3W1GA

Crystal structure of human dna ligase iv-artemis complex (native)
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
599
structure length
583
Chain Sequence
TSQTVASHVPFADLCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHKDVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTGDFAMIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISITLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKGTKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNEAIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEYVSMDELDILIVGGYWGKGSGMMSHFLCAVAEKPPPSVFHTLSRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILCGTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLEQLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the catalytic region of DNA ligase IV in complex with an artemis fragment sheds light on double-strand break repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords DNA ligase 4
total genus 175
structure length 583
sequence length 599
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF04675 DNA_ligase_A_N DNA ligase N terminus
A PF04679 DNA_ligase_A_C ATP dependent DNA ligase C terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3260.10 Mainly Alpha Orthogonal Bundle DNA ligase i, domain 1 DNA ligase, ATP-dependent, N-terminal domain 3w1gA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3w1gA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3w1gA02
5C0XG 3GB8B 1R9TH 2YV5A 2A8VA 2RHSB 3EN2A 4DV4Q 2F4VL 3W5OA 2PQAB 3RZOH 4DK6C 2OTJA 4IOAA 1B04A 1HZAA 3BU2A 2VQEL 2E8GA 4X62Q 4JC0A 4LNQA 4X66Q 2V1CC 4JI0Q 1PH2A 3BZKA 3I55A 5FJ8G 4A3LG 2JEBI 1I5FA 1XPUA 4IFDG 1EUJA 3CF5A 2WAQG 3KF6A 1UEBA 1HJPA 3UDXA 3HKZE 3HOZG 1K8AC 3KJPA 1BBWA 4A3GH 1EOVA 2GVBA 3BZCA 3D31A 2ZM6Q 1MJEA 1N33L 3CQZH 4IPDA 3TY8A 4B3MQ 1VQ9A 3M4PA 2F3IA 3TY9A 1IBMQ 5AJ3L 2VUMH 3PCOB 3S16H 4X6AH 1GD7A 4A3CH 3RLFA 3GTGH 1KD1C 4JYAL 2K5HA 4DR2Q 1CSPA 4GLAC 5DLQE 1X3FA 2MO1A 1FVIA 3E9HA 2QA4A 1SFOH 4YWMA 4R4CA 1HZBA 4YWKA 1Q12A 2RF4A 4DR1L 1E1TA 4A3DH 2PQAA 2AWNA 3IRBA 1M90C 1MIUA 5C3EG 2NVQH 2LXKA 5JJKA 4JI8L 4UFZA 4LF5Q 3T1YL 5LMUL 1XPRA 1XJVA 2IX0A 2ASBA 2HIVA 1VQOA 4DR2L 3KDFA 2JA6H 2JA9A 4OONA 3K81C 4OX9Q 5GAEC 4YCVA 1SR3A 1IBML 5IP9G 3BJUA 4A3MH 2BH2A 4OXPA 1VQPA 2ATWA 1C0AA 1Q46A 1TWFH 5M3MH 2JJQA 3ULLA 4DUZL 5M5YH 2UUCL 1KL9A 1LTLA 3I4NH 2R6GA 1Q1EA 2HQLA 3PN1A 2BA0A 5E7NA 4JI5Q 4LFBQ 5FLXc 4XTCS 4QL5A 3PUYA 1A62A 1K83H 1TWAH 4LH7A 4C3JH 1LM0A 4X62L 1BVSA 1WCMG 4PZ7A 2Q2TA 3U4VA 1TAEA 1HNZQ 5D1PA 4DUYQ 4PG3A 1Y1VH 1I94L 1MKHA 3I4NG 3SGIA 4A3DG 4NB3A 1O7IA 1EYGA 3TEHB 2NN6G 3GO5A 3NEMA 3I4MG 2K5VA 3E9IA 3ERSX 4DUZQ 3PO2G 4UCTA 2VZAA 3L0OA 4PMWA 4GOPC 4A3IG 4DR3Q 1FL0A 1KQSA 1WI5A 4YCUA 4DV5L 1A0IA 3H3VI 1XNQL 4A3CG 1C9OA 2VNUD 3M9BA 1KRSA 1IBLQ 3CC4A 1N33Q 4BBSG 4BBRG 1TA8A 4UCRA 2JQOA 4Y7NH 2VL6A 2CWAA 1VQAA 4DR5Q 4DV0L 3JSNA 2Q2IA 2YTXA 2YU9H 2ES2A 4MTNA 4GOPA 3HOZH 1OTCA 5JEAJ 3Q8DA 3J7ZC 4DR3L 4BA2I 4LWCA 1YZ6A 1YJNA 2UXBL 1Y1WH 3BABA 3EIVA 3M85A 1YIJA 3RLOA 4UCVA 2OTLA 1FGUA 1VQFA 2F4VQ 4JI7Q 1N36L 4R1JA 4L5TA 5M3FH 1I94Q 3HOYH 4JV5L 5GQOA 3F1ZA 1PYBA 3AFPA 2HT1A 2CWPA 2Z0SA 4QQBX 1PH6A 4UP8A 2CFMA 3ZJYC 5IP7H 4DV1L 4DR5L 2WFWA 1UE6A 4UCUA 4IPGA 1CKNA 4DKAC 3S1MH 4A3JH 4JI5L 5LMNQ 4LFBL 3EBEA 1OXTA 2NVYH 4DV5Q 2ZM6L 2Y0SE 4R4IA 3U4ZA 1PH4A 2OCEA 3CPWA 2UUCQ 3CW2C 4LF6Q 4DRFA 1VQ6A 5IT9c 1XTDA 2PMZE 1Q1BA 3E0EA 3UE0A 4NXML 4LW1A 4P75A 1XMQQ 1HNWQ 3CCUA 1GVPA 4DK3C 2OQ0A 1V43A 2R7DA 2E5LL 3PO2H 2JE6I 2NZHA 1N8RC 1EIYB 1D7QA 2ZJQA 4LH6A 4UY8C 1CUKA 2ID0A 4R4OA 4A3KH 1HR0L 1I6HH 1HR0W 1S3OA 4GN5A 1N36Q 5C44G 3RN2A 1DGSA 3UDIA 5IWAQ 3PUWA 4QIWE 3G6EA 3T1HQ 4LF4L 4NXMQ 1QVFA 4KLKA 4DV7Q 4L5QA 2QGQA 4UPAA 2AWOA 4YY3L 5DISC 2KCMA 3GDEA 4GS3A 4MNOA 4X64L 5C44H 5C4JH 3H0GH 4PZ6A 4GNXA 1RIPA 3AFQA 1J5EQ 1T9HA 4B3SL 2UXCL 5M3MG 3TRZA 2HVQA 4JI3L 4P72A 5D1OB 4HJ7A 2YTYA 4L5RC 3F8TA 1XMOL 2OQKA 1X54A 2Z6KC 1QUQA 4IOCA 1N32Q 4WJ3M 1CKOA 3GTPH 3FP9A 4C3IH 3GTLH 2JEAI 2BH8A 3PUZA 2JK8A 1PH1A 2R7ZG 4JBMA 2L15A 3RZDH 3M4OH 3G48A 2NZOA 2C35B 2K50A 4DV3L 2VQEQ 2MQHA 4DV2Q 3PF5A 1S40A 3KFUA 2Z6KA 2R92H 3HKSA 1G6PA 1VCIA 2UUBQ 1WYDA 2GN5A 2KHJA 4EX5A 4B3TQ 4O2DA 1I3QH 4JV5Q 4R4TA 4X65L 3M3YH 2LXJA 2ZJRA 2A1AA 1CKNB 2PI2A 1M1KC 4HTPA 3KF8B 4GKJL 1P16A 4LFCL 3I56A 1Z9FA 3TQYA 4TQUS 4IFDJ 2DGYA 2KENA 3BAAA 2JA7H 1EIFA 2MO0A 4A3IH 3GTQH 4B3RL 4E6NA 2HIXA 1JJ2A 1XNQQ 3S24A 1FJGQ 4GNXB 2UXCQ 1A63A 3RTXA 1YHAA 1TWGH 2ZJPA 1SLJA 2RHQB 2B3GA 2CKZB 3GTOH 1EFWA 2K75A 4BBSH 1X55A 3VNNA 1W2BA 4YHHL 4BXXG 1Y1WG 1S72A 1KXLA 5ELOA 4OO1I 4KI0A 2BA1A 4GLVB 2YYZA 3A5ZB 2WAQE 1WOCA 1NY4A 2KBNA 3F2DA 4GNXC 4BY7G 1JJGA 1SROA 1KIXA 1MJCA 4JI8Q 5HY6A 2AKWB 3TREA 1OXUA 1Z47A 3F2BA 1D8LA 2R92G 1BKBA 3HFZB 4AYBE 4K0KL 2K4KA 2VQFL 1UWVA 2KCTA 1XMQL 1PH5A 1HNWL 4QY7A 1GKHA 1Q81C 3W1GA 2ZTDA 3L7ZC 1E7ZA 4LFAQ 2UXBQ 4AQYQ 4AH6A 4EFEA 2F52A 2E2HH 2EIFA 1VQ5A 5JJLA 1S68A 3BA9A 1UE1A 3NBYB 4LF9Q 1TWHH 1AE3A 1QUQB 3JAMi 4HIKA 4HJ9A 5IYBH 3DLLA 3FHWA 4A3LH 4A75A 4C2MH 3STBC 5J3BA 5IYDH 1QZGA 4OO1G 4GKKQ 1BBUA 4EFBA 2IT1A 1B70B 4JI1Q 2R7FA 2B63H 3S17H 1VS0A 4JCVE 2WP8J 3OTOQ 4A76A 2UXDL 1J5EL 5M5XH 4CC5A 4IPCA 3GTKH 2EQSA 3CC7A 4B3TL 1L0WA 3S1QH 2MFIA 4GN3B 3UDGA 4UP9A 4UP7A 3WWVA 2ZTCA 1VQGA 3PUVA 1PA6A 1JMCA 3CC2A 3HOWG 1VQCA 1V1QA 4QGUA 1OXSC 1CKMA 1SMXA 2K5NA 2XGTA 2B29A 2R93H 3TS2A 5FLMG 1XNRQ 2IX1A 4JI1L 5JJIA 4JI6Q 3RR5A 4DV0Q 1U0LA 3HOUG 2IHFA 3K0XA 1G291 4NXNL 4P73A 5FPOA 1NJIC 3PF4A 1VQKA 4YHHQ 2VW9A 4DAMA 2WB1G 3STBD 4A3GG 3DM3A 1J6QA 3M4QA 1PVOA 2VS1A 1X6OA 3H15A 2JA6G 3JSLA 4DR6Q 5HGQA 3CP0A 4JI6L 4GKJQ 4XIGS 2YTVA 2Y0SG 5IWAL 4IO9A 4LF4Q 2VQFQ 3S1NH 4OX9L 2CCZA 4LUVA 4K0KQ 1HNZL 4PZ8A 3HOVH 2Q2HA 3CAMA 4HIMA 1HZ9A 3KDFB 2VY3A 4RMFA 1K9MC 1UE5A 4X65Q 5C0XJ 3HOWH 1OXVA 4JI2Q 2KHIA 1K3RA 1X56A 3AQQA 3ER0A 4TVAB 3PGZA 1Y1VG 5IP7G 4JI2L 3S14H 1KAWA 2JA8G 4JBWA 3CCJA 5LMNW 1WCMH 4KHPL 2E2IH 1PH7A 4IPHA 1K8GA 4DR4Q 3I4OA 3CPFA 1SE8A 1VQBA 1AE2A 2K14A 4LUZA 3H3VH 4GKKL 2B63G 3A74A 5IP9H 2UU9Q 2I0QA 3OTOL 5AJ3Q 5GROA 3G71A 3CXCA 3TY5A 4B3ML 4JI3Q 4ME3A 1YJ9A 4B3SQ 1G51A 5FJ8H 2IHEA 1XMOQ 4DV1Q 3KOJA 4KHPQ 4A3EG 5C3EH 4APVA 5C4XH 4DR7Q 1KHIA 4POGA 4A3BG 4FDBA 4LF9L 3ULJA 1GO3E 4HIDA 2PNHA 1KC8C 2GVAA 4DR4L 4A3FH 4A3JG 1VQ4A 2AHOB 4J15A 3CCEA 3CCRA 1XPOA 1HR0Q 2NN6I 1JB7A 1K73C 4DV7L 2Q2UA 3HOUH 3CCMA 3T1HL 1XNRL 3KJOA 1CSQA 3MEFA 3ULPA 2FXQA 1NE3A 4IJLA 4A4IA 1N34L 3KYHC 3JAMc 3PV0A 1E24A 4DUYL 3I4MH 2I5HA 3S1RH 4OWWB 1WJJA 3NELA 3UQ8A 1IXRA 2UUAL 3PO3H 1VQEA 1VQ7A 1LYLA 4QJFA 2H5XA 4KHZA 4BXXH 4LF6L 1QVCA 4P71A 3J80i 3UDFA 1PH8A 1IYJB 1YBYA 1TXYA 4B3RQ 3FKIH 4NPSA 4LF8L 4A3MG 1U5KA 4HJ5A 1PHJA 4POFA 3GTJH 2CQOA 1YITA 1FJGL 1VQHA 1E1OA 1XDNA 4YWLA 4NXNQ 1QZHA 4JBKA 3UE1A 1IL2A 2JA8H 1HNXL 3S2DH 4LF7Q 3VDYA 1AH9A 3I2ZA 2N8NA 3CCQA 4OWTB 4UCOA 2UUBL 4AQYL 1YEZA 4DV6L 5GAGC 1YNXA 4LF5L 1OXXK 3CCLA 5ELNA 2D0OA 3HOXH 3KLWA 1VQDA 3CMAA 1NBWA 3RNUA 4JI7L 2D0PA 4DV2L 1YI2A 4A93G 5IYDG 2HHHL 1Q7YC 3QWUA 5FLMH 2WB1E 3J7A5 3NC0B 1NTGA 5C4XG 2VUMG 3PUXA 3A5UA 3TS0A 2QEXA 3PSIA 1W3SA 1SN8A 1Y14B 1E22A 1LUZA 1HNXQ 1ASZA 2NVTH 4A3BH 4JYAQ 3BA8A 2ALYB 4JBJA 2NVXH 2XTIA 4BY1G 3NBZB 3NENA 3CCSA 1H95A 3I7FA 5IE8A 1EQQA 3B6YA 4LF8Q 1N9WA 2JA5G 2ZTEA 3K8AA 3CMEA 4LUOA 3AEVA 5M3FG 4YY3Q 3T1YQ 3HOYG 5IYCG 2N49A 3K7AH 4HJAA 3OW2A 3J81i 3K7UC 2PI2E 4DPGA 3PIPA 4X64Q 2JA5H 4JI0L 2IY5B 3F2CA 4LFAL 4BA1I 4EEQA 5JEAG 5IYCH 4L5SA 3L2PA 3D0FA 4RG1A 1X3GA 5H1SE 4DV6Q 1VQNA 4C3HH 1N34Q 4HTOA 5GAHC 4A3FG 1ASYA 2E5LQ 3U50C 2K52A 4AYBG 1IZ6A 4LF7L 3CCVA 5BR8Q 2HVSA 1TWCH 1QVGA 1X9NA 2A19A 3LGJA 1C7YA 2N3SA 1PV4A 3FKIG 5K36G 4Y52H 4A93H 4DNIA 2D62A 3GTMH 3J81c 5D1OA 1VQLA 1SRUA 1PYSB 5GADC 5IY0A 1VQ8A 4R4QA 4WJ4A 1EWIA 1EQRA 1Q8KA 1NMGA 4JI4L 4UCSA 4OWXB 4JI4Q 4JOIA 2R7ZH 3G4SA 1P8LA 5FPRA 1YJWA 3W1BA 4A3EH 1L1OC 2I5LX 4IJHA 3HOXG 1HZCA 1HH2P 2UUAQ 1A8VA 2I5MX 1PH9A 3S15H 1X65A 5LMNL 1XK5A 3JC66 4MZ9A 1VQIA 1KRTA 4GLXA 4AIMA 5BR8L 1GM5A 2UU9L 2DUDA 1PFSA 4LFCQ 4DV4L 4JOIC 2LSSA 1JT8A 1NMFA 1X3EA 1YVCA 1B7YB 3K80C 3OYYA 1L1OA 5LMUQ 3MXNB 3CD6A 1B8AA 4P74A 4DV3Q 1K0RA 2R93G 1PH3A 4BY7H 3S2HH 1UE7A 2JA7G 5M5WH 1JJCB 5C0XI 3RN5A 2UXDQ 4JG2A 1YHBA 2OWOA 4DR7L 4A3KG 1L1OB 3U58A 1N32L 1JE5A 3J81j 4GOPB 3PO3G 2AMCB 3HKZG 3GJXB 4GN4B 1L2FA 3AYHB 2EXDA 2N78A 3GD7A 3H0GG 4EQ5A 4H02A 4ALPA 1E3PA 4DAYB 1IBKL 1IBKQ 4HJ8A 4BBRH 3A0JA 1Q86C 4DR6L 2E2JH 5IYBG 3KF6B 4CC6A 2MNAA 2VUGA 1VQMA 1Q82C 1I50H 3PIOA 1IBLL 2HVRA 4O0AA 3ICEA 3J80c 4HIOA 3NBHB 2HHHQ 4BY1H 4IFDI 2RCNA 5EAYA 3HOVG 1VQJA 1WFQA 4DR1Q 4X66L 3M7NA 1V9PA 1YHQA 3RLNA 1RL2A 4YCWA
chains in the Genus database with same CATH superfamily
4L8JA 5C0XG 3GB8B 1DCZA 2VQDA 4DV4Q 4ABNA 5CA0F 1WTHA 2NU9B 1GUGA 1A48A 5IIFA 3MWDA 1KBLA 2F4VL 2OTJA 2X6LA 3HOWB 3DAAA 4X62Q 5K5PA 2V1CC 2XWBB 4EQPA 3I55A 4IFDG 4EGJA 1EUJA 2WAQG 3UDXA 1ZKOA 3HKZE 5TSSA 3MXNA 4NZOA 1EOVA 2GQSA 1MJEA 1N33L 3CQZH 4IPDA 3U9OA 2DABA 3K5MA 1VQ9A 2F0WA 2F3IA 3P1HA 1GD7A 4A3CH 3GTGH 1KD1C 2DNCA 3E0JA 2K5HA 1AEXA 5CE8A 1CSPA 4CDDC 1HUNA 2HDLA 1X3FA 3NSWA 2E2JB 5BPHA 5I5WA 1SFOH 3OUUA 4FXGC 4QCLA 3K5NA 2RF4A 1DXMA 2NVQH 4CKCA 5C3EG 1V1OA 3P20A 4LF5Q 1JKJB 1XPRA 4NZMA 1CTMA 2IX0A 2HIVA 3K5LA 3H0GB 1VQOA 3KDFA 1XWEA 4OONA 2YZNA 5GAEC 3S1QB 5LA6F 1BR9A 4YCVA 3I72A 1E4EB 5KYIA 4K5VA 3NK9A 5ELEA 4ZUIA 4OXPA 1OO9B 2JJQA 3Q0AA 3ULLA 1I2LA 5M5YH 1KL9A 1B50A 3M3YB 4JI5Q 1TQOA 1A62A 2B2TA 2R7MA 1HTPA 4DNRB 3ONAB 4C3JH 4X62L 5LP6F 3N8DA 1HNZQ 5FO9B 4DUYQ 2F0DA 1EYCA 1HFNA 1MKHA 2AQ3B 1YNJD 3KK7A 4OELB 3GTMB 3I4MG 3E9IA 5C1PA 3PO2G 3L0OA 4HN2A 4X3TA 1H9MA 4DV5L 1XNQL 2NVQB 1LACA 1IBLQ 4BBSG 4BBRG 1PZID 2JQOA 4I7AA 2R92B 1VQAA 1BOSA 2FP4B 1EU4A 2YTXA 3UI2A 5M5XB 2F0MA 4MTNA 1SCUB 1DOMA 2A69C 5FK9C 4FF2A 1AUVA 3S17B 3Q8DA 4HNVA 3HOZB 2F0TA 1JQYD 1YZ6A 2F0IA 4LWCA 3LWEA 5I4DA 3EIVA 1Y1WH 2L11A 2EJMA 2NTTA 2I07B 3RLOA 2AUKA 1Z7TA 4C5AA 4LMQD 4HMIA 5M3FH 2LS01 4CJ2C 4DXFA 3AU7A 2Q8TA 2G9DA 5CR3A 4XYOA 1I1MA 3ZJYC 5IP7H 4B9WA 5JJZA 2EIYA 4A3JH 4JI5L 5LMNQ 3EBEA 1OXTA 2EJ3A 3U4ZA 3G7LA 1DONA 2QB5A 1JWMD 1LTTD 5DM73 2PMZE 2DZDA 3S15B 2RDFA 3E0EA 3VYUA 3UE0A 5BYBA 4DK3C 3JRWA 2E2HB 1D7QA 2ZJQA 1IYUA 4UY8C 1EY6A 1PRTC 1SE3A 1CUKA 2K05A 4A3KH 3KF8A 1S3OA 1HA6A 4ZRZA 2YU9B 1DGSA 2L1BA 4UPAA 2BE5C 4P2CB 5C44H 1SYCA 1J5EQ 1T9HA 4B3SL 1QWYA 5M3MG 3TRZA 3MTSA 5M3FB 2F0UA 4HJ7A 2YTYA 1XMOL 3HRZC 1X54A 2Z6KC 3T54A 4NDXA 2KCCA 2EJ2A 3FP9A 3GV3A 3SE0A 2WINB 5J1ZA 2P0AA 2JEAI 3PUZA 1PH1A 1CM9A 3RZDH 3M4OH 2HHFB 4DV3L 3FPUB 3IFDA 2X69A 2MQHA 4UDUC 1O7LA 2VQEQ 4DV2Q 1MHWC 2BDNA 1VCIA 1Q3LA 2KHJA 2LY7A 4B3TQ 4EX5A 1B6SA 4I55F 1IYVA 3SK8A 4ZYSA 4R4TA 4KJOA 3TP8A 1NSNS 2X0SA 5DGHA 2XWJB 4IFDJ 2DGYA 2VR1A 3GTQH 1JJ2A 1XNQQ 1GXDC 1PFNA 1FJGQ 4XQQA 4CJ1B 2WACA 3RTXA 4QMGA 2ZJPA 1ZXTA 2JP1A 4QIWB 1B9MA 2CKZB 3GTOH 4MV4A 4ZAIA 2HGWA 3SNOA 2OT2A 4KY6A 1K83B 5E1FA 3TZDA 1KXLA 1IW7D 1ICFB 2HG8A 1EYZA 4M0JA 1VMPA 2XRSD 3F2DA 1NY4A 1SROA 2KOLA 3G8CA 2AKWB 2DJGC 1BKBA 1B4OA 1R4QB 2D9UA 2ZXOA 1PH5A 1Q81C 2CNVA 5JVH3 5I5UA 4FYDA 5JJLA 3NBYB 2K33A 2YZMA 1TWHH 1FNVA 2RCFA 1UC8A 5IYBH 4HAEA 3FHWA 5BWRA 5CGKA 3S2HB 5IYDH 5J3BA 1K28A 1KJQA 1X3QA 4JI1Q 3S17H 2R7FA 3GTKB 1RJTA 3OTOQ 2WP8J 4XQJA 4A76A 2UXDL 2AQ2B 5EBCA 5ELBA 2CH4W 2Z6BA 1PDQA 5M5XH 4IFDH 1MSGA 4B3TL 2CW0C 1L0WA 3K6OA 2K28A 4GN3B 1DZ1A 3UDGA 3WWVA 1ET0A 2L5TA 1CT1D 2O2LD 3GV6A 2COIA 4QGUA 1OXSC 2K5NA 4TRDA 4PMCA 2PPBC 5FLMG 1XNRQ 5JJIA 1QB5D 4JI6Q 4DV0Q 3VYRA 1D5ZC 4MA5A 4P73A 5FLXL 3HOVB 3H09A 4KTAA 2LMCB 1EKFA 2VW9A 3KLSX 5FNVF 2WB1G 4FVMA 3JZ6A 3DM3A 3H15A 4DR6Q 4JI6L 2W71A 4GKJQ 1EY0A 4XIGS 3Q1KA 1K8MA 2F0OA 4IO9A 4XQNA 1EZ1A 5IT9L 4K6NA 4LUVA 3CRKC 3R5HA 5JOBA 1STBA 1WTOA 1GJXA 2SOBA 1GGOA 3HOVH 5D3DA 1K9MC 4HIMA 1ET6A 3OUZA 4JI2Q 4PQXA 2TMPA 5IP7G 3S1RB 1MI2A 1H9JA 4XT3B 4YJ3F 5LMNW 2HD3A 2E2IH 1EYAA 2WIIB 4IPHA 1PH7A 1K8GA 3I4OA 5T1IA 3I4LA 2EY6A 3KLRA 4C56C 1V8QA 3A74A 2I0QA 3TP7A 4CJ0B 4RHRA 4XZ3B 1G51A 2IHEA 4G4KA 2FPPB 3BYTB 1PTOB 4O84A 5C3EH 4APVA 1EY7A 3C2PA 4KJNA 4LF9L 2PBZA 2PNHA 3CCEA 2M9VA 2NN6I 3D4RA 4KKUA 4O7WA 1G91A 1XNRL 3T1HL 1EEID 3WO1A 3ULPA 4IZ8A 3I4MH 3HGBA 3PV0A 5EPKA 3JAMc 3GQBA 1WJJA 2B2YC 3NELA 1IXRA 2UUAL 3UQ8A 4WFN3 3MEHA 1LYLA 2K01A 2H5XA 5C5LA 1EEFD 4LF6L 1QVCA 2JSOA 3C1EA 3UDFA 3TQTA 3I91A 1YBYA 1TXYA 4DGZA 1R9TB 4B3RQ 4A3MG 4RA8A 4POFA 3GTJH 1I7LA 1QNKA 2CQOA 3R3OA 4WBNF 3R9RA 1C4QA 4YWLA 1IL2A 3JZFA 3KAKA 1XTCD 1HNXL 3VDYA 4UCOA 2N8NA 1UAPA 1KTAA 5GAGC 1B9NA 2COJA 3T9BA 3HOXH 3KLWA 3VR4A 2Q8RE 4J1MA 1VQDA 5HGTA 4JI7L 1PZKD 2AQ1B 1IKMA 2EYMA 5IYDG 3QWUA 4CGYB 5FLMH 2WB1E 4J6HA 4JXUA 4O4IF 2RDHA 4O7SA 3PSIA 1W3SA 1LUZA 4A3BH 2OF1A 1HFGA 4BY1G 4NW2A 3CCSA 1Z2PX 3I7FA 4ZHQF 4AYBB 3DWAA 5C4ZA 2JA5G 4A3KB 3QFFA 4RHSA 4JPBW 2N49A 1WTWA 3S1NB 3WO0A 1S5DD 4DPGA 3PIPA 1SE2A 4X64Q 3FVQA 3F2CA 5IOCA 1Q8IA 4NYEA 1CHQD 5HV6A 5DAUA 4JK1C 3R93A 4DV6Q 1SYBA 2A6ED 3NWSA 4LF7L 2EYPA 2QDBA 5C4XB 1TWFB 1X9NA 1KLUD 1PV4A 3FKIG 3KREA 4XYLB 3J81c 4ZKCB 5GADC 1NCVA 1EWIA 1EQRA 2R85A 2IJ0A 1I3QB 1P8LA 2PZTA 4A3EH 2NN6H 3K5HA 2V58A 3SE7A 3HOXG 1HH2P 3OHXC 1X65A 3D4DA 2BE5D 1SE4A 4GLXA 4NMZA 5BR8L 3PMFA 1HQRD 4M1UB 4H13C 3K80C 3OYYA 3T13A 5KRUA 1JT8A 5HBRB 3RD4A 4P74A 1NR2A 1PFMA 2R93G 1ZYRD 1UC9A 4BY7H 3QIAA 1EU3A 2CHBD 3GTJB 2OWOA 3R23A 4A3KG 1B1ZA 3U58A 2AUJD 3HKZG 1STEA 2MJ8A 4GN4B 1U4RA 1QG7A 4ULLA 2YW2A 3GJXB 3GD7A 1E3PA 1SNMA 1IBKL 1Q86C 3R2IA 4HNTA 5IYBG 3TIGA 2DJFC 1VQMA 1LO5D 1CA5A 3ICEA 3I4MB 3J80c 4C3IB 4BY1H 1I4QA 4IFDI 3S16B 4DR1Q 2WV6D 2H4OA 4FF4A 4JBWA 1YHQA 1RL2A 3CHBD 2Z04A 4O7TA 1DJRD 3GTOB 3F2UA 2M00A 4MV3A 1EL0A 4ZI7F 4DK6C 4G7HC 1V1PA 5CV7A 3BU2A 3MXPA 5CM0A 5KNCA 1QE6A 4X66Q 2BOSA 3BZKA 5FJ8G 1SJHD 2B8GA 1D5MC 4A3LG 1A3VA 1JDEA 1JOKA 3CF5A 3QWNA 1UEBA 5LOVF 1JLLB 2ZDQA 1K8AC 3KJPA 4DAYA 4A3GH 1GOZA 1RODA 1TU2B 5AJ3L 3S16H 5C3EB 4JYAL 4KHVA 1A15A 5BN5A 3VYTA 5JQGF 3E9HA 2BDOA 3RUZA 4F88A 3S1MB 4OEMB 4ZK9B 4C3IG 1HZBA 1VBHA 4MA0A 1JICA 2PQAA 4O7RA 2LXKA 4FXKC 4JI8L 5JJKA 4UFZA 5LMUL 2ASBA 3Q22A 2KUMA 3LWUA 4B9XA 4JVZA 4MHEA 1SR3A 1IBML 1SEBD 1W6JA 4IUUA 5ISRA 3HEJA 3BJUA 2K7VA 3E6ZX 2X5RA 3J81E 1Q46A 5M3MH 3N6RA 4XYMB 1MGSA 3N52A 2R6GA 1O80A 2HQLA 5E7NA 1A3TA 1K3BC 3RFCA 1SJED 2F1MA 4G7ZC 4DQNA 4LH7A 1JWUD 2P5ZX 3U4VA 3C46A 1ENFA 4MV6A 4PG3A 2DY8A 1PK8A 1DIKA 3BDOA 1UEAB 3CRLC 4O82A 2B2TC 3TEHB 4DUZQ 1ILQA 4RGTA 2NVTB 1GSOA 4YCUA 1A0IA 3H3VI 1X3PA 2W6QA 1YNNC 3M9BA 1KRSA 3GIDA 1N33Q 4UCRA 1G8ZD 4FF1A 2MPMA 4DR5Q 1WD0A 1IOVA 1STNA 4TM5A 2K6AA 3BYYB 3SK5A 2GA4B 1YJNA 1EKPA 2RBMA 4EQNA 1LTAD 3J80E 1YIJA 4UCVA 1ONLA 2OTLA 1CQIB 1M6VA 1N36L 3TZUA 4R1JA 4HEDA 1EOTA 2C5CA 3HOYH 2MUYA 2TSSA 4K2LA 3F1ZA 4EQOA 2CWPA 3HG9A 2Z0SA 4CHTB 2CFMA 3NTHA 2WFWA 4CHIA 1UE6A 3TSSA 1WR2A 1B53A 1GLVA 1EYDA 3NXWA 4K6LA 4DV5Q 2Y0SE 4R4IA 2OCEA 3CPWA 4LF6Q 2F4IA 4BS9A 2HHFA 1VQ6A 2RDGA 1AZQA 5I5TA 2CQAA 1Q1BA 2NU7B 4YB8B 2I80A 4KY7A 4LW1A 4P75A 3JAML 1SSOA 3CU7A 5IGBA 4R4OA 4C3JG 4A3MB 1QVFA 5IWAQ 4LF4L 4KLKA 1PX2A 2KCMA 3GDEA 4OL7A 4CDEC 4X64L 1IKLA 3AFQA 2EZVA 1SNDA 4JI3L 3HOYB 3F8TA 4KN4C 1PTOF 4KN7C 4IOCA 4O4HF 1ZEQX 1STYA 2KJXA 3I12A 2HDMA 2JYOA 3SEBA 2BH8A 2JK8A 1OBGA 5GONF 1A2TA 4A3IB 3VYSA 2K50A 2FFKB 1LTRD 1S5FD 1TWAB 4C2MB 1S40A 2Z6KA 1CA6A 2R92H 3HKSA 5DGIA 1CZGA 5CR5A 2UUBQ 4DAPA 3NBIA 1I3QH 5EZYF 4NKLA 4X65L 5LYJF 2JXMB 2YL2A 1CKNB 2PI2A 5EKKA 1M1KC 2C00A 2EY2A 5BWUA 4C5CA 1WCMB 1EWCA 3MXUA 1LT6D 1SYFA 1Z9FA 4F87A 1R4PB 4IUQA 3BAAA 1EIFA 4A3IH 2HIXA 2SNMA 3FPPA 4FFRA 1A63A 5CB4F 1SLJA 4MV9A 3GTPB 4XT1B 1X55A 2OEOA 2RKSA 3VNNA 3T51B 1LT4D 4YHHL 1PLFA 1Y1WG 4DA2A 1O7YA 2SDFA 2I87A 2E75C 4OO1I 3K7AB 4KI0A 1T5EA 2BA1A 1G6ZA 1WOCA 3CSWA 2Z1CA 2F03A 4TUYF 3TREA 4JV5Q 1OXUA 1Z47A 1LTBD 1D8LA 3F2BA 3HFZB 2F0KA 3Q2OA 1UWVA 2VB2X 1E7ZA 5JH7F 2UXBQ 4AQYQ 5E25A 4AH6A 2YS6A 2E2HH 3DM1A 2PO4A 1S68A 1UE1A 4LF9Q 1M0TA 1AE3A 5C4HA 5BMVF 2LFNA 2EYOA 3PFFA 2L9HA 3D3RA 1QZGA 4RKBA 3LULA 4OO1G 4EFBA 2IT1A 1B70B 2O5IC 3NP8A 2B63B 1E0BA 2MP1A 2MHVA 5FO8B 3S1QH 5I5VA 1BCPB 1GUWA 2B2WC 1MBYA 1HCZA 4UP7A 3BACA 3CC2A 1JMCA 3NTIA 3T53B 2FB9A 2Z8LA 1VQCA 2R7NA 2XNAC 2W6NA 1RDPD 1BNCA 5J2UF 3TIIA 4JI1L 1XX8A 3DXJC 4U673 4FF3A 5CV5A 3HOUG 3BDLA 4K5XA 3PF4A 3TP6A 4YHHQ 1Y8OB 4V190 1B2TA 4A3GG 3VPCA 1EZ8A 4O42A 1KNAA 2VS1A 1X6OA 1I7NA 3JSLA 3GLKA 2V4DA 2YTVA 2VQFQ 2GQRA 1F9QA 3TMEA 3BG5A 3NE5B 5JVLA 1HNZL 1BCPD 5DEHA 5FLXE 2Q2HA 3CAMA 2VY3A 4RMFA 5J22A 4Q0FA 3V4SA 4WRDA 2KEEA 2HGXA 3PGZA 5F2DA 2A68D 1TS2A 1G2TA 3K59A 4XYQA 3V4ZA 4DR4Q 3CPFA 3H3VH 2EOTA 2DLNA 3P75A 3VOTA 3BVMA 1WTVA 4B3ML 5FOBB 3NQTA 1YJ9A 2B2WA 4B3SQ 5FJ8H 3S9WA 2L55A 2XVSA 3H91A 1T5XD 3A8JE 2EDGA 3MFGA 5EPLA 2F0SA 3S2DB 5C3WA 4GLWA 4A3FH 3RUPA 1PMRA 4V0BA 4DV7L 2KA7A 3JRXA 1U4MA 1U4PA 1TR5A 4IJLA 1SNCA 3V05A 5EQ0A 4ME5A 1N34L 1MSHA 1GHJA 3P7JA 1ULZA 4L63B 3SXHA 5K3WA 1EKVA 3PO3H 3RZOB 1VQEA 2A5HA 4OIJA 1ESFA 3EJIA 3NHHA 3J80L 3EVQA 4LF8L 2V5AA 4I65A 5BWXA 2EYJA 2B2YA 4K8IA 1E1OA 3EFXD 1QZHA 2JA8H 3AX6A 3S2DH 2YRWA 4IUVA 4LF5L 3VPDA 1FYCA 2D0OA 1I4HA 1AFPA 3CMAA 3H94A 1DD2A 4CMDA 4DV2L 1HPCA 1HHVA 3I3CA 2HHHL 3J7A5 5C4XG 2VUMG 3PUXA 2R86A 1C3OA 1ASZA 2OLSA 3BA8A 4JBJA 1A3UA 2NVXH 1EQVA 2XTIA 2HGSA 3V2TA 1FGBD 4KY5A 4O4JF 4LF8Q 2R3ZA 3AEVA 2K5QA 4IALA 1NR4A 3K0YA 5IYCG 1LTGD 2RSOA 4JI0L 2IY5B 1FD7D 1TIID 3Q23A 5JEAG 3QO2A 2DWCA 4TKOB 1DOLA 1N34Q 1CI3M 4A3FG 3U50C 4AYBG 4PNYA 1JWSD 2GPWA 1CHPD 3LGJA 1IOWA 5K36G 1KUTA 1STHA 4HR7B 2D62A 2A69D 1H9SB 4O81A 1WTXA 2ICIA 4JI4L 4MV8A 1NMGA 4IJHA 2NU8B 1HZCA 5CC4A 4QUFA 1A0GA 3S15H 1CS0A 3TEKA 5LMNL 1VQIA 3UFXB 3C1FA 3D6CA 3NUCA 2UU9L 2W6MA 1BDOA 1HA5A 1X3EA 5KX5F 1FNWA 2J4XA 5LMUQ 3MXNB 3CD6A 3S2HH 2Q8IB 1BNZA 1JJCB 4K14A 2CH4A 3DTGA 2N88A 4DR7L 1DM0B 5C4JB 3J81j 3A55A 3PQIA 1J9OA 5A2QL 3AYHB 3H0GG 1IBKQ 2FPIB 1GUTA 4H02A 2K03A 4IN3A 5H80A 4HJ8A 4BBRH 3V96A 5I6WA 2E2JH 1PXUA 4CC6A 3ND9A 2MNAA 4MV7A 5JPMC 1IBLL 1RTNA 2HHHQ 5KNBA 3WWHA 3DEPA 5EAYA 1WFQA 5K36H 3WWJA 2QF7A 4E6NA 2NUAB 4I4TF 2EPBA 2YV5A 3RMHA 2XCLA 1HUMA 2RHSB 3DEOA 1D1KA 1TWGB 4DF7A 4N9TA 1IW7C 3W5OA 3RZOH 2WAQB 5CMDA 4IOAA 1HZAA 2VQEL 2E8GA 2NYZD 4LNQA 2O4XA 4OGQC 4JI0Q 4RGNA 2JEBI 1I5FA 2EXZA 1RCVD 3KF6A 1HJPA 4H0LC 3OW7A 2ICEC 2PVPA 5KKNB 2GVBA 3D31A 3WDNA 3IAYA 5COYA 2FHTA 3S14B 1KLGD 2Y4RA 3M4PA 2VUMH 3PCOB 4X6AH 3RLFA 2PZWA 4DR2Q 1B6RA 4GLAC 5DLQE 1KJJA 3OWEB 1JB3A 1BQQT 3HT5A 2QA4A 1II3A 4Y7NB 4YWMA 2I46A 3R2TA 1JORA 1PTOD 2AWNA 4IIJF 1Y8PB 2C9OA 4ZQIA 3NUAA 3ZYYX 4DR2L 2YZLA 3K81C 4OX9Q 1KDCA 2HCCA 1Y1WB 5IP9G 3VR2A 2ZXPA 1VQPA 2ATWA 3WOFA 1BUVT 2HDKA 2UUCL 3I4NH 1LTLA 1BF4A 2F3VA 3PN1A 2BA0A 2HJWA 5FLXc 4XTCS 2EY5A 2HQEA 1TWAH 1LM0A 1BVSA 1WCMG 2PZUA 5D1PA 2DY7A 1Y1VH 1I94L 5I47A 1I50B 1QOHA 3SGIA 5CV9A 5I9OA 2E76C 3K58A 1EYGA 5IODA 1F9RA 3UZOA 3E3XA 2JA6B 3HB9A 1EZ6A 4UCTA 4GOPC 4A3IG 3R8BA 4DR3Q 1FL0A 1WI5A 1F2MA 3TINA 1ICWA 4A3CG 3NWTA 2VNUD 2EE1A 3CC4A 1TA8A 2VL6A 2CWAA 4HQ6A 3JSNA 2Q2IA 2YU9H 2ES2A 5M5YB 3HOZH 4G7OC 1OTCA 5JEAJ 1Y8NB 3J7ZC 4DR3L 5I5SA 4BA2I 3RV4A 2WYOA 4O7YA 3T4AC 4TVIA 5BYAA 2QILA 4JI7Q 4L5TA 2IP4A 1I94Q 2F0LA 4MV1A 1ENAA 5CORA 5FR9A 1PYBA 3EQLC 2HT1A 1DV1A 4QQBX 5EJWA 4UUGA 4UP8A 4DR5L 4O4LF 4IPGA 1CKNA 4DKAC 3S1MH 4HCSA 1RHPA 3RZDB 3M4OB 4PMBA 5DAAA 2H1EA 1C8CA 4EGQA 2ZM6L 1PH4A 3KLSA 2UUCQ 1I6HB 4DRFA 2FINB 2BCOA 5IT9c 2R7LA 3M7GA 5I5XA 4YJ2F 5DNFA 2FJ2A 2F0VA 5I2YA 1V43A 4HMJA 2R7DA 3O13A 2O5JC 2YYAA 2E5LL 1KT8A 2JE6I 2NZHA 1EIYB 4FO2A 4LH6A 1ENCA 5M3MB 4ZUJA 2F0FA 2ID0A 1HR0L 1E2VA 1I6HH 3HBLA 4GN5A 1N36Q 3UDIA 4LJZC 3PUWA 2QEJC 4QIWE 4RKLA 3FMCA 3SR1A 5CBAE 3G6EA 3T1HQ 2QGQA 2F0QA 2AWOA 4ID6A 4YY3L 4C1NI 4MNOA 3FDTA 2CZGA 5C4JH 1KEEA 4GNXA 3I8ZA 4CDCC 1RIPA 1VBGA 4K5WA 2UXCL 1D2BA 4P72A 3T16A 5D1OB 1SMYD 1XXGA 4L5RC 3K5OA 4R8NA 4IWYA 1QUQA 3IKJA 1CKOA 3GTPH 1B3QA 2EY1A 5E4WC 1KJIA 5CBEE 2R7ZG 1SYGA 4JBMA 4YIJA 1KDBA 2L15A 2K5DA 3BVZA 2VUMB 5J2TF 1HTLD 2IX3A 4FFOA 2NVXB 1PRTB 1BBXC 3PF5A 3BZDB 1G6PA 2PNRC 4ZKBB 5BWWA 1WYDA 3T99A 3M3YH 2A1AA 1Q90A 1P16A 3MFYA 4DK0A 3D4WA 4TQUS 2KENA 2JA7H 1EY9A 4B3RL 4UHVA 1SNPA 3S24A 3T9CA 5JAVA 1YHAA 1S5ED 1TWGH 1AW7A 1RD9D 2RHQB 2B3GA 1Y1VB 1EFWA 4BBSH 4N8FA 3DUZA 4ZOLF 3C3LA 4F7XA 1Y69U 2JA5B 1B3AA 4KD3A 2YYZA 3A5ZB 1QILA 4GNXC 5I5YA 4JI8Q 3FRPB 1CK1A 4A3JB 1L0XB 2R92G 2PMZB 4K0KL 4AYBE 4YBZB 2K4KA 5FO7B 4BBRB 1S5BD 3SHLA 2KCTA 2VQFL 1XMQL 1HNWL 5KEEA 4QY7A 4FE2A 4FFLA 1UNSA 1TWCB 2ZTDA 2HCIA 4LFAQ 2Z4HA 3M4YA 1TWHB 4EG0A 4EFEA 2F52A 2EIFA 1VQ5A 4F8MA 5ELDA 3PO2B 1TVXA 3BA9A 1QUQB 3JAMi 4KKTA 2Z4IA 5J39A 4HIKA 5JVDF 3DLLA 4A3LH 4N8X1 5D14A 4C2MH 2B39A 2ZGIA 1BBUA 4Y8VB 4J8QA 4RZQA 1KAAA 3VR3A 1PZJD 4JCVE 3W2DA 2ODTX 3BVGA 4IPCA 3A8KE 3GTKH 5EGTA 4HNUA 3CC7A 5KS8A 4K2KA 1NUCA 3L9AX 1JCKB 2MFIA 3J7AV 2ZTCA 1F9PA 1A2UA 1CQFA 4WJWA 1FNUA 4H7BA 4Z9CB 1V1QA 3T9AA 1SMXA 2Y0SB 2B29A 2R93H 3TS2A 3RR5A 1U0LA 1M0WA 2COGA 1XYIA 4NXNL 1NJIC 1VQKA 2W70A 5C0XH 3STBD 3TN2A 1KTKA 5K2MA 4DU9A 1Z6HA 4A3GB 2XD4A 1M4VA 3W3AA 2Y0SG 3GP7A 4TSSA 3S1NH 1DYQA 4OX9L 3OIQA 5C8YF 2DAAA 1F2YA 4PZ8A 3J7YW 4CKBA 1VF5C 3H6MA 3MXGA 1I1LA 2LKVA 3HOWH 4R9WA 2KHIA 1X56A 3RV3A 3AQQA 1OBDA 4JI2L 3J81L 3S14H 3K57A 3MZ5A 3CQZB 1KAWA 3QJYA 5EBDA 2JA8G 2R93B 3LNNA 1ESRA 4KHPL 3T9DA 4B08A 4LUZA 1VQBA 1AE2A 2PCFB 3G6JB 1WD1A 1ILPA 2B63G 5D65A 5IP9H 5GROA 1X32A 3MA2B 4JI3Q 1AUXA 1BCPF 2R87A 4ME3A 3WWIA 2QCPX 1EUDB 1XMOQ 3HOXB 1IHZA 1KC7A 4DR7Q 3QG1A 1PTOH 4A3BG 4FDBA 2A1HA 1GO3E 1KDAA 4HIDA 4M9UA 5I2XA 2XRQD 3X3NA 2AHOB 4J15A 4A3JG 1VQ4A 4CMFA 1HQMC 1K73C 3OWFA 3KJOA 3CKIB 2FMCA 3CEBA 3MEFA 3WNZA 1NE3A 2DIKA 3KYHC 2CW0D 2B8FA 2I5HA 3S1RH 4CKEA 5JEAH 3PO3B 4QJFA 4KHZA 1GUOA 4P71A 1IYJB 4O7VA 1NAPA 4IZOA 3FKIH 4U68A 4NPSA 1HRJA 1U5KA 3IL8A 4HJ5A 1PHJA 4DAVA 1LABA 2J0TD 4NXNQ 4JBKA 3UE1A 2DNEA 1AH9A 3I2ZA 4OWTB 1YEZA 2L4NA 1JR0D 2NU6B 1YNXA 5ELNA 3KBGA 1PTOC 1NBWA 2HUGA 2D0PA 2RQXA 3TW6A 2ZDHA 4KMUC 1YI2A 1Q7YC 4DIMA 4RFBA 3A5UA 2K32A 1HNXQ 2NVTH 1Y14B 4JYAQ 2ALYB 3URYA 2RVLA 2EJGC 3NENA 1VF7A 4X3KA 4EVOA 5IE8A 2NZ1D 1EQQA 1RTOA 4LUOA 4DLKA 4M8AA 3HOYG 5FKAC 4YY3Q 4TV9F 1AP0A 3K7AH 3JAME 2JA5H 2PI2E 4LFAL 4EEQA 1FR3A 3D0FA 4RG1A 5H1SE 1JOOA 5LL6S 1VQNA 1BCPC 5GAHC 2E5LQ 5L37A 5ELCA 2F3WA 2PQEA 5BR8Q 1QVGA 2A19A 1I2KA 1QCBD 1C7YA 3WOEA 5JQWA 4A93B 2L0CA 4Y52H 3U0GA 2RA4A 4DNIA 3GTMH 5D1OA 1KNEA 1KABA 1VQLA 4C5BA 1PYSB 3ETHA 4S3SA 4Q4CA 2IPKD 4OWXB 4JOIA 2R7ZH 5FPRA 2B2UA 3Q24A 1EIHA 1L1OC 1V1PB 1G2SA 1LT3D 2I5MX 4I50F 4FNFA 5EPJA 1XK5A 2J7ZA 4MZ9A 1KRTA 2IWHA 4AIMA 1GM5A 5I9PA 2V59A 5BWTA 2QKIC 4DV4L 2LSSA 1YVCA 3GTQB 1PRTD 1PH3A 2GLTA 2JA7G 5M5WH 3U54A 2J9GA 3TBIB 4MIUA 1IYDA 3DF7A 2UXDQ 1D6EC 3T9EA 4JG2A 3D6WA 4O2AF 3SVMA 1KJ9A 3QR8A 3NTKA 1N32L 1JE5A 4O7ZA 4GOPB 3AMUA 3SK4A 1L2FA 1O7ZA 1QJOA 2EXDA 2R7KA 5ELFA 4DR6L 3A0JA 2QDLA 1MD2D 3KF6B 1JOQA 4O86A 4R8IA 5CAEB 1I50H 2HVRA 3KUPA 4O0AA 1UUPA 1H9SA 5KGUA 3DTFA 4TV8F 3NBHB 1LTSD 3HOVG 1VQJA 2PW5A 1L1OB 3HS0C 5CV8A 1R9TH 4A3EB 2A8VA 4HN7A 2XSCA 3EN2A 4C1NK 1W93A 4CE5A 3A7AB 2PQAB 1B04A 3L3OC 3X3MA 4JC0A 3LX0A 1LLRD 4NP5A 1PH2A 1SDFA 3DHQA 4GZYC 4EGVA 1XPUA 4C3HB 3VR6A 3VA7A 3HOZG 4RCNA 2IL8A 1BBWA 5DMXA 3BZCA 2ZM6Q 3VMMA 3TY8A 1W6KA 4B3MQ 4H44C 3TY9A 1IBMQ 3GTLB 2WKDA 1SYDA 1VKZA 2MO1A 1O78A 1FVIA 3DWQA 3A56A 3U9SA 4R4CA 4YWKA 1WTQA 1Q12A 4DR1L 1E1TA 4A3DH 4QSHA 3IRBA 4RAUC 1M90C 1MIUA 2KQ3A 2KCNA 4FXDA 3T1YL 2E2IB 5A35A 5IGDA 1XJVA 2JA6H 2JA9A 2CNUA 1RF2D 2A6HD 2WKCA 4A3MH 2K1BA 2CNQA 2BH2A 1C0AA 1TWFH 1S5CD 3A7LA 4DUZL 5BN4A 2JA8B 1Q1EA 4LFBQ 2DN8A 2F0JA 1SAPA 4QL5A 2Q7DA 3PUYA 1K83H 1CQVA 2QW7A 4FFNA 2Q2TA 4PZ7A 1G2WA 1TAEA 2MGSA 3K3PA 5BWVA 3I4NG 3ITPA 2NVYB 1EHIA 4ODGA 2A74C 1O7IA 1TKWB 4NB3A 4A3DG 1KJ8A 2NN6G 3GO5A 3NEMA 4O7NA 2K5VA 3ERSX 1EUCB 2ZXRA 2VZAA 4PMWA 1KQSA 1GSAA 1C9OA 5D8DA 1DV2A 2SEBD 3DWPA 4Y7NH 3IFTA 2SCUB 3ORQA 4DV0L 3AB9A 4RH6A 5DM63 4GOPA 2EYFA 4I7ZC 4RCOA 3Q6SA 3HKZB 2L12A 2UXBL 2B2VC 2OXPA 3BABA 5HNEA 3MWYW 3M85A 2VB3X 2VXWA 2A6EC 1FGUA 2NUCA 1VQFA 2F4VQ 4DAAA 3VR5A 1BXRA 4JV5L 2F0HA 5GQOA 3AFPA 2F0PA 3QQMA 1PH6A 4DV1L 5NUCA 2F0GA 3T56B 4UCUA 4HCEA 5CV4A 4UAIA 4LFBL 2NVYH 3MWEA 2K04A 2HVSA 4ME6A 2YRXA 2NBFA 3CW2C 5D3IB 1XTDA 5IT9E 3DMUA 4NXML 3LQSA 1XMQQ 1HNWQ 3CCUA 3MJFA 1GVPA 2OQ0A 4A3FB 4QF4A 3PO2H 1N8RC 3FKIB 2XIWA 1C48A 1DOKA 3EA6A 1HR0W 2EVBA 5C44G 2FMMA 3RN2A 4O83A 4NXMQ 2X6GA 4DV7Q 4L5QA 4NZNA 5DISC 4GS3A 3T9FA 1GHKA 4ZQ3A 3H0GH 4PZ6A 1LV9A 1SBBB 1SXTA 2HVQA 1LT5D 2B2VA 2Z9HA 1GUSA 1AN8A 2OQKA 4WJ3M 1N32Q 3OMGA 3ETJA 4BBSB 4QUCA 4C3IH 4BY1B 3GTLH 4OIKA 2QK4A 2D2CC 3GTGB 1D5XC 4Q5VA 2K5WA 4L1KA 3G48A 2NZOA 1K8OA 2C35B 3JZIA 4O2BF 4A3BB 1BXTA 3KFUA 2F0NA 1RKNA 4G57A 1U4LA 1IYEA 3KAJA 4CDFC 2GN5A 4MN3A 4O2DA 2R7ZB 2LXJA 2ZJRA 3I73A 4HTPA 3R5XA 3KF8B 4GKJL 5LL6X 4YAJB 4L6TB 2KECA 4LFCL 3I56A 4HSPA 3TQYA 1EY8A 2MO0A 2GPSA 5BPFA 4GNXB 2UXCQ 2R84A 2PN1A 2K75A 1WVLA 1ML0D 2W6ZA 5KYLA 2E74C 3OPOA 1W2BA 4BXXG 3A8IE 1E2ZA 1I6VC 5JPNC 2ZT9C 1Z2NX 1I1KA 1S72A 2F0EA 5ELOA 4IUNA 4GLVB 3A54A 3UYYA 2KBNA 2WAQE 3U9TA 4XXEA 4BY7G 3ERQA 1JJGA 1KIXA 1TY2A 1MJCA 3TW7A 1SNOA 5HY6A 3LWBA 4DN4M 2KEDA 5LHY1 1PFBA 2NWGA 3BDCA 1GKHA 3W1GA 1JDBB 3L7ZC 4DFAA 4FP5D 5LXTF 4N9PA 4IWXA 2ENBA 1C30A 4PBCA 1F2LA 4HJ9A 2ABJA 5CYUA 2N55A 1E2WA 4A75A 1PRTF 2KVMA 4A3DB 3G8DA 3STBC 3I4NB 3E5SA 2FPGB 4GKKQ 4MTKA 3KBXA 2B63H 1VS0A 5I60A 1S4ZA 5G3LF 1A3GA 4K6DA 1J5EL 4CC5A 4XDXA 2EQSA 1TY0A 3NBHA 2JN4A 1ZYRC 4RGOS 2M2LA 4UP9A 1PA6A 1VQGA 3PUVA 2CVRA 3HOWG 4X3UA 5AFWA 1CQJB 4RWSC 2W6OA 1CKMA 1STAA 2XGTA 4WHXA 2IX1A 4HSVA 3VPBA 5IGCA 2IHFA 3K0XA 1G291 5FPOA 1W96A 4IQZA 3PIP3 5C1OA 4DAMA 1F77A 3FEWX 1J6QA 3M4QA 1PVOA 3HOUB 2JA6G 2WB1B 5HGQA 3CP0A 3OMCA 5IWAL 4LF4Q 1EIGA 3R5FA 5CA1F 3TDQA 2CCZA 4K0KQ 3HZXA 5C6AA 1EFID 2A68C 4E4TA 1I4GA 4O7LA 1HXYD 5IGFA 1HZ9A 3KDFB 3SDZA 1UE5A 4X65Q 5C0XJ 1OXVA 1K3RA 4YAKB 3ER0A 4TVAB 1Y1VG 4C3HG 4KV6A 4ZLTF 3CCJA 1F9SA 1WCMH 3OIPA 4GKKL 1SE8A 2K14A 4IHJF 2UU9Q 4KKSA 1PYWD 5AJ3Q 3OTOL 3G71A 3CXCA 3TY5A 5C3XA 4ZCKA 4BWGB 2SNSA 3BG3A 1EWHA 5EKIA 2EJ0A 4DV1Q 1YNND 2A73B 4JW0A 1ZAUA 1H9KA 1GSHA 3KOJA 4KHPQ 4A3EG 1L0YB 5C4XH 1KHIA 2IW3A 4POGA 3QB3A 1Z2OX 5KNDA 3ULJA 1I4RA 1KC8C 2YS7A 1CZWA 1LTID 2GVAA 4X3SA 4DR4L 1XPOA 1HR0Q 3CCRA 2R82A 1JB7A 1TT2A 2Q2UA 3HOUH 3CCMA 4DNTB 1K0SA 5CV6A 1CSQA 2FXQA 4FU0A 3AW8A 4A4IA 4DUYL 1E24A 3ND8A 3D8GA 4OWWB 3UZBA 3MHBA 2XN9C 1VQ7A 1A6XA 2JA7B 4BXXH 1AZPA 4RGMA 5IYZF 5A2QE 3J80i 1EY5A 1PH8A 2PYKA 2Z02A 4IUTA 2NTSA 3HO8A 4LAAA 1SMYC 4PV1C 3OSOA 2VPQA 1TS3A 3I70A 1YITA 4OO1H 1FJGL 1IL8A 1VQHA 2A6HC 1XDNA 1U9RA 5C5MA 4LF7Q 1D1IA 4FFMA 3CCQA 2UUBL 4AQYL 3HP3A 1TS4A 4DV6L 1QNUA 3TP5A 4Q4DA 1CFMA 1OXXK 3CCLA 3K5IA 3RNUA 4MAMA 4A93G 1JE4A 2KHSA 3NC0B 1NTGA 1WRVA 4HR7A 3TS0A 1H9RA 1E4EA 2QEXA 1SN8A 1E22A 1EY4A 1WTPA 3H3VC 3J7AF 1VDZA 5EKLA 4BY7B 5IGEA 1SFOB 2E2DC 4KD4A 3NBZB 1H95A 2YWVA 1F2ZA 4E6IA 4QB4A 3B6YA 1ET9A 1N9WA 2ZTEA 3K8AA 4HTHA 4IURA 3CMEA 1DAAA 5M3FG 3T1YQ 5E4XA 2YZGA 4K8JA 4HJAA 3VA5A 1NNXA 3OW2A 3J81i 4C3JB 5HURA 3K7UC 4WORA 5T1GA 1JC7A 1GUNA 4BA1I 5IGGA 3PIO3 5IYCH 4DXGA 3L2PA 4L5SA 1CE8A 1X3GA 4XX0B 4C3HH 5JVG3 4HTOA 1ASYA 4CBVA 3T7AA 3I90A 3MAQA 2ZDGA 2K52A 1TS5A 4KK7A 1IZ6A 3CCVA 5I6YA 1TWCH 2D5DA 3OOCA 5M5WB 4ILWA 4LK1C 2N3SA 3MVVA 5M9OA 2R61A 4OHJA 4A93H 1SRUA 3NPPA 1I4XA 5IY0A 1VQ8A 1SYEA 1B44D 3QOJA 4R4QA 1Q8KA 4WJ4A 3KALA 4UCSA 1SNQA 1M8AA 4JI4Q 3G4SA 1T36A 2G5DA 1YJWA 3W1BA 3ORRA 2I5LX 1WTRA 1EQTA 3NQIA 2EYLA 3EROA 2UUAQ 3QOLA 1A8VA 1PH9A 4O1NA 2NB0A 3JC66 2EYHA 5G3LD 2I8CA 2DUDA 1PFSA 4LFCQ 4DK1A 4JOIC 5E3FA 1NMFA 2B2UC 1B7YB 1BO0A 1L1OA 1B8AA 1YNJC 4DV3Q 1K0RA 1STGA 2PW7A 3MC0B 1UE7A 3U55A 5C0XI 3RN5A 1YHBA 5C44B 3PO3G 2AMCB 1VMCA 3SK6A 3E5NA 5KIXA 2N78A 4EQ5A 4ALPA 4DAYB 2W6PA 5BN3A 2RSNA 2G9HD 2VUGA 1Q82C 3PIOA 1I4PA 3LP8A 4FFPA 4HIOA 1J8IA 2RCNA 4IUPA 1A9XA 2EJFC 3BS1A 4X66L 3M7NA 1V9PA 3RLNA 4FGRA 4YCWA
chains in the Genus database with same CATH topology
5C0XG 3GB8B 1R9TH 2YV5A 2A8VA 2RHSB 3EN2A 4DV4Q 2F4VL 3W5OA 2PQAB 3RZOH 4DK6C 2OTJA 4IOAA 1B04A 1HZAA 3BU2A 2VQEL 2E8GA 4X62Q 4JC0A 4LNQA 4X66Q 2V1CC 4JI0Q 1PH2A 3BZKA 3I55A 5FJ8G 4A3LG 2JEBI 1I5FA 1XPUA 4IFDG 1EUJA 3CF5A 2WAQG 3KF6A 1UEBA 1HJPA 3UDXA 3HKZE 3HOZG 1K8AC 3KJPA 1BBWA 4A3GH 1EOVA 2GVBA 3BZCA 3D31A 2ZM6Q 1MJEA 1N33L 3CQZH 4IPDA 3TY8A 4B3MQ 1VQ9A 3M4PA 2F3IA 3TY9A 1IBMQ 5AJ3L 2VUMH 3PCOB 3S16H 4X6AH 1GD7A 4A3CH 3RLFA 3GTGH 1KD1C 4JYAL 2K5HA 4DR2Q 1CSPA 4GLAC 5DLQE 1X3FA 2MO1A 1FVIA 3E9HA 2QA4A 1SFOH 4YWMA 4R4CA 1HZBA 4YWKA 1Q12A 2RF4A 4DR1L 1E1TA 4A3DH 2PQAA 2AWNA 3IRBA 1M90C 1MIUA 5C3EG 2NVQH 2LXKA 5JJKA 4JI8L 4UFZA 4LF5Q 3T1YL 5LMUL 1XPRA 1XJVA 2IX0A 2ASBA 2HIVA 1VQOA 4DR2L 3KDFA 2JA6H 2JA9A 4OONA 3K81C 4OX9Q 5GAEC 4YCVA 1SR3A 1IBML 5IP9G 3BJUA 4A3MH 2BH2A 4OXPA 1VQPA 2ATWA 1C0AA 1Q46A 1TWFH 5M3MH 2JJQA 3ULLA 4DUZL 5M5YH 2UUCL 1KL9A 1LTLA 3I4NH 2R6GA 1Q1EA 2HQLA 3PN1A 2BA0A 5E7NA 4JI5Q 4LFBQ 5FLXc 4XTCS 4QL5A 3PUYA 1A62A 1K83H 1TWAH 4LH7A 4C3JH 1LM0A 4X62L 1BVSA 1WCMG 4PZ7A 2Q2TA 3U4VA 1TAEA 1HNZQ 5D1PA 4DUYQ 4PG3A 1Y1VH 1I94L 1MKHA 3I4NG 3SGIA 4A3DG 4NB3A 1O7IA 1EYGA 3TEHB 2NN6G 3GO5A 3NEMA 3I4MG 2K5VA 3E9IA 3ERSX 4DUZQ 3PO2G 4UCTA 2VZAA 3L0OA 4PMWA 4GOPC 4A3IG 4DR3Q 1FL0A 1KQSA 1WI5A 4YCUA 4DV5L 1A0IA 3H3VI 1XNQL 4A3CG 1C9OA 2VNUD 3M9BA 1KRSA 1IBLQ 3CC4A 1N33Q 4BBSG 4BBRG 1TA8A 4UCRA 2JQOA 4Y7NH 2VL6A 2CWAA 1VQAA 4DR5Q 4DV0L 3JSNA 2Q2IA 2YTXA 2YU9H 2ES2A 4MTNA 4GOPA 3HOZH 1OTCA 5JEAJ 3Q8DA 3J7ZC 4DR3L 4BA2I 4LWCA 1YZ6A 1YJNA 2UXBL 1Y1WH 3BABA 3EIVA 3M85A 1YIJA 3RLOA 4UCVA 2OTLA 1FGUA 1VQFA 2F4VQ 4JI7Q 1N36L 4R1JA 4L5TA 5M3FH 1I94Q 3HOYH 4JV5L 5GQOA 3F1ZA 1PYBA 3AFPA 2HT1A 2CWPA 2Z0SA 4QQBX 1PH6A 4UP8A 2CFMA 3ZJYC 5IP7H 4DV1L 4DR5L 2WFWA 1UE6A 4UCUA 4IPGA 1CKNA 4DKAC 3S1MH 4A3JH 4JI5L 5LMNQ 4LFBL 3EBEA 1OXTA 2NVYH 4DV5Q 2ZM6L 2Y0SE 4R4IA 3U4ZA 1PH4A 2OCEA 3CPWA 2UUCQ 3CW2C 4LF6Q 4DRFA 1VQ6A 5IT9c 1XTDA 2PMZE 1Q1BA 3E0EA 3UE0A 4NXML 4LW1A 4P75A 1XMQQ 1HNWQ 3CCUA 1GVPA 4DK3C 2OQ0A 1V43A 2R7DA 2E5LL 3PO2H 2JE6I 2NZHA 1N8RC 1EIYB 1D7QA 2ZJQA 4LH6A 4UY8C 1CUKA 2ID0A 4R4OA 4A3KH 1HR0L 1I6HH 1HR0W 1S3OA 4GN5A 1N36Q 5C44G 3RN2A 1DGSA 3UDIA 5IWAQ 3PUWA 4QIWE 3G6EA 3T1HQ 4LF4L 4NXMQ 1QVFA 4KLKA 4DV7Q 4L5QA 2QGQA 4UPAA 2AWOA 4YY3L 5DISC 2KCMA 3GDEA 4GS3A 4MNOA 4X64L 5C44H 5C4JH 3H0GH 4PZ6A 4GNXA 1RIPA 3AFQA 1J5EQ 1T9HA 4B3SL 2UXCL 5M3MG 3TRZA 2HVQA 4JI3L 4P72A 5D1OB 4HJ7A 2YTYA 4L5RC 3F8TA 1XMOL 2OQKA 1X54A 2Z6KC 1QUQA 4IOCA 1N32Q 4WJ3M 1CKOA 3GTPH 3FP9A 4C3IH 3GTLH 2JEAI 2BH8A 3PUZA 2JK8A 1PH1A 2R7ZG 4JBMA 2L15A 3RZDH 3M4OH 3G48A 2NZOA 2C35B 2K50A 4DV3L 2VQEQ 2MQHA 4DV2Q 3PF5A 1S40A 3KFUA 2Z6KA 2R92H 3HKSA 1G6PA 1VCIA 2UUBQ 1WYDA 2GN5A 2KHJA 4EX5A 4B3TQ 4O2DA 1I3QH 4JV5Q 4R4TA 4X65L 3M3YH 2LXJA 2ZJRA 2A1AA 1CKNB 2PI2A 1M1KC 4HTPA 3KF8B 4GKJL 1P16A 4LFCL 3I56A 1Z9FA 3TQYA 4TQUS 4IFDJ 2DGYA 2KENA 3BAAA 2JA7H 1EIFA 2MO0A 4A3IH 3GTQH 4B3RL 4E6NA 2HIXA 1JJ2A 1XNQQ 3S24A 1FJGQ 4GNXB 2UXCQ 1A63A 3RTXA 1YHAA 1TWGH 2ZJPA 1SLJA 2RHQB 2B3GA 2CKZB 3GTOH 1EFWA 2K75A 4BBSH 1X55A 3VNNA 1W2BA 4YHHL 4BXXG 1Y1WG 1S72A 1KXLA 5ELOA 4OO1I 4KI0A 2BA1A 4GLVB 2YYZA 3A5ZB 2WAQE 1WOCA 1NY4A 2KBNA 3F2DA 4GNXC 4BY7G 1JJGA 1SROA 1KIXA 1MJCA 4JI8Q 5HY6A 2AKWB 3TREA 1OXUA 1Z47A 3F2BA 1D8LA 2R92G 1BKBA 3HFZB 4AYBE 4K0KL 2K4KA 2VQFL 1UWVA 2KCTA 1XMQL 1PH5A 1HNWL 4QY7A 1GKHA 1Q81C 3W1GA 2ZTDA 3L7ZC 1E7ZA 4LFAQ 2UXBQ 4AQYQ 4AH6A 4EFEA 2F52A 2E2HH 2EIFA 1VQ5A 5JJLA 1S68A 3BA9A 1UE1A 3NBYB 4LF9Q 1TWHH 1AE3A 1QUQB 3JAMi 4HIKA 4HJ9A 5IYBH 3DLLA 3FHWA 4A3LH 4A75A 4C2MH 3STBC 5J3BA 5IYDH 1QZGA 4OO1G 4GKKQ 1BBUA 4EFBA 2IT1A 1B70B 4JI1Q 2R7FA 2B63H 3S17H 1VS0A 4JCVE 2WP8J 3OTOQ 4A76A 2UXDL 1J5EL 5M5XH 4CC5A 4IPCA 3GTKH 2EQSA 3CC7A 4B3TL 1L0WA 3S1QH 2MFIA 4GN3B 3UDGA 4UP9A 4UP7A 3WWVA 2ZTCA 1VQGA 3PUVA 1PA6A 1JMCA 3CC2A 3HOWG 1VQCA 1V1QA 4QGUA 1OXSC 1CKMA 1SMXA 2K5NA 2XGTA 2B29A 2R93H 3TS2A 5FLMG 1XNRQ 2IX1A 4JI1L 5JJIA 4JI6Q 3RR5A 4DV0Q 1U0LA 3HOUG 2IHFA 3K0XA 1G291 4NXNL 4P73A 5FPOA 1NJIC 3PF4A 1VQKA 4YHHQ 2VW9A 4DAMA 2WB1G 3STBD 4A3GG 3DM3A 1J6QA 3M4QA 1PVOA 2VS1A 1X6OA 3H15A 2JA6G 3JSLA 4DR6Q 5HGQA 3CP0A 4JI6L 4GKJQ 4XIGS 2YTVA 2Y0SG 5IWAL 4IO9A 4LF4Q 2VQFQ 3S1NH 4OX9L 2CCZA 4LUVA 4K0KQ 1HNZL 4PZ8A 3HOVH 2Q2HA 3CAMA 4HIMA 1HZ9A 3KDFB 2VY3A 4RMFA 1K9MC 1UE5A 4X65Q 5C0XJ 3HOWH 1OXVA 4JI2Q 2KHIA 1K3RA 1X56A 3AQQA 3ER0A 4TVAB 3PGZA 1Y1VG 5IP7G 4JI2L 3S14H 1KAWA 2JA8G 4JBWA 3CCJA 5LMNW 1WCMH 4KHPL 2E2IH 1PH7A 4IPHA 1K8GA 4DR4Q 3I4OA 3CPFA 1SE8A 1VQBA 1AE2A 2K14A 4LUZA 3H3VH 4GKKL 2B63G 3A74A 5IP9H 2UU9Q 2I0QA 3OTOL 5AJ3Q 5GROA 3G71A 3CXCA 3TY5A 4B3ML 4JI3Q 4ME3A 1YJ9A 4B3SQ 1G51A 5FJ8H 2IHEA 1XMOQ 4DV1Q 3KOJA 4KHPQ 4A3EG 5C3EH 4APVA 5C4XH 4DR7Q 1KHIA 4POGA 4A3BG 4FDBA 4LF9L 3ULJA 1GO3E 4HIDA 2PNHA 1KC8C 2GVAA 4DR4L 4A3FH 4A3JG 1VQ4A 2AHOB 4J15A 3CCEA 3CCRA 1XPOA 1HR0Q 2NN6I 1JB7A 1K73C 4DV7L 2Q2UA 3HOUH 3CCMA 3T1HL 1XNRL 3KJOA 1CSQA 3MEFA 3ULPA 2FXQA 1NE3A 4IJLA 4A4IA 1N34L 3KYHC 3JAMc 3PV0A 1E24A 4DUYL 3I4MH 2I5HA 3S1RH 4OWWB 1WJJA 3NELA 3UQ8A 1IXRA 2UUAL 3PO3H 1VQEA 1VQ7A 1LYLA 4QJFA 2H5XA 4KHZA 4BXXH 4LF6L 1QVCA 4P71A 3J80i 3UDFA 1PH8A 1IYJB 1YBYA 1TXYA 4B3RQ 3FKIH 4NPSA 4LF8L 4A3MG 1U5KA 4HJ5A 1PHJA 4POFA 3GTJH 2CQOA 1YITA 1FJGL 1VQHA 1E1OA 1XDNA 4YWLA 4NXNQ 1QZHA 4JBKA 3UE1A 1IL2A 2JA8H 1HNXL 3S2DH 4LF7Q 3VDYA 1AH9A 3I2ZA 2N8NA 3CCQA 4OWTB 4UCOA 2UUBL 4AQYL 1YEZA 4DV6L 5GAGC 1YNXA 4LF5L 1OXXK 3CCLA 5ELNA 2D0OA 3HOXH 3KLWA 1VQDA 3CMAA 1NBWA 3RNUA 4JI7L 2D0PA 4DV2L 1YI2A 4A93G 5IYDG 2HHHL 1Q7YC 3QWUA 5FLMH 2WB1E 3J7A5 3NC0B 1NTGA 5C4XG 2VUMG 3PUXA 3A5UA 3TS0A 2QEXA 3PSIA 1W3SA 1SN8A 1Y14B 1E22A 1LUZA 1HNXQ 1ASZA 2NVTH 4A3BH 4JYAQ 3BA8A 2ALYB 4JBJA 2NVXH 2XTIA 4BY1G 3NBZB 3NENA 3CCSA 1H95A 3I7FA 5IE8A 1EQQA 3B6YA 4LF8Q 1N9WA 2JA5G 2ZTEA 3K8AA 3CMEA 4LUOA 3AEVA 5M3FG 4YY3Q 3T1YQ 3HOYG 5IYCG 2N49A 3K7AH 4HJAA 3OW2A 3J81i 3K7UC 2PI2E 4DPGA 3PIPA 4X64Q 2JA5H 4JI0L 2IY5B 3F2CA 4LFAL 4BA1I 4EEQA 5JEAG 5IYCH 4L5SA 3L2PA 3D0FA 4RG1A 1X3GA 5H1SE 4DV6Q 1VQNA 4C3HH 1N34Q 4HTOA 5GAHC 4A3FG 1ASYA 2E5LQ 3U50C 2K52A 4AYBG 1IZ6A 4LF7L 3CCVA 5BR8Q 2HVSA 1TWCH 1QVGA 1X9NA 2A19A 3LGJA 1C7YA 2N3SA 1PV4A 3FKIG 5K36G 4Y52H 4A93H 4DNIA 2D62A 3GTMH 3J81c 5D1OA 1VQLA 1SRUA 1PYSB 5GADC 5IY0A 1VQ8A 4R4QA 4WJ4A 1EWIA 1EQRA 1Q8KA 1NMGA 4JI4L 4UCSA 4OWXB 4JI4Q 4JOIA 2R7ZH 3G4SA 1P8LA 5FPRA 1YJWA 3W1BA 4A3EH 1L1OC 2I5LX 4IJHA 3HOXG 1HZCA 1HH2P 2UUAQ 1A8VA 2I5MX 1PH9A 3S15H 1X65A 5LMNL 1XK5A 3JC66 4MZ9A 1VQIA 1KRTA 4GLXA 4AIMA 5BR8L 1GM5A 2UU9L 2DUDA 1PFSA 4LFCQ 4DV4L 4JOIC 2LSSA 1JT8A 1NMFA 1X3EA 1YVCA 1B7YB 3K80C 3OYYA 1L1OA 5LMUQ 3MXNB 3CD6A 1B8AA 4P74A 4DV3Q 1K0RA 2R93G 1PH3A 4BY7H 3S2HH 1UE7A 2JA7G 5M5WH 1JJCB 5C0XI 3RN5A 2UXDQ 4JG2A 1YHBA 2OWOA 4DR7L 4A3KG 1L1OB 3U58A 1N32L 1JE5A 3J81j 4GOPB 3PO3G 2AMCB 3HKZG 3GJXB 4GN4B 1L2FA 3AYHB 2EXDA 2N78A 3GD7A 3H0GG 4EQ5A 4H02A 4ALPA 1E3PA 4DAYB 1IBKL 1IBKQ 4HJ8A 4BBRH 3A0JA 1Q86C 4DR6L 2E2JH 5IYBG 3KF6B 4CC6A 2MNAA 2VUGA 1VQMA 1Q82C 1I50H 3PIOA 1IBLL 2HVRA 4O0AA 3ICEA 3J80c 4HIOA 3NBHB 2HHHQ 4BY1H 4IFDI 2RCNA 5EAYA 3HOVG 1VQJA 1WFQA 4DR1Q 4X66L 3M7NA 1V9PA 1YHQA 3RLNA 1RL2A 4YCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X G;  3GB8 B;  1R9T H;  2YV5 A;  2A8V A;  2RHS B;  3EN2 A;  4DV4 Q;  2F4V L;  3W5O A;  2PQA B;  3RZO H;  4DK6 C;  2OTJ A;  4IOA A;  1B04 A;  1HZA A;  3BU2 A;  2VQE L;  2E8G A;  4X62 Q;  4JC0 A;  4LNQ A;  4X66 Q;  2V1C C;  4JI0 Q;  1PH2 A;  3BZK A;  3I55 A;  5FJ8 G;  4A3L G;  2JEB I;  1I5F A;  1XPU A;  4IFD G;  1EUJ A;  3CF5 A;  2WAQ G;  3KF6 A;  1UEB A;  1HJP A;  3UDX A;  3HKZ E;  3HOZ G;  1K8A C;  3KJP A;  1BBW A;  4A3G H;  1EOV A;  2GVB A;  3BZC A;  3D31 A;  2ZM6 Q;  1MJE A;  1N33 L;  3CQZ H;  4IPD A;  3TY8 A;  4B3M Q;  1VQ9 A;  3M4P A;  2F3I A;  3TY9 A;  1IBM Q;  5AJ3 L;  2VUM H;  3PCO B;  3S16 H;  4X6A H;  1GD7 A;  4A3C H;  3RLF A;  3GTG H;  1KD1 C;  4JYA L;  2K5H A;  4DR2 Q;  1CSP A;  4GLA C;  5DLQ E;  1X3F A;  2MO1 A;  1FVI A;  3E9H A;  2QA4 A;  1SFO H;  4YWM A;  4R4C A;  1HZB A;  4YWK A;  1Q12 A;  2RF4 A;  4DR1 L;  1E1T A;  4A3D H;  2PQA A;  2AWN A;  3IRB A;  1M90 C;  1MIU A;  5C3E G;  2NVQ H;  2LXK A;  5JJK A;  4JI8 L;  4UFZ A;  4LF5 Q;  3T1Y L;  5LMU L;  1XPR A;  1XJV A;  2IX0 A;  2ASB A;  2HIV A;  1VQO A;  4DR2 L;  3KDF A;  2JA6 H;  2JA9 A;  4OON A;  3K81 C;  4OX9 Q;  5GAE C;  4YCV A;  1SR3 A;  1IBM L;  5IP9 G;  3BJU A;  4A3M H;  2BH2 A;  4OXP A;  1VQP A;  2ATW A;  1C0A A;  1Q46 A;  1TWF H;  5M3M H;  2JJQ A;  3ULL A;  4DUZ L;  5M5Y H;  2UUC L;  1KL9 A;  1LTL A;  3I4N H;  2R6G A;  1Q1E A;  2HQL A;  3PN1 A;  2BA0 A;  5E7N A;  4JI5 Q;  4LFB Q;  5FLX c;  4XTC S;  4QL5 A;  3PUY A;  1A62 A;  1K83 H;  1TWA H;  4LH7 A;  4C3J H;  1LM0 A;  4X62 L;  1BVS A;  1WCM G;  4PZ7 A;  2Q2T A;  3U4V A;  1TAE A;  1HNZ Q;  5D1P A;  4DUY Q;  4PG3 A;  1Y1V H;  1I94 L;  1MKH A;  3I4N G;  3SGI A;  4A3D G;  4NB3 A;  1O7I A;  1EYG A;  3TEH B;  2NN6 G;  3GO5 A;  3NEM A;  3I4M G;  2K5V A;  3E9I A;  3ERS X;  4DUZ Q;  3PO2 G;  4UCT A;  2VZA A;  3L0O A;  4PMW A;  4GOP C;  4A3I G;  4DR3 Q;  1FL0 A;  1KQS A;  1WI5 A;  4YCU A;  4DV5 L;  1A0I A;  3H3V I;  1XNQ L;  4A3C G;  1C9O A;  2VNU D;  3M9B A;  1KRS A;  1IBL Q;  3CC4 A;  1N33 Q;  4BBS G;  4BBR G;  1TA8 A;  4UCR A;  2JQO A;  4Y7N H;  2VL6 A;  2CWA A;  1VQA A;  4DR5 Q;  4DV0 L;  3JSN A;  2Q2I A;  2YTX A;  2YU9 H;  2ES2 A;  4MTN A;  4GOP A;  3HOZ H;  1OTC A;  5JEA J;  3Q8D A;  3J7Z C;  4DR3 L;  4BA2 I;  4LWC A;  1YZ6 A;  1YJN A;  2UXB L;  1Y1W H;  3BAB A;  3EIV A;  3M85 A;  1YIJ A;  3RLO A;  4UCV A;  2OTL A;  1FGU A;  1VQF A;  2F4V Q;  4JI7 Q;  1N36 L;  4R1J A;  4L5T A;  5M3F H;  1I94 Q;  3HOY H;  4JV5 L;  5GQO A;  3F1Z A;  1PYB A;  3AFP A;  2HT1 A;  2CWP A;  2Z0S A;  4QQB X;  1PH6 A;  4UP8 A;  2CFM A;  3ZJY C;  5IP7 H;  4DV1 L;  4DR5 L;  2WFW A;  1UE6 A;  4UCU A;  4IPG A;  1CKN A;  4DKA C;  3S1M H;  4A3J H;  4JI5 L;  5LMN Q;  4LFB L;  3EBE A;  1OXT A;  2NVY H;  4DV5 Q;  2ZM6 L;  2Y0S E;  4R4I A;  3U4Z A;  1PH4 A;  2OCE A;  3CPW A;  2UUC Q;  3CW2 C;  4LF6 Q;  4DRF A;  1VQ6 A;  5IT9 c;  1XTD A;  2PMZ E;  1Q1B A;  3E0E A;  3UE0 A;  4NXM L;  4LW1 A;  4P75 A;  1XMQ Q;  1HNW Q;  3CCU A;  1GVP A;  4DK3 C;  2OQ0 A;  1V43 A;  2R7D A;  2E5L L;  3PO2 H;  2JE6 I;  2NZH A;  1N8R C;  1EIY B;  1D7Q A;  2ZJQ A;  4LH6 A;  4UY8 C;  1CUK A;  2ID0 A;  4R4O A;  4A3K H;  1HR0 L;  1I6H H;  1HR0 W;  1S3O A;  4GN5 A;  1N36 Q;  5C44 G;  3RN2 A;  1DGS A;  3UDI A;  5IWA Q;  3PUW A;  4QIW E;  3G6E A;  3T1H Q;  4LF4 L;  4NXM Q;  1QVF A;  4KLK A;  4DV7 Q;  4L5Q A;  2QGQ A;  4UPA A;  2AWO A;  4YY3 L;  5DIS C;  2KCM A;  3GDE A;  4GS3 A;  4MNO A;  4X64 L;  5C44 H;  5C4J H;  3H0G H;  4PZ6 A;  4GNX A;  1RIP A;  3AFQ A;  1J5E Q;  1T9H A;  4B3S L;  2UXC L;  5M3M G;  3TRZ A;  2HVQ A;  4JI3 L;  4P72 A;  5D1O B;  4HJ7 A;  2YTY A;  4L5R C;  3F8T A;  1XMO L;  2OQK A;  1X54 A;  2Z6K C;  1QUQ A;  4IOC A;  1N32 Q;  4WJ3 M;  1CKO A;  3GTP H;  3FP9 A;  4C3I H;  3GTL H;  2JEA I;  2BH8 A;  3PUZ A;  2JK8 A;  1PH1 A;  2R7Z G;  4JBM A;  2L15 A;  3RZD H;  3M4O H;  3G48 A;  2NZO A;  2C35 B;  2K50 A;  4DV3 L;  2VQE Q;  2MQH A;  4DV2 Q;  3PF5 A;  1S40 A;  3KFU A;  2Z6K A;  2R92 H;  3HKS A;  1G6P A;  1VCI A;  2UUB Q;  1WYD A;  2GN5 A;  2KHJ A;  4EX5 A;  4B3T Q;  4O2D A;  1I3Q H;  4JV5 Q;  4R4T A;  4X65 L;  3M3Y H;  2LXJ A;  2ZJR A;  2A1A A;  1CKN B;  2PI2 A;  1M1K C;  4HTP A;  3KF8 B;  4GKJ L;  1P16 A;  4LFC L;  3I56 A;  1Z9F A;  3TQY A;  4TQU S;  4IFD J;  2DGY A;  2KEN A;  3BAA A;  2JA7 H;  1EIF A;  2MO0 A;  4A3I H;  3GTQ H;  4B3R L;  4E6N A;  2HIX A;  1JJ2 A;  1XNQ Q;  3S24 A;  1FJG Q;  4GNX B;  2UXC Q;  1A63 A;  3RTX A;  1YHA A;  1TWG H;  2ZJP A;  1SLJ A;  2RHQ B;  2B3G A;  2CKZ B;  3GTO H;  1EFW A;  2K75 A;  4BBS H;  1X55 A;  3VNN A;  1W2B A;  4YHH L;  4BXX G;  1Y1W G;  1S72 A;  1KXL A;  5ELO A;  4OO1 I;  4KI0 A;  2BA1 A;  4GLV B;  2YYZ A;  3A5Z B;  2WAQ E;  1WOC A;  1NY4 A;  2KBN A;  3F2D A;  4GNX C;  4BY7 G;  1JJG A;  1SRO A;  1KIX A;  1MJC A;  4JI8 Q;  5HY6 A;  2AKW B;  3TRE A;  1OXU A;  1Z47 A;  3F2B A;  1D8L A;  2R92 G;  1BKB A;  3HFZ B;  4AYB E;  4K0K L;  2K4K A;  2VQF L;  1UWV A;  2KCT A;  1XMQ L;  1PH5 A;  1HNW L;  4QY7 A;  1GKH A;  1Q81 C;  3W1G A;  2ZTD A;  3L7Z C;  1E7Z A;  4LFA Q;  2UXB Q;  4AQY Q;  4AH6 A;  4EFE A;  2F52 A;  2E2H H;  2EIF A;  1VQ5 A;  5JJL A;  1S68 A;  3BA9 A;  1UE1 A;  3NBY B;  4LF9 Q;  1TWH H;  1AE3 A;  1QUQ B;  3JAM i;  4HIK A;  4HJ9 A;  5IYB H;  3DLL A;  3FHW A;  4A3L H;  4A75 A;  4C2M H;  3STB C;  5J3B A;  5IYD H;  1QZG A;  4OO1 G;  4GKK Q;  1BBU A;  4EFB A;  2IT1 A;  1B70 B;  4JI1 Q;  2R7F A;  2B63 H;  3S17 H;  1VS0 A;  4JCV E;  2WP8 J;  3OTO Q;  4A76 A;  2UXD L;  1J5E L;  5M5X H;  4CC5 A;  4IPC A;  3GTK H;  2EQS A;  3CC7 A;  4B3T L;  1L0W A;  3S1Q H;  2MFI A;  4GN3 B;  3UDG A;  4UP9 A;  4UP7 A;  3WWV A;  2ZTC A;  1VQG A;  3PUV A;  1PA6 A;  1JMC A;  3CC2 A;  3HOW G;  1VQC A;  1V1Q A;  4QGU A;  1OXS C;  1CKM A;  1SMX A;  2K5N A;  2XGT A;  2B29 A;  2R93 H;  3TS2 A;  5FLM G;  1XNR Q;  2IX1 A;  4JI1 L;  5JJI A;  4JI6 Q;  3RR5 A;  4DV0 Q;  1U0L A;  3HOU G;  2IHF A;  3K0X A;  1G29 1;  4NXN L;  4P73 A;  5FPO A;  1NJI C;  3PF4 A;  1VQK A;  4YHH Q;  2VW9 A;  4DAM A;  2WB1 G;  3STB D;  4A3G G;  3DM3 A;  1J6Q A;  3M4Q A;  1PVO A;  2VS1 A;  1X6O A;  3H15 A;  2JA6 G;  3JSL A;  4DR6 Q;  5HGQ A;  3CP0 A;  4JI6 L;  4GKJ Q;  4XIG S;  2YTV A;  2Y0S G;  5IWA L;  4IO9 A;  4LF4 Q;  2VQF Q;  3S1N H;  4OX9 L;  2CCZ A;  4LUV A;  4K0K Q;  1HNZ L;  4PZ8 A;  3HOV H;  2Q2H A;  3CAM A;  4HIM A;  1HZ9 A;  3KDF B;  2VY3 A;  4RMF A;  1K9M C;  1UE5 A;  4X65 Q;  5C0X J;  3HOW H;  1OXV A;  4JI2 Q;  2KHI A;  1K3R A;  1X56 A;  3AQQ A;  3ER0 A;  4TVA B;  3PGZ A;  1Y1V G;  5IP7 G;  4JI2 L;  3S14 H;  1KAW A;  2JA8 G;  4JBW A;  3CCJ A;  5LMN W;  1WCM H;  4KHP L;  2E2I H;  1PH7 A;  4IPH A;  1K8G A;  4DR4 Q;  3I4O A;  3CPF A;  1SE8 A;  1VQB A;  1AE2 A;  2K14 A;  4LUZ A;  3H3V H;  4GKK L;  2B63 G;  3A74 A;  5IP9 H;  2UU9 Q;  2I0Q A;  3OTO L;  5AJ3 Q;  5GRO A;  3G71 A;  3CXC A;  3TY5 A;  4B3M L;  4JI3 Q;  4ME3 A;  1YJ9 A;  4B3S Q;  1G51 A;  5FJ8 H;  2IHE A;  1XMO Q;  4DV1 Q;  3KOJ A;  4KHP Q;  4A3E G;  5C3E H;  4APV A;  5C4X H;  4DR7 Q;  1KHI A;  4POG A;  4A3B G;  4FDB A;  4LF9 L;  3ULJ A;  1GO3 E;  4HID A;  2PNH A;  1KC8 C;  2GVA A;  4DR4 L;  4A3F H;  4A3J G;  1VQ4 A;  2AHO B;  4J15 A;  3CCE A;  3CCR A;  1XPO A;  1HR0 Q;  2NN6 I;  1JB7 A;  1K73 C;  4DV7 L;  2Q2U A;  3HOU H;  3CCM A;  3T1H L;  1XNR L;  3KJO A;  1CSQ A;  3MEF A;  3ULP A;  2FXQ A;  1NE3 A;  4IJL A;  4A4I A;  1N34 L;  3KYH C;  3JAM c;  3PV0 A;  1E24 A;  4DUY L;  3I4M H;  2I5H A;  3S1R H;  4OWW B;  1WJJ A;  3NEL A;  3UQ8 A;  1IXR A;  2UUA L;  3PO3 H;  1VQE A;  1VQ7 A;  1LYL A;  4QJF A;  2H5X A;  4KHZ A;  4BXX H;  4LF6 L;  1QVC A;  4P71 A;  3J80 i;  3UDF A;  1PH8 A;  1IYJ B;  1YBY A;  1TXY A;  4B3R Q;  3FKI H;  4NPS A;  4LF8 L;  4A3M G;  1U5K A;  4HJ5 A;  1PHJ A;  4POF A;  3GTJ H;  2CQO A;  1YIT A;  1FJG L;  1VQH A;  1E1O A;  1XDN A;  4YWL A;  4NXN Q;  1QZH A;  4JBK A;  3UE1 A;  1IL2 A;  2JA8 H;  1HNX L;  3S2D H;  4LF7 Q;  3VDY A;  1AH9 A;  3I2Z A;  2N8N A;  3CCQ A;  4OWT B;  4UCO A;  2UUB L;  4AQY L;  1YEZ A;  4DV6 L;  5GAG C;  1YNX A;  4LF5 L;  1OXX K;  3CCL A;  5ELN A;  2D0O A;  3HOX H;  3KLW A;  1VQD A;  3CMA A;  1NBW A;  3RNU A;  4JI7 L;  2D0P A;  4DV2 L;  1YI2 A;  4A93 G;  5IYD G;  2HHH L;  1Q7Y C;  3QWU A;  5FLM H;  2WB1 E;  3J7A 5;  3NC0 B;  1NTG A;  5C4X G;  2VUM G;  3PUX A;  3A5U A;  3TS0 A;  2QEX A;  3PSI A;  1W3S A;  1SN8 A;  1Y14 B;  1E22 A;  1LUZ A;  1HNX Q;  1ASZ A;  2NVT H;  4A3B H;  4JYA Q;  3BA8 A;  2ALY B;  4JBJ A;  2NVX H;  2XTI A;  4BY1 G;  3NBZ B;  3NEN A;  3CCS A;  1H95 A;  3I7F A;  5IE8 A;  1EQQ A;  3B6Y A;  4LF8 Q;  1N9W A;  2JA5 G;  2ZTE A;  3K8A A;  3CME A;  4LUO A;  3AEV A;  5M3F G;  4YY3 Q;  3T1Y Q;  3HOY G;  5IYC G;  2N49 A;  3K7A H;  4HJA A;  3OW2 A;  3J81 i;  3K7U C;  2PI2 E;  4DPG A;  3PIP A;  4X64 Q;  2JA5 H;  4JI0 L;  2IY5 B;  3F2C A;  4LFA L;  4BA1 I;  4EEQ A;  5JEA G;  5IYC H;  4L5S A;  3L2P A;  3D0F A;  4RG1 A;  1X3G A;  5H1S E;  4DV6 Q;  1VQN A;  4C3H H;  1N34 Q;  4HTO A;  5GAH C;  4A3F G;  1ASY A;  2E5L Q;  3U50 C;  2K52 A;  4AYB G;  1IZ6 A;  4LF7 L;  3CCV A;  5BR8 Q;  2HVS A;  1TWC H;  1QVG A;  1X9N A;  2A19 A;  3LGJ A;  1C7Y A;  2N3S A;  1PV4 A;  3FKI G;  5K36 G;  4Y52 H;  4A93 H;  4DNI A;  2D62 A;  3GTM H;  3J81 c;  5D1O A;  1VQL A;  1SRU A;  1PYS B;  5GAD C;  5IY0 A;  1VQ8 A;  4R4Q A;  4WJ4 A;  1EWI A;  1EQR A;  1Q8K A;  1NMG A;  4JI4 L;  4UCS A;  4OWX B;  4JI4 Q;  4JOI A;  2R7Z H;  3G4S A;  1P8L A;  5FPR A;  1YJW A;  3W1B A;  4A3E H;  1L1O C;  2I5L X;  4IJH A;  3HOX G;  1HZC A;  1HH2 P;  2UUA Q;  1A8V A;  2I5M X;  1PH9 A;  3S15 H;  1X65 A;  5LMN L;  1XK5 A;  3JC6 6;  4MZ9 A;  1VQI A;  1KRT A;  4GLX A;  4AIM A;  5BR8 L;  1GM5 A;  2UU9 L;  2DUD A;  1PFS A;  4LFC Q;  4DV4 L;  4JOI C;  2LSS A;  1JT8 A;  1NMF A;  1X3E A;  1YVC A;  1B7Y B;  3K80 C;  3OYY A;  1L1O A;  5LMU Q;  3MXN B;  3CD6 A;  1B8A A;  4P74 A;  4DV3 Q;  1K0R A;  2R93 G;  1PH3 A;  4BY7 H;  3S2H H;  1UE7 A;  2JA7 G;  5M5W H;  1JJC B;  5C0X I;  3RN5 A;  2UXD Q;  4JG2 A;  1YHB A;  2OWO A;  4DR7 L;  4A3K G;  1L1O B;  3U58 A;  1N32 L;  1JE5 A;  3J81 j;  4GOP B;  3PO3 G;  2AMC B;  3HKZ G;  3GJX B;  4GN4 B;  1L2F A;  3AYH B;  2EXD A;  2N78 A;  3GD7 A;  3H0G G;  4EQ5 A;  4H02 A;  4ALP A;  1E3P A;  4DAY B;  1IBK L;  1IBK Q;  4HJ8 A;  4BBR H;  3A0J A;  1Q86 C;  4DR6 L;  2E2J H;  5IYB G;  3KF6 B;  4CC6 A;  2MNA A;  2VUG A;  1VQM A;  1Q82 C;  1I50 H;  3PIO A;  1IBL L;  2HVR A;  4O0A A;  3ICE A;  3J80 c;  4HIO A;  3NBH B;  2HHH Q;  4BY1 H;  4IFD I;  2RCN A;  5EAY A;  3HOV G;  1VQJ A;  1WFQ A;  4DR1 Q;  4X66 L;  3M7N A;  1V9P A;  1YHQ A;  3RLN A;  1RL2 A;  4YCW A; 
#chains in the Genus database with same CATH topology
 4L8J A;  5C0X G;  3GB8 B;  1DCZ A;  2VQD A;  4DV4 Q;  4ABN A;  5CA0 F;  1WTH A;  2NU9 B;  1GUG A;  1A48 A;  5IIF A;  3MWD A;  1KBL A;  2F4V L;  2OTJ A;  2X6L A;  3HOW B;  3DAA A;  4X62 Q;  5K5P A;  2V1C C;  2XWB B;  4EQP A;  3I55 A;  4IFD G;  4EGJ A;  1EUJ A;  2WAQ G;  3UDX A;  1ZKO A;  3HKZ E;  5TSS A;  3MXN A;  4NZO A;  1EOV A;  2GQS A;  1MJE A;  1N33 L;  3CQZ H;  4IPD A;  3U9O A;  2DAB A;  3K5M A;  1VQ9 A;  2F0W A;  2F3I A;  3P1H A;  1GD7 A;  4A3C H;  3GTG H;  1KD1 C;  2DNC A;  3E0J A;  2K5H A;  1AEX A;  5CE8 A;  1CSP A;  4CDD C;  1HUN A;  2HDL A;  1X3F A;  3NSW A;  2E2J B;  5BPH A;  5I5W A;  1SFO H;  3OUU A;  4FXG C;  4QCL A;  3K5N A;  2RF4 A;  1DXM A;  2NVQ H;  4CKC A;  5C3E G;  1V1O A;  3P20 A;  4LF5 Q;  1JKJ B;  1XPR A;  4NZM A;  1CTM A;  2IX0 A;  2HIV A;  3K5L A;  3H0G B;  1VQO A;  3KDF A;  1XWE A;  4OON A;  2YZN A;  5GAE C;  3S1Q B;  5LA6 F;  1BR9 A;  4YCV A;  3I72 A;  1E4E B;  5KYI A;  4K5V A;  3NK9 A;  5ELE A;  4ZUI A;  4OXP A;  1OO9 B;  2JJQ A;  3Q0A A;  3ULL A;  1I2L A;  5M5Y H;  1KL9 A;  1B50 A;  3M3Y B;  4JI5 Q;  1TQO A;  1A62 A;  2B2T A;  2R7M A;  1HTP A;  4DNR B;  3ONA B;  4C3J H;  4X62 L;  5LP6 F;  3N8D A;  1HNZ Q;  5FO9 B;  4DUY Q;  2F0D A;  1EYC A;  1HFN A;  1MKH A;  2AQ3 B;  1YNJ D;  3KK7 A;  4OEL B;  3GTM B;  3I4M G;  3E9I A;  5C1P A;  3PO2 G;  3L0O A;  4HN2 A;  4X3T A;  1H9M A;  4DV5 L;  1XNQ L;  2NVQ B;  1LAC A;  1IBL Q;  4BBS G;  4BBR G;  1PZI D;  2JQO A;  4I7A A;  2R92 B;  1VQA A;  1BOS A;  2FP4 B;  1EU4 A;  2YTX A;  3UI2 A;  5M5X B;  2F0M A;  4MTN A;  1SCU B;  1DOM A;  2A69 C;  5FK9 C;  4FF2 A;  1AUV A;  3S17 B;  3Q8D A;  4HNV A;  3HOZ B;  2F0T A;  1JQY D;  1YZ6 A;  2F0I A;  4LWC A;  3LWE A;  5I4D A;  3EIV A;  1Y1W H;  2L11 A;  2EJM A;  2NTT A;  2I07 B;  3RLO A;  2AUK A;  1Z7T A;  4C5A A;  4LMQ D;  4HMI A;  5M3F H;  2LS0 1;  4CJ2 C;  4DXF A;  3AU7 A;  2Q8T A;  2G9D A;  5CR3 A;  4XYO A;  1I1M A;  3ZJY C;  5IP7 H;  4B9W A;  5JJZ A;  2EIY A;  4A3J H;  4JI5 L;  5LMN Q;  3EBE A;  1OXT A;  2EJ3 A;  3U4Z A;  3G7L A;  1DON A;  2QB5 A;  1JWM D;  1LTT D;  5DM7 3;  2PMZ E;  2DZD A;  3S15 B;  2RDF A;  3E0E A;  3VYU A;  3UE0 A;  5BYB A;  4DK3 C;  3JRW A;  2E2H B;  1D7Q A;  2ZJQ A;  1IYU A;  4UY8 C;  1EY6 A;  1PRT C;  1SE3 A;  1CUK A;  2K05 A;  4A3K H;  3KF8 A;  1S3O A;  1HA6 A;  4ZRZ A;  2YU9 B;  1DGS A;  2L1B A;  4UPA A;  2BE5 C;  4P2C B;  5C44 H;  1SYC A;  1J5E Q;  1T9H A;  4B3S L;  1QWY A;  5M3M G;  3TRZ A;  3MTS A;  5M3F B;  2F0U A;  4HJ7 A;  2YTY A;  1XMO L;  3HRZ C;  1X54 A;  2Z6K C;  3T54 A;  4NDX A;  2KCC A;  2EJ2 A;  3FP9 A;  3GV3 A;  3SE0 A;  2WIN B;  5J1Z A;  2P0A A;  2JEA I;  3PUZ A;  1PH1 A;  1CM9 A;  3RZD H;  3M4O H;  2HHF B;  4DV3 L;  3FPU B;  3IFD A;  2X69 A;  2MQH A;  4UDU C;  1O7L A;  2VQE Q;  4DV2 Q;  1MHW C;  2BDN A;  1VCI A;  1Q3L A;  2KHJ A;  2LY7 A;  4B3T Q;  4EX5 A;  1B6S A;  4I55 F;  1IYV A;  3SK8 A;  4ZYS A;  4R4T A;  4KJO A;  3TP8 A;  1NSN S;  2X0S A;  5DGH A;  2XWJ B;  4IFD J;  2DGY A;  2VR1 A;  3GTQ H;  1JJ2 A;  1XNQ Q;  1GXD C;  1PFN A;  1FJG Q;  4XQQ A;  4CJ1 B;  2WAC A;  3RTX A;  4QMG A;  2ZJP A;  1ZXT A;  2JP1 A;  4QIW B;  1B9M A;  2CKZ B;  3GTO H;  4MV4 A;  4ZAI A;  2HGW A;  3SNO A;  2OT2 A;  4KY6 A;  1K83 B;  5E1F A;  3TZD A;  1KXL A;  1IW7 D;  1ICF B;  2HG8 A;  1EYZ A;  4M0J A;  1VMP A;  2XRS D;  3F2D A;  1NY4 A;  1SRO A;  2KOL A;  3G8C A;  2AKW B;  2DJG C;  1BKB A;  1B4O A;  1R4Q B;  2D9U A;  2ZXO A;  1PH5 A;  1Q81 C;  2CNV A;  5JVH 3;  5I5U A;  4FYD A;  5JJL A;  3NBY B;  2K33 A;  2YZM A;  1TWH H;  1FNV A;  2RCF A;  1UC8 A;  5IYB H;  4HAE A;  3FHW A;  5BWR A;  5CGK A;  3S2H B;  5IYD H;  5J3B A;  1K28 A;  1KJQ A;  1X3Q A;  4JI1 Q;  3S17 H;  2R7F A;  3GTK B;  1RJT A;  3OTO Q;  2WP8 J;  4XQJ A;  4A76 A;  2UXD L;  2AQ2 B;  5EBC A;  5ELB A;  2CH4 W;  2Z6B A;  1PDQ A;  5M5X H;  4IFD H;  1MSG A;  4B3T L;  2CW0 C;  1L0W A;  3K6O A;  2K28 A;  4GN3 B;  1DZ1 A;  3UDG A;  3WWV A;  1ET0 A;  2L5T A;  1CT1 D;  2O2L D;  3GV6 A;  2COI A;  4QGU A;  1OXS C;  2K5N A;  4TRD A;  4PMC A;  2PPB C;  5FLM G;  1XNR Q;  5JJI A;  1QB5 D;  4JI6 Q;  4DV0 Q;  3VYR A;  1D5Z C;  4MA5 A;  4P73 A;  5FLX L;  3HOV B;  3H09 A;  4KTA A;  2LMC B;  1EKF A;  2VW9 A;  3KLS X;  5FNV F;  2WB1 G;  4FVM A;  3JZ6 A;  3DM3 A;  3H15 A;  4DR6 Q;  4JI6 L;  2W71 A;  4GKJ Q;  1EY0 A;  4XIG S;  3Q1K A;  1K8M A;  2F0O A;  4IO9 A;  4XQN A;  1EZ1 A;  5IT9 L;  4K6N A;  4LUV A;  3CRK C;  3R5H A;  5JOB A;  1STB A;  1WTO A;  1GJX A;  2SOB A;  1GGO A;  3HOV H;  5D3D A;  1K9M C;  4HIM A;  1ET6 A;  3OUZ A;  4JI2 Q;  4PQX A;  2TMP A;  5IP7 G;  3S1R B;  1MI2 A;  1H9J A;  4XT3 B;  4YJ3 F;  5LMN W;  2HD3 A;  2E2I H;  1EYA A;  2WII B;  4IPH A;  1PH7 A;  1K8G A;  3I4O A;  5T1I A;  3I4L A;  2EY6 A;  3KLR A;  4C56 C;  1V8Q A;  3A74 A;  2I0Q A;  3TP7 A;  4CJ0 B;  4RHR A;  4XZ3 B;  1G51 A;  2IHE A;  4G4K A;  2FPP B;  3BYT B;  1PTO B;  4O84 A;  5C3E H;  4APV A;  1EY7 A;  3C2P A;  4KJN A;  4LF9 L;  2PBZ A;  2PNH A;  3CCE A;  2M9V A;  2NN6 I;  3D4R A;  4KKU A;  4O7W A;  1G91 A;  1XNR L;  3T1H L;  1EEI D;  3WO1 A;  3ULP A;  4IZ8 A;  3I4M H;  3HGB A;  3PV0 A;  5EPK A;  3JAM c;  3GQB A;  1WJJ A;  2B2Y C;  3NEL A;  1IXR A;  2UUA L;  3UQ8 A;  4WFN 3;  3MEH A;  1LYL A;  2K01 A;  2H5X A;  5C5L A;  1EEF D;  4LF6 L;  1QVC A;  2JSO A;  3C1E A;  3UDF A;  3TQT A;  3I91 A;  1YBY A;  1TXY A;  4DGZ A;  1R9T B;  4B3R Q;  4A3M G;  4RA8 A;  4POF A;  3GTJ H;  1I7L A;  1QNK A;  2CQO A;  3R3O A;  4WBN F;  3R9R A;  1C4Q A;  4YWL A;  1IL2 A;  3JZF A;  3KAK A;  1XTC D;  1HNX L;  3VDY A;  4UCO A;  2N8N A;  1UAP A;  1KTA A;  5GAG C;  1B9N A;  2COJ A;  3T9B A;  3HOX H;  3KLW A;  3VR4 A;  2Q8R E;  4J1M A;  1VQD A;  5HGT A;  4JI7 L;  1PZK D;  2AQ1 B;  1IKM A;  2EYM A;  5IYD G;  3QWU A;  4CGY B;  5FLM H;  2WB1 E;  4J6H A;  4JXU A;  4O4I F;  2RDH A;  4O7S A;  3PSI A;  1W3S A;  1LUZ A;  4A3B H;  2OF1 A;  1HFG A;  4BY1 G;  4NW2 A;  3CCS A;  1Z2P X;  3I7F A;  4ZHQ F;  4AYB B;  3DWA A;  5C4Z A;  2JA5 G;  4A3K B;  3QFF A;  4RHS A;  4JPB W;  2N49 A;  1WTW A;  3S1N B;  3WO0 A;  1S5D D;  4DPG A;  3PIP A;  1SE2 A;  4X64 Q;  3FVQ A;  3F2C A;  5IOC A;  1Q8I A;  4NYE A;  1CHQ D;  5HV6 A;  5DAU A;  4JK1 C;  3R93 A;  4DV6 Q;  1SYB A;  2A6E D;  3NWS A;  4LF7 L;  2EYP A;  2QDB A;  5C4X B;  1TWF B;  1X9N A;  1KLU D;  1PV4 A;  3FKI G;  3KRE A;  4XYL B;  3J81 c;  4ZKC B;  5GAD C;  1NCV A;  1EWI A;  1EQR A;  2R85 A;  2IJ0 A;  1I3Q B;  1P8L A;  2PZT A;  4A3E H;  2NN6 H;  3K5H A;  2V58 A;  3SE7 A;  3HOX G;  1HH2 P;  3OHX C;  1X65 A;  3D4D A;  2BE5 D;  1SE4 A;  4GLX A;  4NMZ A;  5BR8 L;  3PMF A;  1HQR D;  4M1U B;  4H13 C;  3K80 C;  3OYY A;  3T13 A;  5KRU A;  1JT8 A;  5HBR B;  3RD4 A;  4P74 A;  1NR2 A;  1PFM A;  2R93 G;  1ZYR D;  1UC9 A;  4BY7 H;  3QIA A;  1EU3 A;  2CHB D;  3GTJ B;  2OWO A;  3R23 A;  4A3K G;  1B1Z A;  3U58 A;  2AUJ D;  3HKZ G;  1STE A;  2MJ8 A;  4GN4 B;  1U4R A;  1QG7 A;  4ULL A;  2YW2 A;  3GJX B;  3GD7 A;  1E3P A;  1SNM A;  1IBK L;  1Q86 C;  3R2I A;  4HNT A;  5IYB G;  3TIG A;  2DJF C;  1VQM A;  1LO5 D;  1CA5 A;  3ICE A;  3I4M B;  3J80 c;  4C3I B;  4BY1 H;  1I4Q A;  4IFD I;  3S16 B;  4DR1 Q;  2WV6 D;  2H4O A;  4FF4 A;  4JBW A;  1YHQ A;  1RL2 A;  3CHB D;  2Z04 A;  4O7T A;  1DJR D;  3GTO B;  3F2U A;  2M00 A;  4MV3 A;  1EL0 A;  4ZI7 F;  4DK6 C;  4G7H C;  1V1P A;  5CV7 A;  3BU2 A;  3MXP A;  5CM0 A;  5KNC A;  1QE6 A;  4X66 Q;  2BOS A;  3BZK A;  5FJ8 G;  1SJH D;  2B8G A;  1D5M C;  4A3L G;  1A3V A;  1JDE A;  1JOK A;  3CF5 A;  3QWN A;  1UEB A;  5LOV F;  1JLL B;  2ZDQ A;  1K8A C;  3KJP A;  4DAY A;  4A3G H;  1GOZ A;  1ROD A;  1TU2 B;  5AJ3 L;  3S16 H;  5C3E B;  4JYA L;  4KHV A;  1A15 A;  5BN5 A;  3VYT A;  5JQG F;  3E9H A;  2BDO A;  3RUZ A;  4F88 A;  3S1M B;  4OEM B;  4ZK9 B;  4C3I G;  1HZB A;  1VBH A;  4MA0 A;  1JIC A;  2PQA A;  4O7R A;  2LXK A;  4FXK C;  4JI8 L;  5JJK A;  4UFZ A;  5LMU L;  2ASB A;  3Q22 A;  2KUM A;  3LWU A;  4B9X A;  4JVZ A;  4MHE A;  1SR3 A;  1IBM L;  1SEB D;  1W6J A;  4IUU A;  5ISR A;  3HEJ A;  3BJU A;  2K7V A;  3E6Z X;  2X5R A;  3J81 E;  1Q46 A;  5M3M H;  3N6R A;  4XYM B;  1MGS A;  3N52 A;  2R6G A;  1O80 A;  2HQL A;  5E7N A;  1A3T A;  1K3B C;  3RFC A;  1SJE D;  2F1M A;  4G7Z C;  4DQN A;  4LH7 A;  1JWU D;  2P5Z X;  3U4V A;  3C46 A;  1ENF A;  4MV6 A;  4PG3 A;  2DY8 A;  1PK8 A;  1DIK A;  3BDO A;  1UEA B;  3CRL C;  4O82 A;  2B2T C;  3TEH B;  4DUZ Q;  1ILQ A;  4RGT A;  2NVT B;  1GSO A;  4YCU A;  1A0I A;  3H3V I;  1X3P A;  2W6Q A;  1YNN C;  3M9B A;  1KRS A;  3GID A;  1N33 Q;  4UCR A;  1G8Z D;  4FF1 A;  2MPM A;  4DR5 Q;  1WD0 A;  1IOV A;  1STN A;  4TM5 A;  2K6A A;  3BYY B;  3SK5 A;  2GA4 B;  1YJN A;  1EKP A;  2RBM A;  4EQN A;  1LTA D;  3J80 E;  1YIJ A;  4UCV A;  1ONL A;  2OTL A;  1CQI B;  1M6V A;  1N36 L;  3TZU A;  4R1J A;  4HED A;  1EOT A;  2C5C A;  3HOY H;  2MUY A;  2TSS A;  4K2L A;  3F1Z A;  4EQO A;  2CWP A;  3HG9 A;  2Z0S A;  4CHT B;  2CFM A;  3NTH A;  2WFW A;  4CHI A;  1UE6 A;  3TSS A;  1WR2 A;  1B53 A;  1GLV A;  1EYD A;  3NXW A;  4K6L A;  4DV5 Q;  2Y0S E;  4R4I A;  2OCE A;  3CPW A;  4LF6 Q;  2F4I A;  4BS9 A;  2HHF A;  1VQ6 A;  2RDG A;  1AZQ A;  5I5T A;  2CQA A;  1Q1B A;  2NU7 B;  4YB8 B;  2I80 A;  4KY7 A;  4LW1 A;  4P75 A;  3JAM L;  1SSO A;  3CU7 A;  5IGB A;  4R4O A;  4C3J G;  4A3M B;  1QVF A;  5IWA Q;  4LF4 L;  4KLK A;  1PX2 A;  2KCM A;  3GDE A;  4OL7 A;  4CDE C;  4X64 L;  1IKL A;  3AFQ A;  2EZV A;  1SND A;  4JI3 L;  3HOY B;  3F8T A;  4KN4 C;  1PTO F;  4KN7 C;  4IOC A;  4O4H F;  1ZEQ X;  1STY A;  2KJX A;  3I12 A;  2HDM A;  2JYO A;  3SEB A;  2BH8 A;  2JK8 A;  1OBG A;  5GON F;  1A2T A;  4A3I B;  3VYS A;  2K50 A;  2FFK B;  1LTR D;  1S5F D;  1TWA B;  4C2M B;  1S40 A;  2Z6K A;  1CA6 A;  2R92 H;  3HKS A;  5DGI A;  1CZG A;  5CR5 A;  2UUB Q;  4DAP A;  3NBI A;  1I3Q H;  5EZY F;  4NKL A;  4X65 L;  5LYJ F;  2JXM B;  2YL2 A;  1CKN B;  2PI2 A;  5EKK A;  1M1K C;  2C00 A;  2EY2 A;  5BWU A;  4C5C A;  1WCM B;  1EWC A;  3MXU A;  1LT6 D;  1SYF A;  1Z9F A;  4F87 A;  1R4P B;  4IUQ A;  3BAA A;  1EIF A;  4A3I H;  2HIX A;  2SNM A;  3FPP A;  4FFR A;  1A63 A;  5CB4 F;  1SLJ A;  4MV9 A;  3GTP B;  4XT1 B;  1X55 A;  2OEO A;  2RKS A;  3VNN A;  3T51 B;  1LT4 D;  4YHH L;  1PLF A;  1Y1W G;  4DA2 A;  1O7Y A;  2SDF A;  2I87 A;  2E75 C;  4OO1 I;  3K7A B;  4KI0 A;  1T5E A;  2BA1 A;  1G6Z A;  1WOC A;  3CSW A;  2Z1C A;  2F03 A;  4TUY F;  3TRE A;  4JV5 Q;  1OXU A;  1Z47 A;  1LTB D;  1D8L A;  3F2B A;  3HFZ B;  2F0K A;  3Q2O A;  1UWV A;  2VB2 X;  1E7Z A;  5JH7 F;  2UXB Q;  4AQY Q;  5E25 A;  4AH6 A;  2YS6 A;  2E2H H;  3DM1 A;  2PO4 A;  1S68 A;  1UE1 A;  4LF9 Q;  1M0T A;  1AE3 A;  5C4H A;  5BMV F;  2LFN A;  2EYO A;  3PFF A;  2L9H A;  3D3R A;  1QZG A;  4RKB A;  3LUL A;  4OO1 G;  4EFB A;  2IT1 A;  1B70 B;  2O5I C;  3NP8 A;  2B63 B;  1E0B A;  2MP1 A;  2MHV A;  5FO8 B;  3S1Q H;  5I5V A;  1BCP B;  1GUW A;  2B2W C;  1MBY A;  1HCZ A;  4UP7 A;  3BAC A;  3CC2 A;  1JMC A;  3NTI A;  3T53 B;  2FB9 A;  2Z8L A;  1VQC A;  2R7N A;  2XNA C;  2W6N A;  1RDP D;  1BNC A;  5J2U F;  3TII A;  4JI1 L;  1XX8 A;  3DXJ C;  4U67 3;  4FF3 A;  5CV5 A;  3HOU G;  3BDL A;  4K5X A;  3PF4 A;  3TP6 A;  4YHH Q;  1Y8O B;  4V19 0;  1B2T A;  4A3G G;  3VPC A;  1EZ8 A;  4O42 A;  1KNA A;  2VS1 A;  1X6O A;  1I7N A;  3JSL A;  3GLK A;  2V4D A;  2YTV A;  2VQF Q;  2GQR A;  1F9Q A;  3TME A;  3BG5 A;  3NE5 B;  5JVL A;  1HNZ L;  1BCP D;  5DEH A;  5FLX E;  2Q2H A;  3CAM A;  2VY3 A;  4RMF A;  5J22 A;  4Q0F A;  3V4S A;  4WRD A;  2KEE A;  2HGX A;  3PGZ A;  5F2D A;  2A68 D;  1TS2 A;  1G2T A;  3K59 A;  4XYQ A;  3V4Z A;  4DR4 Q;  3CPF A;  3H3V H;  2EOT A;  2DLN A;  3P75 A;  3VOT A;  3BVM A;  1WTV A;  4B3M L;  5FOB B;  3NQT A;  1YJ9 A;  2B2W A;  4B3S Q;  5FJ8 H;  3S9W A;  2L55 A;  2XVS A;  3H91 A;  1T5X D;  3A8J E;  2EDG A;  3MFG A;  5EPL A;  2F0S A;  3S2D B;  5C3W A;  4GLW A;  4A3F H;  3RUP A;  1PMR A;  4V0B A;  4DV7 L;  2KA7 A;  3JRX A;  1U4M A;  1U4P A;  1TR5 A;  4IJL A;  1SNC A;  3V05 A;  5EQ0 A;  4ME5 A;  1N34 L;  1MSH A;  1GHJ A;  3P7J A;  1ULZ A;  4L63 B;  3SXH A;  5K3W A;  1EKV A;  3PO3 H;  3RZO B;  1VQE A;  2A5H A;  4OIJ A;  1ESF A;  3EJI A;  3NHH A;  3J80 L;  3EVQ A;  4LF8 L;  2V5A A;  4I65 A;  5BWX A;  2EYJ A;  2B2Y A;  4K8I A;  1E1O A;  3EFX D;  1QZH A;  2JA8 H;  3AX6 A;  3S2D H;  2YRW A;  4IUV A;  4LF5 L;  3VPD A;  1FYC A;  2D0O A;  1I4H A;  1AFP A;  3CMA A;  3H94 A;  1DD2 A;  4CMD A;  4DV2 L;  1HPC A;  1HHV A;  3I3C A;  2HHH L;  3J7A 5;  5C4X G;  2VUM G;  3PUX A;  2R86 A;  1C3O A;  1ASZ A;  2OLS A;  3BA8 A;  4JBJ A;  1A3U A;  2NVX H;  1EQV A;  2XTI A;  2HGS A;  3V2T A;  1FGB D;  4KY5 A;  4O4J F;  4LF8 Q;  2R3Z A;  3AEV A;  2K5Q A;  4IAL A;  1NR4 A;  3K0Y A;  5IYC G;  1LTG D;  2RSO A;  4JI0 L;  2IY5 B;  1FD7 D;  1TII D;  3Q23 A;  5JEA G;  3QO2 A;  2DWC A;  4TKO B;  1DOL A;  1N34 Q;  1CI3 M;  4A3F G;  3U50 C;  4AYB G;  4PNY A;  1JWS D;  2GPW A;  1CHP D;  3LGJ A;  1IOW A;  5K36 G;  1KUT A;  1STH A;  4HR7 B;  2D62 A;  2A69 D;  1H9S B;  4O81 A;  1WTX A;  2ICI A;  4JI4 L;  4MV8 A;  1NMG A;  4IJH A;  2NU8 B;  1HZC A;  5CC4 A;  4QUF A;  1A0G A;  3S15 H;  1CS0 A;  3TEK A;  5LMN L;  1VQI A;  3UFX B;  3C1F A;  3D6C A;  3NUC A;  2UU9 L;  2W6M A;  1BDO A;  1HA5 A;  1X3E A;  5KX5 F;  1FNW A;  2J4X A;  5LMU Q;  3MXN B;  3CD6 A;  3S2H H;  2Q8I B;  1BNZ A;  1JJC B;  4K14 A;  2CH4 A;  3DTG A;  2N88 A;  4DR7 L;  1DM0 B;  5C4J B;  3J81 j;  3A55 A;  3PQI A;  1J9O A;  5A2Q L;  3AYH B;  3H0G G;  1IBK Q;  2FPI B;  1GUT A;  4H02 A;  2K03 A;  4IN3 A;  5H80 A;  4HJ8 A;  4BBR H;  3V96 A;  5I6W A;  2E2J H;  1PXU A;  4CC6 A;  3ND9 A;  2MNA A;  4MV7 A;  5JPM C;  1IBL L;  1RTN A;  2HHH Q;  5KNB A;  3WWH A;  3DEP A;  5EAY A;  1WFQ A;  5K36 H;  3WWJ A;  2QF7 A;  4E6N A;  2NUA B;  4I4T F;  2EPB A;  2YV5 A;  3RMH A;  2XCL A;  1HUM A;  2RHS B;  3DEO A;  1D1K A;  1TWG B;  4DF7 A;  4N9T A;  1IW7 C;  3W5O A;  3RZO H;  2WAQ B;  5CMD A;  4IOA A;  1HZA A;  2VQE L;  2E8G A;  2NYZ D;  4LNQ A;  2O4X A;  4OGQ C;  4JI0 Q;  4RGN A;  2JEB I;  1I5F A;  2EXZ A;  1RCV D;  3KF6 A;  1HJP A;  4H0L C;  3OW7 A;  2ICE C;  2PVP A;  5KKN B;  2GVB A;  3D31 A;  3WDN A;  3IAY A;  5COY A;  2FHT A;  3S14 B;  1KLG D;  2Y4R A;  3M4P A;  2VUM H;  3PCO B;  4X6A H;  3RLF A;  2PZW A;  4DR2 Q;  1B6R A;  4GLA C;  5DLQ E;  1KJJ A;  3OWE B;  1JB3 A;  1BQQ T;  3HT5 A;  2QA4 A;  1II3 A;  4Y7N B;  4YWM A;  2I46 A;  3R2T A;  1JOR A;  1PTO D;  2AWN A;  4IIJ F;  1Y8P B;  2C9O A;  4ZQI A;  3NUA A;  3ZYY X;  4DR2 L;  2YZL A;  3K81 C;  4OX9 Q;  1KDC A;  2HCC A;  1Y1W B;  5IP9 G;  3VR2 A;  2ZXP A;  1VQP A;  2ATW A;  3WOF A;  1BUV T;  2HDK A;  2UUC L;  3I4N H;  1LTL A;  1BF4 A;  2F3V A;  3PN1 A;  2BA0 A;  2HJW A;  5FLX c;  4XTC S;  2EY5 A;  2HQE A;  1TWA H;  1LM0 A;  1BVS A;  1WCM G;  2PZU A;  5D1P A;  2DY7 A;  1Y1V H;  1I94 L;  5I47 A;  1I50 B;  1QOH A;  3SGI A;  5CV9 A;  5I9O A;  2E76 C;  3K58 A;  1EYG A;  5IOD A;  1F9R A;  3UZO A;  3E3X A;  2JA6 B;  3HB9 A;  1EZ6 A;  4UCT A;  4GOP C;  4A3I G;  3R8B A;  4DR3 Q;  1FL0 A;  1WI5 A;  1F2M A;  3TIN A;  1ICW A;  4A3C G;  3NWT A;  2VNU D;  2EE1 A;  3CC4 A;  1TA8 A;  2VL6 A;  2CWA A;  4HQ6 A;  3JSN A;  2Q2I A;  2YU9 H;  2ES2 A;  5M5Y B;  3HOZ H;  4G7O C;  1OTC A;  5JEA J;  1Y8N B;  3J7Z C;  4DR3 L;  5I5S A;  4BA2 I;  3RV4 A;  2WYO A;  4O7Y A;  3T4A C;  4TVI A;  5BYA A;  2QIL A;  4JI7 Q;  4L5T A;  2IP4 A;  1I94 Q;  2F0L A;  4MV1 A;  1ENA A;  5COR A;  5FR9 A;  1PYB A;  3EQL C;  2HT1 A;  1DV1 A;  4QQB X;  5EJW A;  4UUG A;  4UP8 A;  4DR5 L;  4O4L F;  4IPG A;  1CKN A;  4DKA C;  3S1M H;  4HCS A;  1RHP A;  3RZD B;  3M4O B;  4PMB A;  5DAA A;  2H1E A;  1C8C A;  4EGQ A;  2ZM6 L;  1PH4 A;  3KLS A;  2UUC Q;  1I6H B;  4DRF A;  2FIN B;  2BCO A;  5IT9 c;  2R7L A;  3M7G A;  5I5X A;  4YJ2 F;  5DNF A;  2FJ2 A;  2F0V A;  5I2Y A;  1V43 A;  4HMJ A;  2R7D A;  3O13 A;  2O5J C;  2YYA A;  2E5L L;  1KT8 A;  2JE6 I;  2NZH A;  1EIY B;  4FO2 A;  4LH6 A;  1ENC A;  5M3M B;  4ZUJ A;  2F0F A;  2ID0 A;  1HR0 L;  1E2V A;  1I6H H;  3HBL A;  4GN5 A;  1N36 Q;  3UDI A;  4LJZ C;  3PUW A;  2QEJ C;  4QIW E;  4RKL A;  3FMC A;  3SR1 A;  5CBA E;  3G6E A;  3T1H Q;  2QGQ A;  2F0Q A;  2AWO A;  4ID6 A;  4YY3 L;  4C1N I;  4MNO A;  3FDT A;  2CZG A;  5C4J H;  1KEE A;  4GNX A;  3I8Z A;  4CDC C;  1RIP A;  1VBG A;  4K5W A;  2UXC L;  1D2B A;  4P72 A;  3T16 A;  5D1O B;  1SMY D;  1XXG A;  4L5R C;  3K5O A;  4R8N A;  4IWY A;  1QUQ A;  3IKJ A;  1CKO A;  3GTP H;  1B3Q A;  2EY1 A;  5E4W C;  1KJI A;  5CBE E;  2R7Z G;  1SYG A;  4JBM A;  4YIJ A;  1KDB A;  2L15 A;  2K5D A;  3BVZ A;  2VUM B;  5J2T F;  1HTL D;  2IX3 A;  4FFO A;  2NVX B;  1PRT B;  1BBX C;  3PF5 A;  3BZD B;  1G6P A;  2PNR C;  4ZKB B;  5BWW A;  1WYD A;  3T99 A;  3M3Y H;  2A1A A;  1Q90 A;  1P16 A;  3MFY A;  4DK0 A;  3D4W A;  4TQU S;  2KEN A;  2JA7 H;  1EY9 A;  4B3R L;  4UHV A;  1SNP A;  3S24 A;  3T9C A;  5JAV A;  1YHA A;  1S5E D;  1TWG H;  1AW7 A;  1RD9 D;  2RHQ B;  2B3G A;  1Y1V B;  1EFW A;  4BBS H;  4N8F A;  3DUZ A;  4ZOL F;  3C3L A;  4F7X A;  1Y69 U;  2JA5 B;  1B3A A;  4KD3 A;  2YYZ A;  3A5Z B;  1QIL A;  4GNX C;  5I5Y A;  4JI8 Q;  3FRP B;  1CK1 A;  4A3J B;  1L0X B;  2R92 G;  2PMZ B;  4K0K L;  4AYB E;  4YBZ B;  2K4K A;  5FO7 B;  4BBR B;  1S5B D;  3SHL A;  2KCT A;  2VQF L;  1XMQ L;  1HNW L;  5KEE A;  4QY7 A;  4FE2 A;  4FFL A;  1UNS A;  1TWC B;  2ZTD A;  2HCI A;  4LFA Q;  2Z4H A;  3M4Y A;  1TWH B;  4EG0 A;  4EFE A;  2F52 A;  2EIF A;  1VQ5 A;  4F8M A;  5ELD A;  3PO2 B;  1TVX A;  3BA9 A;  1QUQ B;  3JAM i;  4KKT A;  2Z4I A;  5J39 A;  4HIK A;  5JVD F;  3DLL A;  4A3L H;  4N8X 1;  5D14 A;  4C2M H;  2B39 A;  2ZGI A;  1BBU A;  4Y8V B;  4J8Q A;  4RZQ A;  1KAA A;  3VR3 A;  1PZJ D;  4JCV E;  3W2D A;  2ODT X;  3BVG A;  4IPC A;  3A8K E;  3GTK H;  5EGT A;  4HNU A;  3CC7 A;  5KS8 A;  4K2K A;  1NUC A;  3L9A X;  1JCK B;  2MFI A;  3J7A V;  2ZTC A;  1F9P A;  1A2U A;  1CQF A;  4WJW A;  1FNU A;  4H7B A;  4Z9C B;  1V1Q A;  3T9A A;  1SMX A;  2Y0S B;  2B29 A;  2R93 H;  3TS2 A;  3RR5 A;  1U0L A;  1M0W A;  2COG A;  1XYI A;  4NXN L;  1NJI C;  1VQK A;  2W70 A;  5C0X H;  3STB D;  3TN2 A;  1KTK A;  5K2M A;  4DU9 A;  1Z6H A;  4A3G B;  2XD4 A;  1M4V A;  3W3A A;  2Y0S G;  3GP7 A;  4TSS A;  3S1N H;  1DYQ A;  4OX9 L;  3OIQ A;  5C8Y F;  2DAA A;  1F2Y A;  4PZ8 A;  3J7Y W;  4CKB A;  1VF5 C;  3H6M A;  3MXG A;  1I1L A;  2LKV A;  3HOW H;  4R9W A;  2KHI A;  1X56 A;  3RV3 A;  3AQQ A;  1OBD A;  4JI2 L;  3J81 L;  3S14 H;  3K57 A;  3MZ5 A;  3CQZ B;  1KAW A;  3QJY A;  5EBD A;  2JA8 G;  2R93 B;  3LNN A;  1ESR A;  4KHP L;  3T9D A;  4B08 A;  4LUZ A;  1VQB A;  1AE2 A;  2PCF B;  3G6J B;  1WD1 A;  1ILP A;  2B63 G;  5D65 A;  5IP9 H;  5GRO A;  1X32 A;  3MA2 B;  4JI3 Q;  1AUX A;  1BCP F;  2R87 A;  4ME3 A;  3WWI A;  2QCP X;  1EUD B;  1XMO Q;  3HOX B;  1IHZ A;  1KC7 A;  4DR7 Q;  3QG1 A;  1PTO H;  4A3B G;  4FDB A;  2A1H A;  1GO3 E;  1KDA A;  4HID A;  4M9U A;  5I2X A;  2XRQ D;  3X3N A;  2AHO B;  4J15 A;  4A3J G;  1VQ4 A;  4CMF A;  1HQM C;  1K73 C;  3OWF A;  3KJO A;  3CKI B;  2FMC A;  3CEB A;  3MEF A;  3WNZ A;  1NE3 A;  2DIK A;  3KYH C;  2CW0 D;  2B8F A;  2I5H A;  3S1R H;  4CKE A;  5JEA H;  3PO3 B;  4QJF A;  4KHZ A;  1GUO A;  4P71 A;  1IYJ B;  4O7V A;  1NAP A;  4IZO A;  3FKI H;  4U68 A;  4NPS A;  1HRJ A;  1U5K A;  3IL8 A;  4HJ5 A;  1PHJ A;  4DAV A;  1LAB A;  2J0T D;  4NXN Q;  4JBK A;  3UE1 A;  2DNE A;  1AH9 A;  3I2Z A;  4OWT B;  1YEZ A;  2L4N A;  1JR0 D;  2NU6 B;  1YNX A;  5ELN A;  3KBG A;  1PTO C;  1NBW A;  2HUG A;  2D0P A;  2RQX A;  3TW6 A;  2ZDH A;  4KMU C;  1YI2 A;  1Q7Y C;  4DIM A;  4RFB A;  3A5U A;  2K32 A;  1HNX Q;  2NVT H;  1Y14 B;  4JYA Q;  2ALY B;  3URY A;  2RVL A;  2EJG C;  3NEN A;  1VF7 A;  4X3K A;  4EVO A;  5IE8 A;  2NZ1 D;  1EQQ A;  1RTO A;  4LUO A;  4DLK A;  4M8A A;  3HOY G;  5FKA C;  4YY3 Q;  4TV9 F;  1AP0 A;  3K7A H;  3JAM E;  2JA5 H;  2PI2 E;  4LFA L;  4EEQ A;  1FR3 A;  3D0F A;  4RG1 A;  5H1S E;  1JOO A;  5LL6 S;  1VQN A;  1BCP C;  5GAH C;  2E5L Q;  5L37 A;  5ELC A;  2F3W A;  2PQE A;  5BR8 Q;  1QVG A;  2A19 A;  1I2K A;  1QCB D;  1C7Y A;  3WOE A;  5JQW A;  4A93 B;  2L0C A;  4Y52 H;  3U0G A;  2RA4 A;  4DNI A;  3GTM H;  5D1O A;  1KNE A;  1KAB A;  1VQL A;  4C5B A;  1PYS B;  3ETH A;  4S3S A;  4Q4C A;  2IPK D;  4OWX B;  4JOI A;  2R7Z H;  5FPR A;  2B2U A;  3Q24 A;  1EIH A;  1L1O C;  1V1P B;  1G2S A;  1LT3 D;  2I5M X;  4I50 F;  4FNF A;  5EPJ A;  1XK5 A;  2J7Z A;  4MZ9 A;  1KRT A;  2IWH A;  4AIM A;  1GM5 A;  5I9P A;  2V59 A;  5BWT A;  2QKI C;  4DV4 L;  2LSS A;  1YVC A;  3GTQ B;  1PRT D;  1PH3 A;  2GLT A;  2JA7 G;  5M5W H;  3U54 A;  2J9G A;  3TBI B;  4MIU A;  1IYD A;  3DF7 A;  2UXD Q;  1D6E C;  3T9E A;  4JG2 A;  3D6W A;  4O2A F;  3SVM A;  1KJ9 A;  3QR8 A;  3NTK A;  1N32 L;  1JE5 A;  4O7Z A;  4GOP B;  3AMU A;  3SK4 A;  1L2F A;  1O7Z A;  1QJO A;  2EXD A;  2R7K A;  5ELF A;  4DR6 L;  3A0J A;  2QDL A;  1MD2 D;  3KF6 B;  1JOQ A;  4O86 A;  4R8I A;  5CAE B;  1I50 H;  2HVR A;  3KUP A;  4O0A A;  1UUP A;  1H9S A;  5KGU A;  3DTF A;  4TV8 F;  3NBH B;  1LTS D;  3HOV G;  1VQJ A;  2PW5 A;  1L1O B;  3HS0 C;  5CV8 A;  1R9T H;  4A3E B;  2A8V A;  4HN7 A;  2XSC A;  3EN2 A;  4C1N K;  1W93 A;  4CE5 A;  3A7A B;  2PQA B;  1B04 A;  3L3O C;  3X3M A;  4JC0 A;  3LX0 A;  1LLR D;  4NP5 A;  1PH2 A;  1SDF A;  3DHQ A;  4GZY C;  4EGV A;  1XPU A;  4C3H B;  3VR6 A;  3VA7 A;  3HOZ G;  4RCN A;  2IL8 A;  1BBW A;  5DMX A;  3BZC A;  2ZM6 Q;  3VMM A;  3TY8 A;  1W6K A;  4B3M Q;  4H44 C;  3TY9 A;  1IBM Q;  3GTL B;  2WKD A;  1SYD A;  1VKZ A;  2MO1 A;  1O78 A;  1FVI A;  3DWQ A;  3A56 A;  3U9S A;  4R4C A;  4YWK A;  1WTQ A;  1Q12 A;  4DR1 L;  1E1T A;  4A3D H;  4QSH A;  3IRB A;  4RAU C;  1M90 C;  1MIU A;  2KQ3 A;  2KCN A;  4FXD A;  3T1Y L;  2E2I B;  5A35 A;  5IGD A;  1XJV A;  2JA6 H;  2JA9 A;  2CNU A;  1RF2 D;  2A6H D;  2WKC A;  4A3M H;  2K1B A;  2CNQ A;  2BH2 A;  1C0A A;  1TWF H;  1S5C D;  3A7L A;  4DUZ L;  5BN4 A;  2JA8 B;  1Q1E A;  4LFB Q;  2DN8 A;  2F0J A;  1SAP A;  4QL5 A;  2Q7D A;  3PUY A;  1K83 H;  1CQV A;  2QW7 A;  4FFN A;  2Q2T A;  4PZ7 A;  1G2W A;  1TAE A;  2MGS A;  3K3P A;  5BWV A;  3I4N G;  3ITP A;  2NVY B;  1EHI A;  4ODG A;  2A74 C;  1O7I A;  1TKW B;  4NB3 A;  4A3D G;  1KJ8 A;  2NN6 G;  3GO5 A;  3NEM A;  4O7N A;  2K5V A;  3ERS X;  1EUC B;  2ZXR A;  2VZA A;  4PMW A;  1KQS A;  1GSA A;  1C9O A;  5D8D A;  1DV2 A;  2SEB D;  3DWP A;  4Y7N H;  3IFT A;  2SCU B;  3ORQ A;  4DV0 L;  3AB9 A;  4RH6 A;  5DM6 3;  4GOP A;  2EYF A;  4I7Z C;  4RCO A;  3Q6S A;  3HKZ B;  2L12 A;  2UXB L;  2B2V C;  2OXP A;  3BAB A;  5HNE A;  3MWY W;  3M85 A;  2VB3 X;  2VXW A;  2A6E C;  1FGU A;  2NUC A;  1VQF A;  2F4V Q;  4DAA A;  3VR5 A;  1BXR A;  4JV5 L;  2F0H A;  5GQO A;  3AFP A;  2F0P A;  3QQM A;  1PH6 A;  4DV1 L;  5NUC A;  2F0G A;  3T56 B;  4UCU A;  4HCE A;  5CV4 A;  4UAI A;  4LFB L;  2NVY H;  3MWE A;  2K04 A;  2HVS A;  4ME6 A;  2YRX A;  2NBF A;  3CW2 C;  5D3I B;  1XTD A;  5IT9 E;  3DMU A;  4NXM L;  3LQS A;  1XMQ Q;  1HNW Q;  3CCU A;  3MJF A;  1GVP A;  2OQ0 A;  4A3F B;  4QF4 A;  3PO2 H;  1N8R C;  3FKI B;  2XIW A;  1C48 A;  1DOK A;  3EA6 A;  1HR0 W;  2EVB A;  5C44 G;  2FMM A;  3RN2 A;  4O83 A;  4NXM Q;  2X6G A;  4DV7 Q;  4L5Q A;  4NZN A;  5DIS C;  4GS3 A;  3T9F A;  1GHK A;  4ZQ3 A;  3H0G H;  4PZ6 A;  1LV9 A;  1SBB B;  1SXT A;  2HVQ A;  1LT5 D;  2B2V A;  2Z9H A;  1GUS A;  1AN8 A;  2OQK A;  4WJ3 M;  1N32 Q;  3OMG A;  3ETJ A;  4BBS B;  4QUC A;  4C3I H;  4BY1 B;  3GTL H;  4OIK A;  2QK4 A;  2D2C C;  3GTG B;  1D5X C;  4Q5V A;  2K5W A;  4L1K A;  3G48 A;  2NZO A;  1K8O A;  2C35 B;  3JZI A;  4O2B F;  4A3B B;  1BXT A;  3KFU A;  2F0N A;  1RKN A;  4G57 A;  1U4L A;  1IYE A;  3KAJ A;  4CDF C;  2GN5 A;  4MN3 A;  4O2D A;  2R7Z B;  2LXJ A;  2ZJR A;  3I73 A;  4HTP A;  3R5X A;  3KF8 B;  4GKJ L;  5LL6 X;  4YAJ B;  4L6T B;  2KEC A;  4LFC L;  3I56 A;  4HSP A;  3TQY A;  1EY8 A;  2MO0 A;  2GPS A;  5BPF A;  4GNX B;  2UXC Q;  2R84 A;  2PN1 A;  2K75 A;  1WVL A;  1ML0 D;  2W6Z A;  5KYL A;  2E74 C;  3OPO A;  1W2B A;  4BXX G;  3A8I E;  1E2Z A;  1I6V C;  5JPN C;  2ZT9 C;  1Z2N X;  1I1K A;  1S72 A;  2F0E A;  5ELO A;  4IUN A;  4GLV B;  3A54 A;  3UYY A;  2KBN A;  2WAQ E;  3U9T A;  4XXE A;  4BY7 G;  3ERQ A;  1JJG A;  1KIX A;  1TY2 A;  1MJC A;  3TW7 A;  1SNO A;  5HY6 A;  3LWB A;  4DN4 M;  2KED A;  5LHY 1;  1PFB A;  2NWG A;  3BDC A;  1GKH A;  3W1G A;  1JDB B;  3L7Z C;  4DFA A;  4FP5 D;  5LXT F;  4N9P A;  4IWX A;  2ENB A;  1C30 A;  4PBC A;  1F2L A;  4HJ9 A;  2ABJ A;  5CYU A;  2N55 A;  1E2W A;  4A75 A;  1PRT F;  2KVM A;  4A3D B;  3G8D A;  3STB C;  3I4N B;  3E5S A;  2FPG B;  4GKK Q;  4MTK A;  3KBX A;  2B63 H;  1VS0 A;  5I60 A;  1S4Z A;  5G3L F;  1A3G A;  4K6D A;  1J5E L;  4CC5 A;  4XDX A;  2EQS A;  1TY0 A;  3NBH A;  2JN4 A;  1ZYR C;  4RGO S;  2M2L A;  4UP9 A;  1PA6 A;  1VQG A;  3PUV A;  2CVR A;  3HOW G;  4X3U A;  5AFW A;  1CQJ B;  4RWS C;  2W6O A;  1CKM A;  1STA A;  2XGT A;  4WHX A;  2IX1 A;  4HSV A;  3VPB A;  5IGC A;  2IHF A;  3K0X A;  1G29 1;  5FPO A;  1W96 A;  4IQZ A;  3PIP 3;  5C1O A;  4DAM A;  1F77 A;  3FEW X;  1J6Q A;  3M4Q A;  1PVO A;  3HOU B;  2JA6 G;  2WB1 B;  5HGQ A;  3CP0 A;  3OMC A;  5IWA L;  4LF4 Q;  1EIG A;  3R5F A;  5CA1 F;  3TDQ A;  2CCZ A;  4K0K Q;  3HZX A;  5C6A A;  1EFI D;  2A68 C;  4E4T A;  1I4G A;  4O7L A;  1HXY D;  5IGF A;  1HZ9 A;  3KDF B;  3SDZ A;  1UE5 A;  4X65 Q;  5C0X J;  1OXV A;  1K3R A;  4YAK B;  3ER0 A;  4TVA B;  1Y1V G;  4C3H G;  4KV6 A;  4ZLT F;  3CCJ A;  1F9S A;  1WCM H;  3OIP A;  4GKK L;  1SE8 A;  2K14 A;  4IHJ F;  2UU9 Q;  4KKS A;  1PYW D;  5AJ3 Q;  3OTO L;  3G71 A;  3CXC A;  3TY5 A;  5C3X A;  4ZCK A;  4BWG B;  2SNS A;  3BG3 A;  1EWH A;  5EKI A;  2EJ0 A;  4DV1 Q;  1YNN D;  2A73 B;  4JW0 A;  1ZAU A;  1H9K A;  1GSH A;  3KOJ A;  4KHP Q;  4A3E G;  1L0Y B;  5C4X H;  1KHI A;  2IW3 A;  4POG A;  3QB3 A;  1Z2O X;  5KND A;  3ULJ A;  1I4R A;  1KC8 C;  2YS7 A;  1CZW A;  1LTI D;  2GVA A;  4X3S A;  4DR4 L;  1XPO A;  1HR0 Q;  3CCR A;  2R82 A;  1JB7 A;  1TT2 A;  2Q2U A;  3HOU H;  3CCM A;  4DNT B;  1K0S A;  5CV6 A;  1CSQ A;  2FXQ A;  4FU0 A;  3AW8 A;  4A4I A;  4DUY L;  1E24 A;  3ND8 A;  3D8G A;  4OWW B;  3UZB A;  3MHB A;  2XN9 C;  1VQ7 A;  1A6X A;  2JA7 B;  4BXX H;  1AZP A;  4RGM A;  5IYZ F;  5A2Q E;  3J80 i;  1EY5 A;  1PH8 A;  2PYK A;  2Z02 A;  4IUT A;  2NTS A;  3HO8 A;  4LAA A;  1SMY C;  4PV1 C;  3OSO A;  2VPQ A;  1TS3 A;  3I70 A;  1YIT A;  4OO1 H;  1FJG L;  1IL8 A;  1VQH A;  2A6H C;  1XDN A;  1U9R A;  5C5M A;  4LF7 Q;  1D1I A;  4FFM A;  3CCQ A;  2UUB L;  4AQY L;  3HP3 A;  1TS4 A;  4DV6 L;  1QNU A;  3TP5 A;  4Q4D A;  1CFM A;  1OXX K;  3CCL A;  3K5I A;  3RNU A;  4MAM A;  4A93 G;  1JE4 A;  2KHS A;  3NC0 B;  1NTG A;  1WRV A;  4HR7 A;  3TS0 A;  1H9R A;  1E4E A;  2QEX A;  1SN8 A;  1E22 A;  1EY4 A;  1WTP A;  3H3V C;  3J7A F;  1VDZ A;  5EKL A;  4BY7 B;  5IGE A;  1SFO B;  2E2D C;  4KD4 A;  3NBZ B;  1H95 A;  2YWV A;  1F2Z A;  4E6I A;  4QB4 A;  3B6Y A;  1ET9 A;  1N9W A;  2ZTE A;  3K8A A;  4HTH A;  4IUR A;  3CME A;  1DAA A;  5M3F G;  3T1Y Q;  5E4X A;  2YZG A;  4K8J A;  4HJA A;  3VA5 A;  1NNX A;  3OW2 A;  3J81 i;  4C3J B;  5HUR A;  3K7U C;  4WOR A;  5T1G A;  1JC7 A;  1GUN A;  4BA1 I;  5IGG A;  3PIO 3;  5IYC H;  4DXG A;  3L2P A;  4L5S A;  1CE8 A;  1X3G A;  4XX0 B;  4C3H H;  5JVG 3;  4HTO A;  1ASY A;  4CBV A;  3T7A A;  3I90 A;  3MAQ A;  2ZDG A;  2K52 A;  1TS5 A;  4KK7 A;  1IZ6 A;  3CCV A;  5I6Y A;  1TWC H;  2D5D A;  3OOC A;  5M5W B;  4ILW A;  4LK1 C;  2N3S A;  3MVV A;  5M9O A;  2R61 A;  4OHJ A;  4A93 H;  1SRU A;  3NPP A;  1I4X A;  5IY0 A;  1VQ8 A;  1SYE A;  1B44 D;  3QOJ A;  4R4Q A;  1Q8K A;  4WJ4 A;  3KAL A;  4UCS A;  1SNQ A;  1M8A A;  4JI4 Q;  3G4S A;  1T36 A;  2G5D A;  1YJW A;  3W1B A;  3ORR A;  2I5L X;  1WTR A;  1EQT A;  3NQI A;  2EYL A;  3ERO A;  2UUA Q;  3QOL A;  1A8V A;  1PH9 A;  4O1N A;  2NB0 A;  3JC6 6;  2EYH A;  5G3L D;  2I8C A;  2DUD A;  1PFS A;  4LFC Q;  4DK1 A;  4JOI C;  5E3F A;  1NMF A;  2B2U C;  1B7Y B;  1BO0 A;  1L1O A;  1B8A A;  1YNJ C;  4DV3 Q;  1K0R A;  1STG A;  2PW7 A;  3MC0 B;  1UE7 A;  3U55 A;  5C0X I;  3RN5 A;  1YHB A;  5C44 B;  3PO3 G;  2AMC B;  1VMC A;  3SK6 A;  3E5N A;  5KIX A;  2N78 A;  4EQ5 A;  4ALP A;  4DAY B;  2W6P A;  5BN3 A;  2RSN A;  2G9H D;  2VUG A;  1Q82 C;  3PIO A;  1I4P A;  3LP8 A;  4FFP A;  4HIO A;  1J8I A;  2RCN A;  4IUP A;  1A9X A;  2EJF C;  3BS1 A;  4X66 L;  3M7N A;  1V9P A;  3RLN A;  4FGR A;  4YCW A; 
#chains in the Genus database with same CATH homology
 5C0X G;  3GB8 B;  1R9T H;  2YV5 A;  2A8V A;  2RHS B;  3EN2 A;  4DV4 Q;  2F4V L;  3W5O A;  2PQA B;  3RZO H;  4DK6 C;  2OTJ A;  4IOA A;  1B04 A;  1HZA A;  3BU2 A;  2VQE L;  2E8G A;  4X62 Q;  4JC0 A;  4LNQ A;  4X66 Q;  2V1C C;  4JI0 Q;  1PH2 A;  3BZK A;  3I55 A;  5FJ8 G;  4A3L G;  2JEB I;  1I5F A;  1XPU A;  4IFD G;  1EUJ A;  3CF5 A;  2WAQ G;  3KF6 A;  1UEB A;  1HJP A;  3UDX A;  3HKZ E;  3HOZ G;  1K8A C;  3KJP A;  1BBW A;  4A3G H;  1EOV A;  2GVB A;  3BZC A;  3D31 A;  2ZM6 Q;  1MJE A;  1N33 L;  3CQZ H;  4IPD A;  3TY8 A;  4B3M Q;  1VQ9 A;  3M4P A;  2F3I A;  3TY9 A;  1IBM Q;  5AJ3 L;  2VUM H;  3PCO B;  3S16 H;  4X6A H;  1GD7 A;  4A3C H;  3RLF A;  3GTG H;  1KD1 C;  4JYA L;  2K5H A;  4DR2 Q;  1CSP A;  4GLA C;  5DLQ E;  1X3F A;  2MO1 A;  1FVI A;  3E9H A;  2QA4 A;  1SFO H;  4YWM A;  4R4C A;  1HZB A;  4YWK A;  1Q12 A;  2RF4 A;  4DR1 L;  1E1T A;  4A3D H;  2PQA A;  2AWN A;  3IRB A;  1M90 C;  1MIU A;  5C3E G;  2NVQ H;  2LXK A;  5JJK A;  4JI8 L;  4UFZ A;  4LF5 Q;  3T1Y L;  5LMU L;  1XPR A;  1XJV A;  2IX0 A;  2ASB A;  2HIV A;  1VQO A;  4DR2 L;  3KDF A;  2JA6 H;  2JA9 A;  4OON A;  3K81 C;  4OX9 Q;  5GAE C;  4YCV A;  1SR3 A;  1IBM L;  5IP9 G;  3BJU A;  4A3M H;  2BH2 A;  4OXP A;  1VQP A;  2ATW A;  1C0A A;  1Q46 A;  1TWF H;  5M3M H;  2JJQ A;  3ULL A;  4DUZ L;  5M5Y H;  2UUC L;  1KL9 A;  1LTL A;  3I4N H;  2R6G A;  1Q1E A;  2HQL A;  3PN1 A;  2BA0 A;  5E7N A;  4JI5 Q;  4LFB Q;  5FLX c;  4XTC S;  4QL5 A;  3PUY A;  1A62 A;  1K83 H;  1TWA H;  4LH7 A;  4C3J H;  1LM0 A;  4X62 L;  1BVS A;  1WCM G;  4PZ7 A;  2Q2T A;  3U4V A;  1TAE A;  1HNZ Q;  5D1P A;  4DUY Q;  4PG3 A;  1Y1V H;  1I94 L;  1MKH A;  3I4N G;  3SGI A;  4A3D G;  4NB3 A;  1O7I A;  1EYG A;  3TEH B;  2NN6 G;  3GO5 A;  3NEM A;  3I4M G;  2K5V A;  3E9I A;  3ERS X;  4DUZ Q;  3PO2 G;  4UCT A;  2VZA A;  3L0O A;  4PMW A;  4GOP C;  4A3I G;  4DR3 Q;  1FL0 A;  1KQS A;  1WI5 A;  4YCU A;  4DV5 L;  1A0I A;  3H3V I;  1XNQ L;  4A3C G;  1C9O A;  2VNU D;  3M9B A;  1KRS A;  1IBL Q;  3CC4 A;  1N33 Q;  4BBS G;  4BBR G;  1TA8 A;  4UCR A;  2JQO A;  4Y7N H;  2VL6 A;  2CWA A;  1VQA A;  4DR5 Q;  4DV0 L;  3JSN A;  2Q2I A;  2YTX A;  2YU9 H;  2ES2 A;  4MTN A;  4GOP A;  3HOZ H;  1OTC A;  5JEA J;  3Q8D A;  3J7Z C;  4DR3 L;  4BA2 I;  4LWC A;  1YZ6 A;  1YJN A;  2UXB L;  1Y1W H;  3BAB A;  3EIV A;  3M85 A;  1YIJ A;  3RLO A;  4UCV A;  2OTL A;  1FGU A;  1VQF A;  2F4V Q;  4JI7 Q;  1N36 L;  4R1J A;  4L5T A;  5M3F H;  1I94 Q;  3HOY H;  4JV5 L;  5GQO A;  3F1Z A;  1PYB A;  3AFP A;  2HT1 A;  2CWP A;  2Z0S A;  4QQB X;  1PH6 A;  4UP8 A;  2CFM A;  3ZJY C;  5IP7 H;  4DV1 L;  4DR5 L;  2WFW A;  1UE6 A;  4UCU A;  4IPG A;  1CKN A;  4DKA C;  3S1M H;  4A3J H;  4JI5 L;  5LMN Q;  4LFB L;  3EBE A;  1OXT A;  2NVY H;  4DV5 Q;  2ZM6 L;  2Y0S E;  4R4I A;  3U4Z A;  1PH4 A;  2OCE A;  3CPW A;  2UUC Q;  3CW2 C;  4LF6 Q;  4DRF A;  1VQ6 A;  5IT9 c;  1XTD A;  2PMZ E;  1Q1B A;  3E0E A;  3UE0 A;  4NXM L;  4LW1 A;  4P75 A;  1XMQ Q;  1HNW Q;  3CCU A;  1GVP A;  4DK3 C;  2OQ0 A;  1V43 A;  2R7D A;  2E5L L;  3PO2 H;  2JE6 I;  2NZH A;  1N8R C;  1EIY B;  1D7Q A;  2ZJQ A;  4LH6 A;  4UY8 C;  1CUK A;  2ID0 A;  4R4O A;  4A3K H;  1HR0 L;  1I6H H;  1HR0 W;  1S3O A;  4GN5 A;  1N36 Q;  5C44 G;  3RN2 A;  1DGS A;  3UDI A;  5IWA Q;  3PUW A;  4QIW E;  3G6E A;  3T1H Q;  4LF4 L;  4NXM Q;  1QVF A;  4KLK A;  4DV7 Q;  4L5Q A;  2QGQ A;  4UPA A;  2AWO A;  4YY3 L;  5DIS C;  2KCM A;  3GDE A;  4GS3 A;  4MNO A;  4X64 L;  5C44 H;  5C4J H;  3H0G H;  4PZ6 A;  4GNX A;  1RIP A;  3AFQ A;  1J5E Q;  1T9H A;  4B3S L;  2UXC L;  5M3M G;  3TRZ A;  2HVQ A;  4JI3 L;  4P72 A;  5D1O B;  4HJ7 A;  2YTY A;  4L5R C;  3F8T A;  1XMO L;  2OQK A;  1X54 A;  2Z6K C;  1QUQ A;  4IOC A;  1N32 Q;  4WJ3 M;  1CKO A;  3GTP H;  3FP9 A;  4C3I H;  3GTL H;  2JEA I;  2BH8 A;  3PUZ A;  2JK8 A;  1PH1 A;  2R7Z G;  4JBM A;  2L15 A;  3RZD H;  3M4O H;  3G48 A;  2NZO A;  2C35 B;  2K50 A;  4DV3 L;  2VQE Q;  2MQH A;  4DV2 Q;  3PF5 A;  1S40 A;  3KFU A;  2Z6K A;  2R92 H;  3HKS A;  1G6P A;  1VCI A;  2UUB Q;  1WYD A;  2GN5 A;  2KHJ A;  4EX5 A;  4B3T Q;  4O2D A;  1I3Q H;  4JV5 Q;  4R4T A;  4X65 L;  3M3Y H;  2LXJ A;  2ZJR A;  2A1A A;  1CKN B;  2PI2 A;  1M1K C;  4HTP A;  3KF8 B;  4GKJ L;  1P16 A;  4LFC L;  3I56 A;  1Z9F A;  3TQY A;  4TQU S;  4IFD J;  2DGY A;  2KEN A;  3BAA A;  2JA7 H;  1EIF A;  2MO0 A;  4A3I H;  3GTQ H;  4B3R L;  4E6N A;  2HIX A;  1JJ2 A;  1XNQ Q;  3S24 A;  1FJG Q;  4GNX B;  2UXC Q;  1A63 A;  3RTX A;  1YHA A;  1TWG H;  2ZJP A;  1SLJ A;  2RHQ B;  2B3G A;  2CKZ B;  3GTO H;  1EFW A;  2K75 A;  4BBS H;  1X55 A;  3VNN A;  1W2B A;  4YHH L;  4BXX G;  1Y1W G;  1S72 A;  1KXL A;  5ELO A;  4OO1 I;  4KI0 A;  2BA1 A;  4GLV B;  2YYZ A;  3A5Z B;  2WAQ E;  1WOC A;  1NY4 A;  2KBN A;  3F2D A;  4GNX C;  4BY7 G;  1JJG A;  1SRO A;  1KIX A;  1MJC A;  4JI8 Q;  5HY6 A;  2AKW B;  3TRE A;  1OXU A;  1Z47 A;  3F2B A;  1D8L A;  2R92 G;  1BKB A;  3HFZ B;  4AYB E;  4K0K L;  2K4K A;  2VQF L;  1UWV A;  2KCT A;  1XMQ L;  1PH5 A;  1HNW L;  4QY7 A;  1GKH A;  1Q81 C;  3W1G A;  2ZTD A;  3L7Z C;  1E7Z A;  4LFA Q;  2UXB Q;  4AQY Q;  4AH6 A;  4EFE A;  2F52 A;  2E2H H;  2EIF A;  1VQ5 A;  5JJL A;  1S68 A;  3BA9 A;  1UE1 A;  3NBY B;  4LF9 Q;  1TWH H;  1AE3 A;  1QUQ B;  3JAM i;  4HIK A;  4HJ9 A;  5IYB H;  3DLL A;  3FHW A;  4A3L H;  4A75 A;  4C2M H;  3STB C;  5J3B A;  5IYD H;  1QZG A;  4OO1 G;  4GKK Q;  1BBU A;  4EFB A;  2IT1 A;  1B70 B;  4JI1 Q;  2R7F A;  2B63 H;  3S17 H;  1VS0 A;  4JCV E;  2WP8 J;  3OTO Q;  4A76 A;  2UXD L;  1J5E L;  5M5X H;  4CC5 A;  4IPC A;  3GTK H;  2EQS A;  3CC7 A;  4B3T L;  1L0W A;  3S1Q H;  2MFI A;  4GN3 B;  3UDG A;  4UP9 A;  4UP7 A;  3WWV A;  2ZTC A;  1VQG A;  3PUV A;  1PA6 A;  1JMC A;  3CC2 A;  3HOW G;  1VQC A;  1V1Q A;  4QGU A;  1OXS C;  1CKM A;  1SMX A;  2K5N A;  2XGT A;  2B29 A;  2R93 H;  3TS2 A;  5FLM G;  1XNR Q;  2IX1 A;  4JI1 L;  5JJI A;  4JI6 Q;  3RR5 A;  4DV0 Q;  1U0L A;  3HOU G;  2IHF A;  3K0X A;  1G29 1;  4NXN L;  4P73 A;  5FPO A;  1NJI C;  3PF4 A;  1VQK A;  4YHH Q;  2VW9 A;  4DAM A;  2WB1 G;  3STB D;  4A3G G;  3DM3 A;  1J6Q A;  3M4Q A;  1PVO A;  2VS1 A;  1X6O A;  3H15 A;  2JA6 G;  3JSL A;  4DR6 Q;  5HGQ A;  3CP0 A;  4JI6 L;  4GKJ Q;  4XIG S;  2YTV A;  2Y0S G;  5IWA L;  4IO9 A;  4LF4 Q;  2VQF Q;  3S1N H;  4OX9 L;  2CCZ A;  4LUV A;  4K0K Q;  1HNZ L;  4PZ8 A;  3HOV H;  2Q2H A;  3CAM A;  4HIM A;  1HZ9 A;  3KDF B;  2VY3 A;  4RMF A;  1K9M C;  1UE5 A;  4X65 Q;  5C0X J;  3HOW H;  1OXV A;  4JI2 Q;  2KHI A;  1K3R A;  1X56 A;  3AQQ A;  3ER0 A;  4TVA B;  3PGZ A;  1Y1V G;  5IP7 G;  4JI2 L;  3S14 H;  1KAW A;  2JA8 G;  4JBW A;  3CCJ A;  5LMN W;  1WCM H;  4KHP L;  2E2I H;  1PH7 A;  4IPH A;  1K8G A;  4DR4 Q;  3I4O A;  3CPF A;  1SE8 A;  1VQB A;  1AE2 A;  2K14 A;  4LUZ A;  3H3V H;  4GKK L;  2B63 G;  3A74 A;  5IP9 H;  2UU9 Q;  2I0Q A;  3OTO L;  5AJ3 Q;  5GRO A;  3G71 A;  3CXC A;  3TY5 A;  4B3M L;  4JI3 Q;  4ME3 A;  1YJ9 A;  4B3S Q;  1G51 A;  5FJ8 H;  2IHE A;  1XMO Q;  4DV1 Q;  3KOJ A;  4KHP Q;  4A3E G;  5C3E H;  4APV A;  5C4X H;  4DR7 Q;  1KHI A;  4POG A;  4A3B G;  4FDB A;  4LF9 L;  3ULJ A;  1GO3 E;  4HID A;  2PNH A;  1KC8 C;  2GVA A;  4DR4 L;  4A3F H;  4A3J G;  1VQ4 A;  2AHO B;  4J15 A;  3CCE A;  3CCR A;  1XPO A;  1HR0 Q;  2NN6 I;  1JB7 A;  1K73 C;  4DV7 L;  2Q2U A;  3HOU H;  3CCM A;  3T1H L;  1XNR L;  3KJO A;  1CSQ A;  3MEF A;  3ULP A;  2FXQ A;  1NE3 A;  4IJL A;  4A4I A;  1N34 L;  3KYH C;  3JAM c;  3PV0 A;  1E24 A;  4DUY L;  3I4M H;  2I5H A;  3S1R H;  4OWW B;  1WJJ A;  3NEL A;  3UQ8 A;  1IXR A;  2UUA L;  3PO3 H;  1VQE A;  1VQ7 A;  1LYL A;  4QJF A;  2H5X A;  4KHZ A;  4BXX H;  4LF6 L;  1QVC A;  4P71 A;  3J80 i;  3UDF A;  1PH8 A;  1IYJ B;  1YBY A;  1TXY A;  4B3R Q;  3FKI H;  4NPS A;  4LF8 L;  4A3M G;  1U5K A;  4HJ5 A;  1PHJ A;  4POF A;  3GTJ H;  2CQO A;  1YIT A;  1FJG L;  1VQH A;  1E1O A;  1XDN A;  4YWL A;  4NXN Q;  1QZH A;  4JBK A;  3UE1 A;  1IL2 A;  2JA8 H;  1HNX L;  3S2D H;  4LF7 Q;  3VDY A;  1AH9 A;  3I2Z A;  2N8N A;  3CCQ A;  4OWT B;  4UCO A;  2UUB L;  4AQY L;  1YEZ A;  4DV6 L;  5GAG C;  1YNX A;  4LF5 L;  1OXX K;  3CCL A;  5ELN A;  2D0O A;  3HOX H;  3KLW A;  1VQD A;  3CMA A;  1NBW A;  3RNU A;  4JI7 L;  2D0P A;  4DV2 L;  1YI2 A;  4A93 G;  5IYD G;  2HHH L;  1Q7Y C;  3QWU A;  5FLM H;  2WB1 E;  3J7A 5;  3NC0 B;  1NTG A;  5C4X G;  2VUM G;  3PUX A;  3A5U A;  3TS0 A;  2QEX A;  3PSI A;  1W3S A;  1SN8 A;  1Y14 B;  1E22 A;  1LUZ A;  1HNX Q;  1ASZ A;  2NVT H;  4A3B H;  4JYA Q;  3BA8 A;  2ALY B;  4JBJ A;  2NVX H;  2XTI A;  4BY1 G;  3NBZ B;  3NEN A;  3CCS A;  1H95 A;  3I7F A;  5IE8 A;  1EQQ A;  3B6Y A;  4LF8 Q;  1N9W A;  2JA5 G;  2ZTE A;  3K8A A;  3CME A;  4LUO A;  3AEV A;  5M3F G;  4YY3 Q;  3T1Y Q;  3HOY G;  5IYC G;  2N49 A;  3K7A H;  4HJA A;  3OW2 A;  3J81 i;  3K7U C;  2PI2 E;  4DPG A;  3PIP A;  4X64 Q;  2JA5 H;  4JI0 L;  2IY5 B;  3F2C A;  4LFA L;  4BA1 I;  4EEQ A;  5JEA G;  5IYC H;  4L5S A;  3L2P A;  3D0F A;  4RG1 A;  1X3G A;  5H1S E;  4DV6 Q;  1VQN A;  4C3H H;  1N34 Q;  4HTO A;  5GAH C;  4A3F G;  1ASY A;  2E5L Q;  3U50 C;  2K52 A;  4AYB G;  1IZ6 A;  4LF7 L;  3CCV A;  5BR8 Q;  2HVS A;  1TWC H;  1QVG A;  1X9N A;  2A19 A;  3LGJ A;  1C7Y A;  2N3S A;  1PV4 A;  3FKI G;  5K36 G;  4Y52 H;  4A93 H;  4DNI A;  2D62 A;  3GTM H;  3J81 c;  5D1O A;  1VQL A;  1SRU A;  1PYS B;  5GAD C;  5IY0 A;  1VQ8 A;  4R4Q A;  4WJ4 A;  1EWI A;  1EQR A;  1Q8K A;  1NMG A;  4JI4 L;  4UCS A;  4OWX B;  4JI4 Q;  4JOI A;  2R7Z H;  3G4S A;  1P8L A;  5FPR A;  1YJW A;  3W1B A;  4A3E H;  1L1O C;  2I5L X;  4IJH A;  3HOX G;  1HZC A;  1HH2 P;  2UUA Q;  1A8V A;  2I5M X;  1PH9 A;  3S15 H;  1X65 A;  5LMN L;  1XK5 A;  3JC6 6;  4MZ9 A;  1VQI A;  1KRT A;  4GLX A;  4AIM A;  5BR8 L;  1GM5 A;  2UU9 L;  2DUD A;  1PFS A;  4LFC Q;  4DV4 L;  4JOI C;  2LSS A;  1JT8 A;  1NMF A;  1X3E A;  1YVC A;  1B7Y B;  3K80 C;  3OYY A;  1L1O A;  5LMU Q;  3MXN B;  3CD6 A;  1B8A A;  4P74 A;  4DV3 Q;  1K0R A;  2R93 G;  1PH3 A;  4BY7 H;  3S2H H;  1UE7 A;  2JA7 G;  5M5W H;  1JJC B;  5C0X I;  3RN5 A;  2UXD Q;  4JG2 A;  1YHB A;  2OWO A;  4DR7 L;  4A3K G;  1L1O B;  3U58 A;  1N32 L;  1JE5 A;  3J81 j;  4GOP B;  3PO3 G;  2AMC B;  3HKZ G;  3GJX B;  4GN4 B;  1L2F A;  3AYH B;  2EXD A;  2N78 A;  3GD7 A;  3H0G G;  4EQ5 A;  4H02 A;  4ALP A;  1E3P A;  4DAY B;  1IBK L;  1IBK Q;  4HJ8 A;  4BBR H;  3A0J A;  1Q86 C;  4DR6 L;  2E2J H;  5IYB G;  3KF6 B;  4CC6 A;  2MNA A;  2VUG A;  1VQM A;  1Q82 C;  1I50 H;  3PIO A;  1IBL L;  2HVR A;  4O0A A;  3ICE A;  3J80 c;  4HIO A;  3NBH B;  2HHH Q;  4BY1 H;  4IFD I;  2RCN A;  5EAY A;  3HOV G;  1VQJ A;  1WFQ A;  4DR1 Q;  4X66 L;  3M7N A;  1V9P A;  1YHQ A;  3RLN A;  1RL2 A;  4YCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...