZO A;  1J6Q A;  4H02 A;  2UXC L;  3KF8 B;  1SN8 A;  2KBN A;  5HY6 A;  1ASZ A;  2VUM G;  2CKZ B;  3HOW H;  5IP9 H;  4A76 A;  1K83 H;  4DNI A;  4IJH A;  1P8L A;  4GN4 B;  1VQH A;  5HGQ A;  3PUY A;  5AJ3 Q;  3TS0 A;  1X54 A;  2IX0 A;  2AHO B;  1HNZ L;  4GNX B;  1S68 A;  2NVX H;  1IBK L;  3EBE A;  3PO2 H;  2NN6 G;  3PO3 H;  2CWA A;  4PZ8 A;  1X55 A;  4LFC Q;  2IY5 B;  1Q86 C;  1IYJ B;  2N8N A;  1MJE A;  4BXX H;  3HFZ B;  1X3F A;  2K4K A;  3G48 A;  3PUX A;  4P71 A;  4PMW A;  4GN3 B;  1FVI A;  2YTV A;  3H15 A;  1E1O A;  1UEB A;  1VQ7 A;  1IBL Q;  3GTQ H;  1UE6 A;  1VQJ A;  2HVS A;  3UDG A;  1FJG L;  5ELN A;  1Y14 B;  1VQN A;  2R7D A;  3CPW A;  2RHQ B;  5IP9 G;  2WP8 J;  3HOW G;  4IO9 A;  4HIK A;  4DUY Q;  2K5V A;  3DLL A;  1NTG A;  4QY7 A;  5LMN Q;  3OW2 A;  3GTM H;  2BH2 A;  4YY3 Q;  3CMA A;  5C44 H;  2JQO A;  4DK6 C;  2N49 A;  3PO2 G;  3L7Z C;  3CC2 A;  2D62 A;  1EFW A;  1LUZ A;  4BXX G;  4DR2 Q;  3TS2 A;  4LF8 L;  3GO5 A;  2K5H A;  1KRT A;  2Q2T A;  2IHF A;  4K0K Q;  2VQE L;  1JJC B;  4DR5 Q;  4GOP A;  4IPC A;  1BBW A;  1KRS A;  4JOI C;  1R9T H;  3ICE A;  3S2D H;  3CQZ H;  5ELO A;  1EUJ A;  3G6E A;  2HVR A;  3E9I A;  2Q2I A;  5E7N A;  3M4Q A;  3PF5 A;  2E5L Q;  1A8V A;  1N36 L;  1YHA A;  3FKI H;  4EFB A;  2YU9 H;  3PN1 A;  3EN2 A;  5FLX c;  1NMG A;  4NXM L;  3RN5 A;  3NBH B;  5C44 G;  4JBJ A;  2Q2U A;  4DR4 Q;  4OX9 Q;  3K80 C;  4DV6 Q;  3A0J A;  4QJF A;  1GM5 A;  4CC6 A;  4L5S A;  4BBS G;  5IE8 A;  4HTO A;  4JI7 L;  3RLO A;  3CXC A;  4OWX B;  1I50 H;  4X66 Q;  2K52 A;  4JBW A;  4R1J A;  4JI3 L;  1AE3 A;  1SE8 A;  1XNR Q;  3M85 A;  4TQU S;  4JI5 Q;  2DGY A;  2R93 H;  2HVQ A;  5D1P A;  1EQQ A;  1C0A A;  1LYL A;  1XMO L;  2L15 A;  3U4Z A;  1LTL A;  4LF7 L;  2JJQ A;  4LW1 A;  4X64 L;  1YVC A;  2HT1 A;  3J81 c;  3CF5 A;  1K3R A;  4DV7 Q;  3FKI G;  1QVG A;  2WB1 G;  1Q82 C;  3RTX A;  5GAD C;  3J7Z C;  4LUO A;  4MZ9 A;  1L1O A;  2OQK A;  4Y7N H;  4DV0 L;  1PH1 A;  3GB8 B;  4JV5 L;  1NJI C;  4HJ8 A;  1SFO H;  4P72 A;  4GKJ L;  4IFD J;  4C3H H;  1IBM Q;  3T1Y L;  3FHW A;  1N33 Q;  4YCU A;  4DV3 L;  1K8A C;  2PI2 E;  2Z6K A;  4JI6 L;  4A3L H;  2UXB L;  3CCM A;  2PI2 A;  3CCS A;  1SR3 A;  2IHE A;  2BH8 A;  4DUZ L;  4OWW B;  1HR0 W;  2R93 G;  2R92 H;  1I5F A;  1CKO A;  3TY8 A;  1A0I A;  2AKW B;  2JA9 A;  4OO1 I;  4E6N A;  4LFA Q;  1LM0 A;  1BKB A;  2UUC L;  1S3O A;  1U5K A;  4JC0 A;  3S1M H;  4YCW A;  4DAY B;  1JT8 A;  2XGT A;  4X65 L;  1CUK A;  1Q1E A;  2AWN A;  4L5R C;  2NVT H;  4KLK A;  4RMF A;  2EIF A;  5C4X H;  3CCE A;  1L0W A;  1JE5 A;  3FP9 A;  5M3F H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...