3W1GA

Crystal structure of human dna ligase iv-artemis complex (native)
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
599
structure length
583
Chain Sequence
TSQTVASHVPFADLCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHKDVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTGDFAMIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISITLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKGTKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNEAIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEYVSMDELDILIVGGYWGKGSGMMSHFLCAVAEKPPPSVFHTLSRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILCGTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLEQLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the catalytic region of DNA ligase IV in complex with an artemis fragment sheds light on double-strand break repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords DNA ligase 4
total genus 175
structure length 583
sequence length 599
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF04675 DNA_ligase_A_N DNA ligase N terminus
A PF04679 DNA_ligase_A_C ATP dependent DNA ligase C terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3260.10 Mainly Alpha Orthogonal Bundle DNA ligase i, domain 1 DNA ligase, ATP-dependent, N-terminal domain 3w1gA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3w1gA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3w1gA02
4UPAA 3CAMA 1PFSA 1T9HA 1VQAA 3L2PA 5GAEC 2HIXA 4BXXG 4BY1G 4DR5L 4JBWA 5IE8A 3STBD 1L1OA 4GLVB 4JI2Q 1I3QH 4BA2I 1HNZL 1TA8A 1PH3A 1SLJA 4RMFA 4A76A 2I5LX 3CPWA 5IP9H 4BY7G 4IJLA 1JMCA 3PUZA 1C9OA 4NXNQ 1YBYA 2Q2UA 4DR4L 1A63A 2QEXA 2K5NA 2AKWB 5GADC 4DRFA 3KOJA 3J81c 1X3GA 4JI2L 4LH6A 4YHHL 1YHAA 1CKMA 2F3IA 2QGQA 2PI2E 2R93G 3TQYA 1HZAA 4DV2Q 3UQ8A 4GKKL 2ZJQA 2AWNA 4X62L 3GJXB 2BA0A 5C44G 1CSQA 1XMOL 1PH8A 1C0AA 2PNHA 1L1OB 4YCWA 5IYCH 2UUBL 2IY5B 1N36Q 1VQHA 2MNAA 4DV3Q 1PA6A 1R9TH 2OQ0A 5IYCG 2B29A 2JJQA 3RZOH 3M9BA 1VQ7A 2JA6H 3M3YH 4KHZA 3U4VA 4X62Q 1EQRA 1Q86C 1HNWQ 1VQ8A 3S1QH 1Y1WH 1HH2P 3CD6A 1JJCB 4UFZA 1I5FA 1B04A 2WP8J 2R92H 4A3CH 2UXCQ 5D1OB 3G6EA 4TQUS 3KF6A 3RN2A 2JA5G 4A4IA 1LYLA 1PYSB 2NVQH 5GAHC 4JV5L 2R7DA 1J5EQ 1Y1VH 1FVIA 3CPFA 3LGJA 3PCOB 1E7ZA 4A75A 1JJ2A 3OTOQ 1S72A 4LFCQ 4A3CG 5M5YH 3GTLH 3GB8B 3IRBA 1B70B 4OWTB 1K8AC 3HOUH 4EFBA 4A3JG 1X65A 2Y0SE 3U50C 3T1YL 3ERSX 5JEAJ 4IOAA 1K83H 4LF6L 2ALYB 4A3KG 3OTOL 1A62A 1Z47A 4E6NA 1YHBA 3UDFA 4OXPA 3EIVA 4B3MQ 3STBC 3HFZB 4B3TL 1VCIA 1K73C 3M4OH 3F2DA 3GTJH 1KHIA 2AMCB 1EUJA 4IPCA 3RLOA 3J80i 4A3IH 1Y14B 2OWOA 3OW2A 2HHHL 4OWWB 4QJFA 2WFWA 4YY3Q 1OXXK 4JI3L 4GKJQ 4KHPQ 2NN6G 1RIPA 3NBHB 2A8VA 3W5OA 4H02A 1PH9A 3K80C 4RG1A 4DK6C 1HZBA 1X6OA 4JI1Q 3GTQH 2DUDA 4DV7L 1VQNA 4R4IA 1XPRA 2NZHA 4GNXC 1JE5A 3W1BA 5IP9G 2ZJRA 5IYBH 1N8RC 2ES2A 4DR3L 4BY7H 2KBNA 4JOIC 1WCMH 5C0XJ 1XMQQ 1OTCA 1HNZQ 4JI5Q 2CKZB 3NENA 2VUMG 5HGQA 1A0IA 3TY8A 4UP8A 1IL2A 4J15A 3J7ZC 4DV6L 2ZTEA 3NELA 3PF4A 1YJWA 3F2CA 4BY1H 2JEAI 5IWAL 2E2JH 4MTNA 1EIYB 1XNQQ 1K3RA 2F4VQ 3PO2G 1LUZA 1N34Q 4ALPA 1HZCA 3FP9A 3RTXA 3HKSA 3CF5A 2AWOA 2JEBI 3ULLA 2Q2HA 4EEQA 1KRTA 3H15A 2JA7H 4A3EG 3H3VH 3E0EA 1K9MC 2KENA 3PO3G 1TWFH 2D0PA 1SR3A 4YCVA 4X64Q 1KQSA 3BZCA 5JJKA 1N36L 4JCVE 5ELOA 3GDEA 4OO1G 1VQFA 4UP7A 4R4QA 3G71A 3RNUA 2NN6I 3M85A 1EOVA 4YHHQ 4JBMA 1QUQA 3UE1A 2UXCL 5FLXc 4WJ4A 4GOPA 1IBLQ 1EFWA 4KI0A 4R4OA 4GN5A 4XTCS 4JI8L 4UCRA 4DV0Q 3A5ZB 1X56A 1KRSA 1IZ6A 4JI7Q 1VQ5A 1MKHA 3AEVA 2KCMA 2V1CC 4P75A 4A3IG 3ULJA 1IBKQ 3GTGH 3BA9A 3FKIG 2CQOA 4B3SL 2XGTA 4PZ6A 2NZOA 1BBWA 4IOCA 3I4NG 1Q1EA 4POFA 1IBMQ 2UUAL 3HOVG 5DISC 2VS1A 1V9PA 3D31A 2BH2A 5EAYA 2I5MX 4PZ8A 4A3KH 1U0LA 1UEBA 3RLFA 5IP7H 4BBRG 2MQHA 4IFDI 5D1PA 4A93H 2QA4A 2CFMA 4IPHA 3S1MH 5FLMG 4K0KQ 2RF4A 1P16A 2HQLA 1K0RA 1V1QA 3ZJYC 1L0WA 3G4SA 1N33L 4MZ9A 3TREA 3JC66 4DR6Q 4A3DG 3NC0B 3NBZB 4YY3L 1M90C 1Y1VG 4HTPA 3GTPH 3K7UC 2HVQA 4JI3Q 3M7NA 1Z9FA 1WOCA 3KYHC 1XNRQ 2R92G 1PYBA 2VZAA 3B6YA 4A3DH 1QZGA 2ZM6L 4C3IH 4HIOA 4X66L 4LH7A 4JI5L 1S40A 4BBRH 1IYJB 2OCEA 5IP7G 1VS0A 4DR3Q 4OONA 4C3JH 3CC2A 4LNQA 4O2DA 1KD1C 3EBEA 5IT9c 3AFQA 4QL5A 3PV0A 5C3EG 4HIMA 3S1RH 1FJGQ 3KDFB 3HOZH 3AYHB 3CCQA 1YJ9A 1HR0Q 5JEAG 5LMUL 4PMWA 1PH5A 4YWMA 4JI1L 4YCUA 3HOVH 1GVPA 3HKZG 3I4NH 1YVCA 1FGUA 4C3HH 4LF8Q 4X64L 3WWVA 3F8TA 1VQBA 1VQMA 1HR0L 3S2DH 3CMAA 4P71A 2JE6I 4LF8L 3CCUA 3MXNB 4DV6Q 1A8VA 4GOPB 4LWCA 3CCSA 4A3MG 1HNXQ 4XIGS 4A3GG 5FPOA 5IYDG 4LF5L 3HOWH 1X3EA 3I4OA 2K14A 2JA9A 2LSSA 3KF6B 4HJ9A 1N34L 2UXDQ 1LTLA 1HNXL 5LMNL 1L1OC 4GS3A 2UXDL 4NPSA 3BJUA 1OXTA 2LXJA 4PZ7A 1GM5A 4LFBQ 4JI7L 3TY5A 1BBUA 2Y0SG 5AJ3L 1PH4A 4Y52H 1EYGA 1KXLA 4X65L 3I55A 3CXCA 3PO3H 4O0AA 3PIPA 4B3SQ 3RN5A 2UUCQ 4A3EH 1PHJA 1O7IA 1UE7A 1YJNA 4P72A 4HIKA 5AJ3Q 2N78A 3U4ZA 4IO9A 2UUAQ 2XTIA 4JOIA 3PO2H 2KHIA 2VUMH 4DK3C 1J5EL 4QQBX 1QUQB 2L15A 4K0KL 4OO1I 4UCUA 3QWUA 1DGSA 4IFDJ 1I6HH 4JG2A 4LFCL 5D1OA 4LUZA 4YWLA 2PQAB 3I2ZA 1SROA 3HOWG 1AE3A 3GTOH 2WAQE 4DR1L 1CSPA 1TWAH 4DV2L 3HOYH 1WFQA 1VQJA 4DUZQ 4JI4L 4FDBA 4LUVA 2IX1A 4JV5Q 3RLNA 1WJJA 1XMOQ 1TXYA 2GVBA 1NMGA 1P8LA 2N49A 1X9NA 3EN2A 1NBWA 1UE6A 4ME3A 1JB7A 1LM0A 4DV3L 4DUZL 2E2IH 4DR1Q 3CCLA 4JI4Q 1SE8A 2E5LQ 4LF4Q 1EQQA 4UCSA 5E7NA 3S1NH 4LF9L 4P74A 3J81j 1V43A 3HOXH 2CWPA 4DV4Q 1PH1A 4DR7Q 1EIFA 3J80c 3S15H 1HNWL 5C4XG 3JSNA 2ATWA 1VQCA 3CW2C 3AQQA 4DR6L 1VQEA 1JT8A 3JAMi 3PN1A 1Q82C 4B3RQ 3PGZA 1XPUA 4A3LG 4EFEA 1XJVA 1AH9A 3ICEA 4NB3A 4L5RC 1QZHA 3HOUG 1L2FA 3MEFA 4IPGA 3A5UA 4A3BG 1B8AA 1GD7A 4A3FH 3CCJA 2ASBA 1PH6A 5M5WH 5JJLA 1YIJA 4B3RL 1XTDA 4NXML 3DLLA 5LMNW 1NY4A 3CC7A 2F4VL 4A3GH 2MFIA 2VQFQ 2JA5H 1SRUA 3E9IA 3OYYA 2MO1A 4BBSG 2YTVA 3PIOA 2YYZA 3DM3A 3TS0A 1UWVA 3BABA 2VQEQ 5C0XI 4B3ML 3S2HH 2NVTH 5FJ8G 2NVYH 3D0FA 4GNXA 2A19A 4DUYQ 4LFAL 3TS2A 4DKAC 2HVRA 1J6QA 1X54A 4UP9A 3BAAA 1VQ4A 4X65Q 1QVCA 5C3EH 3S16H 1OXSC 1AE2A 5C4JH 3UDIA 4R4TA 2Q2TA 2IX0A 1YEZA 2HVSA 4CC5A 1FL0A 5M5XH 2H5XA 5BR8Q 2UUCL 4EQ5A 1VQIA 3K7AH 5JJIA 4JBKA 2R93H 4R1JA 1SN8A 2Z6KC 5LMNQ 2DGYA 1YHQA 5BR8L 1QVGA 4POGA 2R7ZG 4UCOA 3Q8DA 4WJ3M 2KHJA 3S17H 3T1HL 1ASYA 4EX5A 3HKZE 2VW9A 4BXXH 2IT1A 3I7FA 2WAQG 2OTJA 1NJIC 1TAEA 5M3MG 4X6AH 3RR5A 4DR2L 5GROA 4A3LH 4DV0L 1CKNB 2K75A 1NMFA 5C0XG 4A93G 1VQ6A 1VQLA 5C4XH 1S68A 5HY6A 4DV1Q 1KAWA 4AIMA 3KJPA 3HOXG 4OX9Q 4UCVA 3BZKA 1KIXA 1NE3A 3I56A 3KJOA 3KDFA 4OX9L 2BA1A 1XPOA 3I4MH 5GAGC 2WB1E 2VY3A 1Q12A 5M3FH 1X55A 1K8GA 1X3FA 1TWHH 4JYAQ 4IPDA 3CQZH 1WCMG 3J7A5 2A1AA 1H95A 3GO5A 4X66Q 4A3MH 3VNNA 3JSLA 2KCTA 4IFDG 2IHFA 3F1ZA 2E5LL 3GTKH 3L7ZC 3TEHB 3UDXA 5M3FG 1E22A 4CC6A 2E8GA 4YWKA 1VQ9A 4DV4L 2VQFL 1KL9A 1IBML 1SFOH 2VUGA 2VNUD 4NXMQ 2F52A 2JA8G 4Y7NH 4L5TA 1WYDA 2HT1A 2RHSB 3CCVA 3CP0A 1HR0W 2YTYA 5FJ8H 4DNIA 3A0JA 2HIVA 1G291 2WB1G 3PF5A 1M1KC 1N32Q 3SGIA 1GKHA 3BU2A 2VQEL 4HIDA 1OXUA 3ER0A 2UXBQ 4BBSH 4A3JH 4TVAB 5M3MH 2I0QA 4QY7A 2UU9L 1BKBA 1PVOA 4B3TQ 2UXBL 3L0OA 1N32L 1MJCA 4HJ8A 4HJAA 2OTLA 1CUKA 2UU9Q 4DV5L 5H1SE 1ASZA 2IHEA 2BH8A 1MIUA 2R7FA 4JBJA 2HHHQ 4JI6L 2R7ZH 4OWXB 4A3BH 2ZM6Q 4GLAC 4DV5Q 2MO0A 4R4CA 2EIFA 4AQYL 2CWAA 1GO3E 3K81C 5ELNA 5IWAQ 2PMZE 3PUWA 3CC4A 2Z0SA 3M4PA 3T1HQ 2K52A 1IBLL 4DV7Q 4DAMA 2E2HH 4LF5Q 2B63G 1E3PA 1IXRA 2ZTCA 2K4KA 3PUXA 2GVAA 4NXNL 4JI8Q 1PH2A 3S24A 2ZJPA 2K50A 1EWIA 3UE0A 4GNXB 4LF7L 1XMQL 1TWCH 4UY8C 5J3BA 1IBKL 2JA6G 2EQSA 4LFBL 2ID0A 3KLWA 3M4QA 4QIWE 4LF7Q 3H0GG 1HZ9A 3HOZG 3W1GA 4C2MH 3VDYA 4DR2Q 3H0GH 1U5KA 1Q7YC 1XNQL 1VQPA 4DV1L 4BA1I 1CKNA 3FKIH 3UDGA 1QVFA 1Q81C 2JQOA 2B63H 4LW1A 4DR4Q 3H3VI 3HOYG 3A74A 3GD7A 1D8LA 1XK5A 2RCNA 4APVA 1OXVA 2K5VA 4DAYB 2PQAA 4HJ5A 1I50H 4A3FG 2CCZA 4AYBG 2GN5A 4HJ7A 4KLKA 1G6PA 3FHWA 4P73A 1YI2A 4LF9Q 4GKKQ 1MJEA 4UCTA 1G51A 5K36G 1S3OA 1Q8KA 2OQKA 1WI5A 1XNRL 2D62A 2D0OA 2FXQA 2YV5A 5FLMH 2UUBQ 3AFPA 1CKOA 3G48A 3BA8A 2YTXA 4GN3B 1Y1WG 3GTMH 3NBYB 1RL2A 3F2BA 2JA7G 1XDNA 1YITA 4JI0Q 2N8NA 3JAMc 3J81i 1UE1A 1VQGA 2Z6KA 2RHQB 4JI0L 1HJPA 5DLQE 1PV4A 4JYAL 3PUVA 4GOPC 4LF6Q 5C44H 1UE5A 1C7YA 1PH7A 2JA8H 3K0XA 1E24A 1YNXA 2R6GA 2NVXH 2C35B 4GLXA 1W2BA 4HTOA 2Q2IA 3PUYA 1KC8C 3KF8B 2AHOB 1B7YB 3ULPA 1I94Q 2YU9H 3S14H 3TRZA 5IYDH 5IYBG 1N9WA 3K8AA 4L5QA 2VL6A 2K5HA 3KFUA 1BVSA 1Q46A 1VQKA 1E1TA 1E1OA 4DPGA 3E9HA 2PI2A 1Q1BA 3CCEA 1N33Q 5FPRA 1D7QA 4AYBE 4PG3A 4IJHA 3PSIA 1I94L 4JI6Q 4LF4L 3T1YQ 1VQOA 2EXDA 3CCMA 4AQYQ 2B3GA 2JK8A 5IY0A 1FJGL 1YZ6A 3I4MG 4DR7L 5GQOA 2LXKA 4AH6A 1TWGH 1VQDA 3NEMA 4GN4B 3CMEA 5LMUQ 3TY9A 1W3SA 3RZDH 3U58A 4QGUA 4DUYL 4GKJL 2I5HA 4KHPL 4LUOA 1JJGA 4JC0A 4MNOA 1NTGA 3CCRA 2ZTDA 4L5SA 4DR5Q 1SMXA 4LFAQ 2N3SA
chains in the Genus database with same CATH superfamily
4MA5A 1T9HA 4KD3A 4BXXG 4DR5L 3U9OA 2RDFA 1L1OA 4GLVB 1I3QH 3KALA 1TA8A 1PFBA 4BBRB 2Z4HA 1EZ6A 3CPWA 5LP6F 5IP9H 5DNFA 3OSOA 4BY7G 2C5CA 2K6AA 2Q8IB 1YBYA 4NXNQ 2EY6A 1EKVA 4DRFA 1JLLB 1T36A 4EGJA 3KOJA 3J81c 4YHHL 1YHAA 1CKMA 2VQDA 2F3IA 1D1IA 3NUAA 1JWUD 5C1OA 4GKKL 4N9TA 1CSQA 5JEAH 4FP5D 5BWVA 5ELDA 2UUBL 2IY5B 3BYYB 2MNAA 1R9TH 1HRJA 2OQ0A 1I6HB 1BCPD 3A54A 1SJED 2PW7A 3FMCA 4FVMA 2OLSA 1FR3A 4KHZA 1Q86C 5CV7A 1JJCB 3HGBA 2FB9A 3D8GA 1WVLA 1ZXTA 2CH4A 5D1OB 1PFMA 3WDNA 3M3YB 4XYLB 3BVGA 1LYLA 1PYSB 1MI2A 1J5EQ 3MXNA 4JV5L 1GUWA 1QJOA 3A55A 4C56C 1JJ2A 2W71A 3GTLH 1RHPA 1NSNS 1B70B 2MHVA 4I7ZC 4O1NA 4OWTB 5CORA 3HOUH 2CNVA 5BPFA 3TDQA 1GUNA 1V1PB 2GLTA 1MGSA 5JEAJ 3UYYA 1K83H 4LF6L 2ALYB 5G3LF 4O7NA 3HFZB 5CMDA 4QUCA 1Y69U 1PZID 5IGGA 1Y14B 4IQZA 3OW2A 1LV9A 2VXWA 1RIPA 3NBHB 2F0SA 2A73B 1L0XB 1PH9A 3GTQH 1HZBA 4JI1Q 3K5HA 1PLFA 3VYUA 2K33A 3EROA 1XPRA 2XWBB 2ZJRA 5IYBH 1AZPA 1WRVA 2KBNA 4JOIC 5C0XJ 1XMQQ 4C3IB 1IKMA 4JI5Q 4L1KA 1M8AA 5KYIA 4UP8A 5G3LD 4DV6L 1TY0A 1EY5A 1YJWA 4BY1H 2JEAI 3EJIA 2E2JH 5M5YB 1LT6D 1LUZA 1N34Q 4ALPA 3EVQA 2YU9B 4O4IF 1PRTF 2D9UA 3ULLA 2Q2HA 4EEQA 3H15A 4A3EG 1STNA 3T53B 2V5AA 1SYCA 1HQMC 5IGBA 2D0PA 2B8FA 5KS8A 3A7LA 2F3VA 4WFN3 4KKTA 1ILPA 2KHSA 4JBMA 4RH6A 4Z9CB 3WOFA 1I2KA 2NU9B 5FLXc 3S2HB 3KAKA 1TWFB 4GOPA 2ZGIA 3PQIA 1EFWA 4KI0A 4GN5A 5JJZA 4G57A 4UCRA 3WOEA 3JRXA 1KRSA 2WYOA 1TKWB 5C3XA 1IBKQ 2A6EC 2K5WA 3UFXB 4B3SL 1KLGD 2EJ2A 4IOCA 5GONF 1Q1EA 5DISC 5EAYA 1W6KA 2I5MX 3SK4A 4NZMA 1UEBA 5IP7H 4BBRG 4A93H 1UUPA 4IPHA 4CKCA 4AYBB 5J22A 3ZJYC 1SCUB 3H6MA 4DR6Q 3JC66 4A3DG 3WO1A 1RJTA 4RCNA 1CZGA 1Y1VG 3V96A 1ESFA 4IIJF 4CHTB 3K7UC 4WRDA 4TUYF 1VF5C 3M7NA 5KYLA 1BNCA 1S4ZA 5FOBB 3S1RB 4CE5A 1PYBA 2VZAA 1PRTD 1GSAA 5CR5A 1SNPA 3VYTA 2NTSA 3J7AV 2F0OA 5C4HA 4O2DA 3EBEA 3K0YA 3AFQA 4QL5A 3PV0A 5IODA 3HOZH 1DV1A 3TINA 3CCQA 1KLUD 1XTCD 4XQNA 4IUTA 1HCZA 1PH5A 1AZQA 1SYDA 3HOVH 4CGYB 1YVCA 3A8KE 3U55A 1KNEA 3S2DH 3KBXA 4X3KA 3MWEA 4P71A 2JA8B 1QNKA 2DY8A 4WHXA 3DEPA 2A69C 2Z9HA 2OXPA 3T56B 4LF5L 1X3EA 2K14A 1JCKB 3KF6B 1EL0A 1EUDB 1LTLA 3QOJA 1EOTA 5A35A 3E5SA 1OXTA 1GM5A 4LFBQ 4JI7L 2Y0SG 1Y8OB 2QF7A 1EYGA 4X65L 2KEEA 1YNND 5CM0A 5I60A 2F0GA 2IP4A 1YJNA 2NVXB 4HIKA 1PZJD 3LWEA 4IO9A 4JOIA 1O78A 1WR2A 1UEAB 5LOVF 2F0KA 4DLKA 1QUQB 2PZUA 4OO1I 3QWUA 5HNEA 3JAML 2RVLA 2L11A 3I2ZA 3HOWG 4I4TF 2FMMA 3GTOH 1CSPA 4CDEC 3CSWA 2KECA 3HOYH 4XYOA 4FF4A 2HUGA 1VQJA 3VPDA 4DUZQ 4HR7A 4JV5Q 1EIHA 2N49A 1P8LA 3EN2A 2QK4A 3D4WA 5I5SA 3VR5A 1LM0A 4JI4Q 5DGHA 1SE8A 3VA5A 1MSHA 1XXGA 3R93A 2E5LQ 2EJGC 3S1NH 4LF9L 1V43A 2CWPA 1HNWL 2EOTA 1J9OA 2ATWA 1VQEA 3E6ZX 2LFNA 1JT8A 2ZXOA 3JAMi 3I4MB 3NTKA 4ME5A 3ORRA 2OEOA 2JA6B 4NB3A 5M9OA 1T5XD 1QZHA 1EUCB 1L2FA 1GD7A 2ICEC 5JAVA 5JJLA 1YIJA 2F0NA 1XTDA 2IX3A 3DLLA 2K28A 2MFIA 4XZ3B 4K2KA 4A3KB 3HT5A 4BBSG 2YTVA 4K6LA 3TS0A 1UWVA 5DAUA 2VQEQ 3IKJA 1LABA 5FJ8G 3TS2A 1JOOA 4UP9A 2JSOA 3NTHA 1G2TA 3BAAA 5LYJF 1EY0A 2F0VA 4KMUC 5EGTA 5BN3A 1OXSC 2B2TC 3Q22A 3FKIB 4CC5A 5LL6X 4JVZA 3SXHA 2UUCL 2VB2X 1VQIA 2HCCA 3K7AH 1LTTD 4JBKA 2R93H 5I4DA 5LMNQ 1B6SA 5BR8L 4POGA 3QQMA 4K14A 4C3JB 1TWGB 5CC4A 2DIKA 2KHJA 1ASYA 1HQRD 4QUFA 5JH7F 1KC7A 2VW9A 3I73A 2ZT9C 3QOLA 4CJ0B 2EY2A 2WAQG 2OTJA 1NJIC 1TAEA 3R23A 2HGWA 2DWCA 3RR5A 3OUUA 5GROA 1S5FD 4IALA 3PO3B 1ZKOA 2K75A 3D6WA 1BF4A 3RFCA 3D4DA 3RV3A 4ZHQF 4O4JF 1VKZA 1U4MA 4NZOA 4GLWA 4CDCC 4FFMA 3BDCA 3WWIA 4OX9Q 1STEA 4MHEA 4UCVA 3T16A 4J1MA 3NTIA 2O5IC 5BWTA 3GQBA 1Y8NB 1E2ZA 1Q12A 3OOCA 5C4JB 5M3FH 2XSCA 1X55A 1X3FA 4JYAQ 4IPDA 2PQEA 1AFPA 2A1AA 3GO5A 1CT1D 3VNNA 3K57A 3BYTB 3L7ZC 1QCBD 5A2QE 3TEHB 3UDXA 3IL8A 3AX6A 2NUAB 4CC6A 2E8GA 4ZUJA 3K59A 4KJNA 4JW0A 2VQFL 1SFOH 4ZYSA 3MJFA 1KBLA 1K28A 4NXMQ 4L5TA 3N6RA 3BDOA 4FXDA 1KJ9A 1X3QA 3CP0A 4TSSA 2HDKA 2YTYA 5FJ8H 2HIVA 2G9HD 2Z4IA 3PF5A 2NVQB 3I8ZA 1N32Q 1GKHA 5T1IA 1LT4D 3ER0A 4KD4A 2UXBQ 5HURA 4BBSH 1DV2A 4TVAB 5KKNB 4QY7A 2DAAA 3AW8A 1PVOA 1N32L 4M0JA 3X3NA 4HJAA 1KDAA 4JBJA 3A7AB 1HUNA 4JI6L 2ZM6Q 1LT3D 4DV5Q 2MO0A 4XQQA 4AQYL 1GO3E 4M1UB 5IWAQ 3BVZA 3PUWA 5COYA 2ASBA 2Z0SA 3M4PA 2ABJA 2E2HH 4LF5Q 2COGA 3LWUA 1IXRA 2K4KA 3PUXA 1XMQL 4TRDA 4FF1A 3BZDB 2JA6G 4LFBL 1JB3A 4F88A 4LF7Q 3H0GG 1HZ9A 3R3OA 3HOZG 1EZ8A 4DR2Q 1C3OA 3H0GH 3AB9A 2CW0C 1AP0A 3N52A 1UC8A 4A3GB 1CKNA 3UDGA 1HXYD 1F2LA 1QVFA 4LW1A 3S14B 2K03A 3I70A 1II3A 3SHLA 3H3VI 3HOYG 4NP5A 1O80A 2R7KA 4X3TA 2XVSA 1IW7D 2NVTB 2K5VA 2B2YC 4DAYB 5EBCA 1TQOA 2DNEA 2VR1A 1G6PA 4FFPA 2FINB 4R9WA 1O7ZA 1G6ZA 1B44D 1S3OA 1WI5A 4ZRZA 1XNRL 5IT9L 3GTQB 4XQJA 1NAPA 2YTXA 1SFOB 2V4DA 1RL2A 2JA7G 1YITA 4QF4A 4XT3B 4RHRA 2AUKA 1A2TA 2Z6KA 2DZDA 4JI0L 3RMHA 3K0XA 3TP6A 1WD1A 4NYEA 1F2MA 2NVXH 1TWHB 4GLXA 4FFLA 2XRQD 4HTOA 3UZBA 2YU9H 3FPPA 2F1MA 1D5ZC 1TR5A 3K8AA 3KFUA 2VL6A 4DAYA 3BS1A 1VQKA 1E1TA 4H0LC 2PI2A 3CCEA 1W96A 1TVXA 1LT5D 2ENBA 4AYBE 4PG3A 2V59A 3FEWX 3PSIA 3I72A 3T1YQ 2JK8A 3OMGA 4RKBA 5GQOA 4DR7L 3SEBA 3CMEA 4YIJA 2A1HA 2NZ1D 3HEJA 1KEEA 3U58A 2E2DC 3SK8A 2YZNA 2I5HA 5JOBA 5C8YF 1JJGA 4JC0A 4K5XA 1NTGA 2F0UA 1GUOA 4A3IB 4L5SA 2LKVA 1SMXA 4NZNA 5D8DA 2N3SA 4UPAA 5M3MB 3CAMA 2B2UA 3L2PA 4BY1G 5T1GA 3STBD 4TKOB 2E76C 2EYOA 1HNZL 1PH3A 4RMFA 4A76A 3MVVA 4IJLA 4DQNA 3PUZA 2WINB 1A63A 2J4XA 2K5NA 5GADC 3HO8A 3LX0A 1L0YB 1A3GA 3C1FA 3G6JB 2QDLA 2R93G 3TQYA 1HZAA 4FE2A 1ZEQX 2ZJQA 3R8BA 4X62L 3GTGB 2XWJB 4EQOA 5IYCH 1N36Q 4DV3Q 1UC9A 1PA6A 2R92B 2B29A 1GHJA 3RZOH 4MV3A 1VQ7A 2FPPB 3Q24A 1B3QA 4CHIA 4X62Q 4LJZC 3S1QH 1Y1WH 2O5JC 3VPBA 1R4PB 5C3EB 1I5FA 4C5CA 3SE0A 2WP8J 2R92H 1EKFA 2UXCQ 1DOMA 1B3AA 4HMIA 4TQUS 2P0AA 1S5BD 4YBZB 2L1BA 2R7DA 5KNDA 1E7ZA 4DAVA 4C5BA 2CQAA 1K8AC 4UAIA 4A3JG 1X65A 2Y0SE 3HP3A 1BO0A 1DXMA 1S5ED 3T4AC 3KAJA 2PZTA 4E6NA 1YHBA 4OXPA 3EIVA 3STBC 2KVMA 1VCIA 3GTOB 1KHIA 2AMCB 1M6VA 1HPCA 5I2XA 1TT2A 4PMBA 3RLOA 4A3IH 3PMFA 2HHHL 2WFWA 4YY3Q 4JI3L 1CHQD 2NN6G 3W5OA 1PK8A 4RG1A 1PYWD 4ZOLF 2DUDA 2JP1A 5L37A 4PMCA 2NZHA 2R7MA 1RODA 2EXZA 3TP7A 5IP9G 4BY7H 1OTCA 2PO4A 3NENA 2VUMG 2FPGB 1CQVA 1A0IA 3TY8A 1QNUA 3HKZB 2ZTEA 3GTKB 3T9DA 5E25A 2NUCA 4B9XA 2IPKD 4RGNA 5IWAL 3NC0B 1K3RA 3RTXA 3FP9A 2I87A 4A3BB 3HKSA 3CF5A 5ELCA 1ZYRC 3K7AB 4EGQA 1I1KA 1JDBB 3E0EA 1K9MC 3WWHA 4X64Q 1SR3A 3BZCA 5JJKA 5K36H 4JCVE 1Y1WB 3RNUA 4R4QA 2YRWA 3HOXB 5HV6A 4RAUC 3J7AF 5E1FA 4IN3A 3BVMA 2KEDA 3OUZA 1IBLQ 5KIXA 3CHBD 4YJ3F 4R4OA 4XTCS 4JI8L 2NN6H 4BS9A 4XT1B 3JZIA 1Y8PB 1PTOC 1A2UA 1KJQA 2KCMA 3MHBA 4P75A 4A3IG 3ULJA 3R2IA 2B2UC 1JE4A 2CQOA 2XN9C 2XGTA 3OIPA 2NZOA 2B2TA 3A56A 4O86A 2UUAL 4POFA 1IBMQ 4BY1B 3HOVG 3TY9A 2BH2A 2IJ0A 1IKLA 4TV9F 5IGCA 2MQHA 4IFDI 4C3HB 3U0GA 4HN2A 2AQ2B 4O7LA 4K0KQ 2H1EA 2RF4A 1I7NA 1BXTA 3C3LA 1L0WA 1N33L 4O7SA 4MZ9A 1XWEA 3TREA 3NBZB 4DAAA 4N8FA 1RTOA 5C4XB 1Z9FA 3KYHC 2F0PA 1HTLD 2R92G 4A3DH 1QZGA 2F0LA 1DOLA 4ZK9B 4LH7A 4MAMA 2OCEA 5FO9B 4LNQA 4C3JH 1V8QA 4CDDC 5IT9c 2OT2A 5C3EG 4O83A 2VB3X 5I5VA 1GSHA 1YJ9A 1CM9A 4MIUA 3NK9A 1Z2PX 1GVPA 5EJWA 5CR3A 4Y8VB 5C3WA 2MGSA 3WWVA 1VQBA 2NB0A 1BR9A 2EY1A 1IYDA 3UI2A 3FPUB 1A8VA 4GOPB 4A3MG 1K83B 1HNXQ 4CMDA 1TWCB 5EPLA 5IYDG 2W70A 3I4OA 1GGOA 2JA9A 2LSSA 4DAPA 2F0EA 1O7LA 4NPSA 5EBDA 1WTPA 3RV4A 2LXJA 3CRKC 3TY5A 4DXGA 1OO9B 5JPMC 5AJ3L 4Y52H 3CXCA 3HS0C 3PIPA 3T13A 2QDBA 5BPHA 4A3EH 5ELBA 1O7IA 1B9MA 4ZAIA 4P72A 5AJ3Q 3U4ZA 3D4RA 1G8ZD 3DXJC 3I4NB 5FK9C 1DGSA 4IFDJ 1I6HH 3ETJA 4LFCL 5D1OA 1Q8IA 4LUZA 5DAAA 2KCNA 2QCPX 4K6DA 1SROA 1AE3A 3G8CA 5KEEA 3J7YW 1E4EB 4DV2L 2ZDGA 1WFQA 1C8CA 1ILQA 1CI3M 2WV6D 1RKNA 4LUVA 4O7ZA 3RLNA 1STBA 1XMOQ 1TXYA 1IW7C 3R5XA 2JN4A 4OGQC 4FU0A 4DUZL 5DEHA 4A3DB 4Q4DA 5E7NA 1Y1VB 3ZYYX 3HRZC 3J81j 1G2WA 2EYLA 2F0TA 4DV4Q 1TS5A 1PH1A 3S15H 3J80c 3JSNA 5CV8A 4C1NK 4ID6A 2TMPA 3IFDA 4EG0A 3P1HA 3R2TA 3PN1A 2HCIA 1Q82C 4IUVA 4K8IA 4A3LG 1LO5D 3ETHA 3Q2OA 1STGA 4CMFA 4L5RC 2A6HD 3HOUG 4IPGA 1A3UA 4O42A 3CCJA 2EDGA 1PH6A 1TS2A 2HDMA 1A0GA 1I4HA 1NY4A 5IOCA 5K3WA 4A3GH 1DAAA 3VR4A 3OYYA 3JZFA 4F8MA 1TWAB 1ZYRD 2EJFC 2G5DA 5I6YA 3MC0B 4C3HG 3BABA 2N88A 4ZCKA 4B3ML 2B2YA 3QO2A 3S2HH 3VMMA 4LFAL 4DKAC 3NHHA 4J6HA 1VQ4A 1W6JA 1QVCA 5JPNC 1I6VC 1AE2A 2BE5D 2JYOA 2MPMA 5C4JH 4R4TA 2IX0A 5CV5A 3C46A 4IURA 4J8QA 4KY6A 5JJIA 1SN8A 2Z6KC 4ODGA 3Q8DA 4WJ3M 5FKAC 1RTNA 1SJHD 3T1HL 1JR0D 1BNZA 4EX5A 1B50A 4HAEA 4IZ8A 3LWBA 1EYAA 1PTOF 3I7FA 5I6WA 2MJ8A 3DAAA 1X32A 4JXUA 4LK1C 2L55A 2QILA 3QWNA 3TZUA 4FFRA 1CKNB 1FNWA 2EE1A 4O84A 2AQ3B 1QWYA 4DV1Q 4AIMA 3KJPA 2I8CA 4KN7C 2F03A 3T9EA 5FLXL 1KJ8A 4ZQ3A 3G7LA 1NE3A 4OX9L 3KDFA 2BA1A 1RDPD 1XPOA 3NP8A 2A68D 4CBVA 1SE4A 5GAGC 2VY3A 5J2UF 1BCPC 3KLRA 1TWHH 1LTGD 5M5XB 3TIIA 4I65A 1F9QA 2K01A 4X66Q 4YJ2F 4UHVA 2KCTA 4IFDG 2IHFA 1WTVA 5M3FG 1I4QA 4FFNA 2RA4A 2X69A 2E2IB 2BDNA 1KL9A 1CS0A 2ODTX 5KX5F 2F52A 3K5MA 1A3TA 1LTAD 1WYDA 2W6QA 5CV9A 3T99A 1MBYA 2DN8A 1ULZA 4R8NA 3K5OA 4DNIA 1M1KC 1A3VA 1G291 3JRWA 1EZ1A 2ZXPA 2EYJA 3SGIA 1B53A 2VQEL 5CAEB 4RGTA 4A3JH 1JQYD 3GLKA 3S16B 1BCPB 3AU7A 2UXBL 4RGMA 1Z7TA 1KJIA 3CEBA 2EIYA 1ASZA 4K5WA 2HHHQ 4FF3A 1K8OA 1EY4A 4A3BH 1BQQT 4U673 4XX0B 1ET6A 2EY5A 1STHA 4KN4C 4NXNL 4F87A 3V2TA 5EPKA 3S24A 4GNXB 1EWIA 4KHVA 5IT9E 3U9TA 1IBKL 1FNUA 3K6OA 3KLWA 3M4QA 5FO7B 4PBCA 4K5VA 3SDZA 4G7ZC 1H9SB 3W1GA 4QSHA 4C2MH 2CVRA 3VDYA 1DONA 2PN1A 1U5KA 1RD9D 1Q7YC 5TSSA 1ET0A 3FKIH 1I3QB 4DR4Q 4H7BA 3KREA 4ME6A 1PZKD 1D5MC 2KCCA 4FGRA 3V4SA 4BBSB 3A74A 2YZLA 2RCNA 2Z04A 4APVA 4MV1A 1OXVA 1E4EA 2YL2A 4HJ5A 3GTMB 2CCZA 4KLKA 2COJA 4GKKQ 1MJEA 1HHVA 3NQIA 4G7HC 1Q90A 2D62A 2D0OA 2UUBQ 5FLMH 3NBYB 1E2WA 3F2BA 5NUCA 1PTOD 2N8NA 1B9NA 4DGZA 3J81i 1F2ZA 2JA5B 1NR4A 3T9FA 4ZQIA 1HJPA 5IGEA 3F2UA 2SNSA 4FF2A 4LF6Q 3S2DB 2O4XA 5C44H 1F9PA 2JA8H 1JWSD 1HUMA 2K7VA 3ORQA 5J39A 3EA6A 2P5ZX 1W2BA 2Q2IA 1I1MA 1KC8C 4IFDH 1NCVA 1B7YB 3S14H 1I94Q 1N9WA 1EY7A 5I5XA 4KJOA 4L5QA 1BVSA 1Q46A 5FR9A 5BYAA 4OIJA 4DPGA 1N33Q 5ELFA 1SNMA 1RCVD 3J81E 1VBHA 4L6TB 1I94L 4LF4L 2W6OA 1EEFD 1VQOA 2F0QA 3SK6A 4IWXA 1JDEA 4AH6A 1TWGH 1VQDA 3NEMA 5LMUQ 2COIA 4I50F 3D3RA 3DMUA 4QGUA 4ILWA 1NR2A 4GKJL 4KHPL 1U4LA 4LUOA 2R84A 5HGTA 1Z2OX 4LFAQ 4IUQA 5GAEC 5EPJA 2L5TA 3O13A 4PV1C 1SSOA 5IE8A 4BA2I 3HZXA 5BWRA 1SLJA 1VMCA 3GIDA 3QFFA 1JMCA 1C9OA 4MV8A 1X3GA 3T9CA 4LH6A 4S3SA 5I9OA 5DMXA 2QGQA 2PI2E 3S1NB 5C5LA 2HHFA 4KTAA 2AWNA 1DJRD 5C44G 1PH8A 1KABA 4F7XA 4YCWA 1L1OB 3KK7A 2JJQA 3WNZA 2JA6H 3M3YH 2F0JA 1Q3LA 1CQIB 2RQXA 1HNWQ 1HH2P 4DU9A 2SOBA 2A5HA 3CD6A 4UFZA 3VA7A 2CNQA 2WAQB 4TVIA 2O2LD 3KF6A 3RN2A 1WD0A 3URYA 4A4IA 2NVQH 1EWHA 1Y1VH 1FVIA 3LGJA 2NU8B 1I4RA 2EPBA 4JK1C 4A75A 1X3PA 2Z1CA 3OTOQ 2R3ZA 1EY9A 3H0GB 1S72A 3L3OC 4LFCQ 4A3CG 4Q5VA 3IRBA 4I7AA 4P2CB 1QB5D 2DJFC 1SNQA 4FYDA 3U50C 3ERSX 1I7LA 3PIO3 2YZGA 1CK1A 5CBEE 3OTOL 1A62A 1Z47A 2W6ZA 4IWYA 2AUJD 3UDFA 5CB4F 5H80A 4B3TL 1EUJA 4IPCA 2OWOA 3DWAA 1OXXK 5LHY1 3GP7A 4DK6C 1X6OA 4IUPA 2ZDHA 3HG9A 5I2YA 4DR3L 3OW7A 4DNRB 3S15B 1OBDA 1HNZQ 1STAA 4XXEA 2CKZB 5HGQA 4DK0A 1CA6A 1XX8A 3NELA 3PF4A 4O2BF 1XNQQ 2CW0D 3QR8A 3MFYA 3U9SA 3PO2G 1I50B 3NE5B 4JPBW 3VOTA 2AWOA 3NXWA 2R82A 5I5WA 1KRTA 1TS3A 2KENA 3PO3G 1TWFH 4E6IA 3HBLA 4FO2A 1YNJD 1N36L 5ELOA 3GTJB 2C9OA 4V190 4OO1G 3G71A 2NN6I 2RCFA 1JORA 4YHHQ 3UE1A 1KAAA 3VYSA 2YWVA 1HFGA 5C4ZA 3RZDB 3QG1A 4BWGB 3BG5A 1QILA 1X56A 4WBNF 1IZ6A 4JI7Q 1VQ5A 3MXGA 2A69D 3AEVA 2V1CC 1WCMB 2R85A 3GTGH 3BA9A 3FKIG 1DYQA 1MHWC 1BBWA 4OIKA 2PVPA 1CQFA 1V9PA 2VS1A 4C3JG 3K5IA 2XCLA 5D1PA 2SNMA 2CFMA 3SE7A 2HQLA 3EFXD 2Z6BA 1V1QA 1D1KA 1M90C 2QB5A 1HTPA 2YW2A 3GTPH 3DM1A 2DJGC 2HVQA 3P20A 4JI3Q 1HA6A 1E0BA 3P7JA 3B6YA 3MTSA 2ZM6L 1CZWA 4C3IH 4HIOA 4X66L 4JI5L 4RGOS 1S40A 1IYJB 1D6EC 3VR6A 1VS0A 3CC2A 1LACA 3D6CA 1KD1C 1SE3A 3S1RH 2BCOA 1GSOA 3MFGA 1HR0Q 5JEAG 5LMUL 3OMCA 1I4XA 4JI1L 3I4NH 1FGUA 3TP5A 4C3HH 4LF8Q 4K6NA 2PYKA 1VQMA 2J0TD 1HR0L 4HQ6A 2PZWA 3NBHA 2JE6I 3KLSA 3CCUA 1DM0B 4DV6Q 1VMPA 4A3GG 1DCZA 5FPOA 2A6HC 3HOWH 2UXDQ 3LP8A 1N34L 1CQJB 3JZ6A 1HNXL 2PNRC 2SDFA 5LMNL 2AQ1B 2KUMA 5BWUA 4KKUA 2N55A 4G7OC 3BJUA 2B8GA 2A74C 1VDZA 2Y4RA 1KXLA 1PH4A 3I55A 1D2BA 4NMZA 4HSPA 4B3SQ 2B2WA 5I9PA 1UE7A 2GA4B 1EY6A 4BY7B 4ZLTF 2RKSA 2UUAQ 2XTIA 2KHIA 2VUMH 4DK3C 2V58A 2RSOA 3TIGA 4QQBX 4O7TA 5CE8A 4UCUA 2WB1B 2BE5C 4JG2A 4YWLA 2PQAB 1SNOA 3M4OB 1KUTA 1PRTC 4DR1L 5E4WC 1TWAH 2WACA 5KRUA 4C5AA 5IGDA 3VR3A 1FNVA 3NUCA 4C2MB 2B2VA 1H9RA 1WJJA 5BWXA 2GVBA 1NMGA 1JB7A 4MA0A 1M0WA 1NBWA 1UE6A 4ME3A 2E2IH 1Z2NX 1SNCA 4DR1Q 2RDHA 3CCLA 1EQQA 4UCSA 1SNDA 3HOYB 2D5DA 3A8JE 2R61A 4P74A 2Z8LA 3HOXH 3V4ZA 4NKLA 4DR7Q 1EIFA 3V05A 5C4XG 3CW2C 4DR6L 3AQQA 2CH4W 5D65A 2VPQA 1EWCA 1LTID 2DNCA 1B1ZA 1XJVA 4XDXA 3ICEA 1AH9A 1SEBD 1B8AA 2JA7B 3VYRA 5M5WH 4MV6A 5ELEA 5LMNW 1SAPA 3ND9A 4DFAA 2F4VL 2VQFQ 2JA5H 1CTMA 1SRUA 3E9IA 2MO1A 3K5NA 4HMJA 2DLNA 5I5TA 1YNNC 2YYZA 2EJ3A 3T9BA 1HA5A 3WWJA 1BDOA 4ZKCB 5EKLA 5C0XI 1G91A 2NVYH 3D0FA 4GNXA 1YNJC 4CJ1B 2QW7A 1X54A 4TV8F 4ZUIA 2R93B 4X65Q 3TMEA 5C3EH 2NTTA 1VF7A 3DF7A 2Q2TA 3CRLC 3UDIA 4O7YA 4O7VA 3VR2A 2HVSA 3GV3A 2B63B 1GHKA 5M5XH 1GJXA 2Y0SB 3SK5A 2VUMB 1TIID 1I4PA 3Q0AA 2R7ZG 2DGYA 2FFKB 5I47A 2HD3A 1K0SA 1ESRA 2JXMB 3P75A 3S17H 4O2AF 3KLSX 3DWQA 1BUVT 5M3MG 2CHBD 3MWDA 2OF1A 1M4VA 2PW5A 3AMUA 5IGFA 4MV7A 1SYEA 3MZ5A 5C4XH 2M00A 5HY6A 1S5DD 4O4HF 1KAWA 3S9WA 3HOXG 4IUUA 1V1PA 4A3MB 3KJOA 3I4MH 1PFNA 2FHTA 4R8IA 1IOWA 2TSSA 5DGIA 3TW7A 4LMQD 1UAPA 2EYPA 3J80L 2WKDA 4KKSA 4A3MH 1H95A 4YAKB 2H4OA 2DY7A 1SYGA 3F1ZA 2F4IA 3KUPA 2E5LL 1R9TB 1EIGA 3GTKH 1C48A 3LNNA 2BOSA 1KTKA 3FVQA 2VNUD 4KY7A 5C1PA 1PRTB 2HT1A 4IUNA 1JKJB 4PQXA 1U9RA 3CCVA 1A9XA 2WKCA 5HBRB 3A0JA 3UZOA 1F2YA 4HIDA 1U4RA 2MP1A 2HHFB 3K5LA 5CA1F 1CHPD 2K1BA 2UU9L 4B3TQ 3L0OA 3I4LA 3KF8A 4HJ8A 1CUKA 1SYFA 4A3EB 2OTLA 5H1SE 5LL6S 2R7FA 4M9UA 3OPOA 4ULLA 4OWXB 2NU7B 4GLAC 2IWHA 4R4CA 2CWAA 3K81C 5ELNA 3CC4A 4UCOA 4EQPA 3DTFA 2K52A 2WIIB 1IBLL 1E3PA 2ZTCA 1PH2A 4JI8Q 2GVAA 2I07B 3ERQA 3TBIB 2ZJPA 1ENCA 2K50A 1GLVA 4CKEA 1TWCH 5BN5A 5EZYF 5CGKA 4QIWB 4U68A 2ID0A 4IZOA 5DM73 2K5QA 4NW2A 1XNQL 4RCOA 4BA1I 1Q81C 2JQOA 3H3VC 2HJWA 3GV6A 4O7RA 3DUZA 2HGSA 1BBXC 1C4QA 1B2TA 4RHSA 1AUVA 3M4YA 3A8IE 4OHJA 4YAJB 4A3FG 1I50H 2W6NA 2RDGA 4AYBG 2RBMA 3FRPB 1YI2A 1I4GA 4UCTA 1G51A 1E2VA 2XRSD 1WTQA 5K36G 3GTLB 1EY8A 2FXQA 2YV5A 1PTOH 1WTWA 2EJ0A 4DXFA 4O82A 1OBGA 1Y1WG 3RD4A 4QMGA 2NYZD 3JAMc 3T54A 1UE1A 1VQGA 1AN8A 5ISRA 4JYAL 4GOPC 2F0DA 1PH7A 2CZGA 1E24A 1YNXA 3TN2A 2R6GA 1CE8A 2W6PA 2R7NA 2C35B 3PUYA 3ULPA 2AHOB 2K5HA 3E9HA 2SCUB 5FPRA 1PDQA 4JI6Q 2L4NA 3CCMA 5CYUA 4Y7NB 4AQYQ 2B3GA 5IY0A 5F2DA 5EKIA 1FJGL 3I4MG 2LXKA 1BOSA 1W3SA 3RZDH 1H9SA 3CQZB 2XIWA 3IAYA 3CCRA 2IL8A 2EYMA 3K3PA 4DR5Q 2EYFA 2RSNA 1PFSA 4C3IG 2GQSA 1VQAA 2HIXA 1A15A 2FJ2A 2K05A 4JBWA 5CV6A 4HR7B 4JI2Q 3VPCA 2I5LX 1IYUA 2I46A 3E5NA 3TQTA 1K8MA 4DR4L 2Q2UA 3IFTA 2QEXA 2AKWB 1KDCA 2NU6B 4JI2L 4EVOA 3RZOB 4DV2Q 3UQ8A 3RUZA 3GJXB 2BA0A 1XMOL 1C0AA 5JVDF 3GTPB 2PNHA 1PTOB 5I5UA 1WTHA 1VQHA 2A68C 3WO0A 5IYCG 4FFOA 3M9BA 4XYQA 4KV6A 1UNSA 3OWEB 4Q4CA 3U4VA 2GQRA 4N8X1 1EQRA 1WTRA 1VQ8A 1ICWA 2B2VC 3JAME 1B04A 4HNVA 2E74C 1D5XC 4A3CH 5KGUA 4EQNA 2MUYA 3G6EA 2JA5G 3TP8A 2YYAA 2ZDQA 5GAHC 3S1QB 3CPFA 3NWTA 3PCOB 1R4QB 4OO1H 1DOKA 2B2WC 3Q23A 4RZQA 2X5RA 5M5YH 2E2JB 3TSSA 3GB8B 4MV9A 2M9VA 5EQ0A 4GZYC 4EFBA 2QKIC 1O7YA 1DIKA 3U54A 3T1YL 4IOAA 3MXUA 4ABNA 4A3KG 2SEBD 1AUXA 2R87A 2F0FA 1H9JA 3CU7A 2I80A 4B3MQ 1KJJA 3TEKA 1I1LA 5CV4A 1K73C 3M4OH 5I5YA 3F2DA 3GTJH 4XYMB 1F9RA 5E4XA 1JICA 3FDTA 3J80i 4OWWB 3G8DA 4QJFA 5D14A 5KNBA 4GKJQ 4KHPQ 4OL7A 4HNTA 3I91A 2A8VA 4H02A 3SVMA 3K80C 1KT8A 4DV7L 1VQNA 5JQWA 2Q7DA 4R4IA 4GNXC 1JE5A 3W1BA 1ET9A 1N8RC 2ES2A 3Q1KA 4YB8B 3RUPA 1WCMH 1W93A 1SXTA 3LQSA 1IL2A 4J15A 3J7ZC 3PFFA 3BACA 3W2DA 3F2CA 1EIYB 4MTNA 2F4VQ 1JOQA 5K2MA 5KNCA 1HZCA 3HOUB 1WTOA 2JEBI 1IL8A 3H3VH 4MN3A 2JA7H 1IYVA 2HDLA 3I12A 3ONAB 5C0XH 3OWFA 3QJYA 3DTGA 2F0HA 4YCVA 2CNUA 2Q8RE 5CBAE 3QIAA 4O81A 1KQSA 2W6MA 1BXRA 2L0CA 1U4PA 3GDEA 1VQFA 4UP7A 3M85A 1EOVA 1QUQA 5JQGF 1PX2A 2F0MA 2UXCL 4WJ4A 4FXGC 1EFID 4DV0Q 3A5ZB 1T5EA 3H94A 1MKHA 3X3MA 4UDUC 3C2PA 4K2LA 4DNTB 4K8JA 4PZ6A 3I4NG 5M5WB 4HCEA 3D31A 5M3FB 4PZ8A 2EYHA 4A3KH 1U0LA 3RLFA 1ONLA 4HNUA 2QA4A 3S1MH 3R9RA 5FLMG 1ENAA 1P16A 1JWMD 1K0RA 2J7ZA 1G2SA 3BG3A 3E3XA 3G4SA 4WORA 3E0JA 2YS6A 4DIMA 4YY3L 5BN4A 1NNXA 4HTPA 4HSVA 1C30A 3S1MB 5C44B 1EQTA 1WOCA 1EYCA 4L8JA 4I55F 1XNRQ 1SMYD 4CKBA 2K5DA 4V0BA 4DN4M 2HG8A 3NPPA 3J81L 4BBRH 5IP7G 2PCFB 1EKPA 2F0IA 4X3UA 4OONA 4DR3Q 1GUGA 3TZDA 4HIMA 1FJGQ 3KDFB 3AYHB 4PMWA 5BYBA 4YWMA 3MXPA 4YCUA 2XNAC 3HKZG 4A93B 4X64L 3F8TA 4HCSA 3CMAA 2K04A 1IOVA 4LF8L 4RWSC 3MXNB 4LWCA 3CCSA 4XIGS 2NBFA 2A6ED 4KK7A 1QOHA 4HJ9A 5J1ZA 1L1OC 4GS3A 2UXDL 1QE6A 2F3WA 4PZ7A 1BBUA 4WJWA 1TU2B 3PO3H 2DABA 1B4OA 4O0AA 3HB9A 3RN5A 2EJMA 1PXUA 2UUCQ 2YRXA 5JVH3 1PHJA 2G9DA 2KOLA 3H09A 2N78A 2PPBC 3KBGA 3PO2H 1J5EL 3I3CA 1SE2A 1ML0D 4K0KL 2L15A 2X6GA 2R86A 3SR1A 3DHQA 4DA2A 2WAQE 3CKIB 3PO2B 2L9HA 5DM63 4DK1A 4ZI7F 4JI4L 2IX1A 4FDBA 2IW3A 1X9NA 4DV3L 4LF4Q 3N8DA 2XD4A 2E75C 2YS7A 2R7LA 3T51B 1MSGA 3I90A 1VQCA 4A3FB 1FD7D 1EEID 4B3RQ 3PGZA 1XPUA 5E3FA 4EFEA 2D2CC 4G4KA 3MEFA 1IHZA 3NWSA 4FNFA 3MWYW 3A5UA 4A3BG 2HGXA 4A3FH 4B3RL 4NXML 5LXTF 3SNOA 1RF2D 4CJ2C 3CC7A 5BWWA 5FLXE 1GUSA 3H91A 3PIOA 3K58A 1VBGA 2X6LA 3DM3A 4MTKA 2EVBA 4QCLA 1K3BC 2NVTH 2A19A 4DUYQ 2HVRA 1J6QA 4C1NI 3LULA 2LMCB 5CA0F 1B6RA 3S16H 1EYDA 1STYA 2NWGA 5D3DA 3EQLC 1YEZA 2BDOA 3W3AA 1FL0A 1EQVA 2H5XA 5BR8Q 1BCPF 4EQ5A 2YZMA 5D3IB 2FP4B 1MD2D 4R1JA 4ZKBB 1YHQA 1QVGA 3M7GA 3HOZB 3HKZE 3NQTA 3OHXC 1CA5A 4BXXH 2IT1A 4RA8A 4X6AH 1ICFB 1QG7A 4DR2L 1XYIA 4A3LH 4DV0L 1JC7A 1F77A 3NSWA 1NMFA 5C0XG 4A93G 1VQ6A 1VQLA 2FMCA 1CFMA 5AFWA 1DD2A 1A48A 2K32A 1V1OA 1DZ1A 3BZKA 1KIXA 2QEJC 3I56A 4RFBA 2PBZA 4RKLA 5LA6F 3BDLA 3R5FA 2WB1E 1I2LA 1K8GA 2B39A 1GXDC 3CQZH 2ICIA 1WCMG 4FXKC 5JVG3 3J7A5 5K5PA 2Z02A 1LTSD 1ENFA 2FPIB 3JSLA 4QB4A 4OELB 3HOVB 4N9PA 1TS4A 1E22A 3S17B 4YWKA 1VQ9A 4DV4L 2VUGA 1IBML 1M0TA 1FGBD 4Y7NH 2JA8G 1WTXA 1Z6HA 2RHSB 2EZVA 1HR0W 4IHJF 2X0SA 3L9AX 4HN7A 2WB1G 1NUCA 1EU3A 3BU2A 1JOKA 3MA2B 1OXUA 1SDFA 2C00A 3DEOA 5M3MH 5EKKA 2I0QA 1KDBA 1BKBA 1LLRD 1H9KA 1MJCA 2KQ3A 3T7AA 3T9AA 3NBIA 4L63B 2UU9Q 4DV5L 5BMVF 4HEDA 4PNYA 2IHEA 2BH8A 1MIUA 2R7ZH 4O4LF 4OEMB 5C6AA 2EIFA 4O7WA 4EGVA 2PMZE 3T1HQ 4DV7Q 4DAMA 5IIFA 2B63G 2GPWA 3TW6A 1A6XA 1GUTA 1F9SA 4B9WA 4LF7L 3UE0A 2R7ZB 4UY8C 3HOWB 5J3BA 2EQSA 4QIWE 4TM5A 1KTAA 2M2LA 5IYZF 2GPSA 5FO8B 4NDXA 1VQPA 4DV1L 1TY2A 2B63H 3J80E 1HFNA 3ND8A 4E4TA 3GD7A 1EU4A 1D8LA 1XK5A 1LTBD 2Q8TA 2KJXA 1AW7A 1KNAA 2NVYB 2PQAA 1SBBB 1EHIA 3MAQA 2GN5A 1EYZA 1LTRD 4HJ7A 3FHWA 4P73A 4LF9Q 3ITPA 1PMRA 1Q8KA 2OQKA 4HTHA 3PIP3 3BA8A 3AFPA 1CKOA 3G48A 2E2HB 4GN3B 3GTMH 4X3SA 1XDNA 3DWPA 4LAAA 4JI0Q 4B08A 2L12A 1J8IA 4DF7A 4H44C 1IYEA 2J9GA 2HQEA 2RHQB 3MEHA 5DLQE 1PV4A 3OIQA 3PUVA 1C7YA 1UE5A 3QB3A 5A2QL 1S68A 4KY5A 1S5CD 3KF8B 2ZXRA 4Q0FA 4A3JB 5IYDH 3TRZA 5IYBG 2LS01 5C5MA 1FYCA 3Q6SA 1E1OA 4MV4A 5J2TF 2F0WA 1Q1BA 4CDFC 2PMZB 1D7QA 1H9MA 4IJHA 3C1EA 4UUGA 2EXDA 1YZ6A 4GN4B 5JVLA 1SMYC 2LY7A 5FNVF 1ZAUA 1GOZA 1SYBA 2KA7A 4MNOA 1AEXA 4M8AA 2ZTDA 3R5HA 4H13C 4DUYL
chains in the Genus database with same CATH topology
4UPAA 3CAMA 1PFSA 1T9HA 1VQAA 3L2PA 5GAEC 2HIXA 4BXXG 4BY1G 4DR5L 4JBWA 5IE8A 3STBD 1L1OA 4GLVB 4JI2Q 1I3QH 4BA2I 1HNZL 1TA8A 1PH3A 1SLJA 4RMFA 4A76A 2I5LX 3CPWA 5IP9H 4BY7G 4IJLA 1JMCA 3PUZA 1C9OA 4NXNQ 1YBYA 2Q2UA 4DR4L 1A63A 2QEXA 2K5NA 2AKWB 5GADC 4DRFA 3KOJA 3J81c 1X3GA 4JI2L 4LH6A 4YHHL 1YHAA 1CKMA 2F3IA 2QGQA 2PI2E 2R93G 3TQYA 1HZAA 4DV2Q 3UQ8A 4GKKL 2ZJQA 2AWNA 4X62L 3GJXB 2BA0A 5C44G 1CSQA 1XMOL 1PH8A 1C0AA 2PNHA 1L1OB 4YCWA 5IYCH 2UUBL 2IY5B 1N36Q 1VQHA 2MNAA 4DV3Q 1PA6A 1R9TH 2OQ0A 5IYCG 2B29A 2JJQA 3RZOH 3M9BA 1VQ7A 2JA6H 3M3YH 4KHZA 3U4VA 4X62Q 1EQRA 1Q86C 1HNWQ 1VQ8A 3S1QH 1Y1WH 1HH2P 3CD6A 1JJCB 4UFZA 1I5FA 1B04A 2WP8J 2R92H 4A3CH 2UXCQ 5D1OB 3G6EA 4TQUS 3KF6A 3RN2A 2JA5G 4A4IA 1LYLA 1PYSB 2NVQH 5GAHC 4JV5L 2R7DA 1J5EQ 1Y1VH 1FVIA 3CPFA 3LGJA 3PCOB 1E7ZA 4A75A 1JJ2A 3OTOQ 1S72A 4LFCQ 4A3CG 5M5YH 3GTLH 3GB8B 3IRBA 1B70B 4OWTB 1K8AC 3HOUH 4EFBA 4A3JG 1X65A 2Y0SE 3U50C 3T1YL 3ERSX 5JEAJ 4IOAA 1K83H 4LF6L 2ALYB 4A3KG 3OTOL 1A62A 1Z47A 4E6NA 1YHBA 3UDFA 4OXPA 3EIVA 4B3MQ 3STBC 3HFZB 4B3TL 1VCIA 1K73C 3M4OH 3F2DA 3GTJH 1KHIA 2AMCB 1EUJA 4IPCA 3RLOA 3J80i 4A3IH 1Y14B 2OWOA 3OW2A 2HHHL 4OWWB 4QJFA 2WFWA 4YY3Q 1OXXK 4JI3L 4GKJQ 4KHPQ 2NN6G 1RIPA 3NBHB 2A8VA 3W5OA 4H02A 1PH9A 3K80C 4RG1A 4DK6C 1HZBA 1X6OA 4JI1Q 3GTQH 2DUDA 4DV7L 1VQNA 4R4IA 1XPRA 2NZHA 4GNXC 1JE5A 3W1BA 5IP9G 2ZJRA 5IYBH 1N8RC 2ES2A 4DR3L 4BY7H 2KBNA 4JOIC 1WCMH 5C0XJ 1XMQQ 1OTCA 1HNZQ 4JI5Q 2CKZB 3NENA 2VUMG 5HGQA 1A0IA 3TY8A 4UP8A 1IL2A 4J15A 3J7ZC 4DV6L 2ZTEA 3NELA 3PF4A 1YJWA 3F2CA 4BY1H 2JEAI 5IWAL 2E2JH 4MTNA 1EIYB 1XNQQ 1K3RA 2F4VQ 3PO2G 1LUZA 1N34Q 4ALPA 1HZCA 3FP9A 3RTXA 3HKSA 3CF5A 2AWOA 2JEBI 3ULLA 2Q2HA 4EEQA 1KRTA 3H15A 2JA7H 4A3EG 3H3VH 3E0EA 1K9MC 2KENA 3PO3G 1TWFH 2D0PA 1SR3A 4YCVA 4X64Q 1KQSA 3BZCA 5JJKA 1N36L 4JCVE 5ELOA 3GDEA 4OO1G 1VQFA 4UP7A 4R4QA 3G71A 3RNUA 2NN6I 3M85A 1EOVA 4YHHQ 4JBMA 1QUQA 3UE1A 2UXCL 5FLXc 4WJ4A 4GOPA 1IBLQ 1EFWA 4KI0A 4R4OA 4GN5A 4XTCS 4JI8L 4UCRA 4DV0Q 3A5ZB 1X56A 1KRSA 1IZ6A 4JI7Q 1VQ5A 1MKHA 3AEVA 2KCMA 2V1CC 4P75A 4A3IG 3ULJA 1IBKQ 3GTGH 3BA9A 3FKIG 2CQOA 4B3SL 2XGTA 4PZ6A 2NZOA 1BBWA 4IOCA 3I4NG 1Q1EA 4POFA 1IBMQ 2UUAL 3HOVG 5DISC 2VS1A 1V9PA 3D31A 2BH2A 5EAYA 2I5MX 4PZ8A 4A3KH 1U0LA 1UEBA 3RLFA 5IP7H 4BBRG 2MQHA 4IFDI 5D1PA 4A93H 2QA4A 2CFMA 4IPHA 3S1MH 5FLMG 4K0KQ 2RF4A 1P16A 2HQLA 1K0RA 1V1QA 3ZJYC 1L0WA 3G4SA 1N33L 4MZ9A 3TREA 3JC66 4DR6Q 4A3DG 3NC0B 3NBZB 4YY3L 1M90C 1Y1VG 4HTPA 3GTPH 3K7UC 2HVQA 4JI3Q 3M7NA 1Z9FA 1WOCA 3KYHC 1XNRQ 2R92G 1PYBA 2VZAA 3B6YA 4A3DH 1QZGA 2ZM6L 4C3IH 4HIOA 4X66L 4LH7A 4JI5L 1S40A 4BBRH 1IYJB 2OCEA 5IP7G 1VS0A 4DR3Q 4OONA 4C3JH 3CC2A 4LNQA 4O2DA 1KD1C 3EBEA 5IT9c 3AFQA 4QL5A 3PV0A 5C3EG 4HIMA 3S1RH 1FJGQ 3KDFB 3HOZH 3AYHB 3CCQA 1YJ9A 1HR0Q 5JEAG 5LMUL 4PMWA 1PH5A 4YWMA 4JI1L 4YCUA 3HOVH 1GVPA 3HKZG 3I4NH 1YVCA 1FGUA 4C3HH 4LF8Q 4X64L 3WWVA 3F8TA 1VQBA 1VQMA 1HR0L 3S2DH 3CMAA 4P71A 2JE6I 4LF8L 3CCUA 3MXNB 4DV6Q 1A8VA 4GOPB 4LWCA 3CCSA 4A3MG 1HNXQ 4XIGS 4A3GG 5FPOA 5IYDG 4LF5L 3HOWH 1X3EA 3I4OA 2K14A 2JA9A 2LSSA 3KF6B 4HJ9A 1N34L 2UXDQ 1LTLA 1HNXL 5LMNL 1L1OC 4GS3A 2UXDL 4NPSA 3BJUA 1OXTA 2LXJA 4PZ7A 1GM5A 4LFBQ 4JI7L 3TY5A 1BBUA 2Y0SG 5AJ3L 1PH4A 4Y52H 1EYGA 1KXLA 4X65L 3I55A 3CXCA 3PO3H 4O0AA 3PIPA 4B3SQ 3RN5A 2UUCQ 4A3EH 1PHJA 1O7IA 1UE7A 1YJNA 4P72A 4HIKA 5AJ3Q 2N78A 3U4ZA 4IO9A 2UUAQ 2XTIA 4JOIA 3PO2H 2KHIA 2VUMH 4DK3C 1J5EL 4QQBX 1QUQB 2L15A 4K0KL 4OO1I 4UCUA 3QWUA 1DGSA 4IFDJ 1I6HH 4JG2A 4LFCL 5D1OA 4LUZA 4YWLA 2PQAB 3I2ZA 1SROA 3HOWG 1AE3A 3GTOH 2WAQE 4DR1L 1CSPA 1TWAH 4DV2L 3HOYH 1WFQA 1VQJA 4DUZQ 4JI4L 4FDBA 4LUVA 2IX1A 4JV5Q 3RLNA 1WJJA 1XMOQ 1TXYA 2GVBA 1NMGA 1P8LA 2N49A 1X9NA 3EN2A 1NBWA 1UE6A 4ME3A 1JB7A 1LM0A 4DV3L 4DUZL 2E2IH 4DR1Q 3CCLA 4JI4Q 1SE8A 2E5LQ 4LF4Q 1EQQA 4UCSA 5E7NA 3S1NH 4LF9L 4P74A 3J81j 1V43A 3HOXH 2CWPA 4DV4Q 1PH1A 4DR7Q 1EIFA 3J80c 3S15H 1HNWL 5C4XG 3JSNA 2ATWA 1VQCA 3CW2C 3AQQA 4DR6L 1VQEA 1JT8A 3JAMi 3PN1A 1Q82C 4B3RQ 3PGZA 1XPUA 4A3LG 4EFEA 1XJVA 1AH9A 3ICEA 4NB3A 4L5RC 1QZHA 3HOUG 1L2FA 3MEFA 4IPGA 3A5UA 4A3BG 1B8AA 1GD7A 4A3FH 3CCJA 2ASBA 1PH6A 5M5WH 5JJLA 1YIJA 4B3RL 1XTDA 4NXML 3DLLA 5LMNW 1NY4A 3CC7A 2F4VL 4A3GH 2MFIA 2VQFQ 2JA5H 1SRUA 3E9IA 3OYYA 2MO1A 4BBSG 2YTVA 3PIOA 2YYZA 3DM3A 3TS0A 1UWVA 3BABA 2VQEQ 5C0XI 4B3ML 3S2HH 2NVTH 5FJ8G 2NVYH 3D0FA 4GNXA 2A19A 4DUYQ 4LFAL 3TS2A 4DKAC 2HVRA 1J6QA 1X54A 4UP9A 3BAAA 1VQ4A 4X65Q 1QVCA 5C3EH 3S16H 1OXSC 1AE2A 5C4JH 3UDIA 4R4TA 2Q2TA 2IX0A 1YEZA 2HVSA 4CC5A 1FL0A 5M5XH 2H5XA 5BR8Q 2UUCL 4EQ5A 1VQIA 3K7AH 5JJIA 4JBKA 2R93H 4R1JA 1SN8A 2Z6KC 5LMNQ 2DGYA 1YHQA 5BR8L 1QVGA 4POGA 2R7ZG 4UCOA 3Q8DA 4WJ3M 2KHJA 3S17H 3T1HL 1ASYA 4EX5A 3HKZE 2VW9A 4BXXH 2IT1A 3I7FA 2WAQG 2OTJA 1NJIC 1TAEA 5M3MG 4X6AH 3RR5A 4DR2L 5GROA 4A3LH 4DV0L 1CKNB 2K75A 1NMFA 5C0XG 4A93G 1VQ6A 1VQLA 5C4XH 1S68A 5HY6A 4DV1Q 1KAWA 4AIMA 3KJPA 3HOXG 4OX9Q 4UCVA 3BZKA 1KIXA 1NE3A 3I56A 3KJOA 3KDFA 4OX9L 2BA1A 1XPOA 3I4MH 5GAGC 2WB1E 2VY3A 1Q12A 5M3FH 1X55A 1K8GA 1X3FA 1TWHH 4JYAQ 4IPDA 3CQZH 1WCMG 3J7A5 2A1AA 1H95A 3GO5A 4X66Q 4A3MH 3VNNA 3JSLA 2KCTA 4IFDG 2IHFA 3F1ZA 2E5LL 3GTKH 3L7ZC 3TEHB 3UDXA 5M3FG 1E22A 4CC6A 2E8GA 4YWKA 1VQ9A 4DV4L 2VQFL 1KL9A 1IBML 1SFOH 2VUGA 2VNUD 4NXMQ 2F52A 2JA8G 4Y7NH 4L5TA 1WYDA 2HT1A 2RHSB 3CCVA 3CP0A 1HR0W 2YTYA 5FJ8H 4DNIA 3A0JA 2HIVA 1G291 2WB1G 3PF5A 1M1KC 1N32Q 3SGIA 1GKHA 3BU2A 2VQEL 4HIDA 1OXUA 3ER0A 2UXBQ 4BBSH 4A3JH 4TVAB 5M3MH 2I0QA 4QY7A 2UU9L 1BKBA 1PVOA 4B3TQ 2UXBL 3L0OA 1N32L 1MJCA 4HJ8A 4HJAA 2OTLA 1CUKA 2UU9Q 4DV5L 5H1SE 1ASZA 2IHEA 2BH8A 1MIUA 2R7FA 4JBJA 2HHHQ 4JI6L 2R7ZH 4OWXB 4A3BH 2ZM6Q 4GLAC 4DV5Q 2MO0A 4R4CA 2EIFA 4AQYL 2CWAA 1GO3E 3K81C 5ELNA 5IWAQ 2PMZE 3PUWA 3CC4A 2Z0SA 3M4PA 3T1HQ 2K52A 1IBLL 4DV7Q 4DAMA 2E2HH 4LF5Q 2B63G 1E3PA 1IXRA 2ZTCA 2K4KA 3PUXA 2GVAA 4NXNL 4JI8Q 1PH2A 3S24A 2ZJPA 2K50A 1EWIA 3UE0A 4GNXB 4LF7L 1XMQL 1TWCH 4UY8C 5J3BA 1IBKL 2JA6G 2EQSA 4LFBL 2ID0A 3KLWA 3M4QA 4QIWE 4LF7Q 3H0GG 1HZ9A 3HOZG 3W1GA 4C2MH 3VDYA 4DR2Q 3H0GH 1U5KA 1Q7YC 1XNQL 1VQPA 4DV1L 4BA1I 1CKNA 3FKIH 3UDGA 1QVFA 1Q81C 2JQOA 2B63H 4LW1A 4DR4Q 3H3VI 3HOYG 3A74A 3GD7A 1D8LA 1XK5A 2RCNA 4APVA 1OXVA 2K5VA 4DAYB 2PQAA 4HJ5A 1I50H 4A3FG 2CCZA 4AYBG 2GN5A 4HJ7A 4KLKA 1G6PA 3FHWA 4P73A 1YI2A 4LF9Q 4GKKQ 1MJEA 4UCTA 1G51A 5K36G 1S3OA 1Q8KA 2OQKA 1WI5A 1XNRL 2D62A 2D0OA 2FXQA 2YV5A 5FLMH 2UUBQ 3AFPA 1CKOA 3G48A 3BA8A 2YTXA 4GN3B 1Y1WG 3GTMH 3NBYB 1RL2A 3F2BA 2JA7G 1XDNA 1YITA 4JI0Q 2N8NA 3JAMc 3J81i 1UE1A 1VQGA 2Z6KA 2RHQB 4JI0L 1HJPA 5DLQE 1PV4A 4JYAL 3PUVA 4GOPC 4LF6Q 5C44H 1UE5A 1C7YA 1PH7A 2JA8H 3K0XA 1E24A 1YNXA 2R6GA 2NVXH 2C35B 4GLXA 1W2BA 4HTOA 2Q2IA 3PUYA 1KC8C 3KF8B 2AHOB 1B7YB 3ULPA 1I94Q 2YU9H 3S14H 3TRZA 5IYDH 5IYBG 1N9WA 3K8AA 4L5QA 2VL6A 2K5HA 3KFUA 1BVSA 1Q46A 1VQKA 1E1TA 1E1OA 4DPGA 3E9HA 2PI2A 1Q1BA 3CCEA 1N33Q 5FPRA 1D7QA 4AYBE 4PG3A 4IJHA 3PSIA 1I94L 4JI6Q 4LF4L 3T1YQ 1VQOA 2EXDA 3CCMA 4AQYQ 2B3GA 2JK8A 5IY0A 1FJGL 1YZ6A 3I4MG 4DR7L 5GQOA 2LXKA 4AH6A 1TWGH 1VQDA 3NEMA 4GN4B 3CMEA 5LMUQ 3TY9A 1W3SA 3RZDH 3U58A 4QGUA 4DUYL 4GKJL 2I5HA 4KHPL 4LUOA 1JJGA 4JC0A 4MNOA 1NTGA 3CCRA 2ZTDA 4L5SA 4DR5Q 1SMXA 4LFAQ 2N3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UPA A;  3CAM A;  1PFS A;  1T9H A;  1VQA A;  3L2P A;  5GAE C;  2HIX A;  4BXX G;  4BY1 G;  4DR5 L;  4JBW A;  5IE8 A;  3STB D;  1L1O A;  4GLV B;  4JI2 Q;  1I3Q H;  4BA2 I;  1HNZ L;  1TA8 A;  1PH3 A;  1SLJ A;  4RMF A;  4A76 A;  2I5L X;  3CPW A;  5IP9 H;  4BY7 G;  4IJL A;  1JMC A;  3PUZ A;  1C9O A;  4NXN Q;  1YBY A;  2Q2U A;  4DR4 L;  1A63 A;  2QEX A;  2K5N A;  2AKW B;  5GAD C;  4DRF A;  3KOJ A;  3J81 c;  1X3G A;  4JI2 L;  4LH6 A;  4YHH L;  1YHA A;  1CKM A;  2F3I A;  2QGQ A;  2PI2 E;  2R93 G;  3TQY A;  1HZA A;  4DV2 Q;  3UQ8 A;  4GKK L;  2ZJQ A;  2AWN A;  4X62 L;  3GJX B;  2BA0 A;  5C44 G;  1CSQ A;  1XMO L;  1PH8 A;  1C0A A;  2PNH A;  1L1O B;  4YCW A;  5IYC H;  2UUB L;  2IY5 B;  1N36 Q;  1VQH A;  2MNA A;  4DV3 Q;  1PA6 A;  1R9T H;  2OQ0 A;  5IYC G;  2B29 A;  2JJQ A;  3RZO H;  3M9B A;  1VQ7 A;  2JA6 H;  3M3Y H;  4KHZ A;  3U4V A;  4X62 Q;  1EQR A;  1Q86 C;  1HNW Q;  1VQ8 A;  3S1Q H;  1Y1W H;  1HH2 P;  3CD6 A;  1JJC B;  4UFZ A;  1I5F A;  1B04 A;  2WP8 J;  2R92 H;  4A3C H;  2UXC Q;  5D1O B;  3G6E A;  4TQU S;  3KF6 A;  3RN2 A;  2JA5 G;  4A4I A;  1LYL A;  1PYS B;  2NVQ H;  5GAH C;  4JV5 L;  2R7D A;  1J5E Q;  1Y1V H;  1FVI A;  3CPF A;  3LGJ A;  3PCO B;  1E7Z A;  4A75 A;  1JJ2 A;  3OTO Q;  1S72 A;  4LFC Q;  4A3C G;  5M5Y H;  3GTL H;  3GB8 B;  3IRB A;  1B70 B;  4OWT B;  1K8A C;  3HOU H;  4EFB A;  4A3J G;  1X65 A;  2Y0S E;  3U50 C;  3T1Y L;  3ERS X;  5JEA J;  4IOA A;  1K83 H;  4LF6 L;  2ALY B;  4A3K G;  3OTO L;  1A62 A;  1Z47 A;  4E6N A;  1YHB A;  3UDF A;  4OXP A;  3EIV A;  4B3M Q;  3STB C;  3HFZ B;  4B3T L;  1VCI A;  1K73 C;  3M4O H;  3F2D A;  3GTJ H;  1KHI A;  2AMC B;  1EUJ A;  4IPC A;  3RLO A;  3J80 i;  4A3I H;  1Y14 B;  2OWO A;  3OW2 A;  2HHH L;  4OWW B;  4QJF A;  2WFW A;  4YY3 Q;  1OXX K;  4JI3 L;  4GKJ Q;  4KHP Q;  2NN6 G;  1RIP A;  3NBH B;  2A8V A;  3W5O A;  4H02 A;  1PH9 A;  3K80 C;  4RG1 A;  4DK6 C;  1HZB A;  1X6O A;  4JI1 Q;  3GTQ H;  2DUD A;  4DV7 L;  1VQN A;  4R4I A;  1XPR A;  2NZH A;  4GNX C;  1JE5 A;  3W1B A;  5IP9 G;  2ZJR A;  5IYB H;  1N8R C;  2ES2 A;  4DR3 L;  4BY7 H;  2KBN A;  4JOI C;  1WCM H;  5C0X J;  1XMQ Q;  1OTC A;  1HNZ Q;  4JI5 Q;  2CKZ B;  3NEN A;  2VUM G;  5HGQ A;  1A0I A;  3TY8 A;  4UP8 A;  1IL2 A;  4J15 A;  3J7Z C;  4DV6 L;  2ZTE A;  3NEL A;  3PF4 A;  1YJW A;  3F2C A;  4BY1 H;  2JEA I;  5IWA L;  2E2J H;  4MTN A;  1EIY B;  1XNQ Q;  1K3R A;  2F4V Q;  3PO2 G;  1LUZ A;  1N34 Q;  4ALP A;  1HZC A;  3FP9 A;  3RTX A;  3HKS A;  3CF5 A;  2AWO A;  2JEB I;  3ULL A;  2Q2H A;  4EEQ A;  1KRT A;  3H15 A;  2JA7 H;  4A3E G;  3H3V H;  3E0E A;  1K9M C;  2KEN A;  3PO3 G;  1TWF H;  2D0P A;  1SR3 A;  4YCV A;  4X64 Q;  1KQS A;  3BZC A;  5JJK A;  1N36 L;  4JCV E;  5ELO A;  3GDE A;  4OO1 G;  1VQF A;  4UP7 A;  4R4Q A;  3G71 A;  3RNU A;  2NN6 I;  3M85 A;  1EOV A;  4YHH Q;  4JBM A;  1QUQ A;  3UE1 A;  2UXC L;  5FLX c;  4WJ4 A;  4GOP A;  1IBL Q;  1EFW A;  4KI0 A;  4R4O A;  4GN5 A;  4XTC S;  4JI8 L;  4UCR A;  4DV0 Q;  3A5Z B;  1X56 A;  1KRS A;  1IZ6 A;  4JI7 Q;  1VQ5 A;  1MKH A;  3AEV A;  2KCM A;  2V1C C;  4P75 A;  4A3I G;  3ULJ A;  1IBK Q;  3GTG H;  3BA9 A;  3FKI G;  2CQO A;  4B3S L;  2XGT A;  4PZ6 A;  2NZO A;  1BBW A;  4IOC A;  3I4N G;  1Q1E A;  4POF A;  1IBM Q;  2UUA L;  3HOV G;  5DIS C;  2VS1 A;  1V9P A;  3D31 A;  2BH2 A;  5EAY A;  2I5M X;  4PZ8 A;  4A3K H;  1U0L A;  1UEB A;  3RLF A;  5IP7 H;  4BBR G;  2MQH A;  4IFD I;  5D1P A;  4A93 H;  2QA4 A;  2CFM A;  4IPH A;  3S1M H;  5FLM G;  4K0K Q;  2RF4 A;  1P16 A;  2HQL A;  1K0R A;  1V1Q A;  3ZJY C;  1L0W A;  3G4S A;  1N33 L;  4MZ9 A;  3TRE A;  3JC6 6;  4DR6 Q;  4A3D G;  3NC0 B;  3NBZ B;  4YY3 L;  1M90 C;  1Y1V G;  4HTP A;  3GTP H;  3K7U C;  2HVQ A;  4JI3 Q;  3M7N A;  1Z9F A;  1WOC A;  3KYH C;  1XNR Q;  2R92 G;  1PYB A;  2VZA A;  3B6Y A;  4A3D H;  1QZG A;  2ZM6 L;  4C3I H;  4HIO A;  4X66 L;  4LH7 A;  4JI5 L;  1S40 A;  4BBR H;  1IYJ B;  2OCE A;  5IP7 G;  1VS0 A;  4DR3 Q;  4OON A;  4C3J H;  3CC2 A;  4LNQ A;  4O2D A;  1KD1 C;  3EBE A;  5IT9 c;  3AFQ A;  4QL5 A;  3PV0 A;  5C3E G;  4HIM A;  3S1R H;  1FJG Q;  3KDF B;  3HOZ H;  3AYH B;  3CCQ A;  1YJ9 A;  1HR0 Q;  5JEA G;  5LMU L;  4PMW A;  1PH5 A;  4YWM A;  4JI1 L;  4YCU A;  3HOV H;  1GVP A;  3HKZ G;  3I4N H;  1YVC A;  1FGU A;  4C3H H;  4LF8 Q;  4X64 L;  3WWV A;  3F8T A;  1VQB A;  1VQM A;  1HR0 L;  3S2D H;  3CMA A;  4P71 A;  2JE6 I;  4LF8 L;  3CCU A;  3MXN B;  4DV6 Q;  1A8V A;  4GOP B;  4LWC A;  3CCS A;  4A3M G;  1HNX Q;  4XIG S;  4A3G G;  5FPO A;  5IYD G;  4LF5 L;  3HOW H;  1X3E A;  3I4O A;  2K14 A;  2JA9 A;  2LSS A;  3KF6 B;  4HJ9 A;  1N34 L;  2UXD Q;  1LTL A;  1HNX L;  5LMN L;  1L1O C;  4GS3 A;  2UXD L;  4NPS A;  3BJU A;  1OXT A;  2LXJ A;  4PZ7 A;  1GM5 A;  4LFB Q;  4JI7 L;  3TY5 A;  1BBU A;  2Y0S G;  5AJ3 L;  1PH4 A;  4Y52 H;  1EYG A;  1KXL A;  4X65 L;  3I55 A;  3CXC A;  3PO3 H;  4O0A A;  3PIP A;  4B3S Q;  3RN5 A;  2UUC Q;  4A3E H;  1PHJ A;  1O7I A;  1UE7 A;  1YJN A;  4P72 A;  4HIK A;  5AJ3 Q;  2N78 A;  3U4Z A;  4IO9 A;  2UUA Q;  2XTI A;  4JOI A;  3PO2 H;  2KHI A;  2VUM H;  4DK3 C;  1J5E L;  4QQB X;  1QUQ B;  2L15 A;  4K0K L;  4OO1 I;  4UCU A;  3QWU A;  1DGS A;  4IFD J;  1I6H H;  4JG2 A;  4LFC L;  5D1O A;  4LUZ A;  4YWL A;  2PQA B;  3I2Z A;  1SRO A;  3HOW G;  1AE3 A;  3GTO H;  2WAQ E;  4DR1 L;  1CSP A;  1TWA H;  4DV2 L;  3HOY H;  1WFQ A;  1VQJ A;  4DUZ Q;  4JI4 L;  4FDB A;  4LUV A;  2IX1 A;  4JV5 Q;  3RLN A;  1WJJ A;  1XMO Q;  1TXY A;  2GVB A;  1NMG A;  1P8L A;  2N49 A;  1X9N A;  3EN2 A;  1NBW A;  1UE6 A;  4ME3 A;  1JB7 A;  1LM0 A;  4DV3 L;  4DUZ L;  2E2I H;  4DR1 Q;  3CCL A;  4JI4 Q;  1SE8 A;  2E5L Q;  4LF4 Q;  1EQQ A;  4UCS A;  5E7N A;  3S1N H;  4LF9 L;  4P74 A;  3J81 j;  1V43 A;  3HOX H;  2CWP A;  4DV4 Q;  1PH1 A;  4DR7 Q;  1EIF A;  3J80 c;  3S15 H;  1HNW L;  5C4X G;  3JSN A;  2ATW A;  1VQC A;  3CW2 C;  3AQQ A;  4DR6 L;  1VQE A;  1JT8 A;  3JAM i;  3PN1 A;  1Q82 C;  4B3R Q;  3PGZ A;  1XPU A;  4A3L G;  4EFE A;  1XJV A;  1AH9 A;  3ICE A;  4NB3 A;  4L5R C;  1QZH A;  3HOU G;  1L2F A;  3MEF A;  4IPG A;  3A5U A;  4A3B G;  1B8A A;  1GD7 A;  4A3F H;  3CCJ A;  2ASB A;  1PH6 A;  5M5W H;  5JJL A;  1YIJ A;  4B3R L;  1XTD A;  4NXM L;  3DLL A;  5LMN W;  1NY4 A;  3CC7 A;  2F4V L;  4A3G H;  2MFI A;  2VQF Q;  2JA5 H;  1SRU A;  3E9I A;  3OYY A;  2MO1 A;  4BBS G;  2YTV A;  3PIO A;  2YYZ A;  3DM3 A;  3TS0 A;  1UWV A;  3BAB A;  2VQE Q;  5C0X I;  4B3M L;  3S2H H;  2NVT H;  5FJ8 G;  2NVY H;  3D0F A;  4GNX A;  2A19 A;  4DUY Q;  4LFA L;  3TS2 A;  4DKA C;  2HVR A;  1J6Q A;  1X54 A;  4UP9 A;  3BAA A;  1VQ4 A;  4X65 Q;  1QVC A;  5C3E H;  3S16 H;  1OXS C;  1AE2 A;  5C4J H;  3UDI A;  4R4T A;  2Q2T A;  2IX0 A;  1YEZ A;  2HVS A;  4CC5 A;  1FL0 A;  5M5X H;  2H5X A;  5BR8 Q;  2UUC L;  4EQ5 A;  1VQI A;  3K7A H;  5JJI A;  4JBK A;  2R93 H;  4R1J A;  1SN8 A;  2Z6K C;  5LMN Q;  2DGY A;  1YHQ A;  5BR8 L;  1QVG A;  4POG A;  2R7Z G;  4UCO A;  3Q8D A;  4WJ3 M;  2KHJ A;  3S17 H;  3T1H L;  1ASY A;  4EX5 A;  3HKZ E;  2VW9 A;  4BXX H;  2IT1 A;  3I7F A;  2WAQ G;  2OTJ A;  1NJI C;  1TAE A;  5M3M G;  4X6A H;  3RR5 A;  4DR2 L;  5GRO A;  4A3L H;  4DV0 L;  1CKN B;  2K75 A;  1NMF A;  5C0X G;  4A93 G;  1VQ6 A;  1VQL A;  5C4X H;  1S68 A;  5HY6 A;  4DV1 Q;  1KAW A;  4AIM A;  3KJP A;  3HOX G;  4OX9 Q;  4UCV A;  3BZK A;  1KIX A;  1NE3 A;  3I56 A;  3KJO A;  3KDF A;  4OX9 L;  2BA1 A;  1XPO A;  3I4M H;  5GAG C;  2WB1 E;  2VY3 A;  1Q12 A;  5M3F H;  1X55 A;  1K8G A;  1X3F A;  1TWH H;  4JYA Q;  4IPD A;  3CQZ H;  1WCM G;  3J7A 5;  2A1A A;  1H95 A;  3GO5 A;  4X66 Q;  4A3M H;  3VNN A;  3JSL A;  2KCT A;  4IFD G;  2IHF A;  3F1Z A;  2E5L L;  3GTK H;  3L7Z C;  3TEH B;  3UDX A;  5M3F G;  1E22 A;  4CC6 A;  2E8G A;  4YWK A;  1VQ9 A;  4DV4 L;  2VQF L;  1KL9 A;  1IBM L;  1SFO H;  2VUG A;  2VNU D;  4NXM Q;  2F52 A;  2JA8 G;  4Y7N H;  4L5T A;  1WYD A;  2HT1 A;  2RHS B;  3CCV A;  3CP0 A;  1HR0 W;  2YTY A;  5FJ8 H;  4DNI A;  3A0J A;  2HIV A;  1G29 1;  2WB1 G;  3PF5 A;  1M1K C;  1N32 Q;  3SGI A;  1GKH A;  3BU2 A;  2VQE L;  4HID A;  1OXU A;  3ER0 A;  2UXB Q;  4BBS H;  4A3J H;  4TVA B;  5M3M H;  2I0Q A;  4QY7 A;  2UU9 L;  1BKB A;  1PVO A;  4B3T Q;  2UXB L;  3L0O A;  1N32 L;  1MJC A;  4HJ8 A;  4HJA A;  2OTL A;  1CUK A;  2UU9 Q;  4DV5 L;  5H1S E;  1ASZ A;  2IHE A;  2BH8 A;  1MIU A;  2R7F A;  4JBJ A;  2HHH Q;  4JI6 L;  2R7Z H;  4OWX B;  4A3B H;  2ZM6 Q;  4GLA C;  4DV5 Q;  2MO0 A;  4R4C A;  2EIF A;  4AQY L;  2CWA A;  1GO3 E;  3K81 C;  5ELN A;  5IWA Q;  2PMZ E;  3PUW A;  3CC4 A;  2Z0S A;  3M4P A;  3T1H Q;  2K52 A;  1IBL L;  4DV7 Q;  4DAM A;  2E2H H;  4LF5 Q;  2B63 G;  1E3P A;  1IXR A;  2ZTC A;  2K4K A;  3PUX A;  2GVA A;  4NXN L;  4JI8 Q;  1PH2 A;  3S24 A;  2ZJP A;  2K50 A;  1EWI A;  3UE0 A;  4GNX B;  4LF7 L;  1XMQ L;  1TWC H;  4UY8 C;  5J3B A;  1IBK L;  2JA6 G;  2EQS A;  4LFB L;  2ID0 A;  3KLW A;  3M4Q A;  4QIW E;  4LF7 Q;  3H0G G;  1HZ9 A;  3HOZ G;  3W1G A;  4C2M H;  3VDY A;  4DR2 Q;  3H0G H;  1U5K A;  1Q7Y C;  1XNQ L;  1VQP A;  4DV1 L;  4BA1 I;  1CKN A;  3FKI H;  3UDG A;  1QVF A;  1Q81 C;  2JQO A;  2B63 H;  4LW1 A;  4DR4 Q;  3H3V I;  3HOY G;  3A74 A;  3GD7 A;  1D8L A;  1XK5 A;  2RCN A;  4APV A;  1OXV A;  2K5V A;  4DAY B;  2PQA A;  4HJ5 A;  1I50 H;  4A3F G;  2CCZ A;  4AYB G;  2GN5 A;  4HJ7 A;  4KLK A;  1G6P A;  3FHW A;  4P73 A;  1YI2 A;  4LF9 Q;  4GKK Q;  1MJE A;  4UCT A;  1G51 A;  5K36 G;  1S3O A;  1Q8K A;  2OQK A;  1WI5 A;  1XNR L;  2D62 A;  2D0O A;  2FXQ A;  2YV5 A;  5FLM H;  2UUB Q;  3AFP A;  1CKO A;  3G48 A;  3BA8 A;  2YTX A;  4GN3 B;  1Y1W G;  3GTM H;  3NBY B;  1RL2 A;  3F2B A;  2JA7 G;  1XDN A;  1YIT A;  4JI0 Q;  2N8N A;  3JAM c;  3J81 i;  1UE1 A;  1VQG A;  2Z6K A;  2RHQ B;  4JI0 L;  1HJP A;  5DLQ E;  1PV4 A;  4JYA L;  3PUV A;  4GOP C;  4LF6 Q;  5C44 H;  1UE5 A;  1C7Y A;  1PH7 A;  2JA8 H;  3K0X A;  1E24 A;  1YNX A;  2R6G A;  2NVX H;  2C35 B;  4GLX A;  1W2B A;  4HTO A;  2Q2I A;  3PUY A;  1KC8 C;  3KF8 B;  2AHO B;  1B7Y B;  3ULP A;  1I94 Q;  2YU9 H;  3S14 H;  3TRZ A;  5IYD H;  5IYB G;  1N9W A;  3K8A A;  4L5Q A;  2VL6 A;  2K5H A;  3KFU A;  1BVS A;  1Q46 A;  1VQK A;  1E1T A;  1E1O A;  4DPG A;  3E9H A;  2PI2 A;  1Q1B A;  3CCE A;  1N33 Q;  5FPR A;  1D7Q A;  4AYB E;  4PG3 A;  4IJH A;  3PSI A;  1I94 L;  4JI6 Q;  4LF4 L;  3T1Y Q;  1VQO A;  2EXD A;  3CCM A;  4AQY Q;  2B3G A;  2JK8 A;  5IY0 A;  1FJG L;  1YZ6 A;  3I4M G;  4DR7 L;  5GQO A;  2LXK A;  4AH6 A;  1TWG H;  1VQD A;  3NEM A;  4GN4 B;  3CME A;  5LMU Q;  3TY9 A;  1W3S A;  3RZD H;  3U58 A;  4QGU A;  4DUY L;  4GKJ L;  2I5H A;  4KHP L;  4LUO A;  1JJG A;  4JC0 A;  4MNO A;  1NTG A;  3CCR A;  2ZTD A;  4L5S A;  4DR5 Q;  1SMX A;  4LFA Q;  2N3S A; 
#chains in the Genus database with same CATH topology
 4MA5 A;  1T9H A;  4KD3 A;  4BXX G;  4DR5 L;  3U9O A;  2RDF A;  1L1O A;  4GLV B;  1I3Q H;  3KAL A;  1TA8 A;  1PFB A;  4BBR B;  2Z4H A;  1EZ6 A;  3CPW A;  5LP6 F;  5IP9 H;  5DNF A;  3OSO A;  4BY7 G;  2C5C A;  2K6A A;  2Q8I B;  1YBY A;  4NXN Q;  2EY6 A;  1EKV A;  4DRF A;  1JLL B;  1T36 A;  4EGJ A;  3KOJ A;  3J81 c;  4YHH L;  1YHA A;  1CKM A;  2VQD A;  2F3I A;  1D1I A;  3NUA A;  1JWU D;  5C1O A;  4GKK L;  4N9T A;  1CSQ A;  5JEA H;  4FP5 D;  5BWV A;  5ELD A;  2UUB L;  2IY5 B;  3BYY B;  2MNA A;  1R9T H;  1HRJ A;  2OQ0 A;  1I6H B;  1BCP D;  3A54 A;  1SJE D;  2PW7 A;  3FMC A;  4FVM A;  2OLS A;  1FR3 A;  4KHZ A;  1Q86 C;  5CV7 A;  1JJC B;  3HGB A;  2FB9 A;  3D8G A;  1WVL A;  1ZXT A;  2CH4 A;  5D1O B;  1PFM A;  3WDN A;  3M3Y B;  4XYL B;  3BVG A;  1LYL A;  1PYS B;  1MI2 A;  1J5E Q;  3MXN A;  4JV5 L;  1GUW A;  1QJO A;  3A55 A;  4C56 C;  1JJ2 A;  2W71 A;  3GTL H;  1RHP A;  1NSN S;  1B70 B;  2MHV A;  4I7Z C;  4O1N A;  4OWT B;  5COR A;  3HOU H;  2CNV A;  5BPF A;  3TDQ A;  1GUN A;  1V1P B;  2GLT A;  1MGS A;  5JEA J;  3UYY A;  1K83 H;  4LF6 L;  2ALY B;  5G3L F;  4O7N A;  3HFZ B;  5CMD A;  4QUC A;  1Y69 U;  1PZI D;  5IGG A;  1Y14 B;  4IQZ A;  3OW2 A;  1LV9 A;  2VXW A;  1RIP A;  3NBH B;  2F0S A;  2A73 B;  1L0X B;  1PH9 A;  3GTQ H;  1HZB A;  4JI1 Q;  3K5H A;  1PLF A;  3VYU A;  2K33 A;  3ERO A;  1XPR A;  2XWB B;  2ZJR A;  5IYB H;  1AZP A;  1WRV A;  2KBN A;  4JOI C;  5C0X J;  1XMQ Q;  4C3I B;  1IKM A;  4JI5 Q;  4L1K A;  1M8A A;  5KYI A;  4UP8 A;  5G3L D;  4DV6 L;  1TY0 A;  1EY5 A;  1YJW A;  4BY1 H;  2JEA I;  3EJI A;  2E2J H;  5M5Y B;  1LT6 D;  1LUZ A;  1N34 Q;  4ALP A;  3EVQ A;  2YU9 B;  4O4I F;  1PRT F;  2D9U A;  3ULL A;  2Q2H A;  4EEQ A;  3H15 A;  4A3E G;  1STN A;  3T53 B;  2V5A A;  1SYC A;  1HQM C;  5IGB A;  2D0P A;  2B8F A;  5KS8 A;  3A7L A;  2F3V A;  4WFN 3;  4KKT A;  1ILP A;  2KHS A;  4JBM A;  4RH6 A;  4Z9C B;  3WOF A;  1I2K A;  2NU9 B;  5FLX c;  3S2H B;  3KAK A;  1TWF B;  4GOP A;  2ZGI A;  3PQI A;  1EFW A;  4KI0 A;  4GN5 A;  5JJZ A;  4G57 A;  4UCR A;  3WOE A;  3JRX A;  1KRS A;  2WYO A;  1TKW B;  5C3X A;  1IBK Q;  2A6E C;  2K5W A;  3UFX B;  4B3S L;  1KLG D;  2EJ2 A;  4IOC A;  5GON F;  1Q1E A;  5DIS C;  5EAY A;  1W6K A;  2I5M X;  3SK4 A;  4NZM A;  1UEB A;  5IP7 H;  4BBR G;  4A93 H;  1UUP A;  4IPH A;  4CKC A;  4AYB B;  5J22 A;  3ZJY C;  1SCU B;  3H6M A;  4DR6 Q;  3JC6 6;  4A3D G;  3WO1 A;  1RJT A;  4RCN A;  1CZG A;  1Y1V G;  3V96 A;  1ESF A;  4IIJ F;  4CHT B;  3K7U C;  4WRD A;  4TUY F;  1VF5 C;  3M7N A;  5KYL A;  1BNC A;  1S4Z A;  5FOB B;  3S1R B;  4CE5 A;  1PYB A;  2VZA A;  1PRT D;  1GSA A;  5CR5 A;  1SNP A;  3VYT A;  2NTS A;  3J7A V;  2F0O A;  5C4H A;  4O2D A;  3EBE A;  3K0Y A;  3AFQ A;  4QL5 A;  3PV0 A;  5IOD A;  3HOZ H;  1DV1 A;  3TIN A;  3CCQ A;  1KLU D;  1XTC D;  4XQN A;  4IUT A;  1HCZ A;  1PH5 A;  1AZQ A;  1SYD A;  3HOV H;  4CGY B;  1YVC A;  3A8K E;  3U55 A;  1KNE A;  3S2D H;  3KBX A;  4X3K A;  3MWE A;  4P71 A;  2JA8 B;  1QNK A;  2DY8 A;  4WHX A;  3DEP A;  2A69 C;  2Z9H A;  2OXP A;  3T56 B;  4LF5 L;  1X3E A;  2K14 A;  1JCK B;  3KF6 B;  1EL0 A;  1EUD B;  1LTL A;  3QOJ A;  1EOT A;  5A35 A;  3E5S A;  1OXT A;  1GM5 A;  4LFB Q;  4JI7 L;  2Y0S G;  1Y8O B;  2QF7 A;  1EYG A;  4X65 L;  2KEE A;  1YNN D;  5CM0 A;  5I60 A;  2F0G A;  2IP4 A;  1YJN A;  2NVX B;  4HIK A;  1PZJ D;  3LWE A;  4IO9 A;  4JOI A;  1O78 A;  1WR2 A;  1UEA B;  5LOV F;  2F0K A;  4DLK A;  1QUQ B;  2PZU A;  4OO1 I;  3QWU A;  5HNE A;  3JAM L;  2RVL A;  2L11 A;  3I2Z A;  3HOW G;  4I4T F;  2FMM A;  3GTO H;  1CSP A;  4CDE C;  3CSW A;  2KEC A;  3HOY H;  4XYO A;  4FF4 A;  2HUG A;  1VQJ A;  3VPD A;  4DUZ Q;  4HR7 A;  4JV5 Q;  1EIH A;  2N49 A;  1P8L A;  3EN2 A;  2QK4 A;  3D4W A;  5I5S A;  3VR5 A;  1LM0 A;  4JI4 Q;  5DGH A;  1SE8 A;  3VA5 A;  1MSH A;  1XXG A;  3R93 A;  2E5L Q;  2EJG C;  3S1N H;  4LF9 L;  1V43 A;  2CWP A;  1HNW L;  2EOT A;  1J9O A;  2ATW A;  1VQE A;  3E6Z X;  2LFN A;  1JT8 A;  2ZXO A;  3JAM i;  3I4M B;  3NTK A;  4ME5 A;  3ORR A;  2OEO A;  2JA6 B;  4NB3 A;  5M9O A;  1T5X D;  1QZH A;  1EUC B;  1L2F A;  1GD7 A;  2ICE C;  5JAV A;  5JJL A;  1YIJ A;  2F0N A;  1XTD A;  2IX3 A;  3DLL A;  2K28 A;  2MFI A;  4XZ3 B;  4K2K A;  4A3K B;  3HT5 A;  4BBS G;  2YTV A;  4K6L A;  3TS0 A;  1UWV A;  5DAU A;  2VQE Q;  3IKJ A;  1LAB A;  5FJ8 G;  3TS2 A;  1JOO A;  4UP9 A;  2JSO A;  3NTH A;  1G2T A;  3BAA A;  5LYJ F;  1EY0 A;  2F0V A;  4KMU C;  5EGT A;  5BN3 A;  1OXS C;  2B2T C;  3Q22 A;  3FKI B;  4CC5 A;  5LL6 X;  4JVZ A;  3SXH A;  2UUC L;  2VB2 X;  1VQI A;  2HCC A;  3K7A H;  1LTT D;  4JBK A;  2R93 H;  5I4D A;  5LMN Q;  1B6S A;  5BR8 L;  4POG A;  3QQM A;  4K14 A;  4C3J B;  1TWG B;  5CC4 A;  2DIK A;  2KHJ A;  1ASY A;  1HQR D;  4QUF A;  5JH7 F;  1KC7 A;  2VW9 A;  3I73 A;  2ZT9 C;  3QOL A;  4CJ0 B;  2EY2 A;  2WAQ G;  2OTJ A;  1NJI C;  1TAE A;  3R23 A;  2HGW A;  2DWC A;  3RR5 A;  3OUU A;  5GRO A;  1S5F D;  4IAL A;  3PO3 B;  1ZKO A;  2K75 A;  3D6W A;  1BF4 A;  3RFC A;  3D4D A;  3RV3 A;  4ZHQ F;  4O4J F;  1VKZ A;  1U4M A;  4NZO A;  4GLW A;  4CDC C;  4FFM A;  3BDC A;  3WWI A;  4OX9 Q;  1STE A;  4MHE A;  4UCV A;  3T16 A;  4J1M A;  3NTI A;  2O5I C;  5BWT A;  3GQB A;  1Y8N B;  1E2Z A;  1Q12 A;  3OOC A;  5C4J B;  5M3F H;  2XSC A;  1X55 A;  1X3F A;  4JYA Q;  4IPD A;  2PQE A;  1AFP A;  2A1A A;  3GO5 A;  1CT1 D;  3VNN A;  3K57 A;  3BYT B;  3L7Z C;  1QCB D;  5A2Q E;  3TEH B;  3UDX A;  3IL8 A;  3AX6 A;  2NUA B;  4CC6 A;  2E8G A;  4ZUJ A;  3K59 A;  4KJN A;  4JW0 A;  2VQF L;  1SFO H;  4ZYS A;  3MJF A;  1KBL A;  1K28 A;  4NXM Q;  4L5T A;  3N6R A;  3BDO A;  4FXD A;  1KJ9 A;  1X3Q A;  3CP0 A;  4TSS A;  2HDK A;  2YTY A;  5FJ8 H;  2HIV A;  2G9H D;  2Z4I A;  3PF5 A;  2NVQ B;  3I8Z A;  1N32 Q;  1GKH A;  5T1I A;  1LT4 D;  3ER0 A;  4KD4 A;  2UXB Q;  5HUR A;  4BBS H;  1DV2 A;  4TVA B;  5KKN B;  4QY7 A;  2DAA A;  3AW8 A;  1PVO A;  1N32 L;  4M0J A;  3X3N A;  4HJA A;  1KDA A;  4JBJ A;  3A7A B;  1HUN A;  4JI6 L;  2ZM6 Q;  1LT3 D;  4DV5 Q;  2MO0 A;  4XQQ A;  4AQY L;  1GO3 E;  4M1U B;  5IWA Q;  3BVZ A;  3PUW A;  5COY A;  2ASB A;  2Z0S A;  3M4P A;  2ABJ A;  2E2H H;  4LF5 Q;  2COG A;  3LWU A;  1IXR A;  2K4K A;  3PUX A;  1XMQ L;  4TRD A;  4FF1 A;  3BZD B;  2JA6 G;  4LFB L;  1JB3 A;  4F88 A;  4LF7 Q;  3H0G G;  1HZ9 A;  3R3O A;  3HOZ G;  1EZ8 A;  4DR2 Q;  1C3O A;  3H0G H;  3AB9 A;  2CW0 C;  1AP0 A;  3N52 A;  1UC8 A;  4A3G B;  1CKN A;  3UDG A;  1HXY D;  1F2L A;  1QVF A;  4LW1 A;  3S14 B;  2K03 A;  3I70 A;  1II3 A;  3SHL A;  3H3V I;  3HOY G;  4NP5 A;  1O80 A;  2R7K A;  4X3T A;  2XVS A;  1IW7 D;  2NVT B;  2K5V A;  2B2Y C;  4DAY B;  5EBC A;  1TQO A;  2DNE A;  2VR1 A;  1G6P A;  4FFP A;  2FIN B;  4R9W A;  1O7Z A;  1G6Z A;  1B44 D;  1S3O A;  1WI5 A;  4ZRZ A;  1XNR L;  5IT9 L;  3GTQ B;  4XQJ A;  1NAP A;  2YTX A;  1SFO B;  2V4D A;  1RL2 A;  2JA7 G;  1YIT A;  4QF4 A;  4XT3 B;  4RHR A;  2AUK A;  1A2T A;  2Z6K A;  2DZD A;  4JI0 L;  3RMH A;  3K0X A;  3TP6 A;  1WD1 A;  4NYE A;  1F2M A;  2NVX H;  1TWH B;  4GLX A;  4FFL A;  2XRQ D;  4HTO A;  3UZB A;  2YU9 H;  3FPP A;  2F1M A;  1D5Z C;  1TR5 A;  3K8A A;  3KFU A;  2VL6 A;  4DAY A;  3BS1 A;  1VQK A;  1E1T A;  4H0L C;  2PI2 A;  3CCE A;  1W96 A;  1TVX A;  1LT5 D;  2ENB A;  4AYB E;  4PG3 A;  2V59 A;  3FEW X;  3PSI A;  3I72 A;  3T1Y Q;  2JK8 A;  3OMG A;  4RKB A;  5GQO A;  4DR7 L;  3SEB A;  3CME A;  4YIJ A;  2A1H A;  2NZ1 D;  3HEJ A;  1KEE A;  3U58 A;  2E2D C;  3SK8 A;  2YZN A;  2I5H A;  5JOB A;  5C8Y F;  1JJG A;  4JC0 A;  4K5X A;  1NTG A;  2F0U A;  1GUO A;  4A3I B;  4L5S A;  2LKV A;  1SMX A;  4NZN A;  5D8D A;  2N3S A;  4UPA A;  5M3M B;  3CAM A;  2B2U A;  3L2P A;  4BY1 G;  5T1G A;  3STB D;  4TKO B;  2E76 C;  2EYO A;  1HNZ L;  1PH3 A;  4RMF A;  4A76 A;  3MVV A;  4IJL A;  4DQN A;  3PUZ A;  2WIN B;  1A63 A;  2J4X A;  2K5N A;  5GAD C;  3HO8 A;  3LX0 A;  1L0Y B;  1A3G A;  3C1F A;  3G6J B;  2QDL A;  2R93 G;  3TQY A;  1HZA A;  4FE2 A;  1ZEQ X;  2ZJQ A;  3R8B A;  4X62 L;  3GTG B;  2XWJ B;  4EQO A;  5IYC H;  1N36 Q;  4DV3 Q;  1UC9 A;  1PA6 A;  2R92 B;  2B29 A;  1GHJ A;  3RZO H;  4MV3 A;  1VQ7 A;  2FPP B;  3Q24 A;  1B3Q A;  4CHI A;  4X62 Q;  4LJZ C;  3S1Q H;  1Y1W H;  2O5J C;  3VPB A;  1R4P B;  5C3E B;  1I5F A;  4C5C A;  3SE0 A;  2WP8 J;  2R92 H;  1EKF A;  2UXC Q;  1DOM A;  1B3A A;  4HMI A;  4TQU S;  2P0A A;  1S5B D;  4YBZ B;  2L1B A;  2R7D A;  5KND A;  1E7Z A;  4DAV A;  4C5B A;  2CQA A;  1K8A C;  4UAI A;  4A3J G;  1X65 A;  2Y0S E;  3HP3 A;  1BO0 A;  1DXM A;  1S5E D;  3T4A C;  3KAJ A;  2PZT A;  4E6N A;  1YHB A;  4OXP A;  3EIV A;  3STB C;  2KVM A;  1VCI A;  3GTO B;  1KHI A;  2AMC B;  1M6V A;  1HPC A;  5I2X A;  1TT2 A;  4PMB A;  3RLO A;  4A3I H;  3PMF A;  2HHH L;  2WFW A;  4YY3 Q;  4JI3 L;  1CHQ D;  2NN6 G;  3W5O A;  1PK8 A;  4RG1 A;  1PYW D;  4ZOL F;  2DUD A;  2JP1 A;  5L37 A;  4PMC A;  2NZH A;  2R7M A;  1ROD A;  2EXZ A;  3TP7 A;  5IP9 G;  4BY7 H;  1OTC A;  2PO4 A;  3NEN A;  2VUM G;  2FPG B;  1CQV A;  1A0I A;  3TY8 A;  1QNU A;  3HKZ B;  2ZTE A;  3GTK B;  3T9D A;  5E25 A;  2NUC A;  4B9X A;  2IPK D;  4RGN A;  5IWA L;  3NC0 B;  1K3R A;  3RTX A;  3FP9 A;  2I87 A;  4A3B B;  3HKS A;  3CF5 A;  5ELC A;  1ZYR C;  3K7A B;  4EGQ A;  1I1K A;  1JDB B;  3E0E A;  1K9M C;  3WWH A;  4X64 Q;  1SR3 A;  3BZC A;  5JJK A;  5K36 H;  4JCV E;  1Y1W B;  3RNU A;  4R4Q A;  2YRW A;  3HOX B;  5HV6 A;  4RAU C;  3J7A F;  5E1F A;  4IN3 A;  3BVM A;  2KED A;  3OUZ A;  1IBL Q;  5KIX A;  3CHB D;  4YJ3 F;  4R4O A;  4XTC S;  4JI8 L;  2NN6 H;  4BS9 A;  4XT1 B;  3JZI A;  1Y8P B;  1PTO C;  1A2U A;  1KJQ A;  2KCM A;  3MHB A;  4P75 A;  4A3I G;  3ULJ A;  3R2I A;  2B2U C;  1JE4 A;  2CQO A;  2XN9 C;  2XGT A;  3OIP A;  2NZO A;  2B2T A;  3A56 A;  4O86 A;  2UUA L;  4POF A;  1IBM Q;  4BY1 B;  3HOV G;  3TY9 A;  2BH2 A;  2IJ0 A;  1IKL A;  4TV9 F;  5IGC A;  2MQH A;  4IFD I;  4C3H B;  3U0G A;  4HN2 A;  2AQ2 B;  4O7L A;  4K0K Q;  2H1E A;  2RF4 A;  1I7N A;  1BXT A;  3C3L A;  1L0W A;  1N33 L;  4O7S A;  4MZ9 A;  1XWE A;  3TRE A;  3NBZ B;  4DAA A;  4N8F A;  1RTO A;  5C4X B;  1Z9F A;  3KYH C;  2F0P A;  1HTL D;  2R92 G;  4A3D H;  1QZG A;  2F0L A;  1DOL A;  4ZK9 B;  4LH7 A;  4MAM A;  2OCE A;  5FO9 B;  4LNQ A;  4C3J H;  1V8Q A;  4CDD C;  5IT9 c;  2OT2 A;  5C3E G;  4O83 A;  2VB3 X;  5I5V A;  1GSH A;  1YJ9 A;  1CM9 A;  4MIU A;  3NK9 A;  1Z2P X;  1GVP A;  5EJW A;  5CR3 A;  4Y8V B;  5C3W A;  2MGS A;  3WWV A;  1VQB A;  2NB0 A;  1BR9 A;  2EY1 A;  1IYD A;  3UI2 A;  3FPU B;  1A8V A;  4GOP B;  4A3M G;  1K83 B;  1HNX Q;  4CMD A;  1TWC B;  5EPL A;  5IYD G;  2W70 A;  3I4O A;  1GGO A;  2JA9 A;  2LSS A;  4DAP A;  2F0E A;  1O7L A;  4NPS A;  5EBD A;  1WTP A;  3RV4 A;  2LXJ A;  3CRK C;  3TY5 A;  4DXG A;  1OO9 B;  5JPM C;  5AJ3 L;  4Y52 H;  3CXC A;  3HS0 C;  3PIP A;  3T13 A;  2QDB A;  5BPH A;  4A3E H;  5ELB A;  1O7I A;  1B9M A;  4ZAI A;  4P72 A;  5AJ3 Q;  3U4Z A;  3D4R A;  1G8Z D;  3DXJ C;  3I4N B;  5FK9 C;  1DGS A;  4IFD J;  1I6H H;  3ETJ A;  4LFC L;  5D1O A;  1Q8I A;  4LUZ A;  5DAA A;  2KCN A;  2QCP X;  4K6D A;  1SRO A;  1AE3 A;  3G8C A;  5KEE A;  3J7Y W;  1E4E B;  4DV2 L;  2ZDG A;  1WFQ A;  1C8C A;  1ILQ A;  1CI3 M;  2WV6 D;  1RKN A;  4LUV A;  4O7Z A;  3RLN A;  1STB A;  1XMO Q;  1TXY A;  1IW7 C;  3R5X A;  2JN4 A;  4OGQ C;  4FU0 A;  4DUZ L;  5DEH A;  4A3D B;  4Q4D A;  5E7N A;  1Y1V B;  3ZYY X;  3HRZ C;  3J81 j;  1G2W A;  2EYL A;  2F0T A;  4DV4 Q;  1TS5 A;  1PH1 A;  3S15 H;  3J80 c;  3JSN A;  5CV8 A;  4C1N K;  4ID6 A;  2TMP A;  3IFD A;  4EG0 A;  3P1H A;  3R2T A;  3PN1 A;  2HCI A;  1Q82 C;  4IUV A;  4K8I A;  4A3L G;  1LO5 D;  3ETH A;  3Q2O A;  1STG A;  4CMF A;  4L5R C;  2A6H D;  3HOU G;  4IPG A;  1A3U A;  4O42 A;  3CCJ A;  2EDG A;  1PH6 A;  1TS2 A;  2HDM A;  1A0G A;  1I4H A;  1NY4 A;  5IOC A;  5K3W A;  4A3G H;  1DAA A;  3VR4 A;  3OYY A;  3JZF A;  4F8M A;  1TWA B;  1ZYR D;  2EJF C;  2G5D A;  5I6Y A;  3MC0 B;  4C3H G;  3BAB A;  2N88 A;  4ZCK A;  4B3M L;  2B2Y A;  3QO2 A;  3S2H H;  3VMM A;  4LFA L;  4DKA C;  3NHH A;  4J6H A;  1VQ4 A;  1W6J A;  1QVC A;  5JPN C;  1I6V C;  1AE2 A;  2BE5 D;  2JYO A;  2MPM A;  5C4J H;  4R4T A;  2IX0 A;  5CV5 A;  3C46 A;  4IUR A;  4J8Q A;  4KY6 A;  5JJI A;  1SN8 A;  2Z6K C;  4ODG A;  3Q8D A;  4WJ3 M;  5FKA C;  1RTN A;  1SJH D;  3T1H L;  1JR0 D;  1BNZ A;  4EX5 A;  1B50 A;  4HAE A;  4IZ8 A;  3LWB A;  1EYA A;  1PTO F;  3I7F A;  5I6W A;  2MJ8 A;  3DAA A;  1X32 A;  4JXU A;  4LK1 C;  2L55 A;  2QIL A;  3QWN A;  3TZU A;  4FFR A;  1CKN B;  1FNW A;  2EE1 A;  4O84 A;  2AQ3 B;  1QWY A;  4DV1 Q;  4AIM A;  3KJP A;  2I8C A;  4KN7 C;  2F03 A;  3T9E A;  5FLX L;  1KJ8 A;  4ZQ3 A;  3G7L A;  1NE3 A;  4OX9 L;  3KDF A;  2BA1 A;  1RDP D;  1XPO A;  3NP8 A;  2A68 D;  4CBV A;  1SE4 A;  5GAG C;  2VY3 A;  5J2U F;  1BCP C;  3KLR A;  1TWH H;  1LTG D;  5M5X B;  3TII A;  4I65 A;  1F9Q A;  2K01 A;  4X66 Q;  4YJ2 F;  4UHV A;  2KCT A;  4IFD G;  2IHF A;  1WTV A;  5M3F G;  1I4Q A;  4FFN A;  2RA4 A;  2X69 A;  2E2I B;  2BDN A;  1KL9 A;  1CS0 A;  2ODT X;  5KX5 F;  2F52 A;  3K5M A;  1A3T A;  1LTA D;  1WYD A;  2W6Q A;  5CV9 A;  3T99 A;  1MBY A;  2DN8 A;  1ULZ A;  4R8N A;  3K5O A;  4DNI A;  1M1K C;  1A3V A;  1G29 1;  3JRW A;  1EZ1 A;  2ZXP A;  2EYJ A;  3SGI A;  1B53 A;  2VQE L;  5CAE B;  4RGT A;  4A3J H;  1JQY D;  3GLK A;  3S16 B;  1BCP B;  3AU7 A;  2UXB L;  4RGM A;  1Z7T A;  1KJI A;  3CEB A;  2EIY A;  1ASZ A;  4K5W A;  2HHH Q;  4FF3 A;  1K8O A;  1EY4 A;  4A3B H;  1BQQ T;  4U67 3;  4XX0 B;  1ET6 A;  2EY5 A;  1STH A;  4KN4 C;  4NXN L;  4F87 A;  3V2T A;  5EPK A;  3S24 A;  4GNX B;  1EWI A;  4KHV A;  5IT9 E;  3U9T A;  1IBK L;  1FNU A;  3K6O A;  3KLW A;  3M4Q A;  5FO7 B;  4PBC A;  4K5V A;  3SDZ A;  4G7Z C;  1H9S B;  3W1G A;  4QSH A;  4C2M H;  2CVR A;  3VDY A;  1DON A;  2PN1 A;  1U5K A;  1RD9 D;  1Q7Y C;  5TSS A;  1ET0 A;  3FKI H;  1I3Q B;  4DR4 Q;  4H7B A;  3KRE A;  4ME6 A;  1PZK D;  1D5M C;  2KCC A;  4FGR A;  3V4S A;  4BBS B;  3A74 A;  2YZL A;  2RCN A;  2Z04 A;  4APV A;  4MV1 A;  1OXV A;  1E4E A;  2YL2 A;  4HJ5 A;  3GTM B;  2CCZ A;  4KLK A;  2COJ A;  4GKK Q;  1MJE A;  1HHV A;  3NQI A;  4G7H C;  1Q90 A;  2D62 A;  2D0O A;  2UUB Q;  5FLM H;  3NBY B;  1E2W A;  3F2B A;  5NUC A;  1PTO D;  2N8N A;  1B9N A;  4DGZ A;  3J81 i;  1F2Z A;  2JA5 B;  1NR4 A;  3T9F A;  4ZQI A;  1HJP A;  5IGE A;  3F2U A;  2SNS A;  4FF2 A;  4LF6 Q;  3S2D B;  2O4X A;  5C44 H;  1F9P A;  2JA8 H;  1JWS D;  1HUM A;  2K7V A;  3ORQ A;  5J39 A;  3EA6 A;  2P5Z X;  1W2B A;  2Q2I A;  1I1M A;  1KC8 C;  4IFD H;  1NCV A;  1B7Y B;  3S14 H;  1I94 Q;  1N9W A;  1EY7 A;  5I5X A;  4KJO A;  4L5Q A;  1BVS A;  1Q46 A;  5FR9 A;  5BYA A;  4OIJ A;  4DPG A;  1N33 Q;  5ELF A;  1SNM A;  1RCV D;  3J81 E;  1VBH A;  4L6T B;  1I94 L;  4LF4 L;  2W6O A;  1EEF D;  1VQO A;  2F0Q A;  3SK6 A;  4IWX A;  1JDE A;  4AH6 A;  1TWG H;  1VQD A;  3NEM A;  5LMU Q;  2COI A;  4I50 F;  3D3R A;  3DMU A;  4QGU A;  4ILW A;  1NR2 A;  4GKJ L;  4KHP L;  1U4L A;  4LUO A;  2R84 A;  5HGT A;  1Z2O X;  4LFA Q;  4IUQ A;  5GAE C;  5EPJ A;  2L5T A;  3O13 A;  4PV1 C;  1SSO A;  5IE8 A;  4BA2 I;  3HZX A;  5BWR A;  1SLJ A;  1VMC A;  3GID A;  3QFF A;  1JMC A;  1C9O A;  4MV8 A;  1X3G A;  3T9C A;  4LH6 A;  4S3S A;  5I9O A;  5DMX A;  2QGQ A;  2PI2 E;  3S1N B;  5C5L A;  2HHF A;  4KTA A;  2AWN A;  1DJR D;  5C44 G;  1PH8 A;  1KAB A;  4F7X A;  4YCW A;  1L1O B;  3KK7 A;  2JJQ A;  3WNZ A;  2JA6 H;  3M3Y H;  2F0J A;  1Q3L A;  1CQI B;  2RQX A;  1HNW Q;  1HH2 P;  4DU9 A;  2SOB A;  2A5H A;  3CD6 A;  4UFZ A;  3VA7 A;  2CNQ A;  2WAQ B;  4TVI A;  2O2L D;  3KF6 A;  3RN2 A;  1WD0 A;  3URY A;  4A4I A;  2NVQ H;  1EWH A;  1Y1V H;  1FVI A;  3LGJ A;  2NU8 B;  1I4R A;  2EPB A;  4JK1 C;  4A75 A;  1X3P A;  2Z1C A;  3OTO Q;  2R3Z A;  1EY9 A;  3H0G B;  1S72 A;  3L3O C;  4LFC Q;  4A3C G;  4Q5V A;  3IRB A;  4I7A A;  4P2C B;  1QB5 D;  2DJF C;  1SNQ A;  4FYD A;  3U50 C;  3ERS X;  1I7L A;  3PIO 3;  2YZG A;  1CK1 A;  5CBE E;  3OTO L;  1A62 A;  1Z47 A;  2W6Z A;  4IWY A;  2AUJ D;  3UDF A;  5CB4 F;  5H80 A;  4B3T L;  1EUJ A;  4IPC A;  2OWO A;  3DWA A;  1OXX K;  5LHY 1;  3GP7 A;  4DK6 C;  1X6O A;  4IUP A;  2ZDH A;  3HG9 A;  5I2Y A;  4DR3 L;  3OW7 A;  4DNR B;  3S15 B;  1OBD A;  1HNZ Q;  1STA A;  4XXE A;  2CKZ B;  5HGQ A;  4DK0 A;  1CA6 A;  1XX8 A;  3NEL A;  3PF4 A;  4O2B F;  1XNQ Q;  2CW0 D;  3QR8 A;  3MFY A;  3U9S A;  3PO2 G;  1I50 B;  3NE5 B;  4JPB W;  3VOT A;  2AWO A;  3NXW A;  2R82 A;  5I5W A;  1KRT A;  1TS3 A;  2KEN A;  3PO3 G;  1TWF H;  4E6I A;  3HBL A;  4FO2 A;  1YNJ D;  1N36 L;  5ELO A;  3GTJ B;  2C9O A;  4V19 0;  4OO1 G;  3G71 A;  2NN6 I;  2RCF A;  1JOR A;  4YHH Q;  3UE1 A;  1KAA A;  3VYS A;  2YWV A;  1HFG A;  5C4Z A;  3RZD B;  3QG1 A;  4BWG B;  3BG5 A;  1QIL A;  1X56 A;  4WBN F;  1IZ6 A;  4JI7 Q;  1VQ5 A;  3MXG A;  2A69 D;  3AEV A;  2V1C C;  1WCM B;  2R85 A;  3GTG H;  3BA9 A;  3FKI G;  1DYQ A;  1MHW C;  1BBW A;  4OIK A;  2PVP A;  1CQF A;  1V9P A;  2VS1 A;  4C3J G;  3K5I A;  2XCL A;  5D1P A;  2SNM A;  2CFM A;  3SE7 A;  2HQL A;  3EFX D;  2Z6B A;  1V1Q A;  1D1K A;  1M90 C;  2QB5 A;  1HTP A;  2YW2 A;  3GTP H;  3DM1 A;  2DJG C;  2HVQ A;  3P20 A;  4JI3 Q;  1HA6 A;  1E0B A;  3P7J A;  3B6Y A;  3MTS A;  2ZM6 L;  1CZW A;  4C3I H;  4HIO A;  4X66 L;  4JI5 L;  4RGO S;  1S40 A;  1IYJ B;  1D6E C;  3VR6 A;  1VS0 A;  3CC2 A;  1LAC A;  3D6C A;  1KD1 C;  1SE3 A;  3S1R H;  2BCO A;  1GSO A;  3MFG A;  1HR0 Q;  5JEA G;  5LMU L;  3OMC A;  1I4X A;  4JI1 L;  3I4N H;  1FGU A;  3TP5 A;  4C3H H;  4LF8 Q;  4K6N A;  2PYK A;  1VQM A;  2J0T D;  1HR0 L;  4HQ6 A;  2PZW A;  3NBH A;  2JE6 I;  3KLS A;  3CCU A;  1DM0 B;  4DV6 Q;  1VMP A;  4A3G G;  1DCZ A;  5FPO A;  2A6H C;  3HOW H;  2UXD Q;  3LP8 A;  1N34 L;  1CQJ B;  3JZ6 A;  1HNX L;  2PNR C;  2SDF A;  5LMN L;  2AQ1 B;  2KUM A;  5BWU A;  4KKU A;  2N55 A;  4G7O C;  3BJU A;  2B8G A;  2A74 C;  1VDZ A;  2Y4R A;  1KXL A;  1PH4 A;  3I55 A;  1D2B A;  4NMZ A;  4HSP A;  4B3S Q;  2B2W A;  5I9P A;  1UE7 A;  2GA4 B;  1EY6 A;  4BY7 B;  4ZLT F;  2RKS A;  2UUA Q;  2XTI A;  2KHI A;  2VUM H;  4DK3 C;  2V58 A;  2RSO A;  3TIG A;  4QQB X;  4O7T A;  5CE8 A;  4UCU A;  2WB1 B;  2BE5 C;  4JG2 A;  4YWL A;  2PQA B;  1SNO A;  3M4O B;  1KUT A;  1PRT C;  4DR1 L;  5E4W C;  1TWA H;  2WAC A;  5KRU A;  4C5A A;  5IGD A;  3VR3 A;  1FNV A;  3NUC A;  4C2M B;  2B2V A;  1H9R A;  1WJJ A;  5BWX A;  2GVB A;  1NMG A;  1JB7 A;  4MA0 A;  1M0W A;  1NBW A;  1UE6 A;  4ME3 A;  2E2I H;  1Z2N X;  1SNC A;  4DR1 Q;  2RDH A;  3CCL A;  1EQQ A;  4UCS A;  1SND A;  3HOY B;  2D5D A;  3A8J E;  2R61 A;  4P74 A;  2Z8L A;  3HOX H;  3V4Z A;  4NKL A;  4DR7 Q;  1EIF A;  3V05 A;  5C4X G;  3CW2 C;  4DR6 L;  3AQQ A;  2CH4 W;  5D65 A;  2VPQ A;  1EWC A;  1LTI D;  2DNC A;  1B1Z A;  1XJV A;  4XDX A;  3ICE A;  1AH9 A;  1SEB D;  1B8A A;  2JA7 B;  3VYR A;  5M5W H;  4MV6 A;  5ELE A;  5LMN W;  1SAP A;  3ND9 A;  4DFA A;  2F4V L;  2VQF Q;  2JA5 H;  1CTM A;  1SRU A;  3E9I A;  2MO1 A;  3K5N A;  4HMJ A;  2DLN A;  5I5T A;  1YNN C;  2YYZ A;  2EJ3 A;  3T9B A;  1HA5 A;  3WWJ A;  1BDO A;  4ZKC B;  5EKL A;  5C0X I;  1G91 A;  2NVY H;  3D0F A;  4GNX A;  1YNJ C;  4CJ1 B;  2QW7 A;  1X54 A;  4TV8 F;  4ZUI A;  2R93 B;  4X65 Q;  3TME A;  5C3E H;  2NTT A;  1VF7 A;  3DF7 A;  2Q2T A;  3CRL C;  3UDI A;  4O7Y A;  4O7V A;  3VR2 A;  2HVS A;  3GV3 A;  2B63 B;  1GHK A;  5M5X H;  1GJX A;  2Y0S B;  3SK5 A;  2VUM B;  1TII D;  1I4P A;  3Q0A A;  2R7Z G;  2DGY A;  2FFK B;  5I47 A;  2HD3 A;  1K0S A;  1ESR A;  2JXM B;  3P75 A;  3S17 H;  4O2A F;  3KLS X;  3DWQ A;  1BUV T;  5M3M G;  2CHB D;  3MWD A;  2OF1 A;  1M4V A;  2PW5 A;  3AMU A;  5IGF A;  4MV7 A;  1SYE A;  3MZ5 A;  5C4X H;  2M00 A;  5HY6 A;  1S5D D;  4O4H F;  1KAW A;  3S9W A;  3HOX G;  4IUU A;  1V1P A;  4A3M B;  3KJO A;  3I4M H;  1PFN A;  2FHT A;  4R8I A;  1IOW A;  2TSS A;  5DGI A;  3TW7 A;  4LMQ D;  1UAP A;  2EYP A;  3J80 L;  2WKD A;  4KKS A;  4A3M H;  1H95 A;  4YAK B;  2H4O A;  2DY7 A;  1SYG A;  3F1Z A;  2F4I A;  3KUP A;  2E5L L;  1R9T B;  1EIG A;  3GTK H;  1C48 A;  3LNN A;  2BOS A;  1KTK A;  3FVQ A;  2VNU D;  4KY7 A;  5C1P A;  1PRT B;  2HT1 A;  4IUN A;  1JKJ B;  4PQX A;  1U9R A;  3CCV A;  1A9X A;  2WKC A;  5HBR B;  3A0J A;  3UZO A;  1F2Y A;  4HID A;  1U4R A;  2MP1 A;  2HHF B;  3K5L A;  5CA1 F;  1CHP D;  2K1B A;  2UU9 L;  4B3T Q;  3L0O A;  3I4L A;  3KF8 A;  4HJ8 A;  1CUK A;  1SYF A;  4A3E B;  2OTL A;  5H1S E;  5LL6 S;  2R7F A;  4M9U A;  3OPO A;  4ULL A;  4OWX B;  2NU7 B;  4GLA C;  2IWH A;  4R4C A;  2CWA A;  3K81 C;  5ELN A;  3CC4 A;  4UCO A;  4EQP A;  3DTF A;  2K52 A;  2WII B;  1IBL L;  1E3P A;  2ZTC A;  1PH2 A;  4JI8 Q;  2GVA A;  2I07 B;  3ERQ A;  3TBI B;  2ZJP A;  1ENC A;  2K50 A;  1GLV A;  4CKE A;  1TWC H;  5BN5 A;  5EZY F;  5CGK A;  4QIW B;  4U68 A;  2ID0 A;  4IZO A;  5DM7 3;  2K5Q A;  4NW2 A;  1XNQ L;  4RCO A;  4BA1 I;  1Q81 C;  2JQO A;  3H3V C;  2HJW A;  3GV6 A;  4O7R A;  3DUZ A;  2HGS A;  1BBX C;  1C4Q A;  1B2T A;  4RHS A;  1AUV A;  3M4Y A;  3A8I E;  4OHJ A;  4YAJ B;  4A3F G;  1I50 H;  2W6N A;  2RDG A;  4AYB G;  2RBM A;  3FRP B;  1YI2 A;  1I4G A;  4UCT A;  1G51 A;  1E2V A;  2XRS D;  1WTQ A;  5K36 G;  3GTL B;  1EY8 A;  2FXQ A;  2YV5 A;  1PTO H;  1WTW A;  2EJ0 A;  4DXF A;  4O82 A;  1OBG A;  1Y1W G;  3RD4 A;  4QMG A;  2NYZ D;  3JAM c;  3T54 A;  1UE1 A;  1VQG A;  1AN8 A;  5ISR A;  4JYA L;  4GOP C;  2F0D A;  1PH7 A;  2CZG A;  1E24 A;  1YNX A;  3TN2 A;  2R6G A;  1CE8 A;  2W6P A;  2R7N A;  2C35 B;  3PUY A;  3ULP A;  2AHO B;  2K5H A;  3E9H A;  2SCU B;  5FPR A;  1PDQ A;  4JI6 Q;  2L4N A;  3CCM A;  5CYU A;  4Y7N B;  4AQY Q;  2B3G A;  5IY0 A;  5F2D A;  5EKI A;  1FJG L;  3I4M G;  2LXK A;  1BOS A;  1W3S A;  3RZD H;  1H9S A;  3CQZ B;  2XIW A;  3IAY A;  3CCR A;  2IL8 A;  2EYM A;  3K3P A;  4DR5 Q;  2EYF A;  2RSN A;  1PFS A;  4C3I G;  2GQS A;  1VQA A;  2HIX A;  1A15 A;  2FJ2 A;  2K05 A;  4JBW A;  5CV6 A;  4HR7 B;  4JI2 Q;  3VPC A;  2I5L X;  1IYU A;  2I46 A;  3E5N A;  3TQT A;  1K8M A;  4DR4 L;  2Q2U A;  3IFT A;  2QEX A;  2AKW B;  1KDC A;  2NU6 B;  4JI2 L;  4EVO A;  3RZO B;  4DV2 Q;  3UQ8 A;  3RUZ A;  3GJX B;  2BA0 A;  1XMO L;  1C0A A;  5JVD F;  3GTP B;  2PNH A;  1PTO B;  5I5U A;  1WTH A;  1VQH A;  2A68 C;  3WO0 A;  5IYC G;  4FFO A;  3M9B A;  4XYQ A;  4KV6 A;  1UNS A;  3OWE B;  4Q4C A;  3U4V A;  2GQR A;  4N8X 1;  1EQR A;  1WTR A;  1VQ8 A;  1ICW A;  2B2V C;  3JAM E;  1B04 A;  4HNV A;  2E74 C;  1D5X C;  4A3C H;  5KGU A;  4EQN A;  2MUY A;  3G6E A;  2JA5 G;  3TP8 A;  2YYA A;  2ZDQ A;  5GAH C;  3S1Q B;  3CPF A;  3NWT A;  3PCO B;  1R4Q B;  4OO1 H;  1DOK A;  2B2W C;  3Q23 A;  4RZQ A;  2X5R A;  5M5Y H;  2E2J B;  3TSS A;  3GB8 B;  4MV9 A;  2M9V A;  5EQ0 A;  4GZY C;  4EFB A;  2QKI C;  1O7Y A;  1DIK A;  3U54 A;  3T1Y L;  4IOA A;  3MXU A;  4ABN A;  4A3K G;  2SEB D;  1AUX A;  2R87 A;  2F0F A;  1H9J A;  3CU7 A;  2I80 A;  4B3M Q;  1KJJ A;  3TEK A;  1I1L A;  5CV4 A;  1K73 C;  3M4O H;  5I5Y A;  3F2D A;  3GTJ H;  4XYM B;  1F9R A;  5E4X A;  1JIC A;  3FDT A;  3J80 i;  4OWW B;  3G8D A;  4QJF A;  5D14 A;  5KNB A;  4GKJ Q;  4KHP Q;  4OL7 A;  4HNT A;  3I91 A;  2A8V A;  4H02 A;  3SVM A;  3K80 C;  1KT8 A;  4DV7 L;  1VQN A;  5JQW A;  2Q7D A;  4R4I A;  4GNX C;  1JE5 A;  3W1B A;  1ET9 A;  1N8R C;  2ES2 A;  3Q1K A;  4YB8 B;  3RUP A;  1WCM H;  1W93 A;  1SXT A;  3LQS A;  1IL2 A;  4J15 A;  3J7Z C;  3PFF A;  3BAC A;  3W2D A;  3F2C A;  1EIY B;  4MTN A;  2F4V Q;  1JOQ A;  5K2M A;  5KNC A;  1HZC A;  3HOU B;  1WTO A;  2JEB I;  1IL8 A;  3H3V H;  4MN3 A;  2JA7 H;  1IYV A;  2HDL A;  3I12 A;  3ONA B;  5C0X H;  3OWF A;  3QJY A;  3DTG A;  2F0H A;  4YCV A;  2CNU A;  2Q8R E;  5CBA E;  3QIA A;  4O81 A;  1KQS A;  2W6M A;  1BXR A;  2L0C A;  1U4P A;  3GDE A;  1VQF A;  4UP7 A;  3M85 A;  1EOV A;  1QUQ A;  5JQG F;  1PX2 A;  2F0M A;  2UXC L;  4WJ4 A;  4FXG C;  1EFI D;  4DV0 Q;  3A5Z B;  1T5E A;  3H94 A;  1MKH A;  3X3M A;  4UDU C;  3C2P A;  4K2L A;  4DNT B;  4K8J A;  4PZ6 A;  3I4N G;  5M5W B;  4HCE A;  3D31 A;  5M3F B;  4PZ8 A;  2EYH A;  4A3K H;  1U0L A;  3RLF A;  1ONL A;  4HNU A;  2QA4 A;  3S1M H;  3R9R A;  5FLM G;  1ENA A;  1P16 A;  1JWM D;  1K0R A;  2J7Z A;  1G2S A;  3BG3 A;  3E3X A;  3G4S A;  4WOR A;  3E0J A;  2YS6 A;  4DIM A;  4YY3 L;  5BN4 A;  1NNX A;  4HTP A;  4HSV A;  1C30 A;  3S1M B;  5C44 B;  1EQT A;  1WOC A;  1EYC A;  4L8J A;  4I55 F;  1XNR Q;  1SMY D;  4CKB A;  2K5D A;  4V0B A;  4DN4 M;  2HG8 A;  3NPP A;  3J81 L;  4BBR H;  5IP7 G;  2PCF B;  1EKP A;  2F0I A;  4X3U A;  4OON A;  4DR3 Q;  1GUG A;  3TZD A;  4HIM A;  1FJG Q;  3KDF B;  3AYH B;  4PMW A;  5BYB A;  4YWM A;  3MXP A;  4YCU A;  2XNA C;  3HKZ G;  4A93 B;  4X64 L;  3F8T A;  4HCS A;  3CMA A;  2K04 A;  1IOV A;  4LF8 L;  4RWS C;  3MXN B;  4LWC A;  3CCS A;  4XIG S;  2NBF A;  2A6E D;  4KK7 A;  1QOH A;  4HJ9 A;  5J1Z A;  1L1O C;  4GS3 A;  2UXD L;  1QE6 A;  2F3W A;  4PZ7 A;  1BBU A;  4WJW A;  1TU2 B;  3PO3 H;  2DAB A;  1B4O A;  4O0A A;  3HB9 A;  3RN5 A;  2EJM A;  1PXU A;  2UUC Q;  2YRX A;  5JVH 3;  1PHJ A;  2G9D A;  2KOL A;  3H09 A;  2N78 A;  2PPB C;  3KBG A;  3PO2 H;  1J5E L;  3I3C A;  1SE2 A;  1ML0 D;  4K0K L;  2L15 A;  2X6G A;  2R86 A;  3SR1 A;  3DHQ A;  4DA2 A;  2WAQ E;  3CKI B;  3PO2 B;  2L9H A;  5DM6 3;  4DK1 A;  4ZI7 F;  4JI4 L;  2IX1 A;  4FDB A;  2IW3 A;  1X9N A;  4DV3 L;  4LF4 Q;  3N8D A;  2XD4 A;  2E75 C;  2YS7 A;  2R7L A;  3T51 B;  1MSG A;  3I90 A;  1VQC A;  4A3F B;  1FD7 D;  1EEI D;  4B3R Q;  3PGZ A;  1XPU A;  5E3F A;  4EFE A;  2D2C C;  4G4K A;  3MEF A;  1IHZ A;  3NWS A;  4FNF A;  3MWY W;  3A5U A;  4A3B G;  2HGX A;  4A3F H;  4B3R L;  4NXM L;  5LXT F;  3SNO A;  1RF2 D;  4CJ2 C;  3CC7 A;  5BWW A;  5FLX E;  1GUS A;  3H91 A;  3PIO A;  3K58 A;  1VBG A;  2X6L A;  3DM3 A;  4MTK A;  2EVB A;  4QCL A;  1K3B C;  2NVT H;  2A19 A;  4DUY Q;  2HVR A;  1J6Q A;  4C1N I;  3LUL A;  2LMC B;  5CA0 F;  1B6R A;  3S16 H;  1EYD A;  1STY A;  2NWG A;  5D3D A;  3EQL C;  1YEZ A;  2BDO A;  3W3A A;  1FL0 A;  1EQV A;  2H5X A;  5BR8 Q;  1BCP F;  4EQ5 A;  2YZM A;  5D3I B;  2FP4 B;  1MD2 D;  4R1J A;  4ZKB B;  1YHQ A;  1QVG A;  3M7G A;  3HOZ B;  3HKZ E;  3NQT A;  3OHX C;  1CA5 A;  4BXX H;  2IT1 A;  4RA8 A;  4X6A H;  1ICF B;  1QG7 A;  4DR2 L;  1XYI A;  4A3L H;  4DV0 L;  1JC7 A;  1F77 A;  3NSW A;  1NMF A;  5C0X G;  4A93 G;  1VQ6 A;  1VQL A;  2FMC A;  1CFM A;  5AFW A;  1DD2 A;  1A48 A;  2K32 A;  1V1O A;  1DZ1 A;  3BZK A;  1KIX A;  2QEJ C;  3I56 A;  4RFB A;  2PBZ A;  4RKL A;  5LA6 F;  3BDL A;  3R5F A;  2WB1 E;  1I2L A;  1K8G A;  2B39 A;  1GXD C;  3CQZ H;  2ICI A;  1WCM G;  4FXK C;  5JVG 3;  3J7A 5;  5K5P A;  2Z02 A;  1LTS D;  1ENF A;  2FPI B;  3JSL A;  4QB4 A;  4OEL B;  3HOV B;  4N9P A;  1TS4 A;  1E22 A;  3S17 B;  4YWK A;  1VQ9 A;  4DV4 L;  2VUG A;  1IBM L;  1M0T A;  1FGB D;  4Y7N H;  2JA8 G;  1WTX A;  1Z6H A;  2RHS B;  2EZV A;  1HR0 W;  4IHJ F;  2X0S A;  3L9A X;  4HN7 A;  2WB1 G;  1NUC A;  1EU3 A;  3BU2 A;  1JOK A;  3MA2 B;  1OXU A;  1SDF A;  2C00 A;  3DEO A;  5M3M H;  5EKK A;  2I0Q A;  1KDB A;  1BKB A;  1LLR D;  1H9K A;  1MJC A;  2KQ3 A;  3T7A A;  3T9A A;  3NBI A;  4L63 B;  2UU9 Q;  4DV5 L;  5BMV F;  4HED A;  4PNY A;  2IHE A;  2BH8 A;  1MIU A;  2R7Z H;  4O4L F;  4OEM B;  5C6A A;  2EIF A;  4O7W A;  4EGV A;  2PMZ E;  3T1H Q;  4DV7 Q;  4DAM A;  5IIF A;  2B63 G;  2GPW A;  3TW6 A;  1A6X A;  1GUT A;  1F9S A;  4B9W A;  4LF7 L;  3UE0 A;  2R7Z B;  4UY8 C;  3HOW B;  5J3B A;  2EQS A;  4QIW E;  4TM5 A;  1KTA A;  2M2L A;  5IYZ F;  2GPS A;  5FO8 B;  4NDX A;  1VQP A;  4DV1 L;  1TY2 A;  2B63 H;  3J80 E;  1HFN A;  3ND8 A;  4E4T A;  3GD7 A;  1EU4 A;  1D8L A;  1XK5 A;  1LTB D;  2Q8T A;  2KJX A;  1AW7 A;  1KNA A;  2NVY B;  2PQA A;  1SBB B;  1EHI A;  3MAQ A;  2GN5 A;  1EYZ A;  1LTR D;  4HJ7 A;  3FHW A;  4P73 A;  4LF9 Q;  3ITP A;  1PMR A;  1Q8K A;  2OQK A;  4HTH A;  3PIP 3;  3BA8 A;  3AFP A;  1CKO A;  3G48 A;  2E2H B;  4GN3 B;  3GTM H;  4X3S A;  1XDN A;  3DWP A;  4LAA A;  4JI0 Q;  4B08 A;  2L12 A;  1J8I A;  4DF7 A;  4H44 C;  1IYE A;  2J9G A;  2HQE A;  2RHQ B;  3MEH A;  5DLQ E;  1PV4 A;  3OIQ A;  3PUV A;  1C7Y A;  1UE5 A;  3QB3 A;  5A2Q L;  1S68 A;  4KY5 A;  1S5C D;  3KF8 B;  2ZXR A;  4Q0F A;  4A3J B;  5IYD H;  3TRZ A;  5IYB G;  2LS0 1;  5C5M A;  1FYC A;  3Q6S A;  1E1O A;  4MV4 A;  5J2T F;  2F0W A;  1Q1B A;  4CDF C;  2PMZ B;  1D7Q A;  1H9M A;  4IJH A;  3C1E A;  4UUG A;  2EXD A;  1YZ6 A;  4GN4 B;  5JVL A;  1SMY C;  2LY7 A;  5FNV F;  1ZAU A;  1GOZ A;  1SYB A;  2KA7 A;  4MNO A;  1AEX A;  4M8A A;  2ZTD A;  3R5H A;  4H13 C;  4DUY L; 
#chains in the Genus database with same CATH homology
 4UPA A;  3CAM A;  1PFS A;  1T9H A;  1VQA A;  3L2P A;  5GAE C;  2HIX A;  4BXX G;  4BY1 G;  4DR5 L;  4JBW A;  5IE8 A;  3STB D;  1L1O A;  4GLV B;  4JI2 Q;  1I3Q H;  4BA2 I;  1HNZ L;  1TA8 A;  1PH3 A;  1SLJ A;  4RMF A;  4A76 A;  2I5L X;  3CPW A;  5IP9 H;  4BY7 G;  4IJL A;  1JMC A;  3PUZ A;  1C9O A;  4NXN Q;  1YBY A;  2Q2U A;  4DR4 L;  1A63 A;  2QEX A;  2K5N A;  2AKW B;  5GAD C;  4DRF A;  3KOJ A;  3J81 c;  1X3G A;  4JI2 L;  4LH6 A;  4YHH L;  1YHA A;  1CKM A;  2F3I A;  2QGQ A;  2PI2 E;  2R93 G;  3TQY A;  1HZA A;  4DV2 Q;  3UQ8 A;  4GKK L;  2ZJQ A;  2AWN A;  4X62 L;  3GJX B;  2BA0 A;  5C44 G;  1CSQ A;  1XMO L;  1PH8 A;  1C0A A;  2PNH A;  1L1O B;  4YCW A;  5IYC H;  2UUB L;  2IY5 B;  1N36 Q;  1VQH A;  2MNA A;  4DV3 Q;  1PA6 A;  1R9T H;  2OQ0 A;  5IYC G;  2B29 A;  2JJQ A;  3RZO H;  3M9B A;  1VQ7 A;  2JA6 H;  3M3Y H;  4KHZ A;  3U4V A;  4X62 Q;  1EQR A;  1Q86 C;  1HNW Q;  1VQ8 A;  3S1Q H;  1Y1W H;  1HH2 P;  3CD6 A;  1JJC B;  4UFZ A;  1I5F A;  1B04 A;  2WP8 J;  2R92 H;  4A3C H;  2UXC Q;  5D1O B;  3G6E A;  4TQU S;  3KF6 A;  3RN2 A;  2JA5 G;  4A4I A;  1LYL A;  1PYS B;  2NVQ H;  5GAH C;  4JV5 L;  2R7D A;  1J5E Q;  1Y1V H;  1FVI A;  3CPF A;  3LGJ A;  3PCO B;  1E7Z A;  4A75 A;  1JJ2 A;  3OTO Q;  1S72 A;  4LFC Q;  4A3C G;  5M5Y H;  3GTL H;  3GB8 B;  3IRB A;  1B70 B;  4OWT B;  1K8A C;  3HOU H;  4EFB A;  4A3J G;  1X65 A;  2Y0S E;  3U50 C;  3T1Y L;  3ERS X;  5JEA J;  4IOA A;  1K83 H;  4LF6 L;  2ALY B;  4A3K G;  3OTO L;  1A62 A;  1Z47 A;  4E6N A;  1YHB A;  3UDF A;  4OXP A;  3EIV A;  4B3M Q;  3STB C;  3HFZ B;  4B3T L;  1VCI A;  1K73 C;  3M4O H;  3F2D A;  3GTJ H;  1KHI A;  2AMC B;  1EUJ A;  4IPC A;  3RLO A;  3J80 i;  4A3I H;  1Y14 B;  2OWO A;  3OW2 A;  2HHH L;  4OWW B;  4QJF A;  2WFW A;  4YY3 Q;  1OXX K;  4JI3 L;  4GKJ Q;  4KHP Q;  2NN6 G;  1RIP A;  3NBH B;  2A8V A;  3W5O A;  4H02 A;  1PH9 A;  3K80 C;  4RG1 A;  4DK6 C;  1HZB A;  1X6O A;  4JI1 Q;  3GTQ H;  2DUD A;  4DV7 L;  1VQN A;  4R4I A;  1XPR A;  2NZH A;  4GNX C;  1JE5 A;  3W1B A;  5IP9 G;  2ZJR A;  5IYB H;  1N8R C;  2ES2 A;  4DR3 L;  4BY7 H;  2KBN A;  4JOI C;  1WCM H;  5C0X J;  1XMQ Q;  1OTC A;  1HNZ Q;  4JI5 Q;  2CKZ B;  3NEN A;  2VUM G;  5HGQ A;  1A0I A;  3TY8 A;  4UP8 A;  1IL2 A;  4J15 A;  3J7Z C;  4DV6 L;  2ZTE A;  3NEL A;  3PF4 A;  1YJW A;  3F2C A;  4BY1 H;  2JEA I;  5IWA L;  2E2J H;  4MTN A;  1EIY B;  1XNQ Q;  1K3R A;  2F4V Q;  3PO2 G;  1LUZ A;  1N34 Q;  4ALP A;  1HZC A;  3FP9 A;  3RTX A;  3HKS A;  3CF5 A;  2AWO A;  2JEB I;  3ULL A;  2Q2H A;  4EEQ A;  1KRT A;  3H15 A;  2JA7 H;  4A3E G;  3H3V H;  3E0E A;  1K9M C;  2KEN A;  3PO3 G;  1TWF H;  2D0P A;  1SR3 A;  4YCV A;  4X64 Q;  1KQS A;  3BZC A;  5JJK A;  1N36 L;  4JCV E;  5ELO A;  3GDE A;  4OO1 G;  1VQF A;  4UP7 A;  4R4Q A;  3G71 A;  3RNU A;  2NN6 I;  3M85 A;  1EOV A;  4YHH Q;  4JBM A;  1QUQ A;  3UE1 A;  2UXC L;  5FLX c;  4WJ4 A;  4GOP A;  1IBL Q;  1EFW A;  4KI0 A;  4R4O A;  4GN5 A;  4XTC S;  4JI8 L;  4UCR A;  4DV0 Q;  3A5Z B;  1X56 A;  1KRS A;  1IZ6 A;  4JI7 Q;  1VQ5 A;  1MKH A;  3AEV A;  2KCM A;  2V1C C;  4P75 A;  4A3I G;  3ULJ A;  1IBK Q;  3GTG H;  3BA9 A;  3FKI G;  2CQO A;  4B3S L;  2XGT A;  4PZ6 A;  2NZO A;  1BBW A;  4IOC A;  3I4N G;  1Q1E A;  4POF A;  1IBM Q;  2UUA L;  3HOV G;  5DIS C;  2VS1 A;  1V9P A;  3D31 A;  2BH2 A;  5EAY A;  2I5M X;  4PZ8 A;  4A3K H;  1U0L A;  1UEB A;  3RLF A;  5IP7 H;  4BBR G;  2MQH A;  4IFD I;  5D1P A;  4A93 H;  2QA4 A;  2CFM A;  4IPH A;  3S1M H;  5FLM G;  4K0K Q;  2RF4 A;  1P16 A;  2HQL A;  1K0R A;  1V1Q A;  3ZJY C;  1L0W A;  3G4S A;  1N33 L;  4MZ9 A;  3TRE A;  3JC6 6;  4DR6 Q;  4A3D G;  3NC0 B;  3NBZ B;  4YY3 L;  1M90 C;  1Y1V G;  4HTP A;  3GTP H;  3K7U C;  2HVQ A;  4JI3 Q;  3M7N A;  1Z9F A;  1WOC A;  3KYH C;  1XNR Q;  2R92 G;  1PYB A;  2VZA A;  3B6Y A;  4A3D H;  1QZG A;  2ZM6 L;  4C3I H;  4HIO A;  4X66 L;  4LH7 A;  4JI5 L;  1S40 A;  4BBR H;  1IYJ B;  2OCE A;  5IP7 G;  1VS0 A;  4DR3 Q;  4OON A;  4C3J H;  3CC2 A;  4LNQ A;  4O2D A;  1KD1 C;  3EBE A;  5IT9 c;  3AFQ A;  4QL5 A;  3PV0 A;  5C3E G;  4HIM A;  3S1R H;  1FJG Q;  3KDF B;  3HOZ H;  3AYH B;  3CCQ A;  1YJ9 A;  1HR0 Q;  5JEA G;  5LMU L;  4PMW A;  1PH5 A;  4YWM A;  4JI1 L;  4YCU A;  3HOV H;  1GVP A;  3HKZ G;  3I4N H;  1YVC A;  1FGU A;  4C3H H;  4LF8 Q;  4X64 L;  3WWV A;  3F8T A;  1VQB A;  1VQM A;  1HR0 L;  3S2D H;  3CMA A;  4P71 A;  2JE6 I;  4LF8 L;  3CCU A;  3MXN B;  4DV6 Q;  1A8V A;  4GOP B;  4LWC A;  3CCS A;  4A3M G;  1HNX Q;  4XIG S;  4A3G G;  5FPO A;  5IYD G;  4LF5 L;  3HOW H;  1X3E A;  3I4O A;  2K14 A;  2JA9 A;  2LSS A;  3KF6 B;  4HJ9 A;  1N34 L;  2UXD Q;  1LTL A;  1HNX L;  5LMN L;  1L1O C;  4GS3 A;  2UXD L;  4NPS A;  3BJU A;  1OXT A;  2LXJ A;  4PZ7 A;  1GM5 A;  4LFB Q;  4JI7 L;  3TY5 A;  1BBU A;  2Y0S G;  5AJ3 L;  1PH4 A;  4Y52 H;  1EYG A;  1KXL A;  4X65 L;  3I55 A;  3CXC A;  3PO3 H;  4O0A A;  3PIP A;  4B3S Q;  3RN5 A;  2UUC Q;  4A3E H;  1PHJ A;  1O7I A;  1UE7 A;  1YJN A;  4P72 A;  4HIK A;  5AJ3 Q;  2N78 A;  3U4Z A;  4IO9 A;  2UUA Q;  2XTI A;  4JOI A;  3PO2 H;  2KHI A;  2VUM H;  4DK3 C;  1J5E L;  4QQB X;  1QUQ B;  2L15 A;  4K0K L;  4OO1 I;  4UCU A;  3QWU A;  1DGS A;  4IFD J;  1I6H H;  4JG2 A;  4LFC L;  5D1O A;  4LUZ A;  4YWL A;  2PQA B;  3I2Z A;  1SRO A;  3HOW G;  1AE3 A;  3GTO H;  2WAQ E;  4DR1 L;  1CSP A;  1TWA H;  4DV2 L;  3HOY H;  1WFQ A;  1VQJ A;  4DUZ Q;  4JI4 L;  4FDB A;  4LUV A;  2IX1 A;  4JV5 Q;  3RLN A;  1WJJ A;  1XMO Q;  1TXY A;  2GVB A;  1NMG A;  1P8L A;  2N49 A;  1X9N A;  3EN2 A;  1NBW A;  1UE6 A;  4ME3 A;  1JB7 A;  1LM0 A;  4DV3 L;  4DUZ L;  2E2I H;  4DR1 Q;  3CCL A;  4JI4 Q;  1SE8 A;  2E5L Q;  4LF4 Q;  1EQQ A;  4UCS A;  5E7N A;  3S1N H;  4LF9 L;  4P74 A;  3J81 j;  1V43 A;  3HOX H;  2CWP A;  4DV4 Q;  1PH1 A;  4DR7 Q;  1EIF A;  3J80 c;  3S15 H;  1HNW L;  5C4X G;  3JSN A;  2ATW A;  1VQC A;  3CW2 C;  3AQQ A;  4DR6 L;  1VQE A;  1JT8 A;  3JAM i;  3PN1 A;  1Q82 C;  4B3R Q;  3PGZ A;  1XPU A;  4A3L G;  4EFE A;  1XJV A;  1AH9 A;  3ICE A;  4NB3 A;  4L5R C;  1QZH A;  3HOU G;  1L2F A;  3MEF A;  4IPG A;  3A5U A;  4A3B G;  1B8A A;  1GD7 A;  4A3F H;  3CCJ A;  2ASB A;  1PH6 A;  5M5W H;  5JJL A;  1YIJ A;  4B3R L;  1XTD A;  4NXM L;  3DLL A;  5LMN W;  1NY4 A;  3CC7 A;  2F4V L;  4A3G H;  2MFI A;  2VQF Q;  2JA5 H;  1SRU A;  3E9I A;  3OYY A;  2MO1 A;  4BBS G;  2YTV A;  3PIO A;  2YYZ A;  3DM3 A;  3TS0 A;  1UWV A;  3BAB A;  2VQE Q;  5C0X I;  4B3M L;  3S2H H;  2NVT H;  5FJ8 G;  2NVY H;  3D0F A;  4GNX A;  2A19 A;  4DUY Q;  4LFA L;  3TS2 A;  4DKA C;  2HVR A;  1J6Q A;  1X54 A;  4UP9 A;  3BAA A;  1VQ4 A;  4X65 Q;  1QVC A;  5C3E H;  3S16 H;  1OXS C;  1AE2 A;  5C4J H;  3UDI A;  4R4T A;  2Q2T A;  2IX0 A;  1YEZ A;  2HVS A;  4CC5 A;  1FL0 A;  5M5X H;  2H5X A;  5BR8 Q;  2UUC L;  4EQ5 A;  1VQI A;  3K7A H;  5JJI A;  4JBK A;  2R93 H;  4R1J A;  1SN8 A;  2Z6K C;  5LMN Q;  2DGY A;  1YHQ A;  5BR8 L;  1QVG A;  4POG A;  2R7Z G;  4UCO A;  3Q8D A;  4WJ3 M;  2KHJ A;  3S17 H;  3T1H L;  1ASY A;  4EX5 A;  3HKZ E;  2VW9 A;  4BXX H;  2IT1 A;  3I7F A;  2WAQ G;  2OTJ A;  1NJI C;  1TAE A;  5M3M G;  4X6A H;  3RR5 A;  4DR2 L;  5GRO A;  4A3L H;  4DV0 L;  1CKN B;  2K75 A;  1NMF A;  5C0X G;  4A93 G;  1VQ6 A;  1VQL A;  5C4X H;  1S68 A;  5HY6 A;  4DV1 Q;  1KAW A;  4AIM A;  3KJP A;  3HOX G;  4OX9 Q;  4UCV A;  3BZK A;  1KIX A;  1NE3 A;  3I56 A;  3KJO A;  3KDF A;  4OX9 L;  2BA1 A;  1XPO A;  3I4M H;  5GAG C;  2WB1 E;  2VY3 A;  1Q12 A;  5M3F H;  1X55 A;  1K8G A;  1X3F A;  1TWH H;  4JYA Q;  4IPD A;  3CQZ H;  1WCM G;  3J7A 5;  2A1A A;  1H95 A;  3GO5 A;  4X66 Q;  4A3M H;  3VNN A;  3JSL A;  2KCT A;  4IFD G;  2IHF A;  3F1Z A;  2E5L L;  3GTK H;  3L7Z C;  3TEH B;  3UDX A;  5M3F G;  1E22 A;  4CC6 A;  2E8G A;  4YWK A;  1VQ9 A;  4DV4 L;  2VQF L;  1KL9 A;  1IBM L;  1SFO H;  2VUG A;  2VNU D;  4NXM Q;  2F52 A;  2JA8 G;  4Y7N H;  4L5T A;  1WYD A;  2HT1 A;  2RHS B;  3CCV A;  3CP0 A;  1HR0 W;  2YTY A;  5FJ8 H;  4DNI A;  3A0J A;  2HIV A;  1G29 1;  2WB1 G;  3PF5 A;  1M1K C;  1N32 Q;  3SGI A;  1GKH A;  3BU2 A;  2VQE L;  4HID A;  1OXU A;  3ER0 A;  2UXB Q;  4BBS H;  4A3J H;  4TVA B;  5M3M H;  2I0Q A;  4QY7 A;  2UU9 L;  1BKB A;  1PVO A;  4B3T Q;  2UXB L;  3L0O A;  1N32 L;  1MJC A;  4HJ8 A;  4HJA A;  2OTL A;  1CUK A;  2UU9 Q;  4DV5 L;  5H1S E;  1ASZ A;  2IHE A;  2BH8 A;  1MIU A;  2R7F A;  4JBJ A;  2HHH Q;  4JI6 L;  2R7Z H;  4OWX B;  4A3B H;  2ZM6 Q;  4GLA C;  4DV5 Q;  2MO0 A;  4R4C A;  2EIF A;  4AQY L;  2CWA A;  1GO3 E;  3K81 C;  5ELN A;  5IWA Q;  2PMZ E;  3PUW A;  3CC4 A;  2Z0S A;  3M4P A;  3T1H Q;  2K52 A;  1IBL L;  4DV7 Q;  4DAM A;  2E2H H;  4LF5 Q;  2B63 G;  1E3P A;  1IXR A;  2ZTC A;  2K4K A;  3PUX A;  2GVA A;  4NXN L;  4JI8 Q;  1PH2 A;  3S24 A;  2ZJP A;  2K50 A;  1EWI A;  3UE0 A;  4GNX B;  4LF7 L;  1XMQ L;  1TWC H;  4UY8 C;  5J3B A;  1IBK L;  2JA6 G;  2EQS A;  4LFB L;  2ID0 A;  3KLW A;  3M4Q A;  4QIW E;  4LF7 Q;  3H0G G;  1HZ9 A;  3HOZ G;  3W1G A;  4C2M H;  3VDY A;  4DR2 Q;  3H0G H;  1U5K A;  1Q7Y C;  1XNQ L;  1VQP A;  4DV1 L;  4BA1 I;  1CKN A;  3FKI H;  3UDG A;  1QVF A;  1Q81 C;  2JQO A;  2B63 H;  4LW1 A;  4DR4 Q;  3H3V I;  3HOY G;  3A74 A;  3GD7 A;  1D8L A;  1XK5 A;  2RCN A;  4APV A;  1OXV A;  2K5V A;  4DAY B;  2PQA A;  4HJ5 A;  1I50 H;  4A3F G;  2CCZ A;  4AYB G;  2GN5 A;  4HJ7 A;  4KLK A;  1G6P A;  3FHW A;  4P73 A;  1YI2 A;  4LF9 Q;  4GKK Q;  1MJE A;  4UCT A;  1G51 A;  5K36 G;  1S3O A;  1Q8K A;  2OQK A;  1WI5 A;  1XNR L;  2D62 A;  2D0O A;  2FXQ A;  2YV5 A;  5FLM H;  2UUB Q;  3AFP A;  1CKO A;  3G48 A;  3BA8 A;  2YTX A;  4GN3 B;  1Y1W G;  3GTM H;  3NBY B;  1RL2 A;  3F2B A;  2JA7 G;  1XDN A;  1YIT A;  4JI0 Q;  2N8N A;  3JAM c;  3J81 i;  1UE1 A;  1VQG A;  2Z6K A;  2RHQ B;  4JI0 L;  1HJP A;  5DLQ E;  1PV4 A;  4JYA L;  3PUV A;  4GOP C;  4LF6 Q;  5C44 H;  1UE5 A;  1C7Y A;  1PH7 A;  2JA8 H;  3K0X A;  1E24 A;  1YNX A;  2R6G A;  2NVX H;  2C35 B;  4GLX A;  1W2B A;  4HTO A;  2Q2I A;  3PUY A;  1KC8 C;  3KF8 B;  2AHO B;  1B7Y B;  3ULP A;  1I94 Q;  2YU9 H;  3S14 H;  3TRZ A;  5IYD H;  5IYB G;  1N9W A;  3K8A A;  4L5Q A;  2VL6 A;  2K5H A;  3KFU A;  1BVS A;  1Q46 A;  1VQK A;  1E1T A;  1E1O A;  4DPG A;  3E9H A;  2PI2 A;  1Q1B A;  3CCE A;  1N33 Q;  5FPR A;  1D7Q A;  4AYB E;  4PG3 A;  4IJH A;  3PSI A;  1I94 L;  4JI6 Q;  4LF4 L;  3T1Y Q;  1VQO A;  2EXD A;  3CCM A;  4AQY Q;  2B3G A;  2JK8 A;  5IY0 A;  1FJG L;  1YZ6 A;  3I4M G;  4DR7 L;  5GQO A;  2LXK A;  4AH6 A;  1TWG H;  1VQD A;  3NEM A;  4GN4 B;  3CME A;  5LMU Q;  3TY9 A;  1W3S A;  3RZD H;  3U58 A;  4QGU A;  4DUY L;  4GKJ L;  2I5H A;  4KHP L;  4LUO A;  1JJG A;  4JC0 A;  4MNO A;  1NTG A;  3CCR A;  2ZTD A;  4L5S A;  4DR5 Q;  1SMX A;  4LFA Q;  2N3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...