3W1GA

Crystal structure of human dna ligase iv-artemis complex (native)
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
599
structure length
583
Chain Sequence
TSQTVASHVPFADLCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHKDVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTGDFAMIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISITLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKGTKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNEAIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEYVSMDELDILIVGGYWGKGSGMMSHFLCAVAEKPPPSVFHTLSRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILCGTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLEQLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA ligase 4
publication title Structure of the catalytic region of DNA ligase IV in complex with an artemis fragment sheds light on double-strand break repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 175
structure length 583
sequence length 599
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF04675 DNA_ligase_A_N DNA ligase N terminus
A PF04679 DNA_ligase_A_C ATP dependent DNA ligase C terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3260.10 Mainly Alpha Orthogonal Bundle DNA ligase i, domain 1 DNA ligase, ATP-dependent, N-terminal domain 3w1gA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3w1gA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3w1gA02
3AFQA 4POFA 1VQOA 3J81c 3K0XA 1GM5A 1EUJA 4JI3Q 4BBRH 2D62A 2K50A 1HZ9A 1WCMH 1EIYB 4YCUA 2UXDL 5IYDH 5E7NA 3H0GH 1LUZA 4GS3A 5GQOA 4HJ8A 3HKSA 5IYBH 1NY4A 1SE8A 3GDEA 5D1PA 1X9NA 4DV5L 4JBWA 3K8AA 3B6YA 3ULPA 2R92H 3SGIA 3CC4A 1S40A 3KDFA 3I7FA 1K73C 4JI1Q 3M85A 4LF5Q 1MJEA 3RZDH 2BH8A 4JI0Q 1VQAA 4P75A 3I4NH 1PH7A 1J5EL 1B70B 1P8LA 2OTLA 4AQYQ 4GKKL 4UCOA 1VQ6A 1N32L 1X55A 3M9BA 4APVA 4B3RQ 1YJNA 3HOWH 1WJJA 3KYHC 3K7UC 4A3IH 4C2MH 3RTXA 4GNXC 2K5HA 4OWTB 3S15H 4LF6Q 4B3SQ 5D1OB 1UE5A 4LF9Q 5IP9G 2K75A 3U4VA 3BJUA 2BA0A 4MNOA 3J80c 3S24A 4GN4B 1K3RA 4DV6L 1L2FA 5LMUL 4A3KH 1V43A 1CSPA 1K9MC 4DV0Q 1VQ4A 2Y0SE 4DR2Q 3U50C 1VQLA 1DGSA 4B3MQ 4JC0A 4DAYB 3F2BA 4A3MH 2PI2A 1XMQL 1KQSA 5M5WH 1MJCA 1XMOQ 4K0KQ 2YYZA 2CFMA 1I3QH 3TREA 1I6HH 2Y0SG 1PA6A 2JEBI 3AEVA 3PGZA 3W1BA 1U5KA 2KCMA 4R4IA 1L0WA 4DV7Q 3AYHB 2GVBA 1EYGA 1VQ7A 2MNAA 4LF7Q 3NENA 5LMNW 5IP9H 2JA6H 3J81i 2PNHA 3HOYG 4LFCL 4A3CG 4DR6L 4DR4L 1V9PA 2R7ZH 3MXNB 1HNZL 4IFDG 5IE8A 3HFZB 1MKHA 2C35B 3ERSX 3A74A 3G48A 3HKZE 1HNXQ 4NXNQ 1KRSA 4QGUA 1Q46A 4P74A 4X66L 2MO0A 4LH7A 3OYYA 1L1OC 4DV2Q 1GO3E 1FVIA 4X64L 2D0OA 1C7YA 3M3YH 2AKWB 3HKZG 3VDYA 3HOVH 3KLWA 1J5EQ 4E6NA 4LWCA 5FPOA 3H3VH 5LMNL 4DR7Q 3STBD 3RN2A 1EOVA 1X3EA 2Q2HA 1QUQA 5H1SE 4DK6C 4JBJA 2OCEA 4R1JA 3HOYH 4LW1A 4DR3L 1PYBA 2UUBQ 4X6AH 4GLVB 4CC6A 1Y1VH 1JJGA 1KC8C 1N36L 4A3LH 3EBEA 4DUZQ 1E22A 4RMFA 3NELA 1A62A 1Z47A 4NB3A 4HJAA 1JT8A 5FLMG 2GN5A 3T1HQ 4DAMA 4HIKA 4R4TA 1N33L 1JJ2A 4JI3L 3KJOA 5JEAG 4AYBG 3J80i 4IPDA 3S17H 1QVCA 1TXYA 4R4OA 5C44H 3MEFA 1WFQA 4BY1G 1PFSA 4GOPB 1P16A 1YNXA 3CCUA 3PCOB 1I5FA 3U4ZA 3UE1A 1VQMA 1PH2A 1XNQQ 3ICEA 5IP7G 1PH1A 1RIPA 1KIXA 2JA5H 4DR4Q 3PO3G 4JI4Q 4OX9L 2QGQA 1HNZQ 2VUMH 2NN6I 4JI1L 5EAYA 1V1QA 4LUVA 1Q81C 2XGTA 4R4QA 5IWAQ 4NXMQ 5M5YH 2NZHA 3CCEA 4A76A 2JA7G 5J3BA 4AQYL 1NMFA 2UU9Q 2JK8A 4BBRG 3GJXB 4RG1A 4JI6L 1WCMG 5LMNQ 1N34Q 2UUAQ 1Q1BA 2FXQA 2VZAA 3PIPA 3S2DH 3CAMA 3K80C 4BXXH 1A8VA 4EFEA 1VQPA 4JYAQ 4LF6L 4B3SL 5IYBG 2ZJRA 3RLNA 5IP7H 1TAEA 2VNUD 4A4IA 2CQOA 3TQYA 2HIXA 4HIDA 4DV1L 1SN8A 4DR3Q 3PO3H 2R92G 3PUZA 1N36Q 4YCWA 3KF6A 4ME3A 2E2JH 1N8RC 4DV0L 2JA8H 4UP9A 4DR2L 1K0RA 2E2IH 4IPHA 4HJ9A 1TWAH 4YWKA 1HZBA 1TWGH 2JA7H 3I4NG 4K0KL 1XMOL 2CKZB 4TVAB 1HR0W 3F8TA 1JMCA 5M3FH 1N33Q 1TA8A 1PHJA 4CC5A 4IJLA 4GLXA 2OQ0A 1JE5A 1UE7A 4DV7L 3BAAA 3FHWA 1H95A 3HOWG 1XK5A 4EFBA 1YJ9A 4L5RC 1NMGA 4A3IG 2E5LQ 1OXVA 4JBKA 1YEZA 3PSIA 4LF7L 3J7A5 3TRZA 4IFDJ 2F4VQ 3F2CA 1PH8A 1VQ8A 2CWAA 2Q2UA 2HT1A 1QZHA 1PH3A 2WAQE 3GTGH 3JSNA 4JI2Q 4DR5L 4DKAC 3KF8B 4OX9Q 4NXNL 1HNXL 1HR0L 2EIFA 2A19A 1VQNA 2HHHQ 4A3KG 2WAQG 2R93H 1K83H 1JJCB 1SROA 4JOIA 4DV2L 3RR5A 1OXSC 2PQAA 1YITA 3BA9A 5C0XG 1YI2A 1XTDA 2WP8J 4GKJQ 4A3MG 1C0AA 4DR7L 4OO1G 1XNRQ 3GTJH 1PH4A 4A3JH 4JI6Q 4GN3B 5D1OA 5GADC 4JV5L 4EEQA 3GTLH 3ER0A 3I56A 1AE3A 2E2HH 1N9WA 1SFOH 4PMWA 1KHIA 2CWPA 3IRBA 1KRTA 5FJ8H 2UUBL 2JA6G 1GD7A 1VQFA 5JJIA 2R7ZG 3W1GA 4J15A 4P72A 3CCJA 4DV1Q 4IOCA 3CCLA 1X65A 4A3GH 3E9IA 4DUZL 4GN5A 3I2ZA 2ES2A 3EN2A 3CC7A 5GAGC 1NTGA 3T1HL 3HOUG 3QWUA 2B3GA 2CCZA 1Y1WG 4PG3A 1TWFH 2NVXH 3HOVG 3ULJA 2UUCL 2HVSA 1TWHH 1L1OB 4X65Q 2JE6I 3HOXH 4LNQA 3EIVA 3PUXA 2E5LL 3NC0B 5K36G 1G6PA 1XDNA 1FGUA 4QQBX 3GTOH 3PUYA 1XNQL 2A1AA 4Y7NH 2KHIA 2ZM6Q 3UDGA 4DR1Q 2PI2E 4UCUA 3AFPA 3UQ8A 2JEAI 3CPFA 3RLFA 4JI4L 1X6OA 2LSSA 3M7NA 4IFDI 1Y1VG 4DR5Q 4KHZA 1WOCA 3K81C 2IX0A 4A3LG 1HR0Q 1HZCA 2NVYH 3D31A 5IWAL 4FDBA 4NXML 3HOUH 4X62Q 1XPRA 1UE6A 1Y1WH 4WJ3M 2UU9L 4POGA 5BR8L 1NJIC 4A3EG 4P71A 3WWVA 2ZJQA 4LUOA 3CW2C 3S1MH 4WJ4A 1VQKA 4DNIA 2UUAL 3VNNA 1N34L 3HOZG 4LF8L 2VS1A 2OWOA 3G71A 3GTPH 5C44G 4JYAL 4JV5Q 2JA9A 1D8LA 2K5VA 1T9HA 2JA5G 5JJLA 2VY3A 4YCVA 2VUMG 3OTOL 2HVQA 1E1TA 4AYBE 2Q2TA 4O0AA 4XTCS 4A3BH 2AMCB 2VQEQ 1NE3A 4P73A 1AE2A 1HJPA 4XIGS 5C4XH 2ZTCA 4A3EH 3CD6A 3TY5A 2UUCQ 2OTJA 1IYJB 3LGJA 3HOZH 3I4OA 3UDIA 3TY8A 1FJGL 4KHPQ 2UXBQ 3JSLA 3KOJA 2F4VL 4A3FG 1BVSA 1EFWA 1QUQB 2K14A 3RNUA 1E1OA 4L5TA 2H5XA 3CQZH 3CCRA 5IY0A 1IZ6A 2I0QA 4JI2L 1Q82C 4JI7L 3NBZB 2QA4A 1SMXA 2HHHL 5C0XJ 2OQKA 3TS2A 2B29A 2JA8G 2IY5B 4UCVA 1VQGA 5M3MH 3CP0A 4YY3Q 4GKJL 1VQ9A 5FPRA 3D0FA 2ALYB 1U0LA 2ZTDA 4UPAA 2NZOA 5BR8Q 5M3FG 2KENA 4NPSA 1EQQA 1M90C 1YHBA 3STBC 1XNRL 3PIOA 2D0PA 1EQRA 1WYDA 3W5OA 1X56A 2KBNA 4PZ8A 4LF8Q 4UCRA 4C3IH 2VW9A 2HIVA 3PUVA 4JI8Q 4R4CA 1YHQA 1YJWA 2PMZE 1LTLA 3UDFA 4A3DG 3PN1A 2I5LX 2RCNA 4A3FH 3JAMc 3CCSA 3A0JA 1J6QA 3I4MH 4JBMA 3BU2A 4QL5A 1VQBA 3OTOQ 3BZCA 2R93G 1X3FA 2AWOA 2K5NA 5M5XH 1YIJA 1HNWQ 3M4PA 1S3OA 3DM3A 1PV4A 4HJ7A 4X65L 4C3HH 3NBYB 5GAHC 4A3JG 3NEMA 2UXCL 5ELOA 4IOAA 1BBWA 1MIUA 1FJGQ 1Q1EA 4QIWE 4HJ5A 2ZM6L 1UWVA 2N49A 3GO5A 2VQFQ 4DR1L 4A3DH 3F2DA 3F1ZA 2VUGA 2GVAA 2YTYA 4B3TQ 4YWLA 5FJ8G 4LFAQ 2WB1G 4PZ7A 1CKNB 1GKHA 2IHFA 3M4QA 1CUKA 4PZ6A 2R6GA 4GNXB 4JI7Q 2QEXA 1IL2A 1IBMQ 4A3GG 5HGQA 4DV4Q 4YHHQ 3L7ZC 5IT9c 2RHSB 1ASYA 4L5QA 4X62L 4HTOA 4OWWB 1B7YB 5C0XI 3GTMH 3KJPA 2JQOA 1Y14B 3KF6B 3PO2H 4BBSG 3Q8DA 1PH6A 1ASZA 4C3JH 1SR3A 4JCVE 3HOXG 1FL0A 4OO1I 1VS0A 2HQLA 2XTIA 1Q7YC 5DISC 2A8VA 1A0IA 2Z0SA 5JJKA 2IHEA 3A5UA 4ALPA 3FP9A 2MQHA 1E7ZA 3GTKH 2BA1A 3U58A 1BBUA 2V1CC 5IYCH 2AWNA 4EX5A 3OW2A 3GTQH 4HTPA 3S14H 4A93H 3FKIH 1VQEA 2E8GA 2IT1A 4YWMA 1G51A 3PV0A 4IPGA 5FLXc 4UP8A 4HIOA 1QZGA 5JEAJ 5C3EH 2VQEL 1L1OA 4QJFA 3KDFB 2K52A 4BBSH 3JAMi 3M4OH 1LYLA 2MO1A 2PQAB 3UE0A 3CXCA 3T1YQ 4UCTA 4DV3Q 4DUYL 3H3VI 3H15A 1YZ6A 3DLLA 3RN5A 2F3IA 4KHPL 2UXCQ 2UXBL 3L2PA 4DPGA 1HH2P 4UFZA 4QY7A 1VQDA 1IBLQ 3L0OA 4AIMA 3CPWA 4JI0L 4LF4Q 2N8NA 1K8AC 3TEHB 1YHAA 1VQCA 1I94Q 1IBKQ 4JOIC 4HIMA 1UE1A 1SRUA 4IO9A 3S1QH 3G6EA 3G4SA 1C9OA 4YY3L 3NBHB 4A3BG 1KAWA 3GD7A 2I5HA 1PH9A 3PF4A 2NVQH 5C4XG 3A5ZB 4Y52H 1PVOA 2B63G 3J7ZC 1OXXK 5HY6A 1W3SA 2UXDQ 3BA8A 1A63A 3BABA 1CKOA 2KHJA 4JI8L 3KFUA 4DRFA 1VCIA 1KXLA 4BA1I 2YTXA 3E9HA 1VQIA 4DV5Q 2R7FA 1OTCA 3RLOA 3TS0A 3PUWA 3BZKA 1Q8KA 3RZOH 4AH6A 3CMEA 1HNWL 4OONA 3GB8B 1NBWA 3CF5A 1S68A 3UDXA 5M3MG 1GVPA 1Q86C 1RL2A 3JC66 3CMAA 3PF5A 1VQ5A 5DLQE 4GKKQ 1E24A 1CSQA 1KL9A 2Q2IA 4GOPA 1SLJA 4H02A 2B63H 3S2HH 2IX1A 4DUYQ 1N32Q 2YTVA 1W2BA 2L15A 3J81j 2VQFL 1M1KC 4LFBL 2ID0A 2HVRA 1XPUA 4IJHA 1XPOA 1LM0A 1YVCA 4B3TL 4A3CH 2DUDA 1B04A 4JI5L 2DGYA 3CCQA 1PYSB 4LFAL 1EWIA 3CCVA 4KI0A 5ELNA 3I4MG 1IBML 4DV4L 2LXKA 4YHHL 1TWCH 2RHQB 3ULLA 3ZJYC 5LMUQ 2ZJPA 4DV6Q 1JB7A 3E0EA 5AJ3L 2EQSA 2LXJA 2Z6KA 1QVFA 1UEBA 2N78A 1XMQQ 1Q12A 4BY7G 3CC2A 2YU9H 1CKMA 4TQUS 3S16H 2F52A 2AHOB 2EXDA 1X3GA 1B8AA 4DK3C 1BKBA 1IXRA 3K7AH 2ATWA 4LFCQ 1AH9A 2VL6A 4DR6Q 4LUZA 1OXTA 2KCTA 4EQ5A 4GLAC 2YV5A 2NN6G 4IPCA 3S1NH 2JJQA 1QVGA 4LF5L 2MFIA 4X66Q 2K4KA 4UP7A 5FLMH 2I5MX 4BXXG 3TY9A 2R7DA 4X64Q 5GAEC 4L5SA 4OXPA 4BA2I 3PO2G 3AQQA 2ASBA 4GOPC 3T1YL 3S1RH 4BY7H 1XJVA 1VQHA 1E3PA 1EIFA 2ZTEA 4MTNA 5IYDG 4DV3L 4B3RL 1VQJA 3H0GG 1R9TH 1I50H 2BH2A 4KLKA 1YBYA 4BY1H 5GROA 2NVTH 2WB1E 1WI5A 1IBLL 4LFBQ 1KD1C 1CKNA 4LF9L 4JG2A 1K8GA 1O7IA 4LH6A 1X54A 4O2DA 4GNXA 4LF4L 3I55A 4A75A 3CCMA 4OWXB 4JI5Q 4A93G 1G291 5IYCG 1I94L 2N3SA 1IBKL 4UY8C 1HZAA 3FKIG 1S72A 1OXUA 2WFWA 1D7QA 4UCSA 1Z9FA 2RF4A 2Z6KC 4MZ9A 5C4JH 4B3ML 5AJ3Q 5C3EG 1PH5A
chains in the Genus database with same CATH superfamily
2XWBB 3LNNA 4POFA 1S5FD 4BBRH 4QIWB 4RGOS 1HZ9A 5I60A 4A3GB 1WCMH 1RCVD 5T1IA 5DMXA 1AFPA 3A56A 1NY4A 1SE8A 1B2TA 4Q4DA 4RZQA 1ZXTA 1PFBA 3B6YA 3ULPA 2R92H 1S5BD 3HOXB 3CC4A 3AMUA 1K73C 4LF5Q 2FHTA 1MJEA 1VMCA 5JJZA 1KTKA 2IL8A 3VYSA 4MHEA 2OTLA 4AQYQ 2R82A 3T13A 4K8JA 1N32L 5BYBA 3M9BA 3QOLA 1WJJA 3KYHC 2HDKA 3K7UC 1D2BA 4C2MH 2A69C 4OWTB 5IP9G 3J81E 5KS8A 3U4VA 1BCPB 4MNOA 4FF4A 2F0DA 4DV6L 2HJWA 2EYOA 1K9MC 2Y0SE 3TP6A 4DR2Q 5C0XH 3U50C 2A68D 5ELDA 1KQSA 1XMOQ 1ILPA 2YYZA 1I3QH 3TEKA 1PA6A 2JEBI 3PGZA 2QKIC 4L6TB 2KCMA 1L0WA 4DV7Q 1LTTD 1GLVA 3FPPA 1EEFD 4ZLTF 2JA6H 2AQ2B 2KJXA 4LFCL 4DR4L 1O7YA 1HNZL 1C8CA 3ERSX 1HNXQ 4P74A 2MO0A 3Q24A 3OYYA 4IN3A 3C46A 4LH7A 1FNVA 4DV2Q 1SBBB 5KRUA 1WTRA 3HOVH 3KLWA 1J5EQ 2XD4A 4E6NA 3VYTA 3QB3A 3H3VH 3T9DA 4FXGC 1EEID 3RN2A 3G8CA 4EGQA 3OUZA 1X3EA 4O4HF 4IUVA 5H1SE 1NNXA 3H6MA 4DK6C 4FF1A 2TMPA 3HOYH 1I7LA 4KY6A 2NWGA 4GLVB 4CC6A 1Y1VH 3SK6A 1JJGA 5BWUA 2YS6A 2COIA 1OO9B 1A62A 4HJAA 4CKEA 2A68C 1Y8NB 4HIKA 2WINB 1SE3A 4AYBG 3Q0AA 4YIJA 1PZJD 1TXYA 2RQXA 4GOPB 1VQMA 2L5TA 2XWJB 3ICEA 4PMCA 3HGBA 5IP7G 1SYEA 3HS0C 1RIPA 3VYUA 2JA5H 2DWCA 1Z6HA 3S1RB 1I4HA 3PO3G 2QGQA 1K8MA 1IYVA 4QSHA 1DM0B 4O7YA 2XGTA 2I8CA 2NZHA 3CCEA 3I70A 1FNWA 1BNCA 2B2WC 4AQYL 4MA5A 4RG1A 3L9AX 3PQIA 2DZDA 5F2DA 1EU3A 4EFEA 4BXXH 5IYBG 1CM9A 2Z04A 4DLKA 4HR7B 3TQYA 4BBRB 4DR3Q 4RGTA 3J7YW 1HQMC 3KBXA 2VQDA 3KF6A 2E2JH 4DR2L 1K0RA 3LX0A 4HJ9A 1TWAH 1TWGH 1XMOL 1DIKA 3RV3A 2L9HA 1KT8A 4GLXA 3FKIB 1SDFA 1JE5A 1BF4A 1Q3LA 4DV7L 1BXRA 4JBKA 4A3IG 3TRZA 1OXVA 3UFXB 4CHIA 4IFDJ 3URYA 3F2CA 1VQ8A 2F4VQ 3JSNA 1E2ZA 2WAQE 1GSAA 4OELB 4DR5L 1SYFA 4CMDA 1HNXL 1HR0L 1JOQA 2A19A 1ZYRC 4OIJA 1K83H 1JJCB 1SROA 4H7BA 5JAVA 4DV2L 4V190 2PQAA 1DAAA 3FEWX 2CNVA 2V58A 4I7ZC 3BA9A 2WP8J 4A3MG 4QCLA 2HGWA 2KECA 1C0AA 1JR0D 4IIJF 3KLRA 4OO1G 4JI6Q 2FPPB 5GADC 4BS9A 3ER0A 4RKBA 3H09A 5DNFA 3EROA 1KRTA 1VQFA 1EKFA 1I3QB 3CCLA 3T9FA 1TU2B 2OEOA 4O4JF 2M2LA 5GAGC 1ML0D 3HOUG 3T9BA 1Y1WG 1G6ZA 4IWYA 4CJ2C 1TWFH 2B2YA 2UUCL 2HVSA 4DQNA 3WOFA 3SNOA 3HG9A 2D5DA 3RZOB 4FE2A 2RA4A 2B2UA 4KTAA 4NMZA 5D3DA 3J81L 5CAEB 2O5IC 3MXPA 3SXHA 1D6EC 4A3LG 1EYAA 1HZCA 1NUCA 4O2BF 1I4RA 4FDBA 2ZT9C 4EGVA 2XRQD 3HOYB 1RHPA 4H0LC 3UZOA 3OSOA 3WWVA 4A3EG 2ZJQA 4WJ4A 5CC4A 3NHHA 1Y1VB 3VNNA 5M9OA 2OWOA 3T4AC 3G71A 3GTPH 5C44G 2KVMA 1HTPA 3VR5A 3HT5A 3E5NA 4MV9A 4KKTA 1ZKOA 2HHFB 4Y8VB 4EGJA 4HNUA 2VQEQ 3AB9A 1SSOA 2TSSA 1H9SA 2DNCA 3HOZH 2EYPA 2F0KA 1XTCD 2EJ0A 5I9OA 3KOJA 2F4VL 1DOLA 1QG7A 5K5PA 4CBVA 2W6PA 4JI0Q 1EYCA 1ET9A 4L5TA 3CCRA 4JXUA 5I9PA 1Q82C 5D65A 2B29A 2JA8G 1LTID 4ZQIA 1IKLA 2PZWA 1WTPA 1M4VA 3CRKC 3D0FA 4FVMA 4X3TA 5M3FG 5BPHA 1M90C 2BDOA 1D5MC 1IL8A 3MAQA 3HP3A 4FU0A 1WYDA 1X56A 2E2JB 4OL7A 3BVZA 3KAJA 1YHQA 3MFGA 1TWAB 1A15A 4KN7C 3UDFA 4A3FH 1PDQA 3CCSA 1KJQA 3A0JA 3I4MH 3SHLA 4ZKBB 3DTFA 1BXTA 3BZCA 1X3FA 2K5NA 3RUZA 3F2UA 3SVMA 1HNWQ 2R93G 3M4PA 2IW3A 2CNUA 2EPBA 1PFMA 2L11A 3DM3A 1S5CD 4G57A 1MGSA 4O83A 2EJ2A 2HDLA 5GAHC 2V59A 4A3JG 5ELOA 2R7MA 1FJGQ 1STGA 1TIID 3RZDB 1GJXA 3G8DA 2RBMA 2LFNA 2O2LD 3F1ZA 2YTYA 3DXJC 4LFAQ 1CHPD 4Q5VA 4JI7Q 4A3GG 5HGQA 4DV4Q 1J9OA 5JH7F 1B6SA 3EFXD 4HTOA 4IUPA 1IKMA 5C0XI 3GTMH 1I4PA 1SNDA 1ASZA 1SR3A 3HOXG 2VR1A 2DJGC 2F3WA 2QILA 1Q7YC 5DISC 2A8VA 5KGUA 5BWXA 5KX5F 3U55A 1II3A 1I6VC 2V1CC 4QMGA 4EX5A 3GTQH 4L63B 3MXGA 1VQEA 3W3AA 3V4ZA 5JEAJ 5JPNC 1EQVA 5C3EH 2VQEL 1L1OA 3KALA 1SYGA 3JAMi 3WWHA 3H3VI 4DUYL 1XYIA 1JLLB 1YZ6A 1GUGA 1JORA 4DPGA 3SK5A 3CPWA 4JI0L 2Q8IB 3NBIA 3OHXC 3TEHB 4CDDC 1O78A 1VQCA 1I94Q 2C00A 1ENFA 3UI2A 3QWNA 4HIMA 4IO9A 3HEJA 5CV6A 2YZLA 3BDLA 1K0SA 5LL6X 3NTKA 2NVQH 5KEEA 1EYDA 3P20A 2G9DA 3BA8A 3R23A 3BABA 5FLXE 1SYDA 4DRFA 5LOVF 1ENAA 1DV2A 1A2UA 3E9HA 4IUUA 4J8QA 4TM5A 1ET0A 3HOZB 2YWVA 1Q8KA 1V1PA 1HNWL 4OONA 3GB8B 3CF5A 3UDXA 2B2YC 1SXTA 1VQ5A 4GKKQ 4GOPA 1CSQA 2OTJA 2Q2IA 1SLJA 2B63H 3S2HH 2B2VA 3IL8A 4YJ2F 4ZQ3A 1QILA 1ICFB 2HVRA 4BWGB 4LFBL 5M5YB 4IJHA 5JVG3 1E2VA 4FFLA 4LFAL 4IFDH 1ICWA 5ELNA 4XYQA 1WTXA 3T9EA 3K5NA 4DV4L 1TWCH 4S3SA 5LMUQ 2ZJPA 5FR9A 2BE5C 1PRTF 2LXJA 2Z6KA 2K6AA 4R9WA 4A3FB 3R5FA 2K5WA 4XYLB 4N9TA 3CC2A 2JXMB 2AHOB 4HR7A 2EXDA 1X3GA 2ENBA 1B8AA 3A8IE 3K7AH 5I2YA 2GQRA 4F8MA 4DR6Q 4LUZA 3S1NH 2CZGA 2JJQA 2MGSA 3OIPA 4OHJA 2K4KA 5FLMH 2R7DA 5D14A 5E4WC 3J7AV 4ZOLF 2ASBA 4C1NK 1PTOD 1XJVA 3NE5B 2NU6B 2W70A 1R9TH 5E4XA 4I55F 4BY1H 4DGZA 2Z1CA 1KD1C 2A6EC 1O7IA 2EY5A 3GTMB 4O2DA 2GA4B 2HGXA 4OWXB 4DXFA 3MFYA 4JI5Q 3T7AA 1G291 5IYCG 1PRTC 2N3SA 1I94L 1IYEA 1HZAA 3C1EA 3FKIG 3LULA 2EYFA 4YB8B 2CW0D 4MZ9A 2OF1A 5AJ3Q 2I87A 1VQOA 3J81c 1MSHA 4V0BA 2D62A 2FINB 4YCUA 1WD1A 4ZHQF 4GS3A 4HJ8A 1AW7A 1WR2A 1CA5A 2Q8RE 4HNTA 5D1PA 4KD4A 4JBWA 4MAMA 2J9GA 1TWHB 1I4QA 1VF5C 2LY7A 1STNA 1B53A 3KDFA 3I7FA 1PTOH 2VPQA 4P2CB 4P75A 3I4NH 1PH7A 1B70B 1PTOC 4GKKL 1S5DD 4UCOA 1JWMD 5DGHA 1BR9A 2QEJC 2CVRA 2NVYB 3HOWH 3TBIB 1JOOA 4GNXC 3S15H 2K5DA 2K75A 3S1MB 2NVQB 3BJUA 2D2CC 3S24A 2CW0C 5LMUL 1V43A 4B3MQ 3F2BA 2PI2A 1MJCA 1SEBD 2CFMA 3TREA 5I6WA 4Q4CA 4ME5A 3DMUA 4ME6A 3E3XA 3MXUA 4X3SA 2HCIA 2NB0A 2MNAA 1LT5D 3NENA 4CJ1B 3HOYG 2N55A 2PNHA 4K5WA 4DR6L 5C4XB 2R7ZH 2Y0SB 4XDXA 5IE8A 3HFZB 2B63B 1HXYD 3C3LA 3S2HB 2ABJA 1L1OC 1GO3E 3E0JA 2R87A 1EQTA 3M3YH 3HKZG 4NKLA 3M4YA 2EXZA 1M6VA 1PMRA 1TS5A 3J80E 3BS1A 2SNMA 3STBD 1KDBA 1TWCB 5L37A 5FO8B 1EOVA 2Q2HA 4KY7A 1U4LA 1CFMA 5FLXL 1B44D 4JBJA 2OCEA 4C5CA 4XZ3B 1JKJB 4X6AH 4CGYB 4JVZA 1TR5A 2LMCB 4O1NA 3EBEA 2MUYA 5BN3A 3QR8A 3NELA 4NB3A 1JT8A 3E6ZX 2GN5A 4DAMA 4R4TA 1N33L 3K7AB 3KJOA 4KD3A 3S17H 5I5WA 1QVCA 4R4OA 2E5LL 1TY0A 4BXXG 1YNXA 1PH2A 2XVSA 1A3GA 3FVQA 1XNQQ 4M0JA 1PH1A 4LK1C 3K6OA 1KJIA 4PV1C 4DR4Q 3GIDA 3RFCA 1ESFA 1HNZQ 2VUMH 1QCBD 1C30A 1R9TB 1M0TA 3ORQA 2IX3A 1Q81C 2F3VA 5JQWA 4NXMQ 1PRTB 1QNUA 2UU9Q 5JEAH 2CH4W 1EUDB 3NP8A 2B2VC 1PLFA 4RCNA 3K57A 2FXQA 4TKOB 2VZAA 3S2DH 4O84A 3CAMA 1TAEA 2VNUD 2CQOA 1X32A 2HIXA 3D6CA 4FNFA 4HIDA 3LQSA 2K1BA 1D5ZC 3DF7A 4FF2A 1WVLA 1HFGA 1B9MA 1CQIB 2E2IH 3R8BA 2AUJD 2LKVA 1HR0W 3IFTA 3H94A 2OQ0A 1JQYD 2DJFC 3RD4A 3OWEB 3FHWA 4EFBA 3I73A 1EY8A 1YEZA 2F0MA 3PSIA 1WTWA 3AW8A 3K5LA 2FJ2A 4IZ8A 3M4OB 1W96A 4O7WA 2WYOA 4TRDA 2EIFA 4FFMA 2W6ZA 4ZCKA 3HOWB 4A3KG 2X0SA 1B1ZA 5I5TA 1CT1D 3RR5A 1BDOA 3WDNA 1XTDA 2X5RA 1FYCA 3JAME 1KLUD 1DCZA 4NP5A 3GTJH 4CHTB 4GN3B 1Y69U 5EKIA 3H91A 5ISRA 3GTLH 2WIIB 1N9WA 2WACA 4PMWA 2NU8B 1KHIA 3IRBA 2F0HA 1I1KA 2F0TA 3W1GA 4P72A 4ZUIA 3I2ZA 3MHBA 3EN2A 4U673 3CC7A 1H9KA 3V4SA 1STYA 2QCPX 2O4XA 2L12A 4K8IA 5CMDA 4H44C 4WHXA 2NVXH 3ULJA 2X69A 4LNQA 1L1OB 2HG8A 3EIVA 3NC0B 5K36G 4DAAA 5CA0F 4DN4M 4DF7A 4QQBX 3SE7A 1BUVT 1U4RA 4NDXA 2ICEC 2R84A 3MXNA 4DU9A 1XNQL 2A1AA 4DR1Q 3CPFA 2YS7A 1T5EA 1STAA 1X6OA 1WTOA 4IFDI 4DR5Q 4WBNF 4KHZA 2FFKB 1HR0Q 5I2XA 4WJWA 4NXML 2F0NA 1HUMA 1UE6A 1XPRA 4WJ3M 2UU9L 4POGA 2EYMA 2F0PA 2I07B 3CW2C 2R85A 4MA0A 3IKJA 2QF7A 3HOZG 4LF8L 2VS1A 2FP4B 1HUNA 1EL0A 3H3VC 2JA9A 2K5VA 1YNJD 4YCVA 3S16B 1B50A 1E1TA 2W6QA 2Q2TA 1Z7TA 2A5HA 4IWXA 2AMCB 1V1PB 1AE2A 1F9QA 2XN9C 2ZTCA 3CD6A 3TY5A 2UUCQ 3W2DA 3J80L 3QOJA 3OMCA 2UXBQ 1KNEA 3JSLA 3IAYA 4A3FG 2EYHA 1EFWA 2K14A 3ERQA 2H5XA 3CQZH 2I0QA 4HNVA 1SMXA 5CBEE 2OQKA 5KNCA 3TS2A 5E25A 1RTOA 2P0AA 1A3TA 1VQGA 3CP0A 5M3MH 5FPRA 1VQ9A 2OLSA 2ALYB 2ZTDA 1STEA 4B08A 1ENCA 5BYAA 4NPSA 4N9PA 3W5OA 4UCRA 1QOHA 1JDEA 2R7KA 2CH4A 4C3IH 2HIVA 2DAAA 2K32A 1JCKB 2E2IB 1G2SA 3DHQA 4FYDA 1F2MA 5G3LD 1UC8A 1Z2OX 2L0CA 1DJRD 3UZBA 3MWEA 1F9RA 1FD7D 4K5VA 1WCMB 1GSHA 3PIP3 4MN3A 1UUPA 4K5XA 3TDQA 3BU2A 1VQBA 1JE4A 1YIJA 5M5XH 5ELBA 3R2TA 2K01A 1LT6D 2H4OA 4HJ7A 4C3HH 3BG5A 2R92B 3NBYB 4M9UA 2EY2A 1IHZA 3WO1A 1K8OA 1AUVA 1BBWA 1MIUA 3TW7A 3T9AA 4QIWE 3G7LA 4DR1L 1D5XC 4A3DH 3I90A 4YWLA 5FJ8G 2DIKA 4PZ7A 2FMMA 1CUKA 2NN6H 3RMHA 1HTLD 3GTJB 5LYJF 3T9CA 1XX8A 4YHHQ 4C2MB 4YAKB 3Q1KA 2GLTA 2IPKD 3KJPA 2JQOA 3PO2H 1G2TA 4EVOA 1Z2NX 3Q8DA 4RHSA 3Q2OA 4C3JH 4KJOA 4JCVE 1FL0A 2HQLA 1IW7D 5IGBA 2Z0SA 5CR3A 1WRVA 4ALPA 5ELFA 2RKSA 1EY5A 5EZYF 2MQHA 1E7ZA 3GTKH 3U58A 3OOCA 3S14H 4A93H 4EQPA 3GP7A 2E8GA 3A8KE 3R5HA 1QZGA 5FLXc 1QWYA 4QJFA 3KDFB 2JA6B 5I5UA 2K52A 3SK4A 3JAML 2MO1A 1X3QA 3UE0A 4UCTA 4DV3Q 3H15A 2UXBL 3DLLA 5IT9E 3OW7A 3R9RA 3L2PA 1SNQA 4UFZA 4QY7A 4AIMA 2KEDA 5IOCA 3HOVB 2A6HD 3CHBD 1K8AC 4OGQC 1YHAA 3QQMA 1ONLA 4QF4A 3PFFA 3S1QH 3G6EA 2K04A 4KK7A 4A3BG 4O7RA 1KAWA 2F0OA 1BOSA 1CK1A 1LT4D 5C4XG 3A5ZB 2C9OA 5IGCA 3P1HA 2B63G 3J7ZC 2UXDQ 1W3SA 1IW7C 1A63A 1CKOA 2KHJA 3I8ZA 3KBGA 3KFUA 4O86A 4K6DA 3RUPA 1VQIA 4DV5Q 5DGIA 3BDOA 3TS0A 2H1EA 3HB9A 5HURA 1H9RA 1S68A 3GLKA 2NU9B 1DOMA 3HBLA 1A2TA 2JA5B 3BYTB 3DWAA 5CR5A 2MHVA 2KOLA 1WD0A 1MHWC 2IX1A 4DUYQ 3NK9A 4I4TF 1EIGA 2L15A 3J81j 4IUQA 1YVCA 2A6HC 3JZ6A 4WRDA 1DZ1A 1EWIA 2F0VA 3CCVA 1LTBD 2LXKA 4YHHL 2RHQB 4C3IB 1WTVA 1GUTA 4HN7A 1QVFA 1YNND 1UEBA 3VA5A 1XMQQ 1Q12A 2KA7A 2YU9H 4TQUS 1LT3D 2F52A 5M5XB 4DK3C 3DWQA 1TWGB 2ZXRA 1F9PA 2ATWA 1AH9A 2F0FA 4GLAC 4NZMA 1QVGA 5BWVA 4UP7A 5KKNB 1CI3M 3Q6SA 4X64Q 4A3DB 5CM0A 4BA2I 2M00A 3FRPB 4RH6A 1WTHA 4BY7H 1VQHA 1E3PA 4DV3L 1KLGD 4MTNA 4B3RL 4MV1A 1VQJA 2BH2A 1I50H 1L0XB 1K83B 4DK0A 2WB1E 3U9OA 2NVTH 2FPGB 1OBDA 4LFBQ 4LH6A 1CKNA 2AUKA 4LF9L 5HV6A 4GNXA 4A75A 2B8GA 3R3OA 3CCMA 4ZAIA 2Q8TA 2FPIB 4C3JB 1K3BC 1OXUA 1VMPA 3A7LA 3LWEA 3ZYYX 1Z9FA 1AUXA 3AX6A 2A73B 1TT2A 1V8QA 1PH5A 3AFQA 3K0XA 3NWSA 4JI3Q 4A93B 1MBYA 1UNSA 5IYDH 1EIYB 5BN5A 2UXDL 5BPFA 5E7NA 3H0GH 2KEEA 5JPMC 3N8DA 5GQOA 5IYBH 2GQSA 5I5XA 3KAKA 3GDEA 4HMIA 1X9NA 1TWFB 4DV5L 3U0GA 2L4NA 3SGIA 1B3QA 2RDGA 1NR2A 2YZNA 1EZ6A 1VQAA 5DAUA 3A54A 4FP5D 1P8LA 4HSPA 4KKUA 1X55A 3QIAA 2B39A 1BNZA 1G8ZD 1MI2A 4A3IH 3RTXA 2A1HA 1B3AA 4LF6Q 4B3SQ 2BOSA 2ZDGA 4R8NA 1EY0A 3J80c 4O2AF 3LWBA 1I1LA 1L2FA 1O7ZA 3GTPB 1CSPA 2PO4A 2C5CA 3BG3A 4C56C 4DV0Q 1VQ4A 2EDGA 1VQLA 2D9UA 4JC0A 4DAYB 1XMQL 4A3MH 4K0KQ 3AEVA 4L1KA 4OO1H 5HNEA 3W1BA 4IUTA 1U5KA 1CQJB 5IT9L 1TKWB 1JOKA 4LF7Q 4A3CG 3J81i 4FXKC 2YYAA 1V9PA 2VB2X 3KUPA 3MXNB 1DV1A 1MKHA 2C35B 3MEHA 1Q8IA 3A74A 3G48A 3HKZE 4K2LA 1KRSA 4QUCA 1GOZA 4MTKA 4DXGA 4NXNQ 5J1ZA 3OMGA 2HUGA 3TP7A 4X64L 2D0OA 4TVIA 2E74C 1ZEQX 2PNRC 4LWCA 5FPOA 2JN4A 4XT1B 5LMNL 2EY1A 4WORA 5H80A 4FF3A 3KREA 1MD2D 3HZXA 3V2TA 1IOVA 2FMCA 2NYZD 1PYBA 1RF2D 4JPBW 4G7HC 1UEAB 1N36L 4A3LH 2QDLA 4FXDA 4RMFA 5FO7B 1Y8PB 5HBRB 4KV6A 2YZMA 3T1HQ 4RAUC 4JI3L 4TUYF 3NTHA 5JEAG 3I4MB 1S5ED 4IPDA 4QB4A 5C44H 1JJ2A 1P16A 3PCOB 3UE1A 4ID6A 4DA2A 2EYJA 3CRLC 1C4QA 3VA7A 5IIFA 5JVLA 2RSOA 4BY7B 4OX9L 2NN6I 2DN8A 1SNPA 4DIMA 2I80A 2NTTA 2PZUA 4HCEA 1V1QA 2FB9A 4EQNA 2NVTB 4IHJF 2R61A 2HDMA 2JK8A 3DEOA 4BBRG 3GJXB 3OIQA 3TIGA 1WCMG 2G9HD 1N34Q 1PTOF 5LP6F 3K80C 4NW2A 2DNEA 3DTGA 4LF6L 4B3SL 4QUFA 4A4IA 5LA6F 4ZI7F 2GPSA 4DV1L 5EGTA 2R92G 3DWPA 5CA1F 5EKKA 3PUZA 3SK8A 1RDPD 3H0GB 3KK7A 4ME3A 4DV0L 2JA8H 4UP9A 5I5VA 2JA7H 4K0KL 4IUNA 1EOTA 2CKZB 2MP1A 4TVAB 3F8TA 1JMCA 5M3FH 1N33Q 1TA8A 3K3PA 1KEEA 4K2KA 3GTQB 2CHBD 4IALA 2COJA 4GLWA 1UE7A 1KABA 1ILQA 1XK5A 1NMGA 2E5LQ 2EJ3A 3J7A5 5C3EB 4LF7L 3U54A 1PH8A 2HT1A 1TS4A 2Q2UA 3GTGH 1QZHA 1PH3A 1KTAA 2EJGC 1SNCA 2F03A 1TY2A 2M9VA 3PMFA 4DKAC 4NXNL 1VQNA 2Z8LA 2R93H 2XSCA 1OXSC 3LWUA 1YITA 1E2WA 5C0XG 4GKJQ 3TW6A 5K3WA 4G4KA 5EBDA 1PH4A 4A3JH 4N8FA 5D1OA 1V1OA 4JV5L 4FO2A 1BCPD 1AE3A 2E2HH 5DAAA 1SFOH 2JA6G 2CWPA 4A3MB 1D1IA 1GD7A 4J15A 2VB3X 3SDZA 3CCJA 3DUZA 4IOCA 2Z02A 4A3GH 3E9IA 2PYKA 4GN5A 2ES2A 4F7XA 3T1HL 1Q90A 3TP5A 4G7ZC 5IGEA 1HFNA 4M1UB 1FNUA 1LO5D 4PG3A 3HOVG 4X65Q 3HOXH 3PUXA 1CHQD 1G6PA 1FGUA 3NSWA 3MWDA 2EJMA 1LTSD 2KHIA 2LS01 4EQOA 5FOBB 3NUAA 4UCUA 4LMQD 1HA5A 3RLFA 1TS2A 3M7NA 4I65A 1Y1VG 1DXMA 1WOCA 2HCCA 3KLSX 2EZVA 4I7AA 3D31A 1NSNS 1PXUA 4X62Q 1F2LA 1I2KA 5BR8L 4P71A 3TN2A 3M7GA 1VQKA 1N34L 4O7LA 2PN1A 3MC0B 1BCPC 3MZ5A 3OWFA 5CE8A 3VPBA 1MSGA 4F88A 2JA5G 1VDZA 3WOEA 2VY3A 4YAJB 4FGRA 3OTOL 2HVQA 1ZAUA 5C5MA 5C44B 4AYBE 4O0AA 4XTCS 1NE3A 1W6JA 4P73A 4XIGS 1I1MA 3CEBA 1EY4A 1IYJB 1S4ZA 5KNDA 5KYLA 3S1NB 2CNQA 1AZPA 3N52A 3TY8A 4C3IG 5BWWA 4J6HA 5FNVF 4XQJA 2NU7B 1QUQB 3NXWA 5HGTA 5IY0A 1IZ6A 3NBZB 4HQ6A 1NCVA 2OXPA 4RFBA 4BY1B 4TV8F 4LJZC 2IY5B 1J8IA 1KDCA 2L1BA 4GKJL 1U0LA 4UPAA 2NZOA 2KCCA 2KENA 1YHBA 3STBC 2DY7A 2D0PA 1EQRA 2KBNA 5I4DA 4XQNA 4LF8Q 2JA8B 5BN4A 2V5AA 3CU7A 4R4CA 1YJWA 2F0UA 2PMZE 4A3DG 4HAEA 4RA8A 2JA7B 3PN1A 2I5LX 1EUCB 3CKIB 4JBMA 3VR4A 1F9SA 4XYMB 2XNAC 3VPCA 2W71A 2MJ8A 4UUGA 3VR2A 1S3OA 4KN4C 4TV9F 1PV4A 3DM1A 5LHY1 4MV7A 3ETHA 4X65L 4C3JG 1PYWD 5CYUA 2UXCL 2PPBC 2R93B 1PTOB 1X3PA 1Q1EA 5C5LA 4HJ5A 2Z4IA 2N49A 2VUGA 3KF8A 3I4NB 2A69D 1IYUA 2GVAA 4Z9CB 4B3TQ 2E75C 1G2WA 1CKNB 2IHFA 5CV7A 1PK8A 2R6GA 1JWSD 2F0EA 2K5QA 2QEXA 1BO0A 2EY6A 4GNXB 1IBMQ 5EQ0A 3L7ZC 5IT9c 2SCUB 5K2MA 4L5QA 5ELCA 2RSNA 4X62L 1B7YB 1ESRA 3EA6A 3S15B 1JB3A 2PCFB 3R2IA 4CDFC 1PH6A 4DFAA 5J2UF 4OO1I 1VS0A 1M0WA 2WAQB 2XTIA 2ICIA 5CGKA 1A0IA 1W6KA 2IHEA 3A5UA 4ABNA 1BBUA 1STHA 5IYCH 2AWNA 2NBFA 3FKIH 2EOTA 3A7AB 2IT1A 4DAYA 4YWMA 3PV0A 4IPGA 4UP8A 4HIOA 2E2HB 2HD3A 3P7JA 5C4HA 5CV5A 5C8YF 4BBSH 2R7ZB 1LYLA 4DNRB 2QK4A 3CXCA 3T1YQ 2DY8A 2F3IA 2SEBD 3TMEA 3HO8A 1GXDC 4O7TA 1HH2P 1U4PA 2F4IA 1IBLQ 3L0OA 3M3YB 2N8NA 1IBKQ 1QNKA 3K5IA 4U68A 1DD2A 1UE1A 1SRUA 3G4SA 1C9OA 1LV9A 1GHJA 1GUSA 3GD7A 3T51B 3I3CA 3PF4A 5LL6S 4Y52H 4MV4A 3QO2A 1IYDA 5HY6A 2IP4A 3K5OA 4BA1I 1U9RA 2YTXA 4ILWA 4X3UA 1QE6A 2R7FA 3QFFA 3P75A 3ORRA 3RLOA 5JVH3 3PUWA 5T1GA 3S17B 4X3KA 3RZOH 4AH6A 3CMEA 4MIUA 5C4ZA 5GONF 5BMVF 4WFN3 1E24A 3I91A 4H02A 2VUMB 1EZ1A 1ULZA 4CE5A 4N8X1 5E1FA 1W2BA 3D6WA 4MV8A 2KQ3A 1XPOA 1LM0A 4B3TL 5BWTA 1KUTA 2DUDA 3NTIA 3CCQA 1PYSB 1LTRD 4C1NI 3CSWA 3I4MG 5FK9C 1IBML 3ZJYC 2F0GA 3ULLA 2J0TD 5IGGA 3S2DB 1EFID 3E0EA 3TIIA 2E2DC 3NQIA 1EYZA 2E76C 2PZTA 1U4MA 2R7LA 3T16A 4BY7G 1BBXC 1AZQA 2F1MA 2NUCA 1CKMA 2QDBA 1JC7A 3TINA 2B2TA 4CKCA 2W6OA 2IWHA 1BKBA 4HSVA 4YBZB 2RDHA 2VL6A 1YNJC 5EPLA 5JQGF 4EQ5A 3VR3A 2YV5A 4K6LA 5G3LF 3V05A 5IODA 2K33A 4LF5L 2MFIA 1ZYRD 1DYQA 4X66Q 2I5MX 4O7VA 5C1PA 4L5SA 1O80A 5EPKA 3AQQA 3Q22A 2KUMA 2RCFA 3ND8A 5AFWA 1ET6A 3T1YL 1EIFA 2ZTEA 5CBAE 5IYDG 3H0GG 4KLKA 2EVBA 1WI5A 4O4IF 1IBLL 1X54A 3BZDB 3C2PA 3WNZA 3KLSA 3SEBA 4UY8C 1IBKL 1EKPA 2WFWA 1D7QA 4UCSA 1PZKD 2RF4A 1F2ZA 5C4JH 3GTLB 3EJIA 5C3XA 5C3EG 4E4TA 1CE8A 1GM5A 1EUJA 3MVVA 1SYCA 2WB1B 2K50A 4PMBA 2NTSA 1WTQA 1LUZA 1NR4A 4ZK9B 1A3UA 1B9NA 2SOBA 3HKSA 5TSSA 4BBSB 2NVXB 1O7LA 1D1KA 3K8AA 2EYLA 3N6RA 3GQBA 1S40A 4O7NA 2I46A 4Q0FA 4JI1Q 3M85A 1H9MA 2BH8A 2JSOA 3RZDH 1HHVA 1GGOA 4IURA 1J5EL 5DM63 1LTAD 2W6MA 1VQ6A 4NZNA 3K0YA 2WKCA 4KY5A 4APVA 4B3RQ 5BWRA 1YJNA 1T5XD 2AQ1B 4CJ0B 2K5HA 2YL2A 5D1OB 4HEDA 1UE5A 2EJFC 4RGMA 4LF9Q 4O81A 1GUNA 2BA0A 3R5XA 2O5JC 5I5YA 4GN4B 1K3RA 3NBHA 4IQZA 4C5BA 5C1OA 4A3KH 3NWTA 1SE2A 1K28A 3D4WA 1DGSA 4HMJA 5M5WH 1I6HH 2Y0SG 4R4IA 3AYHB 2GVBA 1EYGA 4RHRA 1VQ7A 3BACA 2ZXOA 1EY9A 5LMNW 5IP9H 1STBA 2J4XA 1G91A 3VMMA 4IFDG 4DAVA 4UDUC 4QGUA 1Q46A 4X66L 1EIHA 3IFDA 1C7YA 1FVIA 2AKWB 5ELEA 3VDYA 3TP8A 4XX0B 1KBLA 3GV6A 3CQZB 1KNAA 5A35A 1UC9A 4MV3A 4DR7Q 3VOTA 4HCSA 4J1MA 5K36H 3LP8A 2F0LA 1QUQA 5CORA 3D4RA 4NYEA 2ZDQA 5M3MB 1CQFA 4R1JA 3HKZB 3D4DA 4LW1A 4DR3L 4RGNA 2UUBQ 2AQ3B 1QB5D 4M8AA 4K14A 4UAIA 1I2LA 1KC8C 2PW5A 4DUZQ 1E22A 4O42A 4YJ3F 3K5MA 1Z47A 1PFNA 5FLMG 4FFNA 2CQAA 3JRWA 1CS0A 2MPMA 5IGDA 3J80i 3E5SA 2COGA 4CDEC 2IJ0A 2R3ZA 1LABA 3MEFA 1FGBD 1WFQA 1PFSA 4BY1G 5CB4F 3CCUA 3AU7A 1I5FA 3U4ZA 4CKBA 1KIXA 5CV8A 4C3HB 4JI4Q 3PIO3 1HRJA 3VYRA 2F0SA 1C3OA 1AP0A 1RKNA 4JI1L 5EAYA 1A48A 3NQTA 4LUVA 4R4QA 5IWAQ 5JVDF 1TS3A 5M5YH 4I50F 2JA7G 4A76A 2B8FA 5J3BA 1NMFA 2YW2A 4JI6L 2ZDHA 2UUAQ 5LMNQ 2WKDA 1Q1BA 3EVQA 3I4LA 3PIPA 5C4JB 1A8VA 3K5HA 1VQPA 4JYAQ 2R86A 2ZJRA 3RLNA 5FO9B 5IP7H 3PO2B 2PBZA 1SN8A 4ZUJA 3PO3H 1N36Q 4YCWA 1N8RC 1SMYD 3MTSA 1KAAA 1YNNC 4IPHA 3QWUA 2SNSA 4YWKA 1HZBA 3I4NG 2BCOA 3GTKB 3S14B 1PHJA 4CC5A 4IJLA 3MA2B 1CZGA 1NAPA 3BAAA 3A55A 3HOWG 1H95A 2EIYA 4PQXA 3MJFA 1YJ9A 4L5RC 4C5AA 3QJYA 2B2TC 2XCLA 1LLRD 4ZYSA 2YRXA 2CWAA 5J39A 1E4EB 3K59A 2X6GA 4JI2Q 3KF8B 4OX9Q 1F77A 1JICA 2HHHQ 2WAQG 1XXGA 4RKLA 3R93A 4JOIA 2Q7DA 1SJHD 1DOKA 5J22A 2V4DA 5EJWA 3HRZC 1YI2A 1OBGA 2RDFA 2L55A 4DR7L 1HCZA 3T53B 1XNRQ 2W6NA 2JP1A 3V96A 4A3KB 3S1QB 2DABA 4EEQA 4GZYC 4F87A 3I56A 5I47A 3OPOA 4UHVA 2UUBL 5FJ8H 5M5WB 5JJIA 2R7ZG 1I6HB 4DV1Q 3JRXA 1X65A 4DUZL 4L8JA 2OT2A 1SMYC 4B9WA 3Q23A 1AEXA 2N88A 1NTGA 2VXWA 1KC7A 2Y4RA 2B3GA 5CV4A 2CCZA 5C6AA 2KHSA 1Z2PX 5D8DA 1CA6A 4O82A 3FPUB 1TWHH 2JE6I 1XDNA 4JK1C 5COYA 2K7VA 3GTOH 5EKLA 3PUYA 3UQ8A 4Y7NH 2ZM6Q 3UDGA 2PI2E 3AFPA 5IYZF 2JEAI 2RVLA 4JI4L 3I72A 2LSSA 3VR6A 3J7AF 3A8JE 3K81C 2IX0A 4O4LF 2NVYH 1SCUB 2PVPA 5IWAL 3HOUH 2BE5D 5FKAC 1BQQT 1Y1WH 3BYYB 1NJIC 3S1MH 3FMCA 4LUOA 3TQTA 5I6YA 4DNIA 2UUAL 1SYBA 4JYAL 3NUCA 3D8GA 4JV5Q 1D8LA 5CV9A 1IOWA 1GUWA 1T9HA 5JJLA 1JDBB 2YU9B 2VUMG 3WO0A 1VBGA 3QG1A 3D3RA 4A3BH 1HPCA 5NUCA 1HJPA 5C4XH 4A3EH 1KJJA 3LGJA 3I4OA 3FDTA 1EU4A 3UDIA 1FJGL 2B2UC 4KHPQ 1KDAA 2K28A 2XIWA 1SJED 3DEPA 3X3MA 3VPDA 2ZGIA 2A6ED 1GHKA 1BVSA 1F2YA 3RNUA 1E1OA 4AYBB 4E6IA 4JI2L 5JOBA 5KIXA 4JI7L 1PRTD 2QA4A 2HHHL 5C0XJ 1I50B 5DM73 1EWCA 4RCOA 1CTMA 1XWEA 4UCVA 1A0GA 4YY3Q 3I12A 2GPWA 1RD9D 5BR8Q 3PO3B 1EQQA 3TZUA 1XNRL 1JWUD 1SNOA 3PIOA 4PZ8A 3DAAA 4O7ZA 1PX2A 1SNMA 2VW9A 3PUVA 2XRSD 4JI8Q 3UYYA 1LTLA 2RCNA 2SDFA 1FR3A 5C3WA 3JAMc 3WWIA 4XT3B 4KKSA 1SAPA 1J6QA 4FFPA 5A2QE 3ITPA 4QL5A 3OTOQ 4KMUC 3GV3A 2AWOA 3S9WA 3U9SA 5LXTF 5EPJA 3ND9A 4B9XA 3T99A 3T54A 5KNBA 2PMZB 3NEMA 4IOAA 1B6RA 2ZM6L 3GO5A 1UWVA 2J7ZA 2VQFQ 3F2DA 2HQEA 2A74C 2G5DA 2WB1G 2Z4HA 4PZ6A 3M4QA 1GKHA 1IL2A 4R8IA 3L3OC 2F0WA 4FFOA 2RHSB 4A3IB 1ASYA 4OWWB 3ONAB 4XXEA 3KF6B 1Y14B 4MV6A 4ODGA 1EY6A 4BBSG 4G7OC 2Z6BA 3WWJA 1VBHA 4EG0A 4OEMB 3TZDA 2KCNA 2PQEA 1RJTA 2K03A 3O13A 3BVMA 5JJKA 2F0IA 3FP9A 1VKZA 4CMFA 3ETJA 2BA1A 1BCPF 1KJ9A 5I5SA 3OW2A 4HTPA 4ZRZA 1HA6A 2NZ1D 3U9TA 1G51A 1TQOA 3GTOB 4Y7NB 1EZ8A 5IGFA 1GSOA 4PNYA 3M4OH 2PQAB 2DLNA 1LTGD 4XQQA 3RN5A 4KHPL 2NUAB 2UXCQ 2F0JA 1CZWA 3HOUB 1I7NA 1VQDA 1Y1WB 2EE1A 3SE0A 4LF4Q 4KHVA 2R7NA 4O7SA 1VF7A 4PBCA 1EY7A 4JOIC 3T56B 4XYOA 4YY3L 2K05A 3NBHB 2Z9HA 2I5HA 4JW0A 2ZXPA 1PH9A 1PVOA 4NZOA 1A9XA 1OXXK 3EQLC 1B4OA 4TSSA 4JI8L 1HQRD 1VCIA 1KXLA 4DNTB 3C1FA 4A3BB 3MWYW 4A3EB 1EHIA 1A6XA 2HHFA 1OTCA 3JZFA 1LACA 1GUOA 1C48A 1EKVA 2YZGA 2JYOA 3BZKA 2QW7A 1M8AA 1NBWA 1EWHA 5M3MG 1GVPA 1Q86C 1RL2A 3BDCA 3JC66 3CMAA 3PF5A 4DAPA 2B2WA 5DLQE 1KL9A 4FFRA 1SE4A 1N32Q 5KYIA 2YTVA 1M1KC 4DK1A 2VQFL 2ID0A 4HTHA 1XPUA 2X6LA 1UAPA 5D3IB 4A3CH 1B04A 4LAAA 2DGYA 4JI5L 1I4GA 4KI0A 1R4QB 3NPPA 1JB7A 4HN2A 4DV6Q 1T36A 2P5ZX 2F0QA 1E0BA 5J2TF 5AJ3L 2EQSA 1CQVA 4H13C 2N78A 2HGSA 5E3FA 1L0YB 2WV6D 4C3HG 1DONA 2QB5A 5EBCA 3S16H 1W93A 1H9SB 4K6NA 1IXRA 3JZIA 5M3FB 4LFCQ 4ULLA 3X3NA 1OXTA 1Y8OB 2KCTA 3K58A 1H9JA 2NN6G 4IPCA 1AN8A 2YRWA 3TSSA 4RWSC 2ODTX 3TY9A 1I4XA 5GAEC 4OXPA 3SR1A 3GTGB 1PZID 3PO2G 3G6JB 1TVXA 4GOPC 3BVGA 3S1RH 4ZKCB 1KJ8A 1RODA 5DEHA 3RV4A 1YBYA 1E4EA 5GROA 4CDCC 4KJNA 1R4PB 1QJOA 4IZOA 4JG2A 1K8GA 4LF4L 3I55A 4A93G 4OIKA 1S72A 5A2QL 4A3JB 1RTNA 3OUUA 2BDNA 2PW7A 2Z6KC 1A3VA 4B3ML 1SFOB
chains in the Genus database with same CATH topology
3AFQA 4POFA 1VQOA 3J81c 3K0XA 1GM5A 1EUJA 4JI3Q 4BBRH 2D62A 2K50A 1HZ9A 1WCMH 1EIYB 4YCUA 2UXDL 5IYDH 5E7NA 3H0GH 1LUZA 4GS3A 5GQOA 4HJ8A 3HKSA 5IYBH 1NY4A 1SE8A 3GDEA 5D1PA 1X9NA 4DV5L 4JBWA 3K8AA 3B6YA 3ULPA 2R92H 3SGIA 3CC4A 1S40A 3KDFA 3I7FA 1K73C 4JI1Q 3M85A 4LF5Q 1MJEA 3RZDH 2BH8A 4JI0Q 1VQAA 4P75A 3I4NH 1PH7A 1J5EL 1B70B 1P8LA 2OTLA 4AQYQ 4GKKL 4UCOA 1VQ6A 1N32L 1X55A 3M9BA 4APVA 4B3RQ 1YJNA 3HOWH 1WJJA 3KYHC 3K7UC 4A3IH 4C2MH 3RTXA 4GNXC 2K5HA 4OWTB 3S15H 4LF6Q 4B3SQ 5D1OB 1UE5A 4LF9Q 5IP9G 2K75A 3U4VA 3BJUA 2BA0A 4MNOA 3J80c 3S24A 4GN4B 1K3RA 4DV6L 1L2FA 5LMUL 4A3KH 1V43A 1CSPA 1K9MC 4DV0Q 1VQ4A 2Y0SE 4DR2Q 3U50C 1VQLA 1DGSA 4B3MQ 4JC0A 4DAYB 3F2BA 4A3MH 2PI2A 1XMQL 1KQSA 5M5WH 1MJCA 1XMOQ 4K0KQ 2YYZA 2CFMA 1I3QH 3TREA 1I6HH 2Y0SG 1PA6A 2JEBI 3AEVA 3PGZA 3W1BA 1U5KA 2KCMA 4R4IA 1L0WA 4DV7Q 3AYHB 2GVBA 1EYGA 1VQ7A 2MNAA 4LF7Q 3NENA 5LMNW 5IP9H 2JA6H 3J81i 2PNHA 3HOYG 4LFCL 4A3CG 4DR6L 4DR4L 1V9PA 2R7ZH 3MXNB 1HNZL 4IFDG 5IE8A 3HFZB 1MKHA 2C35B 3ERSX 3A74A 3G48A 3HKZE 1HNXQ 4NXNQ 1KRSA 4QGUA 1Q46A 4P74A 4X66L 2MO0A 4LH7A 3OYYA 1L1OC 4DV2Q 1GO3E 1FVIA 4X64L 2D0OA 1C7YA 3M3YH 2AKWB 3HKZG 3VDYA 3HOVH 3KLWA 1J5EQ 4E6NA 4LWCA 5FPOA 3H3VH 5LMNL 4DR7Q 3STBD 3RN2A 1EOVA 1X3EA 2Q2HA 1QUQA 5H1SE 4DK6C 4JBJA 2OCEA 4R1JA 3HOYH 4LW1A 4DR3L 1PYBA 2UUBQ 4X6AH 4GLVB 4CC6A 1Y1VH 1JJGA 1KC8C 1N36L 4A3LH 3EBEA 4DUZQ 1E22A 4RMFA 3NELA 1A62A 1Z47A 4NB3A 4HJAA 1JT8A 5FLMG 2GN5A 3T1HQ 4DAMA 4HIKA 4R4TA 1N33L 1JJ2A 4JI3L 3KJOA 5JEAG 4AYBG 3J80i 4IPDA 3S17H 1QVCA 1TXYA 4R4OA 5C44H 3MEFA 1WFQA 4BY1G 1PFSA 4GOPB 1P16A 1YNXA 3CCUA 3PCOB 1I5FA 3U4ZA 3UE1A 1VQMA 1PH2A 1XNQQ 3ICEA 5IP7G 1PH1A 1RIPA 1KIXA 2JA5H 4DR4Q 3PO3G 4JI4Q 4OX9L 2QGQA 1HNZQ 2VUMH 2NN6I 4JI1L 5EAYA 1V1QA 4LUVA 1Q81C 2XGTA 4R4QA 5IWAQ 4NXMQ 5M5YH 2NZHA 3CCEA 4A76A 2JA7G 5J3BA 4AQYL 1NMFA 2UU9Q 2JK8A 4BBRG 3GJXB 4RG1A 4JI6L 1WCMG 5LMNQ 1N34Q 2UUAQ 1Q1BA 2FXQA 2VZAA 3PIPA 3S2DH 3CAMA 3K80C 4BXXH 1A8VA 4EFEA 1VQPA 4JYAQ 4LF6L 4B3SL 5IYBG 2ZJRA 3RLNA 5IP7H 1TAEA 2VNUD 4A4IA 2CQOA 3TQYA 2HIXA 4HIDA 4DV1L 1SN8A 4DR3Q 3PO3H 2R92G 3PUZA 1N36Q 4YCWA 3KF6A 4ME3A 2E2JH 1N8RC 4DV0L 2JA8H 4UP9A 4DR2L 1K0RA 2E2IH 4IPHA 4HJ9A 1TWAH 4YWKA 1HZBA 1TWGH 2JA7H 3I4NG 4K0KL 1XMOL 2CKZB 4TVAB 1HR0W 3F8TA 1JMCA 5M3FH 1N33Q 1TA8A 1PHJA 4CC5A 4IJLA 4GLXA 2OQ0A 1JE5A 1UE7A 4DV7L 3BAAA 3FHWA 1H95A 3HOWG 1XK5A 4EFBA 1YJ9A 4L5RC 1NMGA 4A3IG 2E5LQ 1OXVA 4JBKA 1YEZA 3PSIA 4LF7L 3J7A5 3TRZA 4IFDJ 2F4VQ 3F2CA 1PH8A 1VQ8A 2CWAA 2Q2UA 2HT1A 1QZHA 1PH3A 2WAQE 3GTGH 3JSNA 4JI2Q 4DR5L 4DKAC 3KF8B 4OX9Q 4NXNL 1HNXL 1HR0L 2EIFA 2A19A 1VQNA 2HHHQ 4A3KG 2WAQG 2R93H 1K83H 1JJCB 1SROA 4JOIA 4DV2L 3RR5A 1OXSC 2PQAA 1YITA 3BA9A 5C0XG 1YI2A 1XTDA 2WP8J 4GKJQ 4A3MG 1C0AA 4DR7L 4OO1G 1XNRQ 3GTJH 1PH4A 4A3JH 4JI6Q 4GN3B 5D1OA 5GADC 4JV5L 4EEQA 3GTLH 3ER0A 3I56A 1AE3A 2E2HH 1N9WA 1SFOH 4PMWA 1KHIA 2CWPA 3IRBA 1KRTA 5FJ8H 2UUBL 2JA6G 1GD7A 1VQFA 5JJIA 2R7ZG 3W1GA 4J15A 4P72A 3CCJA 4DV1Q 4IOCA 3CCLA 1X65A 4A3GH 3E9IA 4DUZL 4GN5A 3I2ZA 2ES2A 3EN2A 3CC7A 5GAGC 1NTGA 3T1HL 3HOUG 3QWUA 2B3GA 2CCZA 1Y1WG 4PG3A 1TWFH 2NVXH 3HOVG 3ULJA 2UUCL 2HVSA 1TWHH 1L1OB 4X65Q 2JE6I 3HOXH 4LNQA 3EIVA 3PUXA 2E5LL 3NC0B 5K36G 1G6PA 1XDNA 1FGUA 4QQBX 3GTOH 3PUYA 1XNQL 2A1AA 4Y7NH 2KHIA 2ZM6Q 3UDGA 4DR1Q 2PI2E 4UCUA 3AFPA 3UQ8A 2JEAI 3CPFA 3RLFA 4JI4L 1X6OA 2LSSA 3M7NA 4IFDI 1Y1VG 4DR5Q 4KHZA 1WOCA 3K81C 2IX0A 4A3LG 1HR0Q 1HZCA 2NVYH 3D31A 5IWAL 4FDBA 4NXML 3HOUH 4X62Q 1XPRA 1UE6A 1Y1WH 4WJ3M 2UU9L 4POGA 5BR8L 1NJIC 4A3EG 4P71A 3WWVA 2ZJQA 4LUOA 3CW2C 3S1MH 4WJ4A 1VQKA 4DNIA 2UUAL 3VNNA 1N34L 3HOZG 4LF8L 2VS1A 2OWOA 3G71A 3GTPH 5C44G 4JYAL 4JV5Q 2JA9A 1D8LA 2K5VA 1T9HA 2JA5G 5JJLA 2VY3A 4YCVA 2VUMG 3OTOL 2HVQA 1E1TA 4AYBE 2Q2TA 4O0AA 4XTCS 4A3BH 2AMCB 2VQEQ 1NE3A 4P73A 1AE2A 1HJPA 4XIGS 5C4XH 2ZTCA 4A3EH 3CD6A 3TY5A 2UUCQ 2OTJA 1IYJB 3LGJA 3HOZH 3I4OA 3UDIA 3TY8A 1FJGL 4KHPQ 2UXBQ 3JSLA 3KOJA 2F4VL 4A3FG 1BVSA 1EFWA 1QUQB 2K14A 3RNUA 1E1OA 4L5TA 2H5XA 3CQZH 3CCRA 5IY0A 1IZ6A 2I0QA 4JI2L 1Q82C 4JI7L 3NBZB 2QA4A 1SMXA 2HHHL 5C0XJ 2OQKA 3TS2A 2B29A 2JA8G 2IY5B 4UCVA 1VQGA 5M3MH 3CP0A 4YY3Q 4GKJL 1VQ9A 5FPRA 3D0FA 2ALYB 1U0LA 2ZTDA 4UPAA 2NZOA 5BR8Q 5M3FG 2KENA 4NPSA 1EQQA 1M90C 1YHBA 3STBC 1XNRL 3PIOA 2D0PA 1EQRA 1WYDA 3W5OA 1X56A 2KBNA 4PZ8A 4LF8Q 4UCRA 4C3IH 2VW9A 2HIVA 3PUVA 4JI8Q 4R4CA 1YHQA 1YJWA 2PMZE 1LTLA 3UDFA 4A3DG 3PN1A 2I5LX 2RCNA 4A3FH 3JAMc 3CCSA 3A0JA 1J6QA 3I4MH 4JBMA 3BU2A 4QL5A 1VQBA 3OTOQ 3BZCA 2R93G 1X3FA 2AWOA 2K5NA 5M5XH 1YIJA 1HNWQ 3M4PA 1S3OA 3DM3A 1PV4A 4HJ7A 4X65L 4C3HH 3NBYB 5GAHC 4A3JG 3NEMA 2UXCL 5ELOA 4IOAA 1BBWA 1MIUA 1FJGQ 1Q1EA 4QIWE 4HJ5A 2ZM6L 1UWVA 2N49A 3GO5A 2VQFQ 4DR1L 4A3DH 3F2DA 3F1ZA 2VUGA 2GVAA 2YTYA 4B3TQ 4YWLA 5FJ8G 4LFAQ 2WB1G 4PZ7A 1CKNB 1GKHA 2IHFA 3M4QA 1CUKA 4PZ6A 2R6GA 4GNXB 4JI7Q 2QEXA 1IL2A 1IBMQ 4A3GG 5HGQA 4DV4Q 4YHHQ 3L7ZC 5IT9c 2RHSB 1ASYA 4L5QA 4X62L 4HTOA 4OWWB 1B7YB 5C0XI 3GTMH 3KJPA 2JQOA 1Y14B 3KF6B 3PO2H 4BBSG 3Q8DA 1PH6A 1ASZA 4C3JH 1SR3A 4JCVE 3HOXG 1FL0A 4OO1I 1VS0A 2HQLA 2XTIA 1Q7YC 5DISC 2A8VA 1A0IA 2Z0SA 5JJKA 2IHEA 3A5UA 4ALPA 3FP9A 2MQHA 1E7ZA 3GTKH 2BA1A 3U58A 1BBUA 2V1CC 5IYCH 2AWNA 4EX5A 3OW2A 3GTQH 4HTPA 3S14H 4A93H 3FKIH 1VQEA 2E8GA 2IT1A 4YWMA 1G51A 3PV0A 4IPGA 5FLXc 4UP8A 4HIOA 1QZGA 5JEAJ 5C3EH 2VQEL 1L1OA 4QJFA 3KDFB 2K52A 4BBSH 3JAMi 3M4OH 1LYLA 2MO1A 2PQAB 3UE0A 3CXCA 3T1YQ 4UCTA 4DV3Q 4DUYL 3H3VI 3H15A 1YZ6A 3DLLA 3RN5A 2F3IA 4KHPL 2UXCQ 2UXBL 3L2PA 4DPGA 1HH2P 4UFZA 4QY7A 1VQDA 1IBLQ 3L0OA 4AIMA 3CPWA 4JI0L 4LF4Q 2N8NA 1K8AC 3TEHB 1YHAA 1VQCA 1I94Q 1IBKQ 4JOIC 4HIMA 1UE1A 1SRUA 4IO9A 3S1QH 3G6EA 3G4SA 1C9OA 4YY3L 3NBHB 4A3BG 1KAWA 3GD7A 2I5HA 1PH9A 3PF4A 2NVQH 5C4XG 3A5ZB 4Y52H 1PVOA 2B63G 3J7ZC 1OXXK 5HY6A 1W3SA 2UXDQ 3BA8A 1A63A 3BABA 1CKOA 2KHJA 4JI8L 3KFUA 4DRFA 1VCIA 1KXLA 4BA1I 2YTXA 3E9HA 1VQIA 4DV5Q 2R7FA 1OTCA 3RLOA 3TS0A 3PUWA 3BZKA 1Q8KA 3RZOH 4AH6A 3CMEA 1HNWL 4OONA 3GB8B 1NBWA 3CF5A 1S68A 3UDXA 5M3MG 1GVPA 1Q86C 1RL2A 3JC66 3CMAA 3PF5A 1VQ5A 5DLQE 4GKKQ 1E24A 1CSQA 1KL9A 2Q2IA 4GOPA 1SLJA 4H02A 2B63H 3S2HH 2IX1A 4DUYQ 1N32Q 2YTVA 1W2BA 2L15A 3J81j 2VQFL 1M1KC 4LFBL 2ID0A 2HVRA 1XPUA 4IJHA 1XPOA 1LM0A 1YVCA 4B3TL 4A3CH 2DUDA 1B04A 4JI5L 2DGYA 3CCQA 1PYSB 4LFAL 1EWIA 3CCVA 4KI0A 5ELNA 3I4MG 1IBML 4DV4L 2LXKA 4YHHL 1TWCH 2RHQB 3ULLA 3ZJYC 5LMUQ 2ZJPA 4DV6Q 1JB7A 3E0EA 5AJ3L 2EQSA 2LXJA 2Z6KA 1QVFA 1UEBA 2N78A 1XMQQ 1Q12A 4BY7G 3CC2A 2YU9H 1CKMA 4TQUS 3S16H 2F52A 2AHOB 2EXDA 1X3GA 1B8AA 4DK3C 1BKBA 1IXRA 3K7AH 2ATWA 4LFCQ 1AH9A 2VL6A 4DR6Q 4LUZA 1OXTA 2KCTA 4EQ5A 4GLAC 2YV5A 2NN6G 4IPCA 3S1NH 2JJQA 1QVGA 4LF5L 2MFIA 4X66Q 2K4KA 4UP7A 5FLMH 2I5MX 4BXXG 3TY9A 2R7DA 4X64Q 5GAEC 4L5SA 4OXPA 4BA2I 3PO2G 3AQQA 2ASBA 4GOPC 3T1YL 3S1RH 4BY7H 1XJVA 1VQHA 1E3PA 1EIFA 2ZTEA 4MTNA 5IYDG 4DV3L 4B3RL 1VQJA 3H0GG 1R9TH 1I50H 2BH2A 4KLKA 1YBYA 4BY1H 5GROA 2NVTH 2WB1E 1WI5A 1IBLL 4LFBQ 1KD1C 1CKNA 4LF9L 4JG2A 1K8GA 1O7IA 4LH6A 1X54A 4O2DA 4GNXA 4LF4L 3I55A 4A75A 3CCMA 4OWXB 4JI5Q 4A93G 1G291 5IYCG 1I94L 2N3SA 1IBKL 4UY8C 1HZAA 3FKIG 1S72A 1OXUA 2WFWA 1D7QA 4UCSA 1Z9FA 2RF4A 2Z6KC 4MZ9A 5C4JH 4B3ML 5AJ3Q 5C3EG 1PH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AFQ A;  4POF A;  1VQO A;  3J81 c;  3K0X A;  1GM5 A;  1EUJ A;  4JI3 Q;  4BBR H;  2D62 A;  2K50 A;  1HZ9 A;  1WCM H;  1EIY B;  4YCU A;  2UXD L;  5IYD H;  5E7N A;  3H0G H;  1LUZ A;  4GS3 A;  5GQO A;  4HJ8 A;  3HKS A;  5IYB H;  1NY4 A;  1SE8 A;  3GDE A;  5D1P A;  1X9N A;  4DV5 L;  4JBW A;  3K8A A;  3B6Y A;  3ULP A;  2R92 H;  3SGI A;  3CC4 A;  1S40 A;  3KDF A;  3I7F A;  1K73 C;  4JI1 Q;  3M85 A;  4LF5 Q;  1MJE A;  3RZD H;  2BH8 A;  4JI0 Q;  1VQA A;  4P75 A;  3I4N H;  1PH7 A;  1J5E L;  1B70 B;  1P8L A;  2OTL A;  4AQY Q;  4GKK L;  4UCO A;  1VQ6 A;  1N32 L;  1X55 A;  3M9B A;  4APV A;  4B3R Q;  1YJN A;  3HOW H;  1WJJ A;  3KYH C;  3K7U C;  4A3I H;  4C2M H;  3RTX A;  4GNX C;  2K5H A;  4OWT B;  3S15 H;  4LF6 Q;  4B3S Q;  5D1O B;  1UE5 A;  4LF9 Q;  5IP9 G;  2K75 A;  3U4V A;  3BJU A;  2BA0 A;  4MNO A;  3J80 c;  3S24 A;  4GN4 B;  1K3R A;  4DV6 L;  1L2F A;  5LMU L;  4A3K H;  1V43 A;  1CSP A;  1K9M C;  4DV0 Q;  1VQ4 A;  2Y0S E;  4DR2 Q;  3U50 C;  1VQL A;  1DGS A;  4B3M Q;  4JC0 A;  4DAY B;  3F2B A;  4A3M H;  2PI2 A;  1XMQ L;  1KQS A;  5M5W H;  1MJC A;  1XMO Q;  4K0K Q;  2YYZ A;  2CFM A;  1I3Q H;  3TRE A;  1I6H H;  2Y0S G;  1PA6 A;  2JEB I;  3AEV A;  3PGZ A;  3W1B A;  1U5K A;  2KCM A;  4R4I A;  1L0W A;  4DV7 Q;  3AYH B;  2GVB A;  1EYG A;  1VQ7 A;  2MNA A;  4LF7 Q;  3NEN A;  5LMN W;  5IP9 H;  2JA6 H;  3J81 i;  2PNH A;  3HOY G;  4LFC L;  4A3C G;  4DR6 L;  4DR4 L;  1V9P A;  2R7Z H;  3MXN B;  1HNZ L;  4IFD G;  5IE8 A;  3HFZ B;  1MKH A;  2C35 B;  3ERS X;  3A74 A;  3G48 A;  3HKZ E;  1HNX Q;  4NXN Q;  1KRS A;  4QGU A;  1Q46 A;  4P74 A;  4X66 L;  2MO0 A;  4LH7 A;  3OYY A;  1L1O C;  4DV2 Q;  1GO3 E;  1FVI A;  4X64 L;  2D0O A;  1C7Y A;  3M3Y H;  2AKW B;  3HKZ G;  3VDY A;  3HOV H;  3KLW A;  1J5E Q;  4E6N A;  4LWC A;  5FPO A;  3H3V H;  5LMN L;  4DR7 Q;  3STB D;  3RN2 A;  1EOV A;  1X3E A;  2Q2H A;  1QUQ A;  5H1S E;  4DK6 C;  4JBJ A;  2OCE A;  4R1J A;  3HOY H;  4LW1 A;  4DR3 L;  1PYB A;  2UUB Q;  4X6A H;  4GLV B;  4CC6 A;  1Y1V H;  1JJG A;  1KC8 C;  1N36 L;  4A3L H;  3EBE A;  4DUZ Q;  1E22 A;  4RMF A;  3NEL A;  1A62 A;  1Z47 A;  4NB3 A;  4HJA A;  1JT8 A;  5FLM G;  2GN5 A;  3T1H Q;  4DAM A;  4HIK A;  4R4T A;  1N33 L;  1JJ2 A;  4JI3 L;  3KJO A;  5JEA G;  4AYB G;  3J80 i;  4IPD A;  3S17 H;  1QVC A;  1TXY A;  4R4O A;  5C44 H;  3MEF A;  1WFQ A;  4BY1 G;  1PFS A;  4GOP B;  1P16 A;  1YNX A;  3CCU A;  3PCO B;  1I5F A;  3U4Z A;  3UE1 A;  1VQM A;  1PH2 A;  1XNQ Q;  3ICE A;  5IP7 G;  1PH1 A;  1RIP A;  1KIX A;  2JA5 H;  4DR4 Q;  3PO3 G;  4JI4 Q;  4OX9 L;  2QGQ A;  1HNZ Q;  2VUM H;  2NN6 I;  4JI1 L;  5EAY A;  1V1Q A;  4LUV A;  1Q81 C;  2XGT A;  4R4Q A;  5IWA Q;  4NXM Q;  5M5Y H;  2NZH A;  3CCE A;  4A76 A;  2JA7 G;  5J3B A;  4AQY L;  1NMF A;  2UU9 Q;  2JK8 A;  4BBR G;  3GJX B;  4RG1 A;  4JI6 L;  1WCM G;  5LMN Q;  1N34 Q;  2UUA Q;  1Q1B A;  2FXQ A;  2VZA A;  3PIP A;  3S2D H;  3CAM A;  3K80 C;  4BXX H;  1A8V A;  4EFE A;  1VQP A;  4JYA Q;  4LF6 L;  4B3S L;  5IYB G;  2ZJR A;  3RLN A;  5IP7 H;  1TAE A;  2VNU D;  4A4I A;  2CQO A;  3TQY A;  2HIX A;  4HID A;  4DV1 L;  1SN8 A;  4DR3 Q;  3PO3 H;  2R92 G;  3PUZ A;  1N36 Q;  4YCW A;  3KF6 A;  4ME3 A;  2E2J H;  1N8R C;  4DV0 L;  2JA8 H;  4UP9 A;  4DR2 L;  1K0R A;  2E2I H;  4IPH A;  4HJ9 A;  1TWA H;  4YWK A;  1HZB A;  1TWG H;  2JA7 H;  3I4N G;  4K0K L;  1XMO L;  2CKZ B;  4TVA B;  1HR0 W;  3F8T A;  1JMC A;  5M3F H;  1N33 Q;  1TA8 A;  1PHJ A;  4CC5 A;  4IJL A;  4GLX A;  2OQ0 A;  1JE5 A;  1UE7 A;  4DV7 L;  3BAA A;  3FHW A;  1H95 A;  3HOW G;  1XK5 A;  4EFB A;  1YJ9 A;  4L5R C;  1NMG A;  4A3I G;  2E5L Q;  1OXV A;  4JBK A;  1YEZ A;  3PSI A;  4LF7 L;  3J7A 5;  3TRZ A;  4IFD J;  2F4V Q;  3F2C A;  1PH8 A;  1VQ8 A;  2CWA A;  2Q2U A;  2HT1 A;  1QZH A;  1PH3 A;  2WAQ E;  3GTG H;  3JSN A;  4JI2 Q;  4DR5 L;  4DKA C;  3KF8 B;  4OX9 Q;  4NXN L;  1HNX L;  1HR0 L;  2EIF A;  2A19 A;  1VQN A;  2HHH Q;  4A3K G;  2WAQ G;  2R93 H;  1K83 H;  1JJC B;  1SRO A;  4JOI A;  4DV2 L;  3RR5 A;  1OXS C;  2PQA A;  1YIT A;  3BA9 A;  5C0X G;  1YI2 A;  1XTD A;  2WP8 J;  4GKJ Q;  4A3M G;  1C0A A;  4DR7 L;  4OO1 G;  1XNR Q;  3GTJ H;  1PH4 A;  4A3J H;  4JI6 Q;  4GN3 B;  5D1O A;  5GAD C;  4JV5 L;  4EEQ A;  3GTL H;  3ER0 A;  3I56 A;  1AE3 A;  2E2H H;  1N9W A;  1SFO H;  4PMW A;  1KHI A;  2CWP A;  3IRB A;  1KRT A;  5FJ8 H;  2UUB L;  2JA6 G;  1GD7 A;  1VQF A;  5JJI A;  2R7Z G;  3W1G A;  4J15 A;  4P72 A;  3CCJ A;  4DV1 Q;  4IOC A;  3CCL A;  1X65 A;  4A3G H;  3E9I A;  4DUZ L;  4GN5 A;  3I2Z A;  2ES2 A;  3EN2 A;  3CC7 A;  5GAG C;  1NTG A;  3T1H L;  3HOU G;  3QWU A;  2B3G A;  2CCZ A;  1Y1W G;  4PG3 A;  1TWF H;  2NVX H;  3HOV G;  3ULJ A;  2UUC L;  2HVS A;  1TWH H;  1L1O B;  4X65 Q;  2JE6 I;  3HOX H;  4LNQ A;  3EIV A;  3PUX A;  2E5L L;  3NC0 B;  5K36 G;  1G6P A;  1XDN A;  1FGU A;  4QQB X;  3GTO H;  3PUY A;  1XNQ L;  2A1A A;  4Y7N H;  2KHI A;  2ZM6 Q;  3UDG A;  4DR1 Q;  2PI2 E;  4UCU A;  3AFP A;  3UQ8 A;  2JEA I;  3CPF A;  3RLF A;  4JI4 L;  1X6O A;  2LSS A;  3M7N A;  4IFD I;  1Y1V G;  4DR5 Q;  4KHZ A;  1WOC A;  3K81 C;  2IX0 A;  4A3L G;  1HR0 Q;  1HZC A;  2NVY H;  3D31 A;  5IWA L;  4FDB A;  4NXM L;  3HOU H;  4X62 Q;  1XPR A;  1UE6 A;  1Y1W H;  4WJ3 M;  2UU9 L;  4POG A;  5BR8 L;  1NJI C;  4A3E G;  4P71 A;  3WWV A;  2ZJQ A;  4LUO A;  3CW2 C;  3S1M H;  4WJ4 A;  1VQK A;  4DNI A;  2UUA L;  3VNN A;  1N34 L;  3HOZ G;  4LF8 L;  2VS1 A;  2OWO A;  3G71 A;  3GTP H;  5C44 G;  4JYA L;  4JV5 Q;  2JA9 A;  1D8L A;  2K5V A;  1T9H A;  2JA5 G;  5JJL A;  2VY3 A;  4YCV A;  2VUM G;  3OTO L;  2HVQ A;  1E1T A;  4AYB E;  2Q2T A;  4O0A A;  4XTC S;  4A3B H;  2AMC B;  2VQE Q;  1NE3 A;  4P73 A;  1AE2 A;  1HJP A;  4XIG S;  5C4X H;  2ZTC A;  4A3E H;  3CD6 A;  3TY5 A;  2UUC Q;  2OTJ A;  1IYJ B;  3LGJ A;  3HOZ H;  3I4O A;  3UDI A;  3TY8 A;  1FJG L;  4KHP Q;  2UXB Q;  3JSL A;  3KOJ A;  2F4V L;  4A3F G;  1BVS A;  1EFW A;  1QUQ B;  2K14 A;  3RNU A;  1E1O A;  4L5T A;  2H5X A;  3CQZ H;  3CCR A;  5IY0 A;  1IZ6 A;  2I0Q A;  4JI2 L;  1Q82 C;  4JI7 L;  3NBZ B;  2QA4 A;  1SMX A;  2HHH L;  5C0X J;  2OQK A;  3TS2 A;  2B29 A;  2JA8 G;  2IY5 B;  4UCV A;  1VQG A;  5M3M H;  3CP0 A;  4YY3 Q;  4GKJ L;  1VQ9 A;  5FPR A;  3D0F A;  2ALY B;  1U0L A;  2ZTD A;  4UPA A;  2NZO A;  5BR8 Q;  5M3F G;  2KEN A;  4NPS A;  1EQQ A;  1M90 C;  1YHB A;  3STB C;  1XNR L;  3PIO A;  2D0P A;  1EQR A;  1WYD A;  3W5O A;  1X56 A;  2KBN A;  4PZ8 A;  4LF8 Q;  4UCR A;  4C3I H;  2VW9 A;  2HIV A;  3PUV A;  4JI8 Q;  4R4C A;  1YHQ A;  1YJW A;  2PMZ E;  1LTL A;  3UDF A;  4A3D G;  3PN1 A;  2I5L X;  2RCN A;  4A3F H;  3JAM c;  3CCS A;  3A0J A;  1J6Q A;  3I4M H;  4JBM A;  3BU2 A;  4QL5 A;  1VQB A;  3OTO Q;  3BZC A;  2R93 G;  1X3F A;  2AWO A;  2K5N A;  5M5X H;  1YIJ A;  1HNW Q;  3M4P A;  1S3O A;  3DM3 A;  1PV4 A;  4HJ7 A;  4X65 L;  4C3H H;  3NBY B;  5GAH C;  4A3J G;  3NEM A;  2UXC L;  5ELO A;  4IOA A;  1BBW A;  1MIU A;  1FJG Q;  1Q1E A;  4QIW E;  4HJ5 A;  2ZM6 L;  1UWV A;  2N49 A;  3GO5 A;  2VQF Q;  4DR1 L;  4A3D H;  3F2D A;  3F1Z A;  2VUG A;  2GVA A;  2YTY A;  4B3T Q;  4YWL A;  5FJ8 G;  4LFA Q;  2WB1 G;  4PZ7 A;  1CKN B;  1GKH A;  2IHF A;  3M4Q A;  1CUK A;  4PZ6 A;  2R6G A;  4GNX B;  4JI7 Q;  2QEX A;  1IL2 A;  1IBM Q;  4A3G G;  5HGQ A;  4DV4 Q;  4YHH Q;  3L7Z C;  5IT9 c;  2RHS B;  1ASY A;  4L5Q A;  4X62 L;  4HTO A;  4OWW B;  1B7Y B;  5C0X I;  3GTM H;  3KJP A;  2JQO A;  1Y14 B;  3KF6 B;  3PO2 H;  4BBS G;  3Q8D A;  1PH6 A;  1ASZ A;  4C3J H;  1SR3 A;  4JCV E;  3HOX G;  1FL0 A;  4OO1 I;  1VS0 A;  2HQL A;  2XTI A;  1Q7Y C;  5DIS C;  2A8V A;  1A0I A;  2Z0S A;  5JJK A;  2IHE A;  3A5U A;  4ALP A;  3FP9 A;  2MQH A;  1E7Z A;  3GTK H;  2BA1 A;  3U58 A;  1BBU A;  2V1C C;  5IYC H;  2AWN A;  4EX5 A;  3OW2 A;  3GTQ H;  4HTP A;  3S14 H;  4A93 H;  3FKI H;  1VQE A;  2E8G A;  2IT1 A;  4YWM A;  1G51 A;  3PV0 A;  4IPG A;  5FLX c;  4UP8 A;  4HIO A;  1QZG A;  5JEA J;  5C3E H;  2VQE L;  1L1O A;  4QJF A;  3KDF B;  2K52 A;  4BBS H;  3JAM i;  3M4O H;  1LYL A;  2MO1 A;  2PQA B;  3UE0 A;  3CXC A;  3T1Y Q;  4UCT A;  4DV3 Q;  4DUY L;  3H3V I;  3H15 A;  1YZ6 A;  3DLL A;  3RN5 A;  2F3I A;  4KHP L;  2UXC Q;  2UXB L;  3L2P A;  4DPG A;  1HH2 P;  4UFZ A;  4QY7 A;  1VQD A;  1IBL Q;  3L0O A;  4AIM A;  3CPW A;  4JI0 L;  4LF4 Q;  2N8N A;  1K8A C;  3TEH B;  1YHA A;  1VQC A;  1I94 Q;  1IBK Q;  4JOI C;  4HIM A;  1UE1 A;  1SRU A;  4IO9 A;  3S1Q H;  3G6E A;  3G4S A;  1C9O A;  4YY3 L;  3NBH B;  4A3B G;  1KAW A;  3GD7 A;  2I5H A;  1PH9 A;  3PF4 A;  2NVQ H;  5C4X G;  3A5Z B;  4Y52 H;  1PVO A;  2B63 G;  3J7Z C;  1OXX K;  5HY6 A;  1W3S A;  2UXD Q;  3BA8 A;  1A63 A;  3BAB A;  1CKO A;  2KHJ A;  4JI8 L;  3KFU A;  4DRF A;  1VCI A;  1KXL A;  4BA1 I;  2YTX A;  3E9H A;  1VQI A;  4DV5 Q;  2R7F A;  1OTC A;  3RLO A;  3TS0 A;  3PUW A;  3BZK A;  1Q8K A;  3RZO H;  4AH6 A;  3CME A;  1HNW L;  4OON A;  3GB8 B;  1NBW A;  3CF5 A;  1S68 A;  3UDX A;  5M3M G;  1GVP A;  1Q86 C;  1RL2 A;  3JC6 6;  3CMA A;  3PF5 A;  1VQ5 A;  5DLQ E;  4GKK Q;  1E24 A;  1CSQ A;  1KL9 A;  2Q2I A;  4GOP A;  1SLJ A;  4H02 A;  2B63 H;  3S2H H;  2IX1 A;  4DUY Q;  1N32 Q;  2YTV A;  1W2B A;  2L15 A;  3J81 j;  2VQF L;  1M1K C;  4LFB L;  2ID0 A;  2HVR A;  1XPU A;  4IJH A;  1XPO A;  1LM0 A;  1YVC A;  4B3T L;  4A3C H;  2DUD A;  1B04 A;  4JI5 L;  2DGY A;  3CCQ A;  1PYS B;  4LFA L;  1EWI A;  3CCV A;  4KI0 A;  5ELN A;  3I4M G;  1IBM L;  4DV4 L;  2LXK A;  4YHH L;  1TWC H;  2RHQ B;  3ULL A;  3ZJY C;  5LMU Q;  2ZJP A;  4DV6 Q;  1JB7 A;  3E0E A;  5AJ3 L;  2EQS A;  2LXJ A;  2Z6K A;  1QVF A;  1UEB A;  2N78 A;  1XMQ Q;  1Q12 A;  4BY7 G;  3CC2 A;  2YU9 H;  1CKM A;  4TQU S;  3S16 H;  2F52 A;  2AHO B;  2EXD A;  1X3G A;  1B8A A;  4DK3 C;  1BKB A;  1IXR A;  3K7A H;  2ATW A;  4LFC Q;  1AH9 A;  2VL6 A;  4DR6 Q;  4LUZ A;  1OXT A;  2KCT A;  4EQ5 A;  4GLA C;  2YV5 A;  2NN6 G;  4IPC A;  3S1N H;  2JJQ A;  1QVG A;  4LF5 L;  2MFI A;  4X66 Q;  2K4K A;  4UP7 A;  5FLM H;  2I5M X;  4BXX G;  3TY9 A;  2R7D A;  4X64 Q;  5GAE C;  4L5S A;  4OXP A;  4BA2 I;  3PO2 G;  3AQQ A;  2ASB A;  4GOP C;  3T1Y L;  3S1R H;  4BY7 H;  1XJV A;  1VQH A;  1E3P A;  1EIF A;  2ZTE A;  4MTN A;  5IYD G;  4DV3 L;  4B3R L;  1VQJ A;  3H0G G;  1R9T H;  1I50 H;  2BH2 A;  4KLK A;  1YBY A;  4BY1 H;  5GRO A;  2NVT H;  2WB1 E;  1WI5 A;  1IBL L;  4LFB Q;  1KD1 C;  1CKN A;  4LF9 L;  4JG2 A;  1K8G A;  1O7I A;  4LH6 A;  1X54 A;  4O2D A;  4GNX A;  4LF4 L;  3I55 A;  4A75 A;  3CCM A;  4OWX B;  4JI5 Q;  4A93 G;  1G29 1;  5IYC G;  1I94 L;  2N3S A;  1IBK L;  4UY8 C;  1HZA A;  3FKI G;  1S72 A;  1OXU A;  2WFW A;  1D7Q A;  4UCS A;  1Z9F A;  2RF4 A;  2Z6K C;  4MZ9 A;  5C4J H;  4B3M L;  5AJ3 Q;  5C3E G;  1PH5 A; 
#chains in the Genus database with same CATH topology
 2XWB B;  3LNN A;  4POF A;  1S5F D;  4BBR H;  4QIW B;  4RGO S;  1HZ9 A;  5I60 A;  4A3G B;  1WCM H;  1RCV D;  5T1I A;  5DMX A;  1AFP A;  3A56 A;  1NY4 A;  1SE8 A;  1B2T A;  4Q4D A;  4RZQ A;  1ZXT A;  1PFB A;  3B6Y A;  3ULP A;  2R92 H;  1S5B D;  3HOX B;  3CC4 A;  3AMU A;  1K73 C;  4LF5 Q;  2FHT A;  1MJE A;  1VMC A;  5JJZ A;  1KTK A;  2IL8 A;  3VYS A;  4MHE A;  2OTL A;  4AQY Q;  2R82 A;  3T13 A;  4K8J A;  1N32 L;  5BYB A;  3M9B A;  3QOL A;  1WJJ A;  3KYH C;  2HDK A;  3K7U C;  1D2B A;  4C2M H;  2A69 C;  4OWT B;  5IP9 G;  3J81 E;  5KS8 A;  3U4V A;  1BCP B;  4MNO A;  4FF4 A;  2F0D A;  4DV6 L;  2HJW A;  2EYO A;  1K9M C;  2Y0S E;  3TP6 A;  4DR2 Q;  5C0X H;  3U50 C;  2A68 D;  5ELD A;  1KQS A;  1XMO Q;  1ILP A;  2YYZ A;  1I3Q H;  3TEK A;  1PA6 A;  2JEB I;  3PGZ A;  2QKI C;  4L6T B;  2KCM A;  1L0W A;  4DV7 Q;  1LTT D;  1GLV A;  3FPP A;  1EEF D;  4ZLT F;  2JA6 H;  2AQ2 B;  2KJX A;  4LFC L;  4DR4 L;  1O7Y A;  1HNZ L;  1C8C A;  3ERS X;  1HNX Q;  4P74 A;  2MO0 A;  3Q24 A;  3OYY A;  4IN3 A;  3C46 A;  4LH7 A;  1FNV A;  4DV2 Q;  1SBB B;  5KRU A;  1WTR A;  3HOV H;  3KLW A;  1J5E Q;  2XD4 A;  4E6N A;  3VYT A;  3QB3 A;  3H3V H;  3T9D A;  4FXG C;  1EEI D;  3RN2 A;  3G8C A;  4EGQ A;  3OUZ A;  1X3E A;  4O4H F;  4IUV A;  5H1S E;  1NNX A;  3H6M A;  4DK6 C;  4FF1 A;  2TMP A;  3HOY H;  1I7L A;  4KY6 A;  2NWG A;  4GLV B;  4CC6 A;  1Y1V H;  3SK6 A;  1JJG A;  5BWU A;  2YS6 A;  2COI A;  1OO9 B;  1A62 A;  4HJA A;  4CKE A;  2A68 C;  1Y8N B;  4HIK A;  2WIN B;  1SE3 A;  4AYB G;  3Q0A A;  4YIJ A;  1PZJ D;  1TXY A;  2RQX A;  4GOP B;  1VQM A;  2L5T A;  2XWJ B;  3ICE A;  4PMC A;  3HGB A;  5IP7 G;  1SYE A;  3HS0 C;  1RIP A;  3VYU A;  2JA5 H;  2DWC A;  1Z6H A;  3S1R B;  1I4H A;  3PO3 G;  2QGQ A;  1K8M A;  1IYV A;  4QSH A;  1DM0 B;  4O7Y A;  2XGT A;  2I8C A;  2NZH A;  3CCE A;  3I70 A;  1FNW A;  1BNC A;  2B2W C;  4AQY L;  4MA5 A;  4RG1 A;  3L9A X;  3PQI A;  2DZD A;  5F2D A;  1EU3 A;  4EFE A;  4BXX H;  5IYB G;  1CM9 A;  2Z04 A;  4DLK A;  4HR7 B;  3TQY A;  4BBR B;  4DR3 Q;  4RGT A;  3J7Y W;  1HQM C;  3KBX A;  2VQD A;  3KF6 A;  2E2J H;  4DR2 L;  1K0R A;  3LX0 A;  4HJ9 A;  1TWA H;  1TWG H;  1XMO L;  1DIK A;  3RV3 A;  2L9H A;  1KT8 A;  4GLX A;  3FKI B;  1SDF A;  1JE5 A;  1BF4 A;  1Q3L A;  4DV7 L;  1BXR A;  4JBK A;  4A3I G;  3TRZ A;  1OXV A;  3UFX B;  4CHI A;  4IFD J;  3URY A;  3F2C A;  1VQ8 A;  2F4V Q;  3JSN A;  1E2Z A;  2WAQ E;  1GSA A;  4OEL B;  4DR5 L;  1SYF A;  4CMD A;  1HNX L;  1HR0 L;  1JOQ A;  2A19 A;  1ZYR C;  4OIJ A;  1K83 H;  1JJC B;  1SRO A;  4H7B A;  5JAV A;  4DV2 L;  4V19 0;  2PQA A;  1DAA A;  3FEW X;  2CNV A;  2V58 A;  4I7Z C;  3BA9 A;  2WP8 J;  4A3M G;  4QCL A;  2HGW A;  2KEC A;  1C0A A;  1JR0 D;  4IIJ F;  3KLR A;  4OO1 G;  4JI6 Q;  2FPP B;  5GAD C;  4BS9 A;  3ER0 A;  4RKB A;  3H09 A;  5DNF A;  3ERO A;  1KRT A;  1VQF A;  1EKF A;  1I3Q B;  3CCL A;  3T9F A;  1TU2 B;  2OEO A;  4O4J F;  2M2L A;  5GAG C;  1ML0 D;  3HOU G;  3T9B A;  1Y1W G;  1G6Z A;  4IWY A;  4CJ2 C;  1TWF H;  2B2Y A;  2UUC L;  2HVS A;  4DQN A;  3WOF A;  3SNO A;  3HG9 A;  2D5D A;  3RZO B;  4FE2 A;  2RA4 A;  2B2U A;  4KTA A;  4NMZ A;  5D3D A;  3J81 L;  5CAE B;  2O5I C;  3MXP A;  3SXH A;  1D6E C;  4A3L G;  1EYA A;  1HZC A;  1NUC A;  4O2B F;  1I4R A;  4FDB A;  2ZT9 C;  4EGV A;  2XRQ D;  3HOY B;  1RHP A;  4H0L C;  3UZO A;  3OSO A;  3WWV A;  4A3E G;  2ZJQ A;  4WJ4 A;  5CC4 A;  3NHH A;  1Y1V B;  3VNN A;  5M9O A;  2OWO A;  3T4A C;  3G71 A;  3GTP H;  5C44 G;  2KVM A;  1HTP A;  3VR5 A;  3HT5 A;  3E5N A;  4MV9 A;  4KKT A;  1ZKO A;  2HHF B;  4Y8V B;  4EGJ A;  4HNU A;  2VQE Q;  3AB9 A;  1SSO A;  2TSS A;  1H9S A;  2DNC A;  3HOZ H;  2EYP A;  2F0K A;  1XTC D;  2EJ0 A;  5I9O A;  3KOJ A;  2F4V L;  1DOL A;  1QG7 A;  5K5P A;  4CBV A;  2W6P A;  4JI0 Q;  1EYC A;  1ET9 A;  4L5T A;  3CCR A;  4JXU A;  5I9P A;  1Q82 C;  5D65 A;  2B29 A;  2JA8 G;  1LTI D;  4ZQI A;  1IKL A;  2PZW A;  1WTP A;  1M4V A;  3CRK C;  3D0F A;  4FVM A;  4X3T A;  5M3F G;  5BPH A;  1M90 C;  2BDO A;  1D5M C;  1IL8 A;  3MAQ A;  3HP3 A;  4FU0 A;  1WYD A;  1X56 A;  2E2J B;  4OL7 A;  3BVZ A;  3KAJ A;  1YHQ A;  3MFG A;  1TWA B;  1A15 A;  4KN7 C;  3UDF A;  4A3F H;  1PDQ A;  3CCS A;  1KJQ A;  3A0J A;  3I4M H;  3SHL A;  4ZKB B;  3DTF A;  1BXT A;  3BZC A;  1X3F A;  2K5N A;  3RUZ A;  3F2U A;  3SVM A;  1HNW Q;  2R93 G;  3M4P A;  2IW3 A;  2CNU A;  2EPB A;  1PFM A;  2L11 A;  3DM3 A;  1S5C D;  4G57 A;  1MGS A;  4O83 A;  2EJ2 A;  2HDL A;  5GAH C;  2V59 A;  4A3J G;  5ELO A;  2R7M A;  1FJG Q;  1STG A;  1TII D;  3RZD B;  1GJX A;  3G8D A;  2RBM A;  2LFN A;  2O2L D;  3F1Z A;  2YTY A;  3DXJ C;  4LFA Q;  1CHP D;  4Q5V A;  4JI7 Q;  4A3G G;  5HGQ A;  4DV4 Q;  1J9O A;  5JH7 F;  1B6S A;  3EFX D;  4HTO A;  4IUP A;  1IKM A;  5C0X I;  3GTM H;  1I4P A;  1SND A;  1ASZ A;  1SR3 A;  3HOX G;  2VR1 A;  2DJG C;  2F3W A;  2QIL A;  1Q7Y C;  5DIS C;  2A8V A;  5KGU A;  5BWX A;  5KX5 F;  3U55 A;  1II3 A;  1I6V C;  2V1C C;  4QMG A;  4EX5 A;  3GTQ H;  4L63 B;  3MXG A;  1VQE A;  3W3A A;  3V4Z A;  5JEA J;  5JPN C;  1EQV A;  5C3E H;  2VQE L;  1L1O A;  3KAL A;  1SYG A;  3JAM i;  3WWH A;  3H3V I;  4DUY L;  1XYI A;  1JLL B;  1YZ6 A;  1GUG A;  1JOR A;  4DPG A;  3SK5 A;  3CPW A;  4JI0 L;  2Q8I B;  3NBI A;  3OHX C;  3TEH B;  4CDD C;  1O78 A;  1VQC A;  1I94 Q;  2C00 A;  1ENF A;  3UI2 A;  3QWN A;  4HIM A;  4IO9 A;  3HEJ A;  5CV6 A;  2YZL A;  3BDL A;  1K0S A;  5LL6 X;  3NTK A;  2NVQ H;  5KEE A;  1EYD A;  3P20 A;  2G9D A;  3BA8 A;  3R23 A;  3BAB A;  5FLX E;  1SYD A;  4DRF A;  5LOV F;  1ENA A;  1DV2 A;  1A2U A;  3E9H A;  4IUU A;  4J8Q A;  4TM5 A;  1ET0 A;  3HOZ B;  2YWV A;  1Q8K A;  1V1P A;  1HNW L;  4OON A;  3GB8 B;  3CF5 A;  3UDX A;  2B2Y C;  1SXT A;  1VQ5 A;  4GKK Q;  4GOP A;  1CSQ A;  2OTJ A;  2Q2I A;  1SLJ A;  2B63 H;  3S2H H;  2B2V A;  3IL8 A;  4YJ2 F;  4ZQ3 A;  1QIL A;  1ICF B;  2HVR A;  4BWG B;  4LFB L;  5M5Y B;  4IJH A;  5JVG 3;  1E2V A;  4FFL A;  4LFA L;  4IFD H;  1ICW A;  5ELN A;  4XYQ A;  1WTX A;  3T9E A;  3K5N A;  4DV4 L;  1TWC H;  4S3S A;  5LMU Q;  2ZJP A;  5FR9 A;  2BE5 C;  1PRT F;  2LXJ A;  2Z6K A;  2K6A A;  4R9W A;  4A3F B;  3R5F A;  2K5W A;  4XYL B;  4N9T A;  3CC2 A;  2JXM B;  2AHO B;  4HR7 A;  2EXD A;  1X3G A;  2ENB A;  1B8A A;  3A8I E;  3K7A H;  5I2Y A;  2GQR A;  4F8M A;  4DR6 Q;  4LUZ A;  3S1N H;  2CZG A;  2JJQ A;  2MGS A;  3OIP A;  4OHJ A;  2K4K A;  5FLM H;  2R7D A;  5D14 A;  5E4W C;  3J7A V;  4ZOL F;  2ASB A;  4C1N K;  1PTO D;  1XJV A;  3NE5 B;  2NU6 B;  2W70 A;  1R9T H;  5E4X A;  4I55 F;  4BY1 H;  4DGZ A;  2Z1C A;  1KD1 C;  2A6E C;  1O7I A;  2EY5 A;  3GTM B;  4O2D A;  2GA4 B;  2HGX A;  4OWX B;  4DXF A;  3MFY A;  4JI5 Q;  3T7A A;  1G29 1;  5IYC G;  1PRT C;  2N3S A;  1I94 L;  1IYE A;  1HZA A;  3C1E A;  3FKI G;  3LUL A;  2EYF A;  4YB8 B;  2CW0 D;  4MZ9 A;  2OF1 A;  5AJ3 Q;  2I87 A;  1VQO A;  3J81 c;  1MSH A;  4V0B A;  2D62 A;  2FIN B;  4YCU A;  1WD1 A;  4ZHQ F;  4GS3 A;  4HJ8 A;  1AW7 A;  1WR2 A;  1CA5 A;  2Q8R E;  4HNT A;  5D1P A;  4KD4 A;  4JBW A;  4MAM A;  2J9G A;  1TWH B;  1I4Q A;  1VF5 C;  2LY7 A;  1STN A;  1B53 A;  3KDF A;  3I7F A;  1PTO H;  2VPQ A;  4P2C B;  4P75 A;  3I4N H;  1PH7 A;  1B70 B;  1PTO C;  4GKK L;  1S5D D;  4UCO A;  1JWM D;  5DGH A;  1BR9 A;  2QEJ C;  2CVR A;  2NVY B;  3HOW H;  3TBI B;  1JOO A;  4GNX C;  3S15 H;  2K5D A;  2K75 A;  3S1M B;  2NVQ B;  3BJU A;  2D2C C;  3S24 A;  2CW0 C;  5LMU L;  1V43 A;  4B3M Q;  3F2B A;  2PI2 A;  1MJC A;  1SEB D;  2CFM A;  3TRE A;  5I6W A;  4Q4C A;  4ME5 A;  3DMU A;  4ME6 A;  3E3X A;  3MXU A;  4X3S A;  2HCI A;  2NB0 A;  2MNA A;  1LT5 D;  3NEN A;  4CJ1 B;  3HOY G;  2N55 A;  2PNH A;  4K5W A;  4DR6 L;  5C4X B;  2R7Z H;  2Y0S B;  4XDX A;  5IE8 A;  3HFZ B;  2B63 B;  1HXY D;  3C3L A;  3S2H B;  2ABJ A;  1L1O C;  1GO3 E;  3E0J A;  2R87 A;  1EQT A;  3M3Y H;  3HKZ G;  4NKL A;  3M4Y A;  2EXZ A;  1M6V A;  1PMR A;  1TS5 A;  3J80 E;  3BS1 A;  2SNM A;  3STB D;  1KDB A;  1TWC B;  5L37 A;  5FO8 B;  1EOV A;  2Q2H A;  4KY7 A;  1U4L A;  1CFM A;  5FLX L;  1B44 D;  4JBJ A;  2OCE A;  4C5C A;  4XZ3 B;  1JKJ B;  4X6A H;  4CGY B;  4JVZ A;  1TR5 A;  2LMC B;  4O1N A;  3EBE A;  2MUY A;  5BN3 A;  3QR8 A;  3NEL A;  4NB3 A;  1JT8 A;  3E6Z X;  2GN5 A;  4DAM A;  4R4T A;  1N33 L;  3K7A B;  3KJO A;  4KD3 A;  3S17 H;  5I5W A;  1QVC A;  4R4O A;  2E5L L;  1TY0 A;  4BXX G;  1YNX A;  1PH2 A;  2XVS A;  1A3G A;  3FVQ A;  1XNQ Q;  4M0J A;  1PH1 A;  4LK1 C;  3K6O A;  1KJI A;  4PV1 C;  4DR4 Q;  3GID A;  3RFC A;  1ESF A;  1HNZ Q;  2VUM H;  1QCB D;  1C30 A;  1R9T B;  1M0T A;  3ORQ A;  2IX3 A;  1Q81 C;  2F3V A;  5JQW A;  4NXM Q;  1PRT B;  1QNU A;  2UU9 Q;  5JEA H;  2CH4 W;  1EUD B;  3NP8 A;  2B2V C;  1PLF A;  4RCN A;  3K57 A;  2FXQ A;  4TKO B;  2VZA A;  3S2D H;  4O84 A;  3CAM A;  1TAE A;  2VNU D;  2CQO A;  1X32 A;  2HIX A;  3D6C A;  4FNF A;  4HID A;  3LQS A;  2K1B A;  1D5Z C;  3DF7 A;  4FF2 A;  1WVL A;  1HFG A;  1B9M A;  1CQI B;  2E2I H;  3R8B A;  2AUJ D;  2LKV A;  1HR0 W;  3IFT A;  3H94 A;  2OQ0 A;  1JQY D;  2DJF C;  3RD4 A;  3OWE B;  3FHW A;  4EFB A;  3I73 A;  1EY8 A;  1YEZ A;  2F0M A;  3PSI A;  1WTW A;  3AW8 A;  3K5L A;  2FJ2 A;  4IZ8 A;  3M4O B;  1W96 A;  4O7W A;  2WYO A;  4TRD A;  2EIF A;  4FFM A;  2W6Z A;  4ZCK A;  3HOW B;  4A3K G;  2X0S A;  1B1Z A;  5I5T A;  1CT1 D;  3RR5 A;  1BDO A;  3WDN A;  1XTD A;  2X5R A;  1FYC A;  3JAM E;  1KLU D;  1DCZ A;  4NP5 A;  3GTJ H;  4CHT B;  4GN3 B;  1Y69 U;  5EKI A;  3H91 A;  5ISR A;  3GTL H;  2WII B;  1N9W A;  2WAC A;  4PMW A;  2NU8 B;  1KHI A;  3IRB A;  2F0H A;  1I1K A;  2F0T A;  3W1G A;  4P72 A;  4ZUI A;  3I2Z A;  3MHB A;  3EN2 A;  4U67 3;  3CC7 A;  1H9K A;  3V4S A;  1STY A;  2QCP X;  2O4X A;  2L12 A;  4K8I A;  5CMD A;  4H44 C;  4WHX A;  2NVX H;  3ULJ A;  2X69 A;  4LNQ A;  1L1O B;  2HG8 A;  3EIV A;  3NC0 B;  5K36 G;  4DAA A;  5CA0 F;  4DN4 M;  4DF7 A;  4QQB X;  3SE7 A;  1BUV T;  1U4R A;  4NDX A;  2ICE C;  2R84 A;  3MXN A;  4DU9 A;  1XNQ L;  2A1A A;  4DR1 Q;  3CPF A;  2YS7 A;  1T5E A;  1STA A;  1X6O A;  1WTO A;  4IFD I;  4DR5 Q;  4WBN F;  4KHZ A;  2FFK B;  1HR0 Q;  5I2X A;  4WJW A;  4NXM L;  2F0N A;  1HUM A;  1UE6 A;  1XPR A;  4WJ3 M;  2UU9 L;  4POG A;  2EYM A;  2F0P A;  2I07 B;  3CW2 C;  2R85 A;  4MA0 A;  3IKJ A;  2QF7 A;  3HOZ G;  4LF8 L;  2VS1 A;  2FP4 B;  1HUN A;  1EL0 A;  3H3V C;  2JA9 A;  2K5V A;  1YNJ D;  4YCV A;  3S16 B;  1B50 A;  1E1T A;  2W6Q A;  2Q2T A;  1Z7T A;  2A5H A;  4IWX A;  2AMC B;  1V1P B;  1AE2 A;  1F9Q A;  2XN9 C;  2ZTC A;  3CD6 A;  3TY5 A;  2UUC Q;  3W2D A;  3J80 L;  3QOJ A;  3OMC A;  2UXB Q;  1KNE A;  3JSL A;  3IAY A;  4A3F G;  2EYH A;  1EFW A;  2K14 A;  3ERQ A;  2H5X A;  3CQZ H;  2I0Q A;  4HNV A;  1SMX A;  5CBE E;  2OQK A;  5KNC A;  3TS2 A;  5E25 A;  1RTO A;  2P0A A;  1A3T A;  1VQG A;  3CP0 A;  5M3M H;  5FPR A;  1VQ9 A;  2OLS A;  2ALY B;  2ZTD A;  1STE A;  4B08 A;  1ENC A;  5BYA A;  4NPS A;  4N9P A;  3W5O A;  4UCR A;  1QOH A;  1JDE A;  2R7K A;  2CH4 A;  4C3I H;  2HIV A;  2DAA A;  2K32 A;  1JCK B;  2E2I B;  1G2S A;  3DHQ A;  4FYD A;  1F2M A;  5G3L D;  1UC8 A;  1Z2O X;  2L0C A;  1DJR D;  3UZB A;  3MWE A;  1F9R A;  1FD7 D;  4K5V A;  1WCM B;  1GSH A;  3PIP 3;  4MN3 A;  1UUP A;  4K5X A;  3TDQ A;  3BU2 A;  1VQB A;  1JE4 A;  1YIJ A;  5M5X H;  5ELB A;  3R2T A;  2K01 A;  1LT6 D;  2H4O A;  4HJ7 A;  4C3H H;  3BG5 A;  2R92 B;  3NBY B;  4M9U A;  2EY2 A;  1IHZ A;  3WO1 A;  1K8O A;  1AUV A;  1BBW A;  1MIU A;  3TW7 A;  3T9A A;  4QIW E;  3G7L A;  4DR1 L;  1D5X C;  4A3D H;  3I90 A;  4YWL A;  5FJ8 G;  2DIK A;  4PZ7 A;  2FMM A;  1CUK A;  2NN6 H;  3RMH A;  1HTL D;  3GTJ B;  5LYJ F;  3T9C A;  1XX8 A;  4YHH Q;  4C2M B;  4YAK B;  3Q1K A;  2GLT A;  2IPK D;  3KJP A;  2JQO A;  3PO2 H;  1G2T A;  4EVO A;  1Z2N X;  3Q8D A;  4RHS A;  3Q2O A;  4C3J H;  4KJO A;  4JCV E;  1FL0 A;  2HQL A;  1IW7 D;  5IGB A;  2Z0S A;  5CR3 A;  1WRV A;  4ALP A;  5ELF A;  2RKS A;  1EY5 A;  5EZY F;  2MQH A;  1E7Z A;  3GTK H;  3U58 A;  3OOC A;  3S14 H;  4A93 H;  4EQP A;  3GP7 A;  2E8G A;  3A8K E;  3R5H A;  1QZG A;  5FLX c;  1QWY A;  4QJF A;  3KDF B;  2JA6 B;  5I5U A;  2K52 A;  3SK4 A;  3JAM L;  2MO1 A;  1X3Q A;  3UE0 A;  4UCT A;  4DV3 Q;  3H15 A;  2UXB L;  3DLL A;  5IT9 E;  3OW7 A;  3R9R A;  3L2P A;  1SNQ A;  4UFZ A;  4QY7 A;  4AIM A;  2KED A;  5IOC A;  3HOV B;  2A6H D;  3CHB D;  1K8A C;  4OGQ C;  1YHA A;  3QQM A;  1ONL A;  4QF4 A;  3PFF A;  3S1Q H;  3G6E A;  2K04 A;  4KK7 A;  4A3B G;  4O7R A;  1KAW A;  2F0O A;  1BOS A;  1CK1 A;  1LT4 D;  5C4X G;  3A5Z B;  2C9O A;  5IGC A;  3P1H A;  2B63 G;  3J7Z C;  2UXD Q;  1W3S A;  1IW7 C;  1A63 A;  1CKO A;  2KHJ A;  3I8Z A;  3KBG A;  3KFU A;  4O86 A;  4K6D A;  3RUP A;  1VQI A;  4DV5 Q;  5DGI A;  3BDO A;  3TS0 A;  2H1E A;  3HB9 A;  5HUR A;  1H9R A;  1S68 A;  3GLK A;  2NU9 B;  1DOM A;  3HBL A;  1A2T A;  2JA5 B;  3BYT B;  3DWA A;  5CR5 A;  2MHV A;  2KOL A;  1WD0 A;  1MHW C;  2IX1 A;  4DUY Q;  3NK9 A;  4I4T F;  1EIG A;  2L15 A;  3J81 j;  4IUQ A;  1YVC A;  2A6H C;  3JZ6 A;  4WRD A;  1DZ1 A;  1EWI A;  2F0V A;  3CCV A;  1LTB D;  2LXK A;  4YHH L;  2RHQ B;  4C3I B;  1WTV A;  1GUT A;  4HN7 A;  1QVF A;  1YNN D;  1UEB A;  3VA5 A;  1XMQ Q;  1Q12 A;  2KA7 A;  2YU9 H;  4TQU S;  1LT3 D;  2F52 A;  5M5X B;  4DK3 C;  3DWQ A;  1TWG B;  2ZXR A;  1F9P A;  2ATW A;  1AH9 A;  2F0F A;  4GLA C;  4NZM A;  1QVG A;  5BWV A;  4UP7 A;  5KKN B;  1CI3 M;  3Q6S A;  4X64 Q;  4A3D B;  5CM0 A;  4BA2 I;  2M00 A;  3FRP B;  4RH6 A;  1WTH A;  4BY7 H;  1VQH A;  1E3P A;  4DV3 L;  1KLG D;  4MTN A;  4B3R L;  4MV1 A;  1VQJ A;  2BH2 A;  1I50 H;  1L0X B;  1K83 B;  4DK0 A;  2WB1 E;  3U9O A;  2NVT H;  2FPG B;  1OBD A;  4LFB Q;  4LH6 A;  1CKN A;  2AUK A;  4LF9 L;  5HV6 A;  4GNX A;  4A75 A;  2B8G A;  3R3O A;  3CCM A;  4ZAI A;  2Q8T A;  2FPI B;  4C3J B;  1K3B C;  1OXU A;  1VMP A;  3A7L A;  3LWE A;  3ZYY X;  1Z9F A;  1AUX A;  3AX6 A;  2A73 B;  1TT2 A;  1V8Q A;  1PH5 A;  3AFQ A;  3K0X A;  3NWS A;  4JI3 Q;  4A93 B;  1MBY A;  1UNS A;  5IYD H;  1EIY B;  5BN5 A;  2UXD L;  5BPF A;  5E7N A;  3H0G H;  2KEE A;  5JPM C;  3N8D A;  5GQO A;  5IYB H;  2GQS A;  5I5X A;  3KAK A;  3GDE A;  4HMI A;  1X9N A;  1TWF B;  4DV5 L;  3U0G A;  2L4N A;  3SGI A;  1B3Q A;  2RDG A;  1NR2 A;  2YZN A;  1EZ6 A;  1VQA A;  5DAU A;  3A54 A;  4FP5 D;  1P8L A;  4HSP A;  4KKU A;  1X55 A;  3QIA A;  2B39 A;  1BNZ A;  1G8Z D;  1MI2 A;  4A3I H;  3RTX A;  2A1H A;  1B3A A;  4LF6 Q;  4B3S Q;  2BOS A;  2ZDG A;  4R8N A;  1EY0 A;  3J80 c;  4O2A F;  3LWB A;  1I1L A;  1L2F A;  1O7Z A;  3GTP B;  1CSP A;  2PO4 A;  2C5C A;  3BG3 A;  4C56 C;  4DV0 Q;  1VQ4 A;  2EDG A;  1VQL A;  2D9U A;  4JC0 A;  4DAY B;  1XMQ L;  4A3M H;  4K0K Q;  3AEV A;  4L1K A;  4OO1 H;  5HNE A;  3W1B A;  4IUT A;  1U5K A;  1CQJ B;  5IT9 L;  1TKW B;  1JOK A;  4LF7 Q;  4A3C G;  3J81 i;  4FXK C;  2YYA A;  1V9P A;  2VB2 X;  3KUP A;  3MXN B;  1DV1 A;  1MKH A;  2C35 B;  3MEH A;  1Q8I A;  3A74 A;  3G48 A;  3HKZ E;  4K2L A;  1KRS A;  4QUC A;  1GOZ A;  4MTK A;  4DXG A;  4NXN Q;  5J1Z A;  3OMG A;  2HUG A;  3TP7 A;  4X64 L;  2D0O A;  4TVI A;  2E74 C;  1ZEQ X;  2PNR C;  4LWC A;  5FPO A;  2JN4 A;  4XT1 B;  5LMN L;  2EY1 A;  4WOR A;  5H80 A;  4FF3 A;  3KRE A;  1MD2 D;  3HZX A;  3V2T A;  1IOV A;  2FMC A;  2NYZ D;  1PYB A;  1RF2 D;  4JPB W;  4G7H C;  1UEA B;  1N36 L;  4A3L H;  2QDL A;  4FXD A;  4RMF A;  5FO7 B;  1Y8P B;  5HBR B;  4KV6 A;  2YZM A;  3T1H Q;  4RAU C;  4JI3 L;  4TUY F;  3NTH A;  5JEA G;  3I4M B;  1S5E D;  4IPD A;  4QB4 A;  5C44 H;  1JJ2 A;  1P16 A;  3PCO B;  3UE1 A;  4ID6 A;  4DA2 A;  2EYJ A;  3CRL C;  1C4Q A;  3VA7 A;  5IIF A;  5JVL A;  2RSO A;  4BY7 B;  4OX9 L;  2NN6 I;  2DN8 A;  1SNP A;  4DIM A;  2I80 A;  2NTT A;  2PZU A;  4HCE A;  1V1Q A;  2FB9 A;  4EQN A;  2NVT B;  4IHJ F;  2R61 A;  2HDM A;  2JK8 A;  3DEO A;  4BBR G;  3GJX B;  3OIQ A;  3TIG A;  1WCM G;  2G9H D;  1N34 Q;  1PTO F;  5LP6 F;  3K80 C;  4NW2 A;  2DNE A;  3DTG A;  4LF6 L;  4B3S L;  4QUF A;  4A4I A;  5LA6 F;  4ZI7 F;  2GPS A;  4DV1 L;  5EGT A;  2R92 G;  3DWP A;  5CA1 F;  5EKK A;  3PUZ A;  3SK8 A;  1RDP D;  3H0G B;  3KK7 A;  4ME3 A;  4DV0 L;  2JA8 H;  4UP9 A;  5I5V A;  2JA7 H;  4K0K L;  4IUN A;  1EOT A;  2CKZ B;  2MP1 A;  4TVA B;  3F8T A;  1JMC A;  5M3F H;  1N33 Q;  1TA8 A;  3K3P A;  1KEE A;  4K2K A;  3GTQ B;  2CHB D;  4IAL A;  2COJ A;  4GLW A;  1UE7 A;  1KAB A;  1ILQ A;  1XK5 A;  1NMG A;  2E5L Q;  2EJ3 A;  3J7A 5;  5C3E B;  4LF7 L;  3U54 A;  1PH8 A;  2HT1 A;  1TS4 A;  2Q2U A;  3GTG H;  1QZH A;  1PH3 A;  1KTA A;  2EJG C;  1SNC A;  2F03 A;  1TY2 A;  2M9V A;  3PMF A;  4DKA C;  4NXN L;  1VQN A;  2Z8L A;  2R93 H;  2XSC A;  1OXS C;  3LWU A;  1YIT A;  1E2W A;  5C0X G;  4GKJ Q;  3TW6 A;  5K3W A;  4G4K A;  5EBD A;  1PH4 A;  4A3J H;  4N8F A;  5D1O A;  1V1O A;  4JV5 L;  4FO2 A;  1BCP D;  1AE3 A;  2E2H H;  5DAA A;  1SFO H;  2JA6 G;  2CWP A;  4A3M B;  1D1I A;  1GD7 A;  4J15 A;  2VB3 X;  3SDZ A;  3CCJ A;  3DUZ A;  4IOC A;  2Z02 A;  4A3G H;  3E9I A;  2PYK A;  4GN5 A;  2ES2 A;  4F7X A;  3T1H L;  1Q90 A;  3TP5 A;  4G7Z C;  5IGE A;  1HFN A;  4M1U B;  1FNU A;  1LO5 D;  4PG3 A;  3HOV G;  4X65 Q;  3HOX H;  3PUX A;  1CHQ D;  1G6P A;  1FGU A;  3NSW A;  3MWD A;  2EJM A;  1LTS D;  2KHI A;  2LS0 1;  4EQO A;  5FOB B;  3NUA A;  4UCU A;  4LMQ D;  1HA5 A;  3RLF A;  1TS2 A;  3M7N A;  4I65 A;  1Y1V G;  1DXM A;  1WOC A;  2HCC A;  3KLS X;  2EZV A;  4I7A A;  3D31 A;  1NSN S;  1PXU A;  4X62 Q;  1F2L A;  1I2K A;  5BR8 L;  4P71 A;  3TN2 A;  3M7G A;  1VQK A;  1N34 L;  4O7L A;  2PN1 A;  3MC0 B;  1BCP C;  3MZ5 A;  3OWF A;  5CE8 A;  3VPB A;  1MSG A;  4F88 A;  2JA5 G;  1VDZ A;  3WOE A;  2VY3 A;  4YAJ B;  4FGR A;  3OTO L;  2HVQ A;  1ZAU A;  5C5M A;  5C44 B;  4AYB E;  4O0A A;  4XTC S;  1NE3 A;  1W6J A;  4P73 A;  4XIG S;  1I1M A;  3CEB A;  1EY4 A;  1IYJ B;  1S4Z A;  5KND A;  5KYL A;  3S1N B;  2CNQ A;  1AZP A;  3N52 A;  3TY8 A;  4C3I G;  5BWW A;  4J6H A;  5FNV F;  4XQJ A;  2NU7 B;  1QUQ B;  3NXW A;  5HGT A;  5IY0 A;  1IZ6 A;  3NBZ B;  4HQ6 A;  1NCV A;  2OXP A;  4RFB A;  4BY1 B;  4TV8 F;  4LJZ C;  2IY5 B;  1J8I A;  1KDC A;  2L1B A;  4GKJ L;  1U0L A;  4UPA A;  2NZO A;  2KCC A;  2KEN A;  1YHB A;  3STB C;  2DY7 A;  2D0P A;  1EQR A;  2KBN A;  5I4D A;  4XQN A;  4LF8 Q;  2JA8 B;  5BN4 A;  2V5A A;  3CU7 A;  4R4C A;  1YJW A;  2F0U A;  2PMZ E;  4A3D G;  4HAE A;  4RA8 A;  2JA7 B;  3PN1 A;  2I5L X;  1EUC B;  3CKI B;  4JBM A;  3VR4 A;  1F9S A;  4XYM B;  2XNA C;  3VPC A;  2W71 A;  2MJ8 A;  4UUG A;  3VR2 A;  1S3O A;  4KN4 C;  4TV9 F;  1PV4 A;  3DM1 A;  5LHY 1;  4MV7 A;  3ETH A;  4X65 L;  4C3J G;  1PYW D;  5CYU A;  2UXC L;  2PPB C;  2R93 B;  1PTO B;  1X3P A;  1Q1E A;  5C5L A;  4HJ5 A;  2Z4I A;  2N49 A;  2VUG A;  3KF8 A;  3I4N B;  2A69 D;  1IYU A;  2GVA A;  4Z9C B;  4B3T Q;  2E75 C;  1G2W A;  1CKN B;  2IHF A;  5CV7 A;  1PK8 A;  2R6G A;  1JWS D;  2F0E A;  2K5Q A;  2QEX A;  1BO0 A;  2EY6 A;  4GNX B;  1IBM Q;  5EQ0 A;  3L7Z C;  5IT9 c;  2SCU B;  5K2M A;  4L5Q A;  5ELC A;  2RSN A;  4X62 L;  1B7Y B;  1ESR A;  3EA6 A;  3S15 B;  1JB3 A;  2PCF B;  3R2I A;  4CDF C;  1PH6 A;  4DFA A;  5J2U F;  4OO1 I;  1VS0 A;  1M0W A;  2WAQ B;  2XTI A;  2ICI A;  5CGK A;  1A0I A;  1W6K A;  2IHE A;  3A5U A;  4ABN A;  1BBU A;  1STH A;  5IYC H;  2AWN A;  2NBF A;  3FKI H;  2EOT A;  3A7A B;  2IT1 A;  4DAY A;  4YWM A;  3PV0 A;  4IPG A;  4UP8 A;  4HIO A;  2E2H B;  2HD3 A;  3P7J A;  5C4H A;  5CV5 A;  5C8Y F;  4BBS H;  2R7Z B;  1LYL A;  4DNR B;  2QK4 A;  3CXC A;  3T1Y Q;  2DY8 A;  2F3I A;  2SEB D;  3TME A;  3HO8 A;  1GXD C;  4O7T A;  1HH2 P;  1U4P A;  2F4I A;  1IBL Q;  3L0O A;  3M3Y B;  2N8N A;  1IBK Q;  1QNK A;  3K5I A;  4U68 A;  1DD2 A;  1UE1 A;  1SRU A;  3G4S A;  1C9O A;  1LV9 A;  1GHJ A;  1GUS A;  3GD7 A;  3T51 B;  3I3C A;  3PF4 A;  5LL6 S;  4Y52 H;  4MV4 A;  3QO2 A;  1IYD A;  5HY6 A;  2IP4 A;  3K5O A;  4BA1 I;  1U9R A;  2YTX A;  4ILW A;  4X3U A;  1QE6 A;  2R7F A;  3QFF A;  3P75 A;  3ORR A;  3RLO A;  5JVH 3;  3PUW A;  5T1G A;  3S17 B;  4X3K A;  3RZO H;  4AH6 A;  3CME A;  4MIU A;  5C4Z A;  5GON F;  5BMV F;  4WFN 3;  1E24 A;  3I91 A;  4H02 A;  2VUM B;  1EZ1 A;  1ULZ A;  4CE5 A;  4N8X 1;  5E1F A;  1W2B A;  3D6W A;  4MV8 A;  2KQ3 A;  1XPO A;  1LM0 A;  4B3T L;  5BWT A;  1KUT A;  2DUD A;  3NTI A;  3CCQ A;  1PYS B;  1LTR D;  4C1N I;  3CSW A;  3I4M G;  5FK9 C;  1IBM L;  3ZJY C;  2F0G A;  3ULL A;  2J0T D;  5IGG A;  3S2D B;  1EFI D;  3E0E A;  3TII A;  2E2D C;  3NQI A;  1EYZ A;  2E76 C;  2PZT A;  1U4M A;  2R7L A;  3T16 A;  4BY7 G;  1BBX C;  1AZQ A;  2F1M A;  2NUC A;  1CKM A;  2QDB A;  1JC7 A;  3TIN A;  2B2T A;  4CKC A;  2W6O A;  2IWH A;  1BKB A;  4HSV A;  4YBZ B;  2RDH A;  2VL6 A;  1YNJ C;  5EPL A;  5JQG F;  4EQ5 A;  3VR3 A;  2YV5 A;  4K6L A;  5G3L F;  3V05 A;  5IOD A;  2K33 A;  4LF5 L;  2MFI A;  1ZYR D;  1DYQ A;  4X66 Q;  2I5M X;  4O7V A;  5C1P A;  4L5S A;  1O80 A;  5EPK A;  3AQQ A;  3Q22 A;  2KUM A;  2RCF A;  3ND8 A;  5AFW A;  1ET6 A;  3T1Y L;  1EIF A;  2ZTE A;  5CBA E;  5IYD G;  3H0G G;  4KLK A;  2EVB A;  1WI5 A;  4O4I F;  1IBL L;  1X54 A;  3BZD B;  3C2P A;  3WNZ A;  3KLS A;  3SEB A;  4UY8 C;  1IBK L;  1EKP A;  2WFW A;  1D7Q A;  4UCS A;  1PZK D;  2RF4 A;  1F2Z A;  5C4J H;  3GTL B;  3EJI A;  5C3X A;  5C3E G;  4E4T A;  1CE8 A;  1GM5 A;  1EUJ A;  3MVV A;  1SYC A;  2WB1 B;  2K50 A;  4PMB A;  2NTS A;  1WTQ A;  1LUZ A;  1NR4 A;  4ZK9 B;  1A3U A;  1B9N A;  2SOB A;  3HKS A;  5TSS A;  4BBS B;  2NVX B;  1O7L A;  1D1K A;  3K8A A;  2EYL A;  3N6R A;  3GQB A;  1S40 A;  4O7N A;  2I46 A;  4Q0F A;  4JI1 Q;  3M85 A;  1H9M A;  2BH8 A;  2JSO A;  3RZD H;  1HHV A;  1GGO A;  4IUR A;  1J5E L;  5DM6 3;  1LTA D;  2W6M A;  1VQ6 A;  4NZN A;  3K0Y A;  2WKC A;  4KY5 A;  4APV A;  4B3R Q;  5BWR A;  1YJN A;  1T5X D;  2AQ1 B;  4CJ0 B;  2K5H A;  2YL2 A;  5D1O B;  4HED A;  1UE5 A;  2EJF C;  4RGM A;  4LF9 Q;  4O81 A;  1GUN A;  2BA0 A;  3R5X A;  2O5J C;  5I5Y A;  4GN4 B;  1K3R A;  3NBH A;  4IQZ A;  4C5B A;  5C1O A;  4A3K H;  3NWT A;  1SE2 A;  1K28 A;  3D4W A;  1DGS A;  4HMJ A;  5M5W H;  1I6H H;  2Y0S G;  4R4I A;  3AYH B;  2GVB A;  1EYG A;  4RHR A;  1VQ7 A;  3BAC A;  2ZXO A;  1EY9 A;  5LMN W;  5IP9 H;  1STB A;  2J4X A;  1G91 A;  3VMM A;  4IFD G;  4DAV A;  4UDU C;  4QGU A;  1Q46 A;  4X66 L;  1EIH A;  3IFD A;  1C7Y A;  1FVI A;  2AKW B;  5ELE A;  3VDY A;  3TP8 A;  4XX0 B;  1KBL A;  3GV6 A;  3CQZ B;  1KNA A;  5A35 A;  1UC9 A;  4MV3 A;  4DR7 Q;  3VOT A;  4HCS A;  4J1M A;  5K36 H;  3LP8 A;  2F0L A;  1QUQ A;  5COR A;  3D4R A;  4NYE A;  2ZDQ A;  5M3M B;  1CQF A;  4R1J A;  3HKZ B;  3D4D A;  4LW1 A;  4DR3 L;  4RGN A;  2UUB Q;  2AQ3 B;  1QB5 D;  4M8A A;  4K14 A;  4UAI A;  1I2L A;  1KC8 C;  2PW5 A;  4DUZ Q;  1E22 A;  4O42 A;  4YJ3 F;  3K5M A;  1Z47 A;  1PFN A;  5FLM G;  4FFN A;  2CQA A;  3JRW A;  1CS0 A;  2MPM A;  5IGD A;  3J80 i;  3E5S A;  2COG A;  4CDE C;  2IJ0 A;  2R3Z A;  1LAB A;  3MEF A;  1FGB D;  1WFQ A;  1PFS A;  4BY1 G;  5CB4 F;  3CCU A;  3AU7 A;  1I5F A;  3U4Z A;  4CKB A;  1KIX A;  5CV8 A;  4C3H B;  4JI4 Q;  3PIO 3;  1HRJ A;  3VYR A;  2F0S A;  1C3O A;  1AP0 A;  1RKN A;  4JI1 L;  5EAY A;  1A48 A;  3NQT A;  4LUV A;  4R4Q A;  5IWA Q;  5JVD F;  1TS3 A;  5M5Y H;  4I50 F;  2JA7 G;  4A76 A;  2B8F A;  5J3B A;  1NMF A;  2YW2 A;  4JI6 L;  2ZDH A;  2UUA Q;  5LMN Q;  2WKD A;  1Q1B A;  3EVQ A;  3I4L A;  3PIP A;  5C4J B;  1A8V A;  3K5H A;  1VQP A;  4JYA Q;  2R86 A;  2ZJR A;  3RLN A;  5FO9 B;  5IP7 H;  3PO2 B;  2PBZ A;  1SN8 A;  4ZUJ A;  3PO3 H;  1N36 Q;  4YCW A;  1N8R C;  1SMY D;  3MTS A;  1KAA A;  1YNN C;  4IPH A;  3QWU A;  2SNS A;  4YWK A;  1HZB A;  3I4N G;  2BCO A;  3GTK B;  3S14 B;  1PHJ A;  4CC5 A;  4IJL A;  3MA2 B;  1CZG A;  1NAP A;  3BAA A;  3A55 A;  3HOW G;  1H95 A;  2EIY A;  4PQX A;  3MJF A;  1YJ9 A;  4L5R C;  4C5A A;  3QJY A;  2B2T C;  2XCL A;  1LLR D;  4ZYS A;  2YRX A;  2CWA A;  5J39 A;  1E4E B;  3K59 A;  2X6G A;  4JI2 Q;  3KF8 B;  4OX9 Q;  1F77 A;  1JIC A;  2HHH Q;  2WAQ G;  1XXG A;  4RKL A;  3R93 A;  4JOI A;  2Q7D A;  1SJH D;  1DOK A;  5J22 A;  2V4D A;  5EJW A;  3HRZ C;  1YI2 A;  1OBG A;  2RDF A;  2L55 A;  4DR7 L;  1HCZ A;  3T53 B;  1XNR Q;  2W6N A;  2JP1 A;  3V96 A;  4A3K B;  3S1Q B;  2DAB A;  4EEQ A;  4GZY C;  4F87 A;  3I56 A;  5I47 A;  3OPO A;  4UHV A;  2UUB L;  5FJ8 H;  5M5W B;  5JJI A;  2R7Z G;  1I6H B;  4DV1 Q;  3JRX A;  1X65 A;  4DUZ L;  4L8J A;  2OT2 A;  1SMY C;  4B9W A;  3Q23 A;  1AEX A;  2N88 A;  1NTG A;  2VXW A;  1KC7 A;  2Y4R A;  2B3G A;  5CV4 A;  2CCZ A;  5C6A A;  2KHS A;  1Z2P X;  5D8D A;  1CA6 A;  4O82 A;  3FPU B;  1TWH H;  2JE6 I;  1XDN A;  4JK1 C;  5COY A;  2K7V A;  3GTO H;  5EKL A;  3PUY A;  3UQ8 A;  4Y7N H;  2ZM6 Q;  3UDG A;  2PI2 E;  3AFP A;  5IYZ F;  2JEA I;  2RVL A;  4JI4 L;  3I72 A;  2LSS A;  3VR6 A;  3J7A F;  3A8J E;  3K81 C;  2IX0 A;  4O4L F;  2NVY H;  1SCU B;  2PVP A;  5IWA L;  3HOU H;  2BE5 D;  5FKA C;  1BQQ T;  1Y1W H;  3BYY B;  1NJI C;  3S1M H;  3FMC A;  4LUO A;  3TQT A;  5I6Y A;  4DNI A;  2UUA L;  1SYB A;  4JYA L;  3NUC A;  3D8G A;  4JV5 Q;  1D8L A;  5CV9 A;  1IOW A;  1GUW A;  1T9H A;  5JJL A;  1JDB B;  2YU9 B;  2VUM G;  3WO0 A;  1VBG A;  3QG1 A;  3D3R A;  4A3B H;  1HPC A;  5NUC A;  1HJP A;  5C4X H;  4A3E H;  1KJJ A;  3LGJ A;  3I4O A;  3FDT A;  1EU4 A;  3UDI A;  1FJG L;  2B2U C;  4KHP Q;  1KDA A;  2K28 A;  2XIW A;  1SJE D;  3DEP A;  3X3M A;  3VPD A;  2ZGI A;  2A6E D;  1GHK A;  1BVS A;  1F2Y A;  3RNU A;  1E1O A;  4AYB B;  4E6I A;  4JI2 L;  5JOB A;  5KIX A;  4JI7 L;  1PRT D;  2QA4 A;  2HHH L;  5C0X J;  1I50 B;  5DM7 3;  1EWC A;  4RCO A;  1CTM A;  1XWE A;  4UCV A;  1A0G A;  4YY3 Q;  3I12 A;  2GPW A;  1RD9 D;  5BR8 Q;  3PO3 B;  1EQQ A;  3TZU A;  1XNR L;  1JWU D;  1SNO A;  3PIO A;  4PZ8 A;  3DAA A;  4O7Z A;  1PX2 A;  1SNM A;  2VW9 A;  3PUV A;  2XRS D;  4JI8 Q;  3UYY A;  1LTL A;  2RCN A;  2SDF A;  1FR3 A;  5C3W A;  3JAM c;  3WWI A;  4XT3 B;  4KKS A;  1SAP A;  1J6Q A;  4FFP A;  5A2Q E;  3ITP A;  4QL5 A;  3OTO Q;  4KMU C;  3GV3 A;  2AWO A;  3S9W A;  3U9S A;  5LXT F;  5EPJ A;  3ND9 A;  4B9X A;  3T99 A;  3T54 A;  5KNB A;  2PMZ B;  3NEM A;  4IOA A;  1B6R A;  2ZM6 L;  3GO5 A;  1UWV A;  2J7Z A;  2VQF Q;  3F2D A;  2HQE A;  2A74 C;  2G5D A;  2WB1 G;  2Z4H A;  4PZ6 A;  3M4Q A;  1GKH A;  1IL2 A;  4R8I A;  3L3O C;  2F0W A;  4FFO A;  2RHS B;  4A3I B;  1ASY A;  4OWW B;  3ONA B;  4XXE A;  3KF6 B;  1Y14 B;  4MV6 A;  4ODG A;  1EY6 A;  4BBS G;  4G7O C;  2Z6B A;  3WWJ A;  1VBH A;  4EG0 A;  4OEM B;  3TZD A;  2KCN A;  2PQE A;  1RJT A;  2K03 A;  3O13 A;  3BVM A;  5JJK A;  2F0I A;  3FP9 A;  1VKZ A;  4CMF A;  3ETJ A;  2BA1 A;  1BCP F;  1KJ9 A;  5I5S A;  3OW2 A;  4HTP A;  4ZRZ A;  1HA6 A;  2NZ1 D;  3U9T A;  1G51 A;  1TQO A;  3GTO B;  4Y7N B;  1EZ8 A;  5IGF A;  1GSO A;  4PNY A;  3M4O H;  2PQA B;  2DLN A;  1LTG D;  4XQQ A;  3RN5 A;  4KHP L;  2NUA B;  2UXC Q;  2F0J A;  1CZW A;  3HOU B;  1I7N A;  1VQD A;  1Y1W B;  2EE1 A;  3SE0 A;  4LF4 Q;  4KHV A;  2R7N A;  4O7S A;  1VF7 A;  4PBC A;  1EY7 A;  4JOI C;  3T56 B;  4XYO A;  4YY3 L;  2K05 A;  3NBH B;  2Z9H A;  2I5H A;  4JW0 A;  2ZXP A;  1PH9 A;  1PVO A;  4NZO A;  1A9X A;  1OXX K;  3EQL C;  1B4O A;  4TSS A;  4JI8 L;  1HQR D;  1VCI A;  1KXL A;  4DNT B;  3C1F A;  4A3B B;  3MWY W;  4A3E B;  1EHI A;  1A6X A;  2HHF A;  1OTC A;  3JZF A;  1LAC A;  1GUO A;  1C48 A;  1EKV A;  2YZG A;  2JYO A;  3BZK A;  2QW7 A;  1M8A A;  1NBW A;  1EWH A;  5M3M G;  1GVP A;  1Q86 C;  1RL2 A;  3BDC A;  3JC6 6;  3CMA A;  3PF5 A;  4DAP A;  2B2W A;  5DLQ E;  1KL9 A;  4FFR A;  1SE4 A;  1N32 Q;  5KYI A;  2YTV A;  1M1K C;  4DK1 A;  2VQF L;  2ID0 A;  4HTH A;  1XPU A;  2X6L A;  1UAP A;  5D3I B;  4A3C H;  1B04 A;  4LAA A;  2DGY A;  4JI5 L;  1I4G A;  4KI0 A;  1R4Q B;  3NPP A;  1JB7 A;  4HN2 A;  4DV6 Q;  1T36 A;  2P5Z X;  2F0Q A;  1E0B A;  5J2T F;  5AJ3 L;  2EQS A;  1CQV A;  4H13 C;  2N78 A;  2HGS A;  5E3F A;  1L0Y B;  2WV6 D;  4C3H G;  1DON A;  2QB5 A;  5EBC A;  3S16 H;  1W93 A;  1H9S B;  4K6N A;  1IXR A;  3JZI A;  5M3F B;  4LFC Q;  4ULL A;  3X3N A;  1OXT A;  1Y8O B;  2KCT A;  3K58 A;  1H9J A;  2NN6 G;  4IPC A;  1AN8 A;  2YRW A;  3TSS A;  4RWS C;  2ODT X;  3TY9 A;  1I4X A;  5GAE C;  4OXP A;  3SR1 A;  3GTG B;  1PZI D;  3PO2 G;  3G6J B;  1TVX A;  4GOP C;  3BVG A;  3S1R H;  4ZKC B;  1KJ8 A;  1ROD A;  5DEH A;  3RV4 A;  1YBY A;  1E4E A;  5GRO A;  4CDC C;  4KJN A;  1R4P B;  1QJO A;  4IZO A;  4JG2 A;  1K8G A;  4LF4 L;  3I55 A;  4A93 G;  4OIK A;  1S72 A;  5A2Q L;  4A3J B;  1RTN A;  3OUU A;  2BDN A;  2PW7 A;  2Z6K C;  1A3V A;  4B3M L;  1SFO B; 
#chains in the Genus database with same CATH homology
 3AFQ A;  4POF A;  1VQO A;  3J81 c;  3K0X A;  1GM5 A;  1EUJ A;  4JI3 Q;  4BBR H;  2D62 A;  2K50 A;  1HZ9 A;  1WCM H;  1EIY B;  4YCU A;  2UXD L;  5IYD H;  5E7N A;  3H0G H;  1LUZ A;  4GS3 A;  5GQO A;  4HJ8 A;  3HKS A;  5IYB H;  1NY4 A;  1SE8 A;  3GDE A;  5D1P A;  1X9N A;  4DV5 L;  4JBW A;  3K8A A;  3B6Y A;  3ULP A;  2R92 H;  3SGI A;  3CC4 A;  1S40 A;  3KDF A;  3I7F A;  1K73 C;  4JI1 Q;  3M85 A;  4LF5 Q;  1MJE A;  3RZD H;  2BH8 A;  4JI0 Q;  1VQA A;  4P75 A;  3I4N H;  1PH7 A;  1J5E L;  1B70 B;  1P8L A;  2OTL A;  4AQY Q;  4GKK L;  4UCO A;  1VQ6 A;  1N32 L;  1X55 A;  3M9B A;  4APV A;  4B3R Q;  1YJN A;  3HOW H;  1WJJ A;  3KYH C;  3K7U C;  4A3I H;  4C2M H;  3RTX A;  4GNX C;  2K5H A;  4OWT B;  3S15 H;  4LF6 Q;  4B3S Q;  5D1O B;  1UE5 A;  4LF9 Q;  5IP9 G;  2K75 A;  3U4V A;  3BJU A;  2BA0 A;  4MNO A;  3J80 c;  3S24 A;  4GN4 B;  1K3R A;  4DV6 L;  1L2F A;  5LMU L;  4A3K H;  1V43 A;  1CSP A;  1K9M C;  4DV0 Q;  1VQ4 A;  2Y0S E;  4DR2 Q;  3U50 C;  1VQL A;  1DGS A;  4B3M Q;  4JC0 A;  4DAY B;  3F2B A;  4A3M H;  2PI2 A;  1XMQ L;  1KQS A;  5M5W H;  1MJC A;  1XMO Q;  4K0K Q;  2YYZ A;  2CFM A;  1I3Q H;  3TRE A;  1I6H H;  2Y0S G;  1PA6 A;  2JEB I;  3AEV A;  3PGZ A;  3W1B A;  1U5K A;  2KCM A;  4R4I A;  1L0W A;  4DV7 Q;  3AYH B;  2GVB A;  1EYG A;  1VQ7 A;  2MNA A;  4LF7 Q;  3NEN A;  5LMN W;  5IP9 H;  2JA6 H;  3J81 i;  2PNH A;  3HOY G;  4LFC L;  4A3C G;  4DR6 L;  4DR4 L;  1V9P A;  2R7Z H;  3MXN B;  1HNZ L;  4IFD G;  5IE8 A;  3HFZ B;  1MKH A;  2C35 B;  3ERS X;  3A74 A;  3G48 A;  3HKZ E;  1HNX Q;  4NXN Q;  1KRS A;  4QGU A;  1Q46 A;  4P74 A;  4X66 L;  2MO0 A;  4LH7 A;  3OYY A;  1L1O C;  4DV2 Q;  1GO3 E;  1FVI A;  4X64 L;  2D0O A;  1C7Y A;  3M3Y H;  2AKW B;  3HKZ G;  3VDY A;  3HOV H;  3KLW A;  1J5E Q;  4E6N A;  4LWC A;  5FPO A;  3H3V H;  5LMN L;  4DR7 Q;  3STB D;  3RN2 A;  1EOV A;  1X3E A;  2Q2H A;  1QUQ A;  5H1S E;  4DK6 C;  4JBJ A;  2OCE A;  4R1J A;  3HOY H;  4LW1 A;  4DR3 L;  1PYB A;  2UUB Q;  4X6A H;  4GLV B;  4CC6 A;  1Y1V H;  1JJG A;  1KC8 C;  1N36 L;  4A3L H;  3EBE A;  4DUZ Q;  1E22 A;  4RMF A;  3NEL A;  1A62 A;  1Z47 A;  4NB3 A;  4HJA A;  1JT8 A;  5FLM G;  2GN5 A;  3T1H Q;  4DAM A;  4HIK A;  4R4T A;  1N33 L;  1JJ2 A;  4JI3 L;  3KJO A;  5JEA G;  4AYB G;  3J80 i;  4IPD A;  3S17 H;  1QVC A;  1TXY A;  4R4O A;  5C44 H;  3MEF A;  1WFQ A;  4BY1 G;  1PFS A;  4GOP B;  1P16 A;  1YNX A;  3CCU A;  3PCO B;  1I5F A;  3U4Z A;  3UE1 A;  1VQM A;  1PH2 A;  1XNQ Q;  3ICE A;  5IP7 G;  1PH1 A;  1RIP A;  1KIX A;  2JA5 H;  4DR4 Q;  3PO3 G;  4JI4 Q;  4OX9 L;  2QGQ A;  1HNZ Q;  2VUM H;  2NN6 I;  4JI1 L;  5EAY A;  1V1Q A;  4LUV A;  1Q81 C;  2XGT A;  4R4Q A;  5IWA Q;  4NXM Q;  5M5Y H;  2NZH A;  3CCE A;  4A76 A;  2JA7 G;  5J3B A;  4AQY L;  1NMF A;  2UU9 Q;  2JK8 A;  4BBR G;  3GJX B;  4RG1 A;  4JI6 L;  1WCM G;  5LMN Q;  1N34 Q;  2UUA Q;  1Q1B A;  2FXQ A;  2VZA A;  3PIP A;  3S2D H;  3CAM A;  3K80 C;  4BXX H;  1A8V A;  4EFE A;  1VQP A;  4JYA Q;  4LF6 L;  4B3S L;  5IYB G;  2ZJR A;  3RLN A;  5IP7 H;  1TAE A;  2VNU D;  4A4I A;  2CQO A;  3TQY A;  2HIX A;  4HID A;  4DV1 L;  1SN8 A;  4DR3 Q;  3PO3 H;  2R92 G;  3PUZ A;  1N36 Q;  4YCW A;  3KF6 A;  4ME3 A;  2E2J H;  1N8R C;  4DV0 L;  2JA8 H;  4UP9 A;  4DR2 L;  1K0R A;  2E2I H;  4IPH A;  4HJ9 A;  1TWA H;  4YWK A;  1HZB A;  1TWG H;  2JA7 H;  3I4N G;  4K0K L;  1XMO L;  2CKZ B;  4TVA B;  1HR0 W;  3F8T A;  1JMC A;  5M3F H;  1N33 Q;  1TA8 A;  1PHJ A;  4CC5 A;  4IJL A;  4GLX A;  2OQ0 A;  1JE5 A;  1UE7 A;  4DV7 L;  3BAA A;  3FHW A;  1H95 A;  3HOW G;  1XK5 A;  4EFB A;  1YJ9 A;  4L5R C;  1NMG A;  4A3I G;  2E5L Q;  1OXV A;  4JBK A;  1YEZ A;  3PSI A;  4LF7 L;  3J7A 5;  3TRZ A;  4IFD J;  2F4V Q;  3F2C A;  1PH8 A;  1VQ8 A;  2CWA A;  2Q2U A;  2HT1 A;  1QZH A;  1PH3 A;  2WAQ E;  3GTG H;  3JSN A;  4JI2 Q;  4DR5 L;  4DKA C;  3KF8 B;  4OX9 Q;  4NXN L;  1HNX L;  1HR0 L;  2EIF A;  2A19 A;  1VQN A;  2HHH Q;  4A3K G;  2WAQ G;  2R93 H;  1K83 H;  1JJC B;  1SRO A;  4JOI A;  4DV2 L;  3RR5 A;  1OXS C;  2PQA A;  1YIT A;  3BA9 A;  5C0X G;  1YI2 A;  1XTD A;  2WP8 J;  4GKJ Q;  4A3M G;  1C0A A;  4DR7 L;  4OO1 G;  1XNR Q;  3GTJ H;  1PH4 A;  4A3J H;  4JI6 Q;  4GN3 B;  5D1O A;  5GAD C;  4JV5 L;  4EEQ A;  3GTL H;  3ER0 A;  3I56 A;  1AE3 A;  2E2H H;  1N9W A;  1SFO H;  4PMW A;  1KHI A;  2CWP A;  3IRB A;  1KRT A;  5FJ8 H;  2UUB L;  2JA6 G;  1GD7 A;  1VQF A;  5JJI A;  2R7Z G;  3W1G A;  4J15 A;  4P72 A;  3CCJ A;  4DV1 Q;  4IOC A;  3CCL A;  1X65 A;  4A3G H;  3E9I A;  4DUZ L;  4GN5 A;  3I2Z A;  2ES2 A;  3EN2 A;  3CC7 A;  5GAG C;  1NTG A;  3T1H L;  3HOU G;  3QWU A;  2B3G A;  2CCZ A;  1Y1W G;  4PG3 A;  1TWF H;  2NVX H;  3HOV G;  3ULJ A;  2UUC L;  2HVS A;  1TWH H;  1L1O B;  4X65 Q;  2JE6 I;  3HOX H;  4LNQ A;  3EIV A;  3PUX A;  2E5L L;  3NC0 B;  5K36 G;  1G6P A;  1XDN A;  1FGU A;  4QQB X;  3GTO H;  3PUY A;  1XNQ L;  2A1A A;  4Y7N H;  2KHI A;  2ZM6 Q;  3UDG A;  4DR1 Q;  2PI2 E;  4UCU A;  3AFP A;  3UQ8 A;  2JEA I;  3CPF A;  3RLF A;  4JI4 L;  1X6O A;  2LSS A;  3M7N A;  4IFD I;  1Y1V G;  4DR5 Q;  4KHZ A;  1WOC A;  3K81 C;  2IX0 A;  4A3L G;  1HR0 Q;  1HZC A;  2NVY H;  3D31 A;  5IWA L;  4FDB A;  4NXM L;  3HOU H;  4X62 Q;  1XPR A;  1UE6 A;  1Y1W H;  4WJ3 M;  2UU9 L;  4POG A;  5BR8 L;  1NJI C;  4A3E G;  4P71 A;  3WWV A;  2ZJQ A;  4LUO A;  3CW2 C;  3S1M H;  4WJ4 A;  1VQK A;  4DNI A;  2UUA L;  3VNN A;  1N34 L;  3HOZ G;  4LF8 L;  2VS1 A;  2OWO A;  3G71 A;  3GTP H;  5C44 G;  4JYA L;  4JV5 Q;  2JA9 A;  1D8L A;  2K5V A;  1T9H A;  2JA5 G;  5JJL A;  2VY3 A;  4YCV A;  2VUM G;  3OTO L;  2HVQ A;  1E1T A;  4AYB E;  2Q2T A;  4O0A A;  4XTC S;  4A3B H;  2AMC B;  2VQE Q;  1NE3 A;  4P73 A;  1AE2 A;  1HJP A;  4XIG S;  5C4X H;  2ZTC A;  4A3E H;  3CD6 A;  3TY5 A;  2UUC Q;  2OTJ A;  1IYJ B;  3LGJ A;  3HOZ H;  3I4O A;  3UDI A;  3TY8 A;  1FJG L;  4KHP Q;  2UXB Q;  3JSL A;  3KOJ A;  2F4V L;  4A3F G;  1BVS A;  1EFW A;  1QUQ B;  2K14 A;  3RNU A;  1E1O A;  4L5T A;  2H5X A;  3CQZ H;  3CCR A;  5IY0 A;  1IZ6 A;  2I0Q A;  4JI2 L;  1Q82 C;  4JI7 L;  3NBZ B;  2QA4 A;  1SMX A;  2HHH L;  5C0X J;  2OQK A;  3TS2 A;  2B29 A;  2JA8 G;  2IY5 B;  4UCV A;  1VQG A;  5M3M H;  3CP0 A;  4YY3 Q;  4GKJ L;  1VQ9 A;  5FPR A;  3D0F A;  2ALY B;  1U0L A;  2ZTD A;  4UPA A;  2NZO A;  5BR8 Q;  5M3F G;  2KEN A;  4NPS A;  1EQQ A;  1M90 C;  1YHB A;  3STB C;  1XNR L;  3PIO A;  2D0P A;  1EQR A;  1WYD A;  3W5O A;  1X56 A;  2KBN A;  4PZ8 A;  4LF8 Q;  4UCR A;  4C3I H;  2VW9 A;  2HIV A;  3PUV A;  4JI8 Q;  4R4C A;  1YHQ A;  1YJW A;  2PMZ E;  1LTL A;  3UDF A;  4A3D G;  3PN1 A;  2I5L X;  2RCN A;  4A3F H;  3JAM c;  3CCS A;  3A0J A;  1J6Q A;  3I4M H;  4JBM A;  3BU2 A;  4QL5 A;  1VQB A;  3OTO Q;  3BZC A;  2R93 G;  1X3F A;  2AWO A;  2K5N A;  5M5X H;  1YIJ A;  1HNW Q;  3M4P A;  1S3O A;  3DM3 A;  1PV4 A;  4HJ7 A;  4X65 L;  4C3H H;  3NBY B;  5GAH C;  4A3J G;  3NEM A;  2UXC L;  5ELO A;  4IOA A;  1BBW A;  1MIU A;  1FJG Q;  1Q1E A;  4QIW E;  4HJ5 A;  2ZM6 L;  1UWV A;  2N49 A;  3GO5 A;  2VQF Q;  4DR1 L;  4A3D H;  3F2D A;  3F1Z A;  2VUG A;  2GVA A;  2YTY A;  4B3T Q;  4YWL A;  5FJ8 G;  4LFA Q;  2WB1 G;  4PZ7 A;  1CKN B;  1GKH A;  2IHF A;  3M4Q A;  1CUK A;  4PZ6 A;  2R6G A;  4GNX B;  4JI7 Q;  2QEX A;  1IL2 A;  1IBM Q;  4A3G G;  5HGQ A;  4DV4 Q;  4YHH Q;  3L7Z C;  5IT9 c;  2RHS B;  1ASY A;  4L5Q A;  4X62 L;  4HTO A;  4OWW B;  1B7Y B;  5C0X I;  3GTM H;  3KJP A;  2JQO A;  1Y14 B;  3KF6 B;  3PO2 H;  4BBS G;  3Q8D A;  1PH6 A;  1ASZ A;  4C3J H;  1SR3 A;  4JCV E;  3HOX G;  1FL0 A;  4OO1 I;  1VS0 A;  2HQL A;  2XTI A;  1Q7Y C;  5DIS C;  2A8V A;  1A0I A;  2Z0S A;  5JJK A;  2IHE A;  3A5U A;  4ALP A;  3FP9 A;  2MQH A;  1E7Z A;  3GTK H;  2BA1 A;  3U58 A;  1BBU A;  2V1C C;  5IYC H;  2AWN A;  4EX5 A;  3OW2 A;  3GTQ H;  4HTP A;  3S14 H;  4A93 H;  3FKI H;  1VQE A;  2E8G A;  2IT1 A;  4YWM A;  1G51 A;  3PV0 A;  4IPG A;  5FLX c;  4UP8 A;  4HIO A;  1QZG A;  5JEA J;  5C3E H;  2VQE L;  1L1O A;  4QJF A;  3KDF B;  2K52 A;  4BBS H;  3JAM i;  3M4O H;  1LYL A;  2MO1 A;  2PQA B;  3UE0 A;  3CXC A;  3T1Y Q;  4UCT A;  4DV3 Q;  4DUY L;  3H3V I;  3H15 A;  1YZ6 A;  3DLL A;  3RN5 A;  2F3I A;  4KHP L;  2UXC Q;  2UXB L;  3L2P A;  4DPG A;  1HH2 P;  4UFZ A;  4QY7 A;  1VQD A;  1IBL Q;  3L0O A;  4AIM A;  3CPW A;  4JI0 L;  4LF4 Q;  2N8N A;  1K8A C;  3TEH B;  1YHA A;  1VQC A;  1I94 Q;  1IBK Q;  4JOI C;  4HIM A;  1UE1 A;  1SRU A;  4IO9 A;  3S1Q H;  3G6E A;  3G4S A;  1C9O A;  4YY3 L;  3NBH B;  4A3B G;  1KAW A;  3GD7 A;  2I5H A;  1PH9 A;  3PF4 A;  2NVQ H;  5C4X G;  3A5Z B;  4Y52 H;  1PVO A;  2B63 G;  3J7Z C;  1OXX K;  5HY6 A;  1W3S A;  2UXD Q;  3BA8 A;  1A63 A;  3BAB A;  1CKO A;  2KHJ A;  4JI8 L;  3KFU A;  4DRF A;  1VCI A;  1KXL A;  4BA1 I;  2YTX A;  3E9H A;  1VQI A;  4DV5 Q;  2R7F A;  1OTC A;  3RLO A;  3TS0 A;  3PUW A;  3BZK A;  1Q8K A;  3RZO H;  4AH6 A;  3CME A;  1HNW L;  4OON A;  3GB8 B;  1NBW A;  3CF5 A;  1S68 A;  3UDX A;  5M3M G;  1GVP A;  1Q86 C;  1RL2 A;  3JC6 6;  3CMA A;  3PF5 A;  1VQ5 A;  5DLQ E;  4GKK Q;  1E24 A;  1CSQ A;  1KL9 A;  2Q2I A;  4GOP A;  1SLJ A;  4H02 A;  2B63 H;  3S2H H;  2IX1 A;  4DUY Q;  1N32 Q;  2YTV A;  1W2B A;  2L15 A;  3J81 j;  2VQF L;  1M1K C;  4LFB L;  2ID0 A;  2HVR A;  1XPU A;  4IJH A;  1XPO A;  1LM0 A;  1YVC A;  4B3T L;  4A3C H;  2DUD A;  1B04 A;  4JI5 L;  2DGY A;  3CCQ A;  1PYS B;  4LFA L;  1EWI A;  3CCV A;  4KI0 A;  5ELN A;  3I4M G;  1IBM L;  4DV4 L;  2LXK A;  4YHH L;  1TWC H;  2RHQ B;  3ULL A;  3ZJY C;  5LMU Q;  2ZJP A;  4DV6 Q;  1JB7 A;  3E0E A;  5AJ3 L;  2EQS A;  2LXJ A;  2Z6K A;  1QVF A;  1UEB A;  2N78 A;  1XMQ Q;  1Q12 A;  4BY7 G;  3CC2 A;  2YU9 H;  1CKM A;  4TQU S;  3S16 H;  2F52 A;  2AHO B;  2EXD A;  1X3G A;  1B8A A;  4DK3 C;  1BKB A;  1IXR A;  3K7A H;  2ATW A;  4LFC Q;  1AH9 A;  2VL6 A;  4DR6 Q;  4LUZ A;  1OXT A;  2KCT A;  4EQ5 A;  4GLA C;  2YV5 A;  2NN6 G;  4IPC A;  3S1N H;  2JJQ A;  1QVG A;  4LF5 L;  2MFI A;  4X66 Q;  2K4K A;  4UP7 A;  5FLM H;  2I5M X;  4BXX G;  3TY9 A;  2R7D A;  4X64 Q;  5GAE C;  4L5S A;  4OXP A;  4BA2 I;  3PO2 G;  3AQQ A;  2ASB A;  4GOP C;  3T1Y L;  3S1R H;  4BY7 H;  1XJV A;  1VQH A;  1E3P A;  1EIF A;  2ZTE A;  4MTN A;  5IYD G;  4DV3 L;  4B3R L;  1VQJ A;  3H0G G;  1R9T H;  1I50 H;  2BH2 A;  4KLK A;  1YBY A;  4BY1 H;  5GRO A;  2NVT H;  2WB1 E;  1WI5 A;  1IBL L;  4LFB Q;  1KD1 C;  1CKN A;  4LF9 L;  4JG2 A;  1K8G A;  1O7I A;  4LH6 A;  1X54 A;  4O2D A;  4GNX A;  4LF4 L;  3I55 A;  4A75 A;  3CCM A;  4OWX B;  4JI5 Q;  4A93 G;  1G29 1;  5IYC G;  1I94 L;  2N3S A;  1IBK L;  4UY8 C;  1HZA A;  3FKI G;  1S72 A;  1OXU A;  2WFW A;  1D7Q A;  4UCS A;  1Z9F A;  2RF4 A;  2Z6K C;  4MZ9 A;  5C4J H;  4B3M L;  5AJ3 Q;  5C3E G;  1PH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...