3W1GA

Crystal structure of human dna ligase iv-artemis complex (native)
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
599
structure length
583
Chain Sequence
b'TSQTVASHVPFADLCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHKDVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTGDFAMIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISITLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKGTKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNEAIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEYVSMDELDILIVGGYWGKGSGMMSHFLCAVAEKPPPSVFHTLSRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILCGTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLEQLRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA ligase 4
publication title Structure of the catalytic region of DNA ligase IV in complex with an artemis fragment sheds light on double-strand break repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 175
structure length 583
sequence length 599
ec nomenclature ec 6.5.1.1: DNA ligase (ATP).
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain
A PF04675 DNA_ligase_A_N DNA ligase N terminus
A PF04679 DNA_ligase_A_C ATP dependent DNA ligase C terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3260.10 Mainly Alpha Orthogonal Bundle DNA ligase i, domain 1 DNA ligase, ATP-dependent, N-terminal domain 3w1gA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3w1gA03
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3w1gA02
5D1OB 3UDGA 3H0GG 2HIVA 4YY3Q 3A5ZB 1P16A 5IYDH 3K80C 3RLOA 4GN4B 1SRUA 4X62Q 3CP0A 2VUMG 3HOWG 1TA8A 3HFZB 1Q8KA 4IPGA 4QIWE 4QL5A 5FLXc 3RR5A 1PHJA 4A93H 1XJVA 3CF5A 3BZKA 2F4VQ 1A63A 4EX5A 1VQNA 1VQOA 2OWOA 4HIDA 4A3GG 4B3TL 1V43A 3LGJA 1SFOH 4LF5L 4JG2A 4IPHA 4LF6L 2XTIA 4HJAA 1E1TA 3WWVA 1N8RC 4JOIC 1I94Q 3MXNB 2KCMA 1WI5A 1OXTA 1SROA 4B3SL 5LMUQ 3F8TA 3I4OA 3PGZA 2BH2A 2UXCL 4C2MH 3CMEA 4LWCA 4HIMA 4HIOA 1XMQL 3KJPA 2K5NA 1YJNA 1PH8A 3J7A5 1OXVA 1EIYB 3S14H 5JJKA 2KBNA 1N36Q 1HZBA 2EIFA 1WCMG 1EFWA 4UCOA 4A3LH 4PG3A 1VQMA 2PNHA 5GROA 1NJIC 4NXMQ 4BY7G 5AJ3Q 4EFBA 4A3BH 4UCVA 3DLLA 4DR2L 3K81C 3FKIG 3PUXA 4JI0L 3M4OH 2ZTDA 5E7NA 3S16H 2R92H 1NMGA 2MFIA 4LUZA 4JI4Q 4GN5A 3KFUA 1CKNA 1A0IA 1Y1VH 4J15A 4R1JA 1EIFA 3J7ZC 2UUCL 3S15H 1HNWQ 2UXDL 2UU9Q 4NXNQ 1PH2A 4KHPL 2ES2A 4YWMA 1SN8A 3K8AA 1I5FA 2NN6G 4A3FG 2GVBA 2YTVA 1XNQL 5M5YH 4A3IG 2Z6KA 3PCOB 3S1RH 5GADC 2NVXH 2CFMA 4DPGA 4JBMA 4LFAL 4OX9L 2UUAL 2ZJPA 5JJIA 3HOXH 4LH7A 3I4MH 3A74A 2DGYA 4B3TQ 3HOVG 2R93G 3RN2A 4LF5Q 1N32L 4DR1L 1PYSB 5C0XG 4A3EG 4LF6Q 3S2DH 1WYDA 2CWAA 1YZ6A 1XNRL 3PIPA 5IWAL 4JYAL 1TAEA 5H1SE 3RZOH 1A62A 1P8LA 3GTPH 1HJPA 3PO3H 4DR4L 4JI1L 4X6AH 4OONA 3NEMA 4B3SQ 4LUOA 4HJ9A 2N49A 2UXCQ 1XMQQ 1M1KC 1YJ9A 3EN2A 2K4KA 1YEZA 5IP9H 2D0OA 1KD1C 3HOZG 1TWGH 3PN1A 3K0XA 4DK6C 3D31A 5C0XJ 3PF5A 2B63G 2VZAA 1WJJA 1PH7A 3GB8B 4OWTB 1G51A 3AQQA 1PH6A 1UEBA 3TS0A 2JA6H 4O2DA 1D7QA 1VQFA 4IJHA 4DR2Q 4UCSA 1VQEA 5M3MH 1QZHA 1FGUA 4JI0Q 4X65L 4BBSG 1KRSA 1KC8C 4P73A 5DISC 2CCZA 4B3ML 4MTNA 4YY3L 3KF6B 4HJ8A 2UUCQ 3GTQH 4LNQA 2UXDQ 4IFDG 3KJOA 4A3CH 3KLWA 4KHPQ 1E1OA 1G291 1YI2A 3KF8B 4PZ6A 2VUGA 2HVRA 1Q7YC 4B3RQ 1HZCA 1VQLA 3PO2G 1BVSA 2B3GA 2JA7H 4Y7NH 3CCJA 1XNQQ 5GAGC 4CC6A 4OX9Q 3AYHB 3TREA 1VQ4A 2UUAQ 3GJXB 3S1QH 2WAQE 1X3EA 3STBC 4UCTA 3KOJA 4CC5A 2ZJRA 1L1OA 3GTMH 4IFDJ 1N32Q 4DR1Q 2K5VA 5EAYA 2VW9A 1XNRQ 3I4NH 5IWAQ 4JYAQ 4UPAA 5M5XH 3PV0A 3G48A 4JI1Q 5ELNA 1IBMQ 4DR4Q 3NELA 2KCTA 4GOPA 4LFBL 2LXJA 2WAQG 3BZCA 4RMFA 1YIJA 3TY5A 1AE3A 4GS3A 5M5WH 1VCIA 4X64L 3QWUA 1PH4A 2D0PA 1Q82C 2IHFA 3HOYH 1PH1A 1E7ZA 2YTXA 2HQLA 4JBJA 2N3SA 3BABA 1EQRA 3TEHB 1BKBA 2NZOA 1VQPA 1QUQA 1GO3E 2RF4A 4AYBG 1GM5A 2HHHL 4JI7L 1BBUA 1VQGA 4JI2L 2LSSA 5C3EG 2OQ0A 4IPCA 5C44G 4X65Q 2UU9L 4A3JG 4BY1H 3MEFA 4OXPA 2ZM6L 4B3MQ 3EIVA 2QEXA 4HJ5A 1XDNA 3VNNA 4IJLA 4L5RC 4C3IH 2KHIA 1MKHA 3H0GH 2JQOA 1LYLA 1L2FA 4DV2L 1PYBA 4POGA 2JEAI 3BAAA 2PI2A 1YVCA 3HOWH 1IXRA 2I5HA 4TVAB 2Q2HA 4DV4L 1VQAA 4XIGS 3ZJYC 3K7UC 1ASZA 1J6QA 3GTOH 1N34L 1Y1WG 4JBWA 2K14A 3G6EA 3UDFA 4JCVE 1X54A 4A3GH 1NE3A 4JI8L 2HT1A 4C3HH 3AFQA 4P71A 1K8GA 2PQAA 1PA6A 2VQFL 3E9HA 1NMFA 4Y52H 1S72A 4JI5L 2I0QA 4DUYL 1GVPA 1RIPA 3RLNA 1VQ5A 1AH9A 1K3RA 5IYBG 4DV1L 1M90C 4YCUA 2CKZB 3HOUH 4DR6L 3TY8A 4LFBQ 4QJFA 4GNXB 4H02A 1SR3A 4UP8A 4X64Q 4GNXC 2OTLA 1WFQA 4HTOA 3CC4A 4YWKA 2Q2UA 2IY5B 3F2CA 4BY7H 2AMCB 2NVQH 1Z9FA 2IX0A 1X55A 2VQEL 2HHHQ 4JI7Q 1A8VA 4KHZA 2AKWB 2VL6A 3CPWA 2UUBL 2H5XA 4GLVB 4JI2Q 1FL0A 1KRTA 2V1CC 2E8GA 1OXSC 3UDXA 2PI2E 3F2BA 2NVYH 3HKZE 1HNZL 1JJCB 3NC0B 2ZM6Q 1I50H 3CCVA 4PZ8A 4A3BG 3A5UA 2YYZA 3PUVA 2R7ZH 4YCVA 4DV2Q 4DAMA 5FJ8G 4A3FH 4AH6A 1HNXL 2R92G 5C4JH 3CQZH 4L5QA 4DK3C 3HKZG 4DV4Q 1K8AC 5D1OA 1YJWA 3PSIA 1Y1VG 3OTOL 1N34Q 3S2HH 5LMNL 1KL9A 3L2PA 3CD6A 1C9OA 3HOVH 4FDBA 4JI8Q 1VQ9A 3JSNA 4E6NA 4P72A 5JEAG 3W1BA 1IBML 3CCSA 1VQJA 4TQUS 5FLMG 2VQFQ 5ELOA 1YBYA 2JA5H 4JI5Q 4LW1A 4DUYQ 3I7FA 2JA8G 2K50A 4A3DG 5K36G 1J5EL 3FP9A 3G4SA 2ID0A 4OO1I 1L1OC 1Q46A 3HOXG 3RLFA 4DV1Q 1K9MC 4DV3L 5IE8A 3I4MG 1CUKA 4DR6Q 1JT8A 2GN5A 3ULJA 3OYYA 4BBRH 2HVQA 1I6HH 2IX1A 1EUJA 1K0RA 5IYCH 1PV4A 3BA8A 1TWCH 1D8LA 2B63H 4JI3L 4BXXH 3PO3G 1UE6A 3G71A 3H3VH 3CW2C 4OWWB 1GKHA 4A4IA 1VQ6A 4LH6A 2VQEQ 1LUZA 3F2DA 2E2IH 4AQYL 2UUBQ 2UXBL 4WJ4A 5IP9G 1YHAA 3PUYA 1E22A 4R4IA 1OXXK 1TWAH 2Y0SE 4X66L 5M3FG 4DR5L 4LFCL 1HNZQ 1IBLL 4A3KH 4B3RL 4EFEA 1WOCA 3CC7A 4C3JH 4GKKL 3AFPA 1S40A 4IOAA 3E0EA 3RTXA 2JA6G 4JC0A 2ALYB 1EYGA 4NB3A 3D0FA 5M3MG 2YU9H 1B8AA 4R4OA 2ATWA 3M3YH 3PO2H 1NTGA 1UWVA 4BA2I 4KLKA 1HNXQ 4POFA 3H15A 2Y0SG 1QZGA 1N33L 1Z47A 3OTOQ 1KXLA 3FHWA 5LMNQ 3GTJH 3U4VA 2F3IA 4A3CG 4A3MG 5C4XG 1B04A 5LMNW 4AYBE 2I5MX 4MZ9A 2WFWA 2JA7G 1K73C 3PUZA 1B7YB 1J5EQ 5IY0A 2Q2IA 1JJGA 4DV3Q 1KIXA 3UE1A 1JB7A 3E9IA 4GN3B 1PH9A 4LF7L 3TY9A 2Z0SA 4LF8L 1JMCA 2IT1A 1N9WA 3JAMi 3I4NG 4JI3Q 1SE8A 3UE0A 3CCEA 4R4TA 1C7YA 1MJCA 2N78A 1SLJA 5C3EH 3CXCA 3S1NH 4OWXB 3I56A 2R6GA 3CCRA 2VNUD 1U5KA 1IZ6A 4AQYQ 3CCLA 2UXBQ 5D1PA 3S17H 4XTCS 4L5SA 3HOYG 2VY3A 5IP7G 1VQ8A 2RHSB 4X66Q 3J81i 4DR5Q 1QVGA 1CKNB 1IBLQ 4LFCQ 1AE2A 2CQOA 2VUMH 1IBKL 3HKSA 1BBWA 3GTGH 4GKKQ 1QVFA 3TRZA 4O0AA 4IPDA 2RCNA 3OW2A 2E5LL 1UE5A 2DUDA 2EXDA 5BR8L 1EOVA 3KF6A 2ZJQA 1H95A 1Y14B 3W5OA 3GDEA 3K7AH 1XPUA 3TS2A 1E24A 4UP9A 1Y1WH 1MIUA 2Z6KC 1N33Q 3JC66 5IYDG 2K75A 2JEBI 3U4ZA 2Q2TA 2XGTA 1OXUA 4DV7L 1XMOL 1UE7A 2I5LX 4UP7A 5C0XI 2EQSA 4A93G 1VQ7A 4HTPA 1EWIA 3I55A 3CMAA 4DV6L 4HIKA 1MJEA 3ICEA 3CCMA 4A76A 4GKJL 3T1YL 3BU2A 2K52A 3W1GA 4K0KL 4AIMA 2R7DA 1X6OA 5IYBH 2JA8H 4LF4L 1YNXA 3J81j 4LF9L 1WCMH 4DV5L 4DAYB 1VQDA 4UCUA 4LF7Q 1KHIA 3CCUA 1FJGL 4P74A 4LF8Q 2KHJA 3RNUA 1HZAA 3FKIH 3CCQA 1VQKA 2KENA 2WB1E 4IO9A 3GTKH 1DGSA 2JK8A 1LTLA 1VS0A 1LM0A 3HOUG 2ZTCA 4ME3A 4YWLA 1UE1A 2E2JH 4A3LG 2ASBA 4DV0L 1YHQA 1X3FA 2CWPA 5FPRA 1VQCA 5HY6A 5GAEC 1OTCA 4DRFA 1V9PA 4KI0A 4A75A 3IRBA 4IFDI 2WB1G 2FXQA 4UCRA 1IBKQ 4MNOA 3KDFA 2YV5A 4GLXA 4A3IH 1TWFH 1Q86C 2E5LQ 3L0OA 5FJ8H 5BR8Q 3AEVA 1NBWA 4EQ5A 1W3SA 4UY8C 2R93H 1SMXA 4APVA 1VQBA 4YHHL 2ZTEA 4A3EH 3JSLA 1CKMA 4PMWA 1YITA 1KQSA 2F52A 1HZ9A 4DV7Q 1XMOQ 3Q8DA 2R7ZG 1L1OB 4L5TA 5FLMH 4JOIA 4LUVA 1IYJB 3STBD 5HGQA 4DV6Q 1PH5A 2L15A 1IL2A 2NVTH 3PIOA 2HIXA 3T1YQ 2BA0A 1JJ2A 4JI6L 4A3DH 4GKJQ 4K0KQ 4JV5L 2R7FA 4DUZL 3RZDH 1RL2A 3DM3A 3HOZH 2AHOB 3BJUA 4LF4Q 5JEAJ 4DKAC 4GOPB 3CPFA 4LF9Q 2A8VA 1R9TH 1S68A 3F1ZA 4GOPC 1K83H 3NBYB 4QGUA 4DV5Q 3UQ8A 3KYHC 4ALPA 1QVCA 1EQQA 1FJGQ 2JA5G 2MQHA 2MO1A 1NY4A 4P75A 3ULLA 4QY7A 3A0JA 3M4PA 4GNXA 4JBKA 4BBSH 4DR7L 2N8NA 2AWOA 1ASYA 5FPOA 1QUQB 1Q81C 3ERSX 2A1AA 2JA9A 1X65A 3NENA 3RN5A 1W2BA 4GLAC 2GVAA 3U50C 4BBRG 5IT9c 1U0LA 2WP8J 3T1HL 1XPRA 1HR0L 3M4QA 4R4CA 5IYCG 5M3FH 4DV0Q 1PVOA 2QGQA 1HH2P 4BXXG 3GD7A 1XTDA 3CC2A 1JE5A 4RG1A 4DR3L 2HVSA 3S24A 5GAHC 3JAMc 3GTLH 1CSPA 2MO0A 1Q1BA 2OQKA 3TQYA 4QQBX 2PMZE 3U58A 3PUWA 2IHEA 1TWHH 1L0WA 4YHHQ 5JJLA 4X62L 4A3KG 1G6PA 4UFZA 4BA1I 3I2ZA 1PH3A 4DNIA 1PFSA 1C0AA 2A19A 4A3MH 5C4XH 2F4VL 1X9NA 1B70B 3ER0A 3J81c 2PQAB 3PF4A 3M9BA 3L7ZC 1E3PA 2LXKA 1Q1EA 4LFAQ 4JI6Q 3BA9A 3GO5A 4JV5Q 3SGIA 4DUZQ 2QA4A 4WJ3M 2RHQB 1I94L 3UDIA 1S3OA 1XPOA 1XK5A 5DLQE 1VQIA 2C35B 5LMUL 3EBEA 3S1MH 4HJ7A 2OCEA 4OO1G 1O7IA 1Q12A 2YTYA 2K5HA 5C44H 2JE6I 1CSQA 3J80c 3M7NA 1N36L 4A3JH 2E2HH 1T9HA 4DR7Q 1CKOA 2MNAA 3VDYA 2D62A 4NPSA 5J3BA 4R4QA 1VQHA 2BH8A 4PZ7A 2OTJA 1V1QA 4NXML 5AJ3L 3B6YA 2BA1A 1HR0Q 1FVIA 1X3GA 3T1HQ 3ULPA 2B29A 5IP7H 1YHBA 3H3VI 2JJQA 3NBHB 1I3QH 4EEQA 1HR0W 2NZHA 2NN6I 1X56A 4YCWA 4JI4L 1TXYA 2VS1A 5GQOA 4BY1G 4DR3Q 1HNWL 1GD7A 1KAWA 3CAMA 4NXNL 4IOCA 2AWNA 3M85A 3KDFB 3NBZB 3J80i
chains in the Genus database with same CATH superfamily
1TWHB 3H0GG 2JSOA 3E6ZX 3WWJA 3GTQB 1P16A 2VUMG 3QO2A 1SRUA 3SHLA 3CP0A 2EJGC 4WRDA 4A3MB 4IPGA 4QL5A 5FLXc 3RR5A 2F4VQ 1WTOA 4IUQA 2CZGA 3MJFA 4NDXA 2K5DA 1VQOA 1R4PB 2H1EA 4Y7NB 3QIAA 4A3GG 4FGRA 4M9UA 4WHXA 4O86A 2XCLA 4IPHA 4FF2A 2K04A 3NSWA 1KDBA 1OXTA 5LMUQ 3F8TA 3CMEA 3R2TA 1Z7TA 3KJPA 3G8DA 1LLRD 5C44B 3T54A 5CMDA 2EIFA 4UCOA 3TBIB 1SJED 1Y8NB 5GROA 4EFBA 4ME5A 4EGQA 1GLVA 1NMGA 4JI4Q 4GN5A 2R7NA 2HCIA 1A0IA 4J15A 3J7ZC 4Q0FA 1HNWQ 5D8DA 2UU9Q 1IKLA 1PH2A 4DK1A 4KHPL 1SN8A 3QWNA 1EU3A 5BN4A 1I4HA 5HBRB 1HTPA 2RA4A 4A3IG 5GADC 2FHTA 5CV4A 2F0FA 3K6OA 2UUAL 2CVRA 3R8BA 5JJIA 4LH7A 5E4XA 1SFOB 3GTOB 2NU6B 4B3TQ 1K8MA 3RN2A 1PYSB 5C0XG 3S2DH 4LF6Q 5IWAL 5EJWA 1F2YA 1P8LA 3PO3H 5DGIA 2LFNA 4DR4L 3VOTA 4OONA 1HPCA 3NEMA 3V05A 4HJ9A 4B3SQ 4C2MB 2A74C 4OEMB 1KJ8A 1O7LA 2KECA 2WYOA 1XMQQ 1M1KC 1OBGA 4KY5A 1YEZA 2XN9C 2D0OA 3J81L 5J2UF 2BE5C 2P0AA 1HFNA 3D31A 1OO9B 4QCLA 3EJIA 1PH6A 2FB9A 1UEBA 1STNA 2JA6H 2FMCA 2PW7A 3DEOA 4XT1B 4IJHA 3R93A 4DR2Q 1BDOA 1UUPA 5EPJA 5FKAC 3V96A 4JI0Q 2K1BA 1Q8IA 4CHTB 1KC8C 2J0TD 1Y1VB 1RCVD 3MWDA 3KF6B 4HJ8A 3GTQH 3TP7A 1F2ZA 2NTTA 1E1OA 1YI2A 2HVRA 4PZ6A 1HZCA 1SSOA 2F0HA 1SE4A 4Y7NH 2NB0A 3CU7A 1GGOA 4OX9Q 3AYHB 3TEKA 1VQ4A 4K6NA 3CRLC 1SDFA 3SR1A 3KOJA 3L9AX 3S2HB 1IYDA 3GTMH 1XNRQ 3RZOB 2RSOA 2R82A 2NUCA 3VYSA 4JYAQ 1RD9D 1IBMQ 1Y69U 3NP8A 4KJNA 5J2TF 3BZCA 5FLXL 1AE3A 3QWUA 4YJ2F 1ICFB 4ULLA 1PH1A 4KD4A 4BBRB 2BDNA 1I6HB 2HQLA 1FYCA 1VBGA 3MWEA 1NCVA 3TEHB 2YZNA 1QUQA 1MD2D 2G9HD 2RF4A 1GM5A 1DJRD 5C44G 5KKNB 1X32A 3G7LA 4KY7A 4X65Q 2B2TA 2UU9L 3MEFA 1Y8PB 4OXPA 2K5WA 2ZXPA 2SNMA 2Q7DA 3EROA 2AQ2B 4KN4C 1QCBD 2KHIA 4DN4M 4HTHA 2XRQD 2JQOA 1L2FA 1PYBA 2PI2A 3HOWH 1IXRA 2I5HA 3QOJA 4TVAB 5BWRA 5I5WA 1VQAA 2XNAC 1XYIA 3K7UC 3GTOH 1J6QA 4ZRZA 3SK8A 3LX0A 1NE3A 2PMZB 1HA6A 2KQ3A 2EYFA 2GQSA 1GUNA 1X3PA 4Y52H 1ZYRC 4DFAA 1S72A 1G2SA 1GVPA 1NUCA 2OF1A 1GHKA 3RLNA 3JRWA 5CV5A 4H13C 1VQ5A 1ET9A 1WR2A 4DV1L 2EYMA 3TY8A 3VMMA 5EPLA 1YNND 4QJFA 4UP8A 1H9KA 1A9XA 3DXJC 1WFQA 5C4HA 1JOKA 4YWKA 3C46A 2COIA 3T9CA 4J8QA 2XIWA 1W96A 4IWYA 2VQEL 4JI7Q 1MHWC 2BE5D 4JI2Q 1KRTA 2V1CC 1OXSC 3TZDA 3VR6A 1BCPC 3HKZE 1IW7C 1JJCB 3OSOA 1EY8A 3I70A 2FINB 2YRWA 3QJYA 3OPOA 5FJ8G 4A3FH 4AH6A 1MBYA 1HNXL 3WDNA 4DK3C 4ABNA 1YJWA 5CORA 3TIIA 1Y1VG 3S2HH 4MV3A 3A8JE 3CD6A 5CAEB 1H9MA 5JEAG 2DJGC 1IBML 1I7LA 3DF7A 1F2LA 2VQFQ 4IURA 1M0TA 4JI5Q 1PYWD 5EKIA 2JA8G 3I7FA 3DWPA 3FP9A 4O4JF 1Q46A 2F0KA 1UAPA 3I4MG 1EY6A 2HVQA 4BBRH 1JR0D 1I6HH 3T9BA 4WBNF 2E74C 1HUNA 1WCMB 1K0RA 3AU7A 1PV4A 3BA8A 5L37A 3H3VH 3PIO3 4OWWB 1BO0A 4A4IA 1LO5D 5JH7F 4CBVA 1LUZA 1CI3M 1V1OA 4AQYL 2OLSA 1DOKA 5IP9G 3VPCA 4CE5A 2QK4A 2YWVA 4R4IA 1E22A 1AW7A 5M3FG 5M9OA 2Y0SE 1I1MA 2M00A 4O7TA 1JWSD 1LTSD 4IFDH 3E0EA 3RTXA 2KEEA 5JPNC 2B2TC 1EYGA 4YB8B 5M3MG 3IFTA 3PO2H 1GHJA 4X3TA 4CDDC 2RDGA 1UWVA 3OWFA 4KLKA 4BA2I 4POFA 2DAAA 3H15A 1N33L 1Z47A 3OTOQ 3G6JB 5ELEA 2F3IA 4MZ9A 2F03A 5I2XA 3PUZA 1B7YB 2AUJD 1DOMA 5JVDF 4OL7A 2R87A 2Q2IA 1LTTD 4ZI7F 3H6MA 1KIXA 3UE1A 4UDUC 1ENAA 4LF7L 4J1MA 2B63B 1N9WA 4JI3Q 1SE8A 1QNUA 1B6RA 3CCEA 4R4TA 1C7YA 5CV6A 1A3GA 1ESRA 5C3EH 3CXCA 2PW5A 2E2IB 4HNVA 2COGA 2R6GA 3CCLA 2GPWA 1TWAB 3GTPB 3TW6A 1U4LA 1YNJD 4C3JB 1A6XA 1EUCB 3TRZA 1C30A 3M3YB 2RCNA 1EUDB 2TMPA 5BR8L 1EOVA 3BVMA 3KF6A 1JOOA 3I12A 4LK1C 2RDFA 4HAEA 3K5IA 3TS2A 4FFMA 4UP9A 4ZQIA 1EZ8A 2V59A 1KNAA 1Z2NX 3JC66 3H09A 5IYDG 3HS0C 2I5LX 2ABJA 4UP7A 1F9RA 3NUCA 1D2BA 4X3UA 4A93G 3V4ZA 4R9WA 1MJEA 4GKJL 3T1YL 3W1GA 4FF4A 1GUWA 5IYBH 1PXUA 1DZ1A 4V190 3J81j 3T56B 1CA6A 1WCMH 1EIHA 5A2QE 4M8AA 4DV5L 1WTPA 4UCUA 4K8JA 1KHIA 4K8IA 3VYUA 5AFWA 3GV3A 5H80A 3NWSA 4RGOS 2KHJA 3SK5A 5CV7A 1AP0A 3S1MB 4IO9A 1DGSA 3S1NB 3TP5A 5IGEA 1LM0A 1AEXA 1CHPD 4HSVA 4WORA 1WTRA 1ESFA 5JPMC 4K14A 3FMCA 1YHQA 1X3FA 4DXFA 3NWTA 1LTID 5GAEC 4KI0A 3RFCA 2RBMA 1IBKQ 1SE3A 4IUUA 2YV5A 3EQLC 3OHXC 2F0UA 1QJOA 4FFOA 2J7ZA 3FRPB 1W3SA 2MPMA 4IUTA 4UY8C 3JRXA 1Q3LA 1Y1WB 1VQBA 4YHHL 2ZTEA 4O7YA 4G7ZC 4PMWA 1KQSA 1O78A 5I9OA 2F52A 5CA1F 4DV7Q 3HGBA 1V1PA 2G9DA 3FEWX 3Q8DA 4C5CA 5FLMH 1DV1A 3ERQA 4LUVA 3U9OA 4CMFA 1IL2A 4IWXA 3R5HA 4K0KQ 4A3DH 5K36H 2R7FA 4DUZL 5EZYF 3BJUA 5G3LF 1S68A 4HMJA 2ZXRA 3NBYB 1ICWA 2NUAB 4ALPA 1SMYD 4HNUA 2MO1A 1LV9A 2I07B 4JBKA 3A0JA 2MHVA 2YYAA 1C8CA 3NENA 2F0PA 1EEID 1FNVA 2KCNA 5IT9c 3T1HL 1XPRA 1W2BA 1D5ZC 1HQRD 1PVOA 3UZOA 5TSSA 4N8FA 2QGQA 1HH2P 2W6MA 3GD7A 2K33A 2XVSA 1H9JA 1JE5A 1NAPA 4DR3L 3N6RA 3JAMc 3S16B 2R92B 1EY7A 3HKZB 3JZIA 2OQKA 4KMUC 1SYCA 1GOZA 3P7JA 3U58A 1FNUA 3K3PA 4M0JA 4UFZA 4X62L 4O7WA 1PH3A 2F3WA 5F2DA 2L1BA 3SVMA 2O2LD 4RH6A 1B70B 2L9HA 3PF4A 1EEFD 3S1RB 1PMRA 1Q1EA 1ZEQX 4CKCA 1HTLD 4JV5Q 2XD4A 5I4DA 1I94L 2YZLA 5IGGA 3OIQA 4ZOLF 5HNEA 1VQIA 3S1MH 1JKJB 2SEBD 1PRTF 1Q12A 5IOCA 1N36L 5BWWA 5JQGF 3QOLA 1CKOA 1KC7A 2NYZD 2OTJA 1ULZA 4NXML 4JPBW 3KLSX 2BA1A 5AJ3L 2ICEC 2GPSA 1G91A 4EEQA 2WACA 1PZJD 3WO1A 1B1ZA 4YCWA 1TXYA 2VS1A 4BY1G 1EY4A 5K5PA 2DABA 1KAWA 5NUCA 4NXNL 3R5FA 3M85A 2Y0SB 2R7KA 5D1OB 3UDGA 4NKLA 2OT2A 4GN4B 1RJTA 1HUMA 1TA8A 2VQDA 3HFZB 5C4XB 3NE5B 1A63A 3RUZA 3CF5A 4EX5A 5CYUA 2A6EC 5JVH3 4HIDA 4LF5L 1VKZA 3AB9A 5LA6F 5KX5F 3K58A 2I80A 1E1TA 4TV8F 3WWVA 4EQPA 2R7MA 1EOTA 5C3WA 4U673 1SROA 3I4NB 2BH2A 1O80A 4HIOA 1VF5C 4LWCA 1PH8A 5I5TA 1YJNA 1OXVA 1EU4A 4A3JB 2DY7A 1BOSA 1HZBA 5GONF 2PBZA 1NJIC 4BY7G 3DLLA 3MTSA 1QE6A 4PBCA 3K81C 1LABA 3FKIG 1CQVA 4RGNA 3S16H 2R92H 3QQMA 3MVVA 2UUCL 1GUOA 2EYJA 4KJOA 2UXDL 5FOBB 1AZPA 2EIYA 2ES2A 1JB3A 3ETHA 3F2UA 4C3IB 5IT9L 1I5FA 1D1KA 3AX6A 1I4PA 2GVBA 1XNQL 3S1RH 2Z6KA 4JBMA 4NMZA 2DNEA 3WWHA 2R3ZA 3A74A 2HGXA 3HOVG 2R93G 3VPBA 2DZDA 4I7ZC 1N32L 3JAML 3OMCA 1PFNA 1YZ6A 1B4OA 2CWAA 1EZ1A 2CNQA 5H1SE 1PZKD 4UAIA 1HJPA 2F0TA 4JI1L 2W6OA 1LTGD 4LUOA 4N9TA 2VB2X 3Q6SA 1A0GA 3EN2A 2K4KA 1KD1C 1CQJB 1TWGH 1A3VA 4KKTA 5FK9C 3PF5A 2EJ3A 1QOHA 2A5HA 4RAUC 1VBHA 3ETJA 2ICIA 4O2DA 1D7QA 1VQEA 4KV6A 1FGUA 4QF4A 4B3ML 2MJ8A 5EBCA 2E75C 3KJOA 4A3CH 2EE1A 3K5MA 4KHPQ 2VUGA 1G291 2O5IC 3T7AA 4WJWA 1PDQA 1VQLA 1BVSA 3Q0AA 2R7ZB 3TREA 2UUAQ 3GJXB 2WAQE 3STBC 4CC5A 3S2DB 4IFDJ 2K5VA 1EZ6A 3RD4A 3I4NH 5IWAQ 3UFXB 2IL8A 2OXPA 5IODA 3G48A 4DR4Q 3NELA 2KCTA 4CGYB 2E2DC 4PMCA 3TY5A 4N8X1 3HOYH 1Q82C 1C3OA 1E7ZA 4F8MA 2LKVA 3BABA 1BKBA 2HHHL 3SXHA 1UC8A 3ORQA 1BBUA 2K03A 4EQNA 5J1ZA 2PN1A 3FVQA 4A3JG 4O2AF 3I72A 3BVGA 2ZM6L 2QEXA 5EPKA 4IJLA 4L5RC 4OGQC 4C3IH 1A3TA 3H0GH 1EKFA 4DV2L 4ZUJA 1YVCA 4DV4L 4XIGS 3ZJYC 3G6EA 4A3GH 4MTKA 4JI8L 5LL6S 4C3HH 3K57A 2HT1A 2W6QA 4P71A 3GTMB 1IYUA 1DYQA 1E2ZA 2V5AA 3E9HA 1NMFA 2B8GA 4DUYL 2B2UA 3R3OA 1W6KA 4DAPA 2BOSA 3VR4A 2QB5A 1M90C 2VXWA 4DR6L 2DN8A 4O7ZA 3T51B 4RKLA 1TT2A 4H02A 2A69C 1KTKA 4GNXC 2OTLA 3CC4A 1M4VA 3TSSA 1KLUD 2AMCB 4TKOB 2IX0A 1GSAA 1AN8A 4MA0A 1SNCA 5JVG3 1A8VA 3H3VI 3UDXA 3QR8A 1CS0A 4WFN3 4UUGA 4I4TF 1PLFA 2EYLA 4L63B 5T1IA 1PFMA 2CQAA 3CCVA 2CW0C 3SNOA 4PZ8A 2M2LA 4XZ3B 1KTAA 2R7ZH 4YCVA 3HOWB 3CQZH 1K8AC 5D1OA 2EYPA 2K32A 4K5VA 5FNVF 1Q90A 5LMNL 2F0IA 1C9OA 4FDBA 1VQ9A 3R23A 5C0XH 5DM63 2FMMA 2PQEA 1PTOD 5ELOA 4MV4A 5IIFA 2MUYA 2ZDGA 1DOLA 4MIUA 2H4OA 4OO1I 2ID0A 3V2TA 4DV1Q 3RLFA 4DV3L 2NZ1D 5IE8A 3VA5A 4HN7A 2B8FA 2EZVA 5IYCH 5K3WA 1TWCH 1M8AA 3PO3G 3G71A 3CW2C 3HEJA 1WTHA 1F2MA 1TQOA 5CBEE 2VQEQ 1AUVA 3KAKA 1BR9A 3F2DA 4WJ4A 2UXBL 3A8KE 1PRTB 2GLTA 3PUYA 4X66L 1Z6HA 1IBLL 4DR5L 4LFCL 1WOCA 3AFPA 1S40A 2JA6G 4JC0A 4A3FB 1NTGA 1HNXQ 1TY0A 2I8CA 4IHJF 1CK1A 3TIGA 2JXMB 4DAAA 1KXLA 2HGWA 2ZT9C 3GTJH 3TZUA 3U4VA 4A3EB 3CEBA 4A3MG 5KGUA 3P75A 4AYBE 5IGFA 4ZKCB 1ENFA 1K73C 4P2CB 1GJXA 4FFLA 2NVTB 2X5RA 3J81E 3HOZB 3L3OC 1STHA 1JB7A 1PH9A 3Q23A 1EKVA 3TY9A 2Z0SA 4LF8L 2IT1A 1GUTA 3UE0A 1MI2A 1XTCD 1QWYA 2N78A 2Z9HA 3ORRA 1WD0A 3I56A 2VNUD 2RQXA 5D1PA 4AQYQ 4O2BF 1MSHA 4L5SA 1S5CD 4ME6A 2JP1A 3ND9A 1T5XD 5E3FA 4FYDA 5LYJF 1XWEA 3GLKA 2X6LA 4MV6A 3HKSA 1BBWA 3MZ5A 3SE0A 4K6LA 4O0AA 3TP6A 3HP3A 4IPDA 2E5LL 2FPIB 3PO2B 1KBLA 2F0NA 1I4GA 1H95A 4MN3A 2NU8B 4EGVA 5BYBA 3K5NA 2F0QA 1MIUA 1N33Q 2K75A 2JEBI 3U4ZA 2Q2TA 2XGTA 1OXUA 1NR2A 1XMOL 1UE7A 2W6PA 3JZFA 2WINB 2EQSA 4HTPA 5JAVA 3I55A 1S5DD 4DV6L 3ICEA 4A76A 2K52A 1AFPA 3DM1A 1X6OA 2WAQB 5KEEA 1ZAUA 2DY8A 4FO2A 1AUXA 2D9UA 4LF7Q 5ELDA 5C5MA 4O84A 4P74A 2PNRC 5FO7B 1H9RA 1HZAA 4E6IA 3KBGA 2F0LA 2WB1E 4XYQA 2JK8A 1LTLA 1SEBD 5C3EB 4ME3A 1NR4A 5D14A 3BS1A 2E2JH 4A3LG 2YL2A 1FR3A 3ZYYX 4DV0L 3MXPA 4CMDA 2CWPA 2KVMA 2KUMA 4NP5A 5HY6A 3VYRA 3IRBA 4RHSA 2FXQA 2NN6H 3LWEA 1ILPA 5C1OA 1I3QB 3T16A 4K5WA 3KUPA 1WTXA 5FJ8H 5BR8Q 5KNDA 4EVOA 1E4EB 4A3EH 4KY6A 3JSLA 5BPFA 1CKMA 5ELBA 1H9SB 1JQYD 2YS7A 2PZTA 2C00A 1L1OB 2SDFA 4XDXA 5I5SA 2NVTH 5HGQA 3OWEB 2HIXA 3T1YQ 2BA0A 4GKJQ 3RZDH 3HOZH 1RL2A 2L11A 4ZK9B 4GOPB 1XXGA 3F1ZA 4HMIA 1K83H 3MEHA 4DV5Q 3UQ8A 4IZOA 1C4QA 4ZHQF 2EDGA 4BBSH 4QY7A 3K59A 1ASYA 3HBLA 5FPOA 2EY2A 3S14B 1X65A 3RN5A 4BBRG 2GVAA 1HR0L 2WP8J 5BN3A 4R4CA 1FNWA 3SEBA 5M3FH 4A3BB 5IYZF 2PZUA 1GSHA 1SBBB 1UNSA 1JWMD 3S24A 1PFBA 5GAHC 2DJFC 1A2TA 3AMUA 3CSWA 1CSPA 3TQYA 3OMGA 3DAAA 3PUWA 2IHEA 4Q5VA 4YHHQ 2PPBC 5JJLA 2Z02A 4NYEA 4BA1I 1VF7A 4FU0A 1X9NA 2O4XA 3M9BA 5M5YB 1J9OA 2LY7A 2EVBA 1PTOB 4A3DB 4LFAQ 1W93A 2F0VA 1ZYRD 4NZOA 4DUZQ 1ZKOA 2QA4A 4WJ3M 4X3SA 1F77A 4MV9A 1TS3A 3EBEA 4HJ7A 4LAAA 4OO1G 2GA4B 2CH4A 2YTYA 4YBZB 2JE6I 1CSQA 5D3IB 3J80E 3DUZA 4DU9A 4NPSA 4R4QA 3ITPA 2BH8A 4PZ7A 1V1QA 4EG0A 2SNSA 1C48A 1FVIA 1X3GA 2Z4HA 4B9WA 3T1HQ 5A2QL 3NBHB 1I3QH 2I87A 1BCPD 1IW7D 1D5MC 3U9SA 4KN7C 1A48A 2J9GA 4XYMB 3V4SA 5GQOA 4DR3Q 5HV6A 2YZMA 5JOBA 5C8YF 4IOCA 3KDFB 3WWIA 1PZID 5EBDA 1LT5D 4YY3Q 3A5ZB 1JOQA 5IYDH 3RLOA 4X62Q 4H7BA 4C56C 4IIJF 2XRSD 4QIWE 4A93H 3U9TA 1KLGD 3BZKA 3BYTB 4PNYA 1VQNA 1R4QB 1B44D 4JG2A 4DA2A 4HN2A 1T5EA 1UEAB 1GSOA 1EYAA 1CTMA 3NTHA 1I94Q 2KCMA 1WI5A 2EJ0A 1KEEA 4AYBB 1RDPD 5EGTA 2UXCL 5DISC 4IQZA 4M1UB 3J7A5 4DLKA 3GQBA 1A3UA 3S14H 3K0YA 2EJFC 2V58A 4FE2A 2KBNA 1N36Q 1A15A 1II3A 1WCMG 4CDEC 3I8ZA 4PG3A 1QNKA 2PNHA 3DWQA 4NXMQ 5AJ3Q 4A3BH 4UCVA 3RV4A 4XQQA 3EA6A 5CB4F 1LT4D 3GV6A 4G57A 4DXGA 2MFIA 1LACA 2PYKA 4R1JA 3S15H 4NXNQ 3GP7A 1KJQA 4IN3A 4CHIA 2OEOA 5M5YH 4LFAL 2Q8RE 3PCOB 2NVXH 1I1KA 1PTOH 2ZJPA 3HOXH 4ZYSA 5CC4A 2DGYA 4LF5Q 1EWCA 3BDLA 3U54A 4DR1L 4E4TA 2RSNA 3D6CA 3PIPA 1TAEA 2N88A 3AW8A 4C5BA 3VYTA 3JZ6A 4BWGB 3KK7A 4IUVA 2FPGB 1JLLB 1ZXTA 2A73B 3HOUB 4DK6C 5C0XJ 2B63G 1DD2A 2VZAA 4KK7A 3GB8B 1G51A 1KABA 1JE4A 1VQFA 5CR3A 4UCSA 2WB1B 1KRSA 4O7SA 1E2WA 4P73A 1CA5A 3KLSA 2CCZA 4MTNA 2RCFA 4YY3L 3BACA 2NVYB 2UUCQ 3DTGA 4C3JG 2UXDQ 2IJ0A 3K5OA 2EY1A 3KLWA 1PRTC 3SE7A 1ILQA 3KF8B 1Q7YC 5BPHA 1WRVA 2B3GA 4CDCC 2A68C 2JA7H 1XNQQ 3DMUA 1E4EA 2Z8LA 1DIKA 1H9SA 1EQVA 3MFGA 4O82A 4UCTA 2XWBB 2WKDA 2ZJRA 1L1OA 1N32Q 2VW9A 1Y8OB 3X3MA 2QF7A 3PV0A 5I5UA 4JI1Q 1HRJA 2JA5B 1B6SA 4CKEA 4GOPA 1U4MA 4UHVA 4LFBL 1YIJA 4RMFA 3TDQA 4YAJB 1TWGB 4MV1A 1VCIA 4X64L 2D0PA 1IYEA 4O42A 4OIJA 4AYBG 1VQGA 2LSSA 2Q8IB 2OQ0A 3H3VC 4IPCA 4C1NK 2HQEA 2Z04A 4BY1H 4FXKC 4B3MQ 4HJ5A 4JXUA 2ZDQA 3Q22A 3WNZA 1SNDA 2JEAI 4POGA 1KDAA 5DAUA 3FPUB 5CR5A 1KUTA 5KNCA 2EXZA 4F88A 2F3VA 3PQIA 1KJIA 2F0OA 2A6HC 1N34L 4O7RA 1Y1WG 4JBWA 3UDFA 1X54A 4I7AA 3KALA 3AFQA 5KIXA 4CJ2C 4ZKBB 1B3AA 1QG7A 3NXWA 3PMFA 1AH9A 1K3RA 4BS9A 1U9RA 3HOUH 1S5BD 4Y8VB 2W71A 1LT3D 1SAPA 1SR3A 1EHIA 3HOYB 3Q1KA 3T13A 4HTOA 2EPBA 2B2VA 4QUCA 5I5XA 1TY2A 2IY5B 4BY7H 1LTRD 2EY5A 2B2WA 2RKSA 1X55A 2HHHQ 3NQIA 4KHZA 2VL6A 2UUBL 2H5XA 4GLVB 1BCPB 4RCOA 2NVYH 3F2BA 4MV8A 3N8DA 1HNZL 3NBHA 3NC0B 2ZM6Q 1I50H 3S17B 3I91A 1JC7A 3H0GB 1GXDC 4H44C 4YIJA 3Q2OA 2VUMB 1EQTA 3GTGB 4DV2Q 4DAMA 1STYA 3VR2A 5C4JH 4L5QA 2R92G 3HKZG 4DV4Q 4F87A 5I2YA 4A3GB 1KL9A 3L2PA 4C3HB 2KA7A 3HOVH 4E6NA 4JI8Q 3JSNA 3OOCA 4O83A 2JN4A 4P72A 4YJ3F 3W1BA 2L12A 3CCSA 2DWCA 4TQUS 1YBYA 4QIWB 2JA5H 1IKMA 4LW1A 4DUYQ 1EKPA 5I60A 1SYFA 2NU7B 3WOFA 1J5EL 4XQNA 4S3SA 2DLNA 4H0LC 1L1OC 3T9AA 4RA8A 4DR6Q 2FPPB 2GN5A 3ULJA 4CJ0B 5CBAE 2ZDHA 5BWVA 3LNNA 1EUJA 3LULA 1U4RA 4BXXH 4HQ6A 1GKHA 1HFGA 4KTAA 1VQ6A 4QB4A 4LH6A 3WOEA 4X3KA 1IL8A 3TMEA 3LWUA 4FFPA 4R8NA 2HHFB 1OXXK 3BZDB 3M7GA 2C9OA 4B3RL 2PZWA 1MSGA 4A3KH 4GKKL 3CC7A 4TSSA 4IOAA 2SCUB 4FXDA 2ALYB 4R8IA 5BWXA 1B8AA 4R4OA 2ATWA 1B3QA 5COYA 4A3IB 2PVPA 3CQZB 1TWFB 1BXRA 3HT5A 1I6VC 2Y0SG 3W2DA 5LMNQ 4A3CG 1GUSA 5E1FA 1O7ZA 5KRUA 5C4XG 2A6ED 1SNOA 1D6EC 5LMNW 1CM9A 2NWGA 2A6HD 2I5MX 2FFKB 1Z2PX 3BDOA 4G7OC 4DV3Q 1KT8A 4GN3B 3NK9A 1DXMA 1TWCB 3I4NG 5EKLA 4C5AA 2NBFA 1SLJA 2F0GA 1S5FD 3HZXA 4IALA 4OWXB 4Q4CA 3CCRA 1U5KA 1IZ6A 2UXBQ 5BYAA 3S17H 4NZNA 3HOYG 2VY3A 5IP7G 1VQ8A 2TSSA 1D1IA 4X66Q 3J81i 4DR5Q 1CKNB 4PV1C 3NQTA 2CQOA 1QVGA 1IBLQ 4LFCQ 1PTOF 2VUMH 3GTGH 3OIPA 3OUZA 2ENBA 5ISRA 1IHZA 4TVIA 2EXDA 1FD7D 2ZJQA 1JDEA 2MP1A 3W5OA 2VR1A 1XPUA 1SYEA 3KF8A 1E24A 4O1NA 1ET6A 2Z6KC 5CV8A 3GTJB 4C3IG 3CRKC 1VQ7A 4RHRA 3CMAA 2PO4A 4TRDA 5T1GA 1DCZA 2R7DA 3R2IA 4YAKB 2R85A 4LF4L 1ENCA 1YNXA 4LF9L 1E0BA 4C3HG 2Z6BA 5K2MA 4DAYB 1VQDA 2YW2A 4QMGA 3CCUA 1D5XC 1FJGL 2R7LA 4LF8Q 3RNUA 3CCQA 1VQKA 2KENA 3GTKH 1V8QA 2F4IA 2ZTCA 4RZQA 2E2HB 1O7YA 1TS5A 4ZQ3A 2COJA 3QG1A 4TM5A 1VQCA 3T99A 4DRFA 4IFDI 4UCRA 1TU2B 4MNOA 1G6ZA 4GLXA 4A3IH 1DV2A 1TWFH 1Q86C 4K5XA 3L0OA 2E5LQ 5LXTF 4DAVA 2AQ1B 1NBWA 4EQ5A 1VMPA 1SYBA 4APVA 3QB3A 2KJXA 1SE2A 1QILA 2G5DA 1HZ9A 1XMOQ 2R7ZG 4L5TA 4JOIA 3STBD 1IYJB 1HXYD 4DV6Q 2L15A 5J39A 3PIOA 3WO0A 4JI6L 4FF1A 2J4XA 3DM3A 3SK4A 2AHOB 4ODGA 1EFID 4FXGC 4LMQD 1HQMC 3A8IE 5D3DA 1CE8A 4JW0A 3R9RA 1SXTA 3KYHC 3TINA 1YNNC 1STBA 1EQQA 2MQHA 2GQRA 4P75A 3ULLA 4DR7L 2YRXA 5LL6X 2AWOA 1EYDA 1Q81C 3ERSX 2E2JB 3UI2A 2L5TA 4O4IF 3U50C 1U0LA 2L0CA 4IUNA 5LHY1 1K8OA 5IYCG 2NTSA 4NW2A 4DV0Q 4XYLB 1L0XB 1XTDA 5KYLA 1DONA 1BF4A 3CC2A 3D6WA 3S9WA 2BDOA 2F0JA 3M4OB 1CQIB 2EJ2A 3GTLH 4XX0B 2MO0A 4OHJA 1NSNS 3K5LA 5ELCA 5E25A 1TWHH 1I2LA 1TS2A 2HDMA 1BUVT 1C0AA 3FPPA 4A3MH 2F4VL 3ER0A 2PQAB 1M6VA 3L7ZC 1RTNA 2JA8B 2I46A 3P1HA 2LXKA 3RZDB 3W3AA 1NNXA 3GO5A 3SGIA 2B2UC 3I4MB 1KJJA 2RHQB 3FDTA 3UDIA 1K83B 1XPOA 1XK5A 5DLQE 5LMUL 4ZCKA 2IW3A 3I73A 5DGHA 2OCEA 2ZGIA 2A69D 4BBSB 1RTOA 4N9PA 3J80c 2K5HA 5C44H 3M7NA 3QFFA 2E2HH 4JK1C 1T9HA 2MNAA 4GZYC 3VDYA 2D62A 2IX3A 1VQHA 2WIIB 2Q8TA 5C1PA 5M3FB 1HR0Q 4FVMA 3BG3A 3NHHA 1VDZA 3MWYW 1HR0W 5JQWA 2HHFA 1EIGA 1KDCA 5M3MB 2CW0D 4JI4L 3T53B 1HNWL 5LP6F 1CHQD 3BU2A 1LTAD 3J80i 4O4LF 2HIVA 2W6NA 2HCCA 2K5QA 3K80C 3J7AF 4LJZC 5C3XA 3OUUA 3HOWG 1EY0A 5I6YA 1I4QA 3HG9A 1Q8KA 2W70A 1M0WA 1PHJA 1S5ED 1XJVA 3A7AB 5FLXE 5C4ZA 2OWOA 4B3TL 1V43A 3LGJA 1SFOH 1V1PB 3D3RA 4LF6L 1WTQA 3S1QB 2XTIA 4HJAA 3UYYA 3U0GA 1JICA 1N8RC 2EYHA 4JOIC 4EGJA 2L4NA 3MXNB 4B3SL 1BNZA 3I4OA 4EQOA 3PGZA 4C2MH 1XMQL 4HIMA 1B53A 5CV9A 2K5NA 5M5XB 1EIYB 5JJKA 5LOVF 1EFWA 2V4DA 4A3LH 5M5WB 1VQMA 3KAJA 4K2LA 4K2KA 3C3LA 3R5XA 1BBXC 4DR2L 4DF7A 1BXTA 3PUXA 1TIID 4XYOA 4JI0L 1RKNA 3M4OH 1KNEA 2ZTDA 2IPKD 5E7NA 1YNJC 4O81A 4LUZA 2KHSA 5DM73 2R61A 1B50A 2MGSA 5EQ0A 3KFUA 1CKNA 1IYVA 1Y1VH 1FGBD 2VPQA 1EIFA 3HRZC 5JEAH 4YWMA 4V0BA 3K8AA 1TR5A 1PK8A 4TUYF 2NN6G 4A3FG 2YTVA 2B39A 3LP8A 2JA8H 4A93B 1L0YB 2CFMA 4DPGA 4OX9L 3UZBA 3T9DA 3U55A 2QKIC 3GIDA 5KS8A 4NZMA 3I4MH 1K3BC 2K6AA 4A3EG 3A54A 1WYDA 1XNRL 4JYAL 3RZOH 1A62A 1BCPF 4X6AH 4TV9F 3BVZA 2IP4A 2EOTA 2N49A 2UXCQ 3T9EA 1YJ9A 4DAYA 5IP9H 3HOZG 3PN1A 3K0XA 1QB5D 4RWSC 1PH7A 1WJJA 2Z4IA 3RMHA 4OWTB 3AQQA 5CM0A 3TS0A 4L8JA 2ZXOA 1K0SA 5M3MH 2NVQB 1QZHA 4BBSG 4X65L 3I4LA 3S15B 3TW7A 2QEJC 3SK6A 3J80L 4MV7A 4PQXA 4LNQA 4IFDG 1CZGA 3E5NA 3LWBA 1STGA 2CHBD 2WKCA 4OELB 3PO2G 1SYGA 2NVXB 3CCJA 5GAGC 2F0EA 4CC6A 4I65A 3HOXB 3KBXA 3MXUA 1X3QA 3S1QH 1BNCA 1X3EA 3NUAA 3MHBA 1E2VA 2B2YA 4DR1Q 4ILWA 5EAYA 1F9PA 1WTVA 1EYZA 3MFYA 5JVLA 4UPAA 2AUKA 5M5XH 5ELNA 4O7LA 2W6ZA 4OO1H 2LXJA 2WAQG 2IWHA 4RFBA 1SMYC 4ZAIA 4GS3A 3VR3A 3P20A 5M5WH 1PH4A 2PCFB 3NPPA 2IHFA 2QILA 2YTXA 3C1FA 4JBJA 2N3SA 1EQRA 4DIMA 1VQPA 2NZOA 1GO3E 4JI7L 1SNMA 5BWUA 4HEDA 4JI2L 5C3EG 3BDCA 5DNFA 4JVZA 5KYIA 3RUPA 1GUGA 1XDNA 1RHPA 3EIVA 2WV6D 4L6TB 3VNNA 2LMCB 5E4WC 1MKHA 1B9MA 1LYLA 3BAAA 2F0WA 3C1EA 4FFRA 2JA7B 5A35A 1PX2A 2Q2HA 2YU9B 1ASZA 3I90A 2A1HA 4ID6A 4FF3A 1B9NA 2K14A 4JCVE 4B9XA 2KEDA 3O13A 4HSPA 5DMXA 1STAA 1K8GA 2PQAA 1PA6A 1LT6D 2VQFL 4JI5L 2I0QA 3LQSA 1IOWA 1RIPA 5I5YA 5IYBG 4KD3A 4YCUA 1ET0A 2CKZB 1EWHA 4LFBQ 2EY6A 4G4KA 4GNXB 4X64Q 5IGCA 2KCCA 2Q2UA 3F2CA 4B08A 3C2PA 2NVQH 3PFFA 1Z9FA 1I1LA 4O7NA 2CH4W 1SJHD 2AKWB 3CPWA 2HDLA 1WTWA 1FL0A 2Z1CA 4HCEA 1KAAA 2E8GA 3Q24A 4BY1B 2PI2E 3IFDA 2HDKA 2HJWA 2HG8A 4FFNA 3IKJA 4A3BG 3A5UA 2RDHA 2YYZA 3PUVA 4RGMA 2XSCA 5C5LA 2FJ2A 5JJZA 3G8CA 3A55A 5FR9A 3NTKA 1SCUB 3HO8A 4QSHA 3PSIA 3OTOL 1N34Q 5KNBA 4MA5A 3K7AB 4O7VA 2QW7A 1VQJA 5FLMG 1SNPA 3A7LA 2K50A 5FO8B 4A3DG 5K36G 2FP4B 4HNTA 1OBDA 5CA0F 5FO9B 3G4SA 2B2YC 2LS01 5D65A 3HOXG 1K9MC 1JT8A 3HB9A 1CUKA 3MXNA 4DK0A 3OYYA 4Q4DA 2IX1A 3X3NA 1D8LA 2B63H 2K28A 1AZQA 4JI3L 4HR7B 5HGTA 4BY7B 1UE6A 3J7AV 1WD1A 5IGBA 1J8IA 2X6GA 3VA7A 3FKIB 2KOLA 5DAAA 4C1NI 2QCPX 2E2IH 2UUBQ 1UC9A 2BCOA 1U4PA 2C5CA 1YHAA 1TWAH 1HNZQ 1I50B 3GTPH 2YS6A 4EFEA 4C3JH 3E5SA 4CKBA 4NB3A 2K7VA 3D0FA 2DNCA 2YU9H 3M3YH 3VR5A 1F9SA 5I47A 2YZGA 5C4JB 5HURA 1QZGA 1DM0B 1SYDA 1WVLA 2QDBA 3FHWA 4KKUA 3HOVB 2R93B 3MAQA 3RV3A 4XQJA 1RF2D 1CQFA 4DNRB 5ELFA 1B04A 2CNVA 2HGSA 1G2WA 2WFWA 2JA7G 3SDZA 2AQ3B 2F0DA 1J5EQ 2E76C 5IY0A 4I55F 3T9FA 1JJGA 1I4RA 2M9VA 2RVLA 3E9IA 4ZLTF 2Y4RA 1R9TB 1JMCA 1A2UA 3JAMi 2P5ZX 4QUFA 2SOBA 3TQTA 3OW7A 1CZWA 1MJCA 3TP8A 3IL8A 3S1NH 2L55A 4IZ8A 3ND8A 1I4XA 2JYOA 4XTCS 5G3LD 2RHSB 4A3KB 4B3RQ 1AE2A 4J6HA 5EKKA 1VMCA 3MC0B 1IBKL 4IUPA 4GKKQ 1QVFA 3KREA 2O5JC 3OW2A 1UE5A 2DUDA 1IOVA 4O4HF 2F0SA 3DTFA 1Y14B 3M4YA 3GDEA 1I2KA 3K7AH 3T4AC 1JDBB 1Y1WH 4RKBA 3D8GA 3EFXD 4DV7L 3A56A 2HD3A 5C0XI 2XWJB 1EWIA 4F7XA 4HIKA 3CCMA 4K0KL 1LTBD 4AIMA 3D4WA 1CFMA 4DGZA 4GLWA 1I7NA 1G2TA 2VB3X 2X0SA 2R84A 5C6AA 3TN2A 4DNTB 1G8ZD 1ONLA 3D4RA 3FKIH 2EYOA 1DAAA 4DQNA 1STEA 2F1MA 1VS0A 3HOUG 2X69A 4YWLA 2EJMA 1UE1A 4I50F 2ASBA 2NU9B 5FPRA 1OTCA 4RCNA 1V9PA 3D4DA 2R86A 3KLRA 4A75A 2WB1G 5DEHA 4ZUIA 3KDFA 2K05A 1TS4A 1ML0D 1PRTD 3AEVA 2R93H 1SMXA 3J7YW 1TVXA 2A68D 1KJ9A 5BWTA 1YITA 5I6WA 1Z2OX 3CHBD 3IAYA 1EY5A 3H91A 1CT1D 3K5HA 3MA2B 1SNQA 3URYA 1PH5A 3DHQA 5I5VA 1JJ2A 4JV5L 2F0MA 4CDFC 2ODTX 4CJ1B 4LF4Q 5JEAJ 4DKAC 2K01A 3CPFA 1EYCA 4LF9Q 1R9TH 2A8VA 5I9PA 4GOPC 4QGUA 4XXEA 5J22A 3VPDA 1EL0A 1QVCA 1FJGQ 2JA5G 1BQQT 1NY4A 2N55A 4GNXA 3GTKB 3M4PA 5CGKA 2N8NA 1F9QA 1QUQB 2A1AA 2JA9A 4U68A 1S4ZA 5BN5A 3PIP3 4HCSA 4GLAC 3M4QA 5IT9E 4BXXG 1EY9A 1B2TA 4RGTA 4RG1A 2HVSA 3BYYB 2D2CC 4G7HC 3JAME 1HCZA 1Q1BA 4QQBX 2PMZE 1MGSA 1JORA 1L0WA 4A3KG 3MXGA 1G6PA 1W6JA 1HHVA 3I2ZA 3NTIA 1PFSA 4K6DA 4DNIA 2A19A 5C4XH 2HUGA 3J81c 4KHVA 3N52A 1E3PA 3NBIA 3EVQA 4JI6Q 3BA9A 1PTOC 3I3CA 1HA5A 3E3XA 4PMBA 5IGDA 5CE8A 1S3OA 2C35B 3PO3B 4FP5D 1O7IA 1K28A 2B2VC 3H94A 4A3JH 4DR7Q 3CKIB 1JCKB 4Z9CB 2DIKA 4HR7A 4FNFA 5J3BA 2B2WC 1JWUD 5BMVF 3DWAA 3B6YA 1RODA 3ULPA 4OIKA 2B29A 5IP7H 3BG5A 1XX8A 1YHBA 4L1KA 4MHEA 2JJQA 2CNUA 2D5DA 4KKSA 2NZHA 2NN6I 3DEPA 1X56A 2JA6B 4XT3B 3ONAB 3E0JA 1T36A 4MAMA 1GD7A 3GTLB 1TKWB 3CAMA 2AWNA 2QDLA 3NBZB
chains in the Genus database with same CATH topology
5D1OB 3UDGA 3H0GG 2HIVA 4YY3Q 3A5ZB 1P16A 5IYDH 3K80C 3RLOA 4GN4B 1SRUA 4X62Q 3CP0A 2VUMG 3HOWG 1TA8A 3HFZB 1Q8KA 4IPGA 4QIWE 4QL5A 5FLXc 3RR5A 1PHJA 4A93H 1XJVA 3CF5A 3BZKA 2F4VQ 1A63A 4EX5A 1VQNA 1VQOA 2OWOA 4HIDA 4A3GG 4B3TL 1V43A 3LGJA 1SFOH 4LF5L 4JG2A 4IPHA 4LF6L 2XTIA 4HJAA 1E1TA 3WWVA 1N8RC 4JOIC 1I94Q 3MXNB 2KCMA 1WI5A 1OXTA 1SROA 4B3SL 5LMUQ 3F8TA 3I4OA 3PGZA 2BH2A 2UXCL 4C2MH 3CMEA 4LWCA 4HIMA 4HIOA 1XMQL 3KJPA 2K5NA 1YJNA 1PH8A 3J7A5 1OXVA 1EIYB 3S14H 5JJKA 2KBNA 1N36Q 1HZBA 2EIFA 1WCMG 1EFWA 4UCOA 4A3LH 4PG3A 1VQMA 2PNHA 5GROA 1NJIC 4NXMQ 4BY7G 5AJ3Q 4EFBA 4A3BH 4UCVA 3DLLA 4DR2L 3K81C 3FKIG 3PUXA 4JI0L 3M4OH 2ZTDA 5E7NA 3S16H 2R92H 1NMGA 2MFIA 4LUZA 4JI4Q 4GN5A 3KFUA 1CKNA 1A0IA 1Y1VH 4J15A 4R1JA 1EIFA 3J7ZC 2UUCL 3S15H 1HNWQ 2UXDL 2UU9Q 4NXNQ 1PH2A 4KHPL 2ES2A 4YWMA 1SN8A 3K8AA 1I5FA 2NN6G 4A3FG 2GVBA 2YTVA 1XNQL 5M5YH 4A3IG 2Z6KA 3PCOB 3S1RH 5GADC 2NVXH 2CFMA 4DPGA 4JBMA 4LFAL 4OX9L 2UUAL 2ZJPA 5JJIA 3HOXH 4LH7A 3I4MH 3A74A 2DGYA 4B3TQ 3HOVG 2R93G 3RN2A 4LF5Q 1N32L 4DR1L 1PYSB 5C0XG 4A3EG 4LF6Q 3S2DH 1WYDA 2CWAA 1YZ6A 1XNRL 3PIPA 5IWAL 4JYAL 1TAEA 5H1SE 3RZOH 1A62A 1P8LA 3GTPH 1HJPA 3PO3H 4DR4L 4JI1L 4X6AH 4OONA 3NEMA 4B3SQ 4LUOA 4HJ9A 2N49A 2UXCQ 1XMQQ 1M1KC 1YJ9A 3EN2A 2K4KA 1YEZA 5IP9H 2D0OA 1KD1C 3HOZG 1TWGH 3PN1A 3K0XA 4DK6C 3D31A 5C0XJ 3PF5A 2B63G 2VZAA 1WJJA 1PH7A 3GB8B 4OWTB 1G51A 3AQQA 1PH6A 1UEBA 3TS0A 2JA6H 4O2DA 1D7QA 1VQFA 4IJHA 4DR2Q 4UCSA 1VQEA 5M3MH 1QZHA 1FGUA 4JI0Q 4X65L 4BBSG 1KRSA 1KC8C 4P73A 5DISC 2CCZA 4B3ML 4MTNA 4YY3L 3KF6B 4HJ8A 2UUCQ 3GTQH 4LNQA 2UXDQ 4IFDG 3KJOA 4A3CH 3KLWA 4KHPQ 1E1OA 1G291 1YI2A 3KF8B 4PZ6A 2VUGA 2HVRA 1Q7YC 4B3RQ 1HZCA 1VQLA 3PO2G 1BVSA 2B3GA 2JA7H 4Y7NH 3CCJA 1XNQQ 5GAGC 4CC6A 4OX9Q 3AYHB 3TREA 1VQ4A 2UUAQ 3GJXB 3S1QH 2WAQE 1X3EA 3STBC 4UCTA 3KOJA 4CC5A 2ZJRA 1L1OA 3GTMH 4IFDJ 1N32Q 4DR1Q 2K5VA 5EAYA 2VW9A 1XNRQ 3I4NH 5IWAQ 4JYAQ 4UPAA 5M5XH 3PV0A 3G48A 4JI1Q 5ELNA 1IBMQ 4DR4Q 3NELA 2KCTA 4GOPA 4LFBL 2LXJA 2WAQG 3BZCA 4RMFA 1YIJA 3TY5A 1AE3A 4GS3A 5M5WH 1VCIA 4X64L 3QWUA 1PH4A 2D0PA 1Q82C 2IHFA 3HOYH 1PH1A 1E7ZA 2YTXA 2HQLA 4JBJA 2N3SA 3BABA 1EQRA 3TEHB 1BKBA 2NZOA 1VQPA 1QUQA 1GO3E 2RF4A 4AYBG 1GM5A 2HHHL 4JI7L 1BBUA 1VQGA 4JI2L 2LSSA 5C3EG 2OQ0A 4IPCA 5C44G 4X65Q 2UU9L 4A3JG 4BY1H 3MEFA 4OXPA 2ZM6L 4B3MQ 3EIVA 2QEXA 4HJ5A 1XDNA 3VNNA 4IJLA 4L5RC 4C3IH 2KHIA 1MKHA 3H0GH 2JQOA 1LYLA 1L2FA 4DV2L 1PYBA 4POGA 2JEAI 3BAAA 2PI2A 1YVCA 3HOWH 1IXRA 2I5HA 4TVAB 2Q2HA 4DV4L 1VQAA 4XIGS 3ZJYC 3K7UC 1ASZA 1J6QA 3GTOH 1N34L 1Y1WG 4JBWA 2K14A 3G6EA 3UDFA 4JCVE 1X54A 4A3GH 1NE3A 4JI8L 2HT1A 4C3HH 3AFQA 4P71A 1K8GA 2PQAA 1PA6A 2VQFL 3E9HA 1NMFA 4Y52H 1S72A 4JI5L 2I0QA 4DUYL 1GVPA 1RIPA 3RLNA 1VQ5A 1AH9A 1K3RA 5IYBG 4DV1L 1M90C 4YCUA 2CKZB 3HOUH 4DR6L 3TY8A 4LFBQ 4QJFA 4GNXB 4H02A 1SR3A 4UP8A 4X64Q 4GNXC 2OTLA 1WFQA 4HTOA 3CC4A 4YWKA 2Q2UA 2IY5B 3F2CA 4BY7H 2AMCB 2NVQH 1Z9FA 2IX0A 1X55A 2VQEL 2HHHQ 4JI7Q 1A8VA 4KHZA 2AKWB 2VL6A 3CPWA 2UUBL 2H5XA 4GLVB 4JI2Q 1FL0A 1KRTA 2V1CC 2E8GA 1OXSC 3UDXA 2PI2E 3F2BA 2NVYH 3HKZE 1HNZL 1JJCB 3NC0B 2ZM6Q 1I50H 3CCVA 4PZ8A 4A3BG 3A5UA 2YYZA 3PUVA 2R7ZH 4YCVA 4DV2Q 4DAMA 5FJ8G 4A3FH 4AH6A 1HNXL 2R92G 5C4JH 3CQZH 4L5QA 4DK3C 3HKZG 4DV4Q 1K8AC 5D1OA 1YJWA 3PSIA 1Y1VG 3OTOL 1N34Q 3S2HH 5LMNL 1KL9A 3L2PA 3CD6A 1C9OA 3HOVH 4FDBA 4JI8Q 1VQ9A 3JSNA 4E6NA 4P72A 5JEAG 3W1BA 1IBML 3CCSA 1VQJA 4TQUS 5FLMG 2VQFQ 5ELOA 1YBYA 2JA5H 4JI5Q 4LW1A 4DUYQ 3I7FA 2JA8G 2K50A 4A3DG 5K36G 1J5EL 3FP9A 3G4SA 2ID0A 4OO1I 1L1OC 1Q46A 3HOXG 3RLFA 4DV1Q 1K9MC 4DV3L 5IE8A 3I4MG 1CUKA 4DR6Q 1JT8A 2GN5A 3ULJA 3OYYA 4BBRH 2HVQA 1I6HH 2IX1A 1EUJA 1K0RA 5IYCH 1PV4A 3BA8A 1TWCH 1D8LA 2B63H 4JI3L 4BXXH 3PO3G 1UE6A 3G71A 3H3VH 3CW2C 4OWWB 1GKHA 4A4IA 1VQ6A 4LH6A 2VQEQ 1LUZA 3F2DA 2E2IH 4AQYL 2UUBQ 2UXBL 4WJ4A 5IP9G 1YHAA 3PUYA 1E22A 4R4IA 1OXXK 1TWAH 2Y0SE 4X66L 5M3FG 4DR5L 4LFCL 1HNZQ 1IBLL 4A3KH 4B3RL 4EFEA 1WOCA 3CC7A 4C3JH 4GKKL 3AFPA 1S40A 4IOAA 3E0EA 3RTXA 2JA6G 4JC0A 2ALYB 1EYGA 4NB3A 3D0FA 5M3MG 2YU9H 1B8AA 4R4OA 2ATWA 3M3YH 3PO2H 1NTGA 1UWVA 4BA2I 4KLKA 1HNXQ 4POFA 3H15A 2Y0SG 1QZGA 1N33L 1Z47A 3OTOQ 1KXLA 3FHWA 5LMNQ 3GTJH 3U4VA 2F3IA 4A3CG 4A3MG 5C4XG 1B04A 5LMNW 4AYBE 2I5MX 4MZ9A 2WFWA 2JA7G 1K73C 3PUZA 1B7YB 1J5EQ 5IY0A 2Q2IA 1JJGA 4DV3Q 1KIXA 3UE1A 1JB7A 3E9IA 4GN3B 1PH9A 4LF7L 3TY9A 2Z0SA 4LF8L 1JMCA 2IT1A 1N9WA 3JAMi 3I4NG 4JI3Q 1SE8A 3UE0A 3CCEA 4R4TA 1C7YA 1MJCA 2N78A 1SLJA 5C3EH 3CXCA 3S1NH 4OWXB 3I56A 2R6GA 3CCRA 2VNUD 1U5KA 1IZ6A 4AQYQ 3CCLA 2UXBQ 5D1PA 3S17H 4XTCS 4L5SA 3HOYG 2VY3A 5IP7G 1VQ8A 2RHSB 4X66Q 3J81i 4DR5Q 1QVGA 1CKNB 1IBLQ 4LFCQ 1AE2A 2CQOA 2VUMH 1IBKL 3HKSA 1BBWA 3GTGH 4GKKQ 1QVFA 3TRZA 4O0AA 4IPDA 2RCNA 3OW2A 2E5LL 1UE5A 2DUDA 2EXDA 5BR8L 1EOVA 3KF6A 2ZJQA 1H95A 1Y14B 3W5OA 3GDEA 3K7AH 1XPUA 3TS2A 1E24A 4UP9A 1Y1WH 1MIUA 2Z6KC 1N33Q 3JC66 5IYDG 2K75A 2JEBI 3U4ZA 2Q2TA 2XGTA 1OXUA 4DV7L 1XMOL 1UE7A 2I5LX 4UP7A 5C0XI 2EQSA 4A93G 1VQ7A 4HTPA 1EWIA 3I55A 3CMAA 4DV6L 4HIKA 1MJEA 3ICEA 3CCMA 4A76A 4GKJL 3T1YL 3BU2A 2K52A 3W1GA 4K0KL 4AIMA 2R7DA 1X6OA 5IYBH 2JA8H 4LF4L 1YNXA 3J81j 4LF9L 1WCMH 4DV5L 4DAYB 1VQDA 4UCUA 4LF7Q 1KHIA 3CCUA 1FJGL 4P74A 4LF8Q 2KHJA 3RNUA 1HZAA 3FKIH 3CCQA 1VQKA 2KENA 2WB1E 4IO9A 3GTKH 1DGSA 2JK8A 1LTLA 1VS0A 1LM0A 3HOUG 2ZTCA 4ME3A 4YWLA 1UE1A 2E2JH 4A3LG 2ASBA 4DV0L 1YHQA 1X3FA 2CWPA 5FPRA 1VQCA 5HY6A 5GAEC 1OTCA 4DRFA 1V9PA 4KI0A 4A75A 3IRBA 4IFDI 2WB1G 2FXQA 4UCRA 1IBKQ 4MNOA 3KDFA 2YV5A 4GLXA 4A3IH 1TWFH 1Q86C 2E5LQ 3L0OA 5FJ8H 5BR8Q 3AEVA 1NBWA 4EQ5A 1W3SA 4UY8C 2R93H 1SMXA 4APVA 1VQBA 4YHHL 2ZTEA 4A3EH 3JSLA 1CKMA 4PMWA 1YITA 1KQSA 2F52A 1HZ9A 4DV7Q 1XMOQ 3Q8DA 2R7ZG 1L1OB 4L5TA 5FLMH 4JOIA 4LUVA 1IYJB 3STBD 5HGQA 4DV6Q 1PH5A 2L15A 1IL2A 2NVTH 3PIOA 2HIXA 3T1YQ 2BA0A 1JJ2A 4JI6L 4A3DH 4GKJQ 4K0KQ 4JV5L 2R7FA 4DUZL 3RZDH 1RL2A 3DM3A 3HOZH 2AHOB 3BJUA 4LF4Q 5JEAJ 4DKAC 4GOPB 3CPFA 4LF9Q 2A8VA 1R9TH 1S68A 3F1ZA 4GOPC 1K83H 3NBYB 4QGUA 4DV5Q 3UQ8A 3KYHC 4ALPA 1QVCA 1EQQA 1FJGQ 2JA5G 2MQHA 2MO1A 1NY4A 4P75A 3ULLA 4QY7A 3A0JA 3M4PA 4GNXA 4JBKA 4BBSH 4DR7L 2N8NA 2AWOA 1ASYA 5FPOA 1QUQB 1Q81C 3ERSX 2A1AA 2JA9A 1X65A 3NENA 3RN5A 1W2BA 4GLAC 2GVAA 3U50C 4BBRG 5IT9c 1U0LA 2WP8J 3T1HL 1XPRA 1HR0L 3M4QA 4R4CA 5IYCG 5M3FH 4DV0Q 1PVOA 2QGQA 1HH2P 4BXXG 3GD7A 1XTDA 3CC2A 1JE5A 4RG1A 4DR3L 2HVSA 3S24A 5GAHC 3JAMc 3GTLH 1CSPA 2MO0A 1Q1BA 2OQKA 3TQYA 4QQBX 2PMZE 3U58A 3PUWA 2IHEA 1TWHH 1L0WA 4YHHQ 5JJLA 4X62L 4A3KG 1G6PA 4UFZA 4BA1I 3I2ZA 1PH3A 4DNIA 1PFSA 1C0AA 2A19A 4A3MH 5C4XH 2F4VL 1X9NA 1B70B 3ER0A 3J81c 2PQAB 3PF4A 3M9BA 3L7ZC 1E3PA 2LXKA 1Q1EA 4LFAQ 4JI6Q 3BA9A 3GO5A 4JV5Q 3SGIA 4DUZQ 2QA4A 4WJ3M 2RHQB 1I94L 3UDIA 1S3OA 1XPOA 1XK5A 5DLQE 1VQIA 2C35B 5LMUL 3EBEA 3S1MH 4HJ7A 2OCEA 4OO1G 1O7IA 1Q12A 2YTYA 2K5HA 5C44H 2JE6I 1CSQA 3J80c 3M7NA 1N36L 4A3JH 2E2HH 1T9HA 4DR7Q 1CKOA 2MNAA 3VDYA 2D62A 4NPSA 5J3BA 4R4QA 1VQHA 2BH8A 4PZ7A 2OTJA 1V1QA 4NXML 5AJ3L 3B6YA 2BA1A 1HR0Q 1FVIA 1X3GA 3T1HQ 3ULPA 2B29A 5IP7H 1YHBA 3H3VI 2JJQA 3NBHB 1I3QH 4EEQA 1HR0W 2NZHA 2NN6I 1X56A 4YCWA 4JI4L 1TXYA 2VS1A 5GQOA 4BY1G 4DR3Q 1HNWL 1GD7A 1KAWA 3CAMA 4NXNL 4IOCA 2AWNA 3M85A 3KDFB 3NBZB 3J80i
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D1O B;  3UDG A;  3H0G G;  2HIV A;  4YY3 Q;  3A5Z B;  1P16 A;  5IYD H;  3K80 C;  3RLO A;  4GN4 B;  1SRU A;  4X62 Q;  3CP0 A;  2VUM G;  3HOW G;  1TA8 A;  3HFZ B;  1Q8K A;  4IPG A;  4QIW E;  4QL5 A;  5FLX c;  3RR5 A;  1PHJ A;  4A93 H;  1XJV A;  3CF5 A;  3BZK A;  2F4V Q;  1A63 A;  4EX5 A;  1VQN A;  1VQO A;  2OWO A;  4HID A;  4A3G G;  4B3T L;  1V43 A;  3LGJ A;  1SFO H;  4LF5 L;  4JG2 A;  4IPH A;  4LF6 L;  2XTI A;  4HJA A;  1E1T A;  3WWV A;  1N8R C;  4JOI C;  1I94 Q;  3MXN B;  2KCM A;  1WI5 A;  1OXT A;  1SRO A;  4B3S L;  5LMU Q;  3F8T A;  3I4O A;  3PGZ A;  2BH2 A;  2UXC L;  4C2M H;  3CME A;  4LWC A;  4HIM A;  4HIO A;  1XMQ L;  3KJP A;  2K5N A;  1YJN A;  1PH8 A;  3J7A 5;  1OXV A;  1EIY B;  3S14 H;  5JJK A;  2KBN A;  1N36 Q;  1HZB A;  2EIF A;  1WCM G;  1EFW A;  4UCO A;  4A3L H;  4PG3 A;  1VQM A;  2PNH A;  5GRO A;  1NJI C;  4NXM Q;  4BY7 G;  5AJ3 Q;  4EFB A;  4A3B H;  4UCV A;  3DLL A;  4DR2 L;  3K81 C;  3FKI G;  3PUX A;  4JI0 L;  3M4O H;  2ZTD A;  5E7N A;  3S16 H;  2R92 H;  1NMG A;  2MFI A;  4LUZ A;  4JI4 Q;  4GN5 A;  3KFU A;  1CKN A;  1A0I A;  1Y1V H;  4J15 A;  4R1J A;  1EIF A;  3J7Z C;  2UUC L;  3S15 H;  1HNW Q;  2UXD L;  2UU9 Q;  4NXN Q;  1PH2 A;  4KHP L;  2ES2 A;  4YWM A;  1SN8 A;  3K8A A;  1I5F A;  2NN6 G;  4A3F G;  2GVB A;  2YTV A;  1XNQ L;  5M5Y H;  4A3I G;  2Z6K A;  3PCO B;  3S1R H;  5GAD C;  2NVX H;  2CFM A;  4DPG A;  4JBM A;  4LFA L;  4OX9 L;  2UUA L;  2ZJP A;  5JJI A;  3HOX H;  4LH7 A;  3I4M H;  3A74 A;  2DGY A;  4B3T Q;  3HOV G;  2R93 G;  3RN2 A;  4LF5 Q;  1N32 L;  4DR1 L;  1PYS B;  5C0X G;  4A3E G;  4LF6 Q;  3S2D H;  1WYD A;  2CWA A;  1YZ6 A;  1XNR L;  3PIP A;  5IWA L;  4JYA L;  1TAE A;  5H1S E;  3RZO H;  1A62 A;  1P8L A;  3GTP H;  1HJP A;  3PO3 H;  4DR4 L;  4JI1 L;  4X6A H;  4OON A;  3NEM A;  4B3S Q;  4LUO A;  4HJ9 A;  2N49 A;  2UXC Q;  1XMQ Q;  1M1K C;  1YJ9 A;  3EN2 A;  2K4K A;  1YEZ A;  5IP9 H;  2D0O A;  1KD1 C;  3HOZ G;  1TWG H;  3PN1 A;  3K0X A;  4DK6 C;  3D31 A;  5C0X J;  3PF5 A;  2B63 G;  2VZA A;  1WJJ A;  1PH7 A;  3GB8 B;  4OWT B;  1G51 A;  3AQQ A;  1PH6 A;  1UEB A;  3TS0 A;  2JA6 H;  4O2D A;  1D7Q A;  1VQF A;  4IJH A;  4DR2 Q;  4UCS A;  1VQE A;  5M3M H;  1QZH A;  1FGU A;  4JI0 Q;  4X65 L;  4BBS G;  1KRS A;  1KC8 C;  4P73 A;  5DIS C;  2CCZ A;  4B3M L;  4MTN A;  4YY3 L;  3KF6 B;  4HJ8 A;  2UUC Q;  3GTQ H;  4LNQ A;  2UXD Q;  4IFD G;  3KJO A;  4A3C H;  3KLW A;  4KHP Q;  1E1O A;  1G29 1;  1YI2 A;  3KF8 B;  4PZ6 A;  2VUG A;  2HVR A;  1Q7Y C;  4B3R Q;  1HZC A;  1VQL A;  3PO2 G;  1BVS A;  2B3G A;  2JA7 H;  4Y7N H;  3CCJ A;  1XNQ Q;  5GAG C;  4CC6 A;  4OX9 Q;  3AYH B;  3TRE A;  1VQ4 A;  2UUA Q;  3GJX B;  3S1Q H;  2WAQ E;  1X3E A;  3STB C;  4UCT A;  3KOJ A;  4CC5 A;  2ZJR A;  1L1O A;  3GTM H;  4IFD J;  1N32 Q;  4DR1 Q;  2K5V A;  5EAY A;  2VW9 A;  1XNR Q;  3I4N H;  5IWA Q;  4JYA Q;  4UPA A;  5M5X H;  3PV0 A;  3G48 A;  4JI1 Q;  5ELN A;  1IBM Q;  4DR4 Q;  3NEL A;  2KCT A;  4GOP A;  4LFB L;  2LXJ A;  2WAQ G;  3BZC A;  4RMF A;  1YIJ A;  3TY5 A;  1AE3 A;  4GS3 A;  5M5W H;  1VCI A;  4X64 L;  3QWU A;  1PH4 A;  2D0P A;  1Q82 C;  2IHF A;  3HOY H;  1PH1 A;  1E7Z A;  2YTX A;  2HQL A;  4JBJ A;  2N3S A;  3BAB A;  1EQR A;  3TEH B;  1BKB A;  2NZO A;  1VQP A;  1QUQ A;  1GO3 E;  2RF4 A;  4AYB G;  1GM5 A;  2HHH L;  4JI7 L;  1BBU A;  1VQG A;  4JI2 L;  2LSS A;  5C3E G;  2OQ0 A;  4IPC A;  5C44 G;  4X65 Q;  2UU9 L;  4A3J G;  4BY1 H;  3MEF A;  4OXP A;  2ZM6 L;  4B3M Q;  3EIV A;  2QEX A;  4HJ5 A;  1XDN A;  3VNN A;  4IJL A;  4L5R C;  4C3I H;  2KHI A;  1MKH A;  3H0G H;  2JQO A;  1LYL A;  1L2F A;  4DV2 L;  1PYB A;  4POG A;  2JEA I;  3BAA A;  2PI2 A;  1YVC A;  3HOW H;  1IXR A;  2I5H A;  4TVA B;  2Q2H A;  4DV4 L;  1VQA A;  4XIG S;  3ZJY C;  3K7U C;  1ASZ A;  1J6Q A;  3GTO H;  1N34 L;  1Y1W G;  4JBW A;  2K14 A;  3G6E A;  3UDF A;  4JCV E;  1X54 A;  4A3G H;  1NE3 A;  4JI8 L;  2HT1 A;  4C3H H;  3AFQ A;  4P71 A;  1K8G A;  2PQA A;  1PA6 A;  2VQF L;  3E9H A;  1NMF A;  4Y52 H;  1S72 A;  4JI5 L;  2I0Q A;  4DUY L;  1GVP A;  1RIP A;  3RLN A;  1VQ5 A;  1AH9 A;  1K3R A;  5IYB G;  4DV1 L;  1M90 C;  4YCU A;  2CKZ B;  3HOU H;  4DR6 L;  3TY8 A;  4LFB Q;  4QJF A;  4GNX B;  4H02 A;  1SR3 A;  4UP8 A;  4X64 Q;  4GNX C;  2OTL A;  1WFQ A;  4HTO A;  3CC4 A;  4YWK A;  2Q2U A;  2IY5 B;  3F2C A;  4BY7 H;  2AMC B;  2NVQ H;  1Z9F A;  2IX0 A;  1X55 A;  2VQE L;  2HHH Q;  4JI7 Q;  1A8V A;  4KHZ A;  2AKW B;  2VL6 A;  3CPW A;  2UUB L;  2H5X A;  4GLV B;  4JI2 Q;  1FL0 A;  1KRT A;  2V1C C;  2E8G A;  1OXS C;  3UDX A;  2PI2 E;  3F2B A;  2NVY H;  3HKZ E;  1HNZ L;  1JJC B;  3NC0 B;  2ZM6 Q;  1I50 H;  3CCV A;  4PZ8 A;  4A3B G;  3A5U A;  2YYZ A;  3PUV A;  2R7Z H;  4YCV A;  4DV2 Q;  4DAM A;  5FJ8 G;  4A3F H;  4AH6 A;  1HNX L;  2R92 G;  5C4J H;  3CQZ H;  4L5Q A;  4DK3 C;  3HKZ G;  4DV4 Q;  1K8A C;  5D1O A;  1YJW A;  3PSI A;  1Y1V G;  3OTO L;  1N34 Q;  3S2H H;  5LMN L;  1KL9 A;  3L2P A;  3CD6 A;  1C9O A;  3HOV H;  4FDB A;  4JI8 Q;  1VQ9 A;  3JSN A;  4E6N A;  4P72 A;  5JEA G;  3W1B A;  1IBM L;  3CCS A;  1VQJ A;  4TQU S;  5FLM G;  2VQF Q;  5ELO A;  1YBY A;  2JA5 H;  4JI5 Q;  4LW1 A;  4DUY Q;  3I7F A;  2JA8 G;  2K50 A;  4A3D G;  5K36 G;  1J5E L;  3FP9 A;  3G4S A;  2ID0 A;  4OO1 I;  1L1O C;  1Q46 A;  3HOX G;  3RLF A;  4DV1 Q;  1K9M C;  4DV3 L;  5IE8 A;  3I4M G;  1CUK A;  4DR6 Q;  1JT8 A;  2GN5 A;  3ULJ A;  3OYY A;  4BBR H;  2HVQ A;  1I6H H;  2IX1 A;  1EUJ A;  1K0R A;  5IYC H;  1PV4 A;  3BA8 A;  1TWC H;  1D8L A;  2B63 H;  4JI3 L;  4BXX H;  3PO3 G;  1UE6 A;  3G71 A;  3H3V H;  3CW2 C;  4OWW B;  1GKH A;  4A4I A;  1VQ6 A;  4LH6 A;  2VQE Q;  1LUZ A;  3F2D A;  2E2I H;  4AQY L;  2UUB Q;  2UXB L;  4WJ4 A;  5IP9 G;  1YHA A;  3PUY A;  1E22 A;  4R4I A;  1OXX K;  1TWA H;  2Y0S E;  4X66 L;  5M3F G;  4DR5 L;  4LFC L;  1HNZ Q;  1IBL L;  4A3K H;  4B3R L;  4EFE A;  1WOC A;  3CC7 A;  4C3J H;  4GKK L;  3AFP A;  1S40 A;  4IOA A;  3E0E A;  3RTX A;  2JA6 G;  4JC0 A;  2ALY B;  1EYG A;  4NB3 A;  3D0F A;  5M3M G;  2YU9 H;  1B8A A;  4R4O A;  2ATW A;  3M3Y H;  3PO2 H;  1NTG A;  1UWV A;  4BA2 I;  4KLK A;  1HNX Q;  4POF A;  3H15 A;  2Y0S G;  1QZG A;  1N33 L;  1Z47 A;  3OTO Q;  1KXL A;  3FHW A;  5LMN Q;  3GTJ H;  3U4V A;  2F3I A;  4A3C G;  4A3M G;  5C4X G;  1B04 A;  5LMN W;  4AYB E;  2I5M X;  4MZ9 A;  2WFW A;  2JA7 G;  1K73 C;  3PUZ A;  1B7Y B;  1J5E Q;  5IY0 A;  2Q2I A;  1JJG A;  4DV3 Q;  1KIX A;  3UE1 A;  1JB7 A;  3E9I A;  4GN3 B;  1PH9 A;  4LF7 L;  3TY9 A;  2Z0S A;  4LF8 L;  1JMC A;  2IT1 A;  1N9W A;  3JAM i;  3I4N G;  4JI3 Q;  1SE8 A;  3UE0 A;  3CCE A;  4R4T A;  1C7Y A;  1MJC A;  2N78 A;  1SLJ A;  5C3E H;  3CXC A;  3S1N H;  4OWX B;  3I56 A;  2R6G A;  3CCR A;  2VNU D;  1U5K A;  1IZ6 A;  4AQY Q;  3CCL A;  2UXB Q;  5D1P A;  3S17 H;  4XTC S;  4L5S A;  3HOY G;  2VY3 A;  5IP7 G;  1VQ8 A;  2RHS B;  4X66 Q;  3J81 i;  4DR5 Q;  1QVG A;  1CKN B;  1IBL Q;  4LFC Q;  1AE2 A;  2CQO A;  2VUM H;  1IBK L;  3HKS A;  1BBW A;  3GTG H;  4GKK Q;  1QVF A;  3TRZ A;  4O0A A;  4IPD A;  2RCN A;  3OW2 A;  2E5L L;  1UE5 A;  2DUD A;  2EXD A;  5BR8 L;  1EOV A;  3KF6 A;  2ZJQ A;  1H95 A;  1Y14 B;  3W5O A;  3GDE A;  3K7A H;  1XPU A;  3TS2 A;  1E24 A;  4UP9 A;  1Y1W H;  1MIU A;  2Z6K C;  1N33 Q;  3JC6 6;  5IYD G;  2K75 A;  2JEB I;  3U4Z A;  2Q2T A;  2XGT A;  1OXU A;  4DV7 L;  1XMO L;  1UE7 A;  2I5L X;  4UP7 A;  5C0X I;  2EQS A;  4A93 G;  1VQ7 A;  4HTP A;  1EWI A;  3I55 A;  3CMA A;  4DV6 L;  4HIK A;  1MJE A;  3ICE A;  3CCM A;  4A76 A;  4GKJ L;  3T1Y L;  3BU2 A;  2K52 A;  3W1G A;  4K0K L;  4AIM A;  2R7D A;  1X6O A;  5IYB H;  2JA8 H;  4LF4 L;  1YNX A;  3J81 j;  4LF9 L;  1WCM H;  4DV5 L;  4DAY B;  1VQD A;  4UCU A;  4LF7 Q;  1KHI A;  3CCU A;  1FJG L;  4P74 A;  4LF8 Q;  2KHJ A;  3RNU A;  1HZA A;  3FKI H;  3CCQ A;  1VQK A;  2KEN A;  2WB1 E;  4IO9 A;  3GTK H;  1DGS A;  2JK8 A;  1LTL A;  1VS0 A;  1LM0 A;  3HOU G;  2ZTC A;  4ME3 A;  4YWL A;  1UE1 A;  2E2J H;  4A3L G;  2ASB A;  4DV0 L;  1YHQ A;  1X3F A;  2CWP A;  5FPR A;  1VQC A;  5HY6 A;  5GAE C;  1OTC A;  4DRF A;  1V9P A;  4KI0 A;  4A75 A;  3IRB A;  4IFD I;  2WB1 G;  2FXQ A;  4UCR A;  1IBK Q;  4MNO A;  3KDF A;  2YV5 A;  4GLX A;  4A3I H;  1TWF H;  1Q86 C;  2E5L Q;  3L0O A;  5FJ8 H;  5BR8 Q;  3AEV A;  1NBW A;  4EQ5 A;  1W3S A;  4UY8 C;  2R93 H;  1SMX A;  4APV A;  1VQB A;  4YHH L;  2ZTE A;  4A3E H;  3JSL A;  1CKM A;  4PMW A;  1YIT A;  1KQS A;  2F52 A;  1HZ9 A;  4DV7 Q;  1XMO Q;  3Q8D A;  2R7Z G;  1L1O B;  4L5T A;  5FLM H;  4JOI A;  4LUV A;  1IYJ B;  3STB D;  5HGQ A;  4DV6 Q;  1PH5 A;  2L15 A;  1IL2 A;  2NVT H;  3PIO A;  2HIX A;  3T1Y Q;  2BA0 A;  1JJ2 A;  4JI6 L;  4A3D H;  4GKJ Q;  4K0K Q;  4JV5 L;  2R7F A;  4DUZ L;  3RZD H;  1RL2 A;  3DM3 A;  3HOZ H;  2AHO B;  3BJU A;  4LF4 Q;  5JEA J;  4DKA C;  4GOP B;  3CPF A;  4LF9 Q;  2A8V A;  1R9T H;  1S68 A;  3F1Z A;  4GOP C;  1K83 H;  3NBY B;  4QGU A;  4DV5 Q;  3UQ8 A;  3KYH C;  4ALP A;  1QVC A;  1EQQ A;  1FJG Q;  2JA5 G;  2MQH A;  2MO1 A;  1NY4 A;  4P75 A;  3ULL A;  4QY7 A;  3A0J A;  3M4P A;  4GNX A;  4JBK A;  4BBS H;  4DR7 L;  2N8N A;  2AWO A;  1ASY A;  5FPO A;  1QUQ B;  1Q81 C;  3ERS X;  2A1A A;  2JA9 A;  1X65 A;  3NEN A;  3RN5 A;  1W2B A;  4GLA C;  2GVA A;  3U50 C;  4BBR G;  5IT9 c;  1U0L A;  2WP8 J;  3T1H L;  1XPR A;  1HR0 L;  3M4Q A;  4R4C A;  5IYC G;  5M3F H;  4DV0 Q;  1PVO A;  2QGQ A;  1HH2 P;  4BXX G;  3GD7 A;  1XTD A;  3CC2 A;  1JE5 A;  4RG1 A;  4DR3 L;  2HVS A;  3S24 A;  5GAH C;  3JAM c;  3GTL H;  1CSP A;  2MO0 A;  1Q1B A;  2OQK A;  3TQY A;  4QQB X;  2PMZ E;  3U58 A;  3PUW A;  2IHE A;  1TWH H;  1L0W A;  4YHH Q;  5JJL A;  4X62 L;  4A3K G;  1G6P A;  4UFZ A;  4BA1 I;  3I2Z A;  1PH3 A;  4DNI A;  1PFS A;  1C0A A;  2A19 A;  4A3M H;  5C4X H;  2F4V L;  1X9N A;  1B70 B;  3ER0 A;  3J81 c;  2PQA B;  3PF4 A;  3M9B A;  3L7Z C;  1E3P A;  2LXK A;  1Q1E A;  4LFA Q;  4JI6 Q;  3BA9 A;  3GO5 A;  4JV5 Q;  3SGI A;  4DUZ Q;  2QA4 A;  4WJ3 M;  2RHQ B;  1I94 L;  3UDI A;  1S3O A;  1XPO A;  1XK5 A;  5DLQ E;  1VQI A;  2C35 B;  5LMU L;  3EBE A;  3S1M H;  4HJ7 A;  2OCE A;  4OO1 G;  1O7I A;  1Q12 A;  2YTY A;  2K5H A;  5C44 H;  2JE6 I;  1CSQ A;  3J80 c;  3M7N A;  1N36 L;  4A3J H;  2E2H H;  1T9H A;  4DR7 Q;  1CKO A;  2MNA A;  3VDY A;  2D62 A;  4NPS A;  5J3B A;  4R4Q A;  1VQH A;  2BH8 A;  4PZ7 A;  2OTJ A;  1V1Q A;  4NXM L;  5AJ3 L;  3B6Y A;  2BA1 A;  1HR0 Q;  1FVI A;  1X3G A;  3T1H Q;  3ULP A;  2B29 A;  5IP7 H;  1YHB A;  3H3V I;  2JJQ A;  3NBH B;  1I3Q H;  4EEQ A;  1HR0 W;  2NZH A;  2NN6 I;  1X56 A;  4YCW A;  4JI4 L;  1TXY A;  2VS1 A;  5GQO A;  4BY1 G;  4DR3 Q;  1HNW L;  1GD7 A;  1KAW A;  3CAM A;  4NXN L;  4IOC A;  2AWN A;  3M85 A;  3KDF B;  3NBZ B;  3J80 i; 
#chains in the Genus database with same CATH topology
 1TWH B;  3H0G G;  2JSO A;  3E6Z X;  3WWJ A;  3GTQ B;  1P16 A;  2VUM G;  3QO2 A;  1SRU A;  3SHL A;  3CP0 A;  2EJG C;  4WRD A;  4A3M B;  4IPG A;  4QL5 A;  5FLX c;  3RR5 A;  2F4V Q;  1WTO A;  4IUQ A;  2CZG A;  3MJF A;  4NDX A;  2K5D A;  1VQO A;  1R4P B;  2H1E A;  4Y7N B;  3QIA A;  4A3G G;  4FGR A;  4M9U A;  4WHX A;  4O86 A;  2XCL A;  4IPH A;  4FF2 A;  2K04 A;  3NSW A;  1KDB A;  1OXT A;  5LMU Q;  3F8T A;  3CME A;  3R2T A;  1Z7T A;  3KJP A;  3G8D A;  1LLR D;  5C44 B;  3T54 A;  5CMD A;  2EIF A;  4UCO A;  3TBI B;  1SJE D;  1Y8N B;  5GRO A;  4EFB A;  4ME5 A;  4EGQ A;  1GLV A;  1NMG A;  4JI4 Q;  4GN5 A;  2R7N A;  2HCI A;  1A0I A;  4J15 A;  3J7Z C;  4Q0F A;  1HNW Q;  5D8D A;  2UU9 Q;  1IKL A;  1PH2 A;  4DK1 A;  4KHP L;  1SN8 A;  3QWN A;  1EU3 A;  5BN4 A;  1I4H A;  5HBR B;  1HTP A;  2RA4 A;  4A3I G;  5GAD C;  2FHT A;  5CV4 A;  2F0F A;  3K6O A;  2UUA L;  2CVR A;  3R8B A;  5JJI A;  4LH7 A;  5E4X A;  1SFO B;  3GTO B;  2NU6 B;  4B3T Q;  1K8M A;  3RN2 A;  1PYS B;  5C0X G;  3S2D H;  4LF6 Q;  5IWA L;  5EJW A;  1F2Y A;  1P8L A;  3PO3 H;  5DGI A;  2LFN A;  4DR4 L;  3VOT A;  4OON A;  1HPC A;  3NEM A;  3V05 A;  4HJ9 A;  4B3S Q;  4C2M B;  2A74 C;  4OEM B;  1KJ8 A;  1O7L A;  2KEC A;  2WYO A;  1XMQ Q;  1M1K C;  1OBG A;  4KY5 A;  1YEZ A;  2XN9 C;  2D0O A;  3J81 L;  5J2U F;  2BE5 C;  2P0A A;  1HFN A;  3D31 A;  1OO9 B;  4QCL A;  3EJI A;  1PH6 A;  2FB9 A;  1UEB A;  1STN A;  2JA6 H;  2FMC A;  2PW7 A;  3DEO A;  4XT1 B;  4IJH A;  3R93 A;  4DR2 Q;  1BDO A;  1UUP A;  5EPJ A;  5FKA C;  3V96 A;  4JI0 Q;  2K1B A;  1Q8I A;  4CHT B;  1KC8 C;  2J0T D;  1Y1V B;  1RCV D;  3MWD A;  3KF6 B;  4HJ8 A;  3GTQ H;  3TP7 A;  1F2Z A;  2NTT A;  1E1O A;  1YI2 A;  2HVR A;  4PZ6 A;  1HZC A;  1SSO A;  2F0H A;  1SE4 A;  4Y7N H;  2NB0 A;  3CU7 A;  1GGO A;  4OX9 Q;  3AYH B;  3TEK A;  1VQ4 A;  4K6N A;  3CRL C;  1SDF A;  3SR1 A;  3KOJ A;  3L9A X;  3S2H B;  1IYD A;  3GTM H;  1XNR Q;  3RZO B;  2RSO A;  2R82 A;  2NUC A;  3VYS A;  4JYA Q;  1RD9 D;  1IBM Q;  1Y69 U;  3NP8 A;  4KJN A;  5J2T F;  3BZC A;  5FLX L;  1AE3 A;  3QWU A;  4YJ2 F;  1ICF B;  4ULL A;  1PH1 A;  4KD4 A;  4BBR B;  2BDN A;  1I6H B;  2HQL A;  1FYC A;  1VBG A;  3MWE A;  1NCV A;  3TEH B;  2YZN A;  1QUQ A;  1MD2 D;  2G9H D;  2RF4 A;  1GM5 A;  1DJR D;  5C44 G;  5KKN B;  1X32 A;  3G7L A;  4KY7 A;  4X65 Q;  2B2T A;  2UU9 L;  3MEF A;  1Y8P B;  4OXP A;  2K5W A;  2ZXP A;  2SNM A;  2Q7D A;  3ERO A;  2AQ2 B;  4KN4 C;  1QCB D;  2KHI A;  4DN4 M;  4HTH A;  2XRQ D;  2JQO A;  1L2F A;  1PYB A;  2PI2 A;  3HOW H;  1IXR A;  2I5H A;  3QOJ A;  4TVA B;  5BWR A;  5I5W A;  1VQA A;  2XNA C;  1XYI A;  3K7U C;  3GTO H;  1J6Q A;  4ZRZ A;  3SK8 A;  3LX0 A;  1NE3 A;  2PMZ B;  1HA6 A;  2KQ3 A;  2EYF A;  2GQS A;  1GUN A;  1X3P A;  4Y52 H;  1ZYR C;  4DFA A;  1S72 A;  1G2S A;  1GVP A;  1NUC A;  2OF1 A;  1GHK A;  3RLN A;  3JRW A;  5CV5 A;  4H13 C;  1VQ5 A;  1ET9 A;  1WR2 A;  4DV1 L;  2EYM A;  3TY8 A;  3VMM A;  5EPL A;  1YNN D;  4QJF A;  4UP8 A;  1H9K A;  1A9X A;  3DXJ C;  1WFQ A;  5C4H A;  1JOK A;  4YWK A;  3C46 A;  2COI A;  3T9C A;  4J8Q A;  2XIW A;  1W96 A;  4IWY A;  2VQE L;  4JI7 Q;  1MHW C;  2BE5 D;  4JI2 Q;  1KRT A;  2V1C C;  1OXS C;  3TZD A;  3VR6 A;  1BCP C;  3HKZ E;  1IW7 C;  1JJC B;  3OSO A;  1EY8 A;  3I70 A;  2FIN B;  2YRW A;  3QJY A;  3OPO A;  5FJ8 G;  4A3F H;  4AH6 A;  1MBY A;  1HNX L;  3WDN A;  4DK3 C;  4ABN A;  1YJW A;  5COR A;  3TII A;  1Y1V G;  3S2H H;  4MV3 A;  3A8J E;  3CD6 A;  5CAE B;  1H9M A;  5JEA G;  2DJG C;  1IBM L;  1I7L A;  3DF7 A;  1F2L A;  2VQF Q;  4IUR A;  1M0T A;  4JI5 Q;  1PYW D;  5EKI A;  2JA8 G;  3I7F A;  3DWP A;  3FP9 A;  4O4J F;  1Q46 A;  2F0K A;  1UAP A;  3I4M G;  1EY6 A;  2HVQ A;  4BBR H;  1JR0 D;  1I6H H;  3T9B A;  4WBN F;  2E74 C;  1HUN A;  1WCM B;  1K0R A;  3AU7 A;  1PV4 A;  3BA8 A;  5L37 A;  3H3V H;  3PIO 3;  4OWW B;  1BO0 A;  4A4I A;  1LO5 D;  5JH7 F;  4CBV A;  1LUZ A;  1CI3 M;  1V1O A;  4AQY L;  2OLS A;  1DOK A;  5IP9 G;  3VPC A;  4CE5 A;  2QK4 A;  2YWV A;  4R4I A;  1E22 A;  1AW7 A;  5M3F G;  5M9O A;  2Y0S E;  1I1M A;  2M00 A;  4O7T A;  1JWS D;  1LTS D;  4IFD H;  3E0E A;  3RTX A;  2KEE A;  5JPN C;  2B2T C;  1EYG A;  4YB8 B;  5M3M G;  3IFT A;  3PO2 H;  1GHJ A;  4X3T A;  4CDD C;  2RDG A;  1UWV A;  3OWF A;  4KLK A;  4BA2 I;  4POF A;  2DAA A;  3H15 A;  1N33 L;  1Z47 A;  3OTO Q;  3G6J B;  5ELE A;  2F3I A;  4MZ9 A;  2F03 A;  5I2X A;  3PUZ A;  1B7Y B;  2AUJ D;  1DOM A;  5JVD F;  4OL7 A;  2R87 A;  2Q2I A;  1LTT D;  4ZI7 F;  3H6M A;  1KIX A;  3UE1 A;  4UDU C;  1ENA A;  4LF7 L;  4J1M A;  2B63 B;  1N9W A;  4JI3 Q;  1SE8 A;  1QNU A;  1B6R A;  3CCE A;  4R4T A;  1C7Y A;  5CV6 A;  1A3G A;  1ESR A;  5C3E H;  3CXC A;  2PW5 A;  2E2I B;  4HNV A;  2COG A;  2R6G A;  3CCL A;  2GPW A;  1TWA B;  3GTP B;  3TW6 A;  1U4L A;  1YNJ D;  4C3J B;  1A6X A;  1EUC B;  3TRZ A;  1C30 A;  3M3Y B;  2RCN A;  1EUD B;  2TMP A;  5BR8 L;  1EOV A;  3BVM A;  3KF6 A;  1JOO A;  3I12 A;  4LK1 C;  2RDF A;  4HAE A;  3K5I A;  3TS2 A;  4FFM A;  4UP9 A;  4ZQI A;  1EZ8 A;  2V59 A;  1KNA A;  1Z2N X;  3JC6 6;  3H09 A;  5IYD G;  3HS0 C;  2I5L X;  2ABJ A;  4UP7 A;  1F9R A;  3NUC A;  1D2B A;  4X3U A;  4A93 G;  3V4Z A;  4R9W A;  1MJE A;  4GKJ L;  3T1Y L;  3W1G A;  4FF4 A;  1GUW A;  5IYB H;  1PXU A;  1DZ1 A;  4V19 0;  3J81 j;  3T56 B;  1CA6 A;  1WCM H;  1EIH A;  5A2Q E;  4M8A A;  4DV5 L;  1WTP A;  4UCU A;  4K8J A;  1KHI A;  4K8I A;  3VYU A;  5AFW A;  3GV3 A;  5H80 A;  3NWS A;  4RGO S;  2KHJ A;  3SK5 A;  5CV7 A;  1AP0 A;  3S1M B;  4IO9 A;  1DGS A;  3S1N B;  3TP5 A;  5IGE A;  1LM0 A;  1AEX A;  1CHP D;  4HSV A;  4WOR A;  1WTR A;  1ESF A;  5JPM C;  4K14 A;  3FMC A;  1YHQ A;  1X3F A;  4DXF A;  3NWT A;  1LTI D;  5GAE C;  4KI0 A;  3RFC A;  2RBM A;  1IBK Q;  1SE3 A;  4IUU A;  2YV5 A;  3EQL C;  3OHX C;  2F0U A;  1QJO A;  4FFO A;  2J7Z A;  3FRP B;  1W3S A;  2MPM A;  4IUT A;  4UY8 C;  3JRX A;  1Q3L A;  1Y1W B;  1VQB A;  4YHH L;  2ZTE A;  4O7Y A;  4G7Z C;  4PMW A;  1KQS A;  1O78 A;  5I9O A;  2F52 A;  5CA1 F;  4DV7 Q;  3HGB A;  1V1P A;  2G9D A;  3FEW X;  3Q8D A;  4C5C A;  5FLM H;  1DV1 A;  3ERQ A;  4LUV A;  3U9O A;  4CMF A;  1IL2 A;  4IWX A;  3R5H A;  4K0K Q;  4A3D H;  5K36 H;  2R7F A;  4DUZ L;  5EZY F;  3BJU A;  5G3L F;  1S68 A;  4HMJ A;  2ZXR A;  3NBY B;  1ICW A;  2NUA B;  4ALP A;  1SMY D;  4HNU A;  2MO1 A;  1LV9 A;  2I07 B;  4JBK A;  3A0J A;  2MHV A;  2YYA A;  1C8C A;  3NEN A;  2F0P A;  1EEI D;  1FNV A;  2KCN A;  5IT9 c;  3T1H L;  1XPR A;  1W2B A;  1D5Z C;  1HQR D;  1PVO A;  3UZO A;  5TSS A;  4N8F A;  2QGQ A;  1HH2 P;  2W6M A;  3GD7 A;  2K33 A;  2XVS A;  1H9J A;  1JE5 A;  1NAP A;  4DR3 L;  3N6R A;  3JAM c;  3S16 B;  2R92 B;  1EY7 A;  3HKZ B;  3JZI A;  2OQK A;  4KMU C;  1SYC A;  1GOZ A;  3P7J A;  3U58 A;  1FNU A;  3K3P A;  4M0J A;  4UFZ A;  4X62 L;  4O7W A;  1PH3 A;  2F3W A;  5F2D A;  2L1B A;  3SVM A;  2O2L D;  4RH6 A;  1B70 B;  2L9H A;  3PF4 A;  1EEF D;  3S1R B;  1PMR A;  1Q1E A;  1ZEQ X;  4CKC A;  1HTL D;  4JV5 Q;  2XD4 A;  5I4D A;  1I94 L;  2YZL A;  5IGG A;  3OIQ A;  4ZOL F;  5HNE A;  1VQI A;  3S1M H;  1JKJ B;  2SEB D;  1PRT F;  1Q12 A;  5IOC A;  1N36 L;  5BWW A;  5JQG F;  3QOL A;  1CKO A;  1KC7 A;  2NYZ D;  2OTJ A;  1ULZ A;  4NXM L;  4JPB W;  3KLS X;  2BA1 A;  5AJ3 L;  2ICE C;  2GPS A;  1G91 A;  4EEQ A;  2WAC A;  1PZJ D;  3WO1 A;  1B1Z A;  4YCW A;  1TXY A;  2VS1 A;  4BY1 G;  1EY4 A;  5K5P A;  2DAB A;  1KAW A;  5NUC A;  4NXN L;  3R5F A;  3M85 A;  2Y0S B;  2R7K A;  5D1O B;  3UDG A;  4NKL A;  2OT2 A;  4GN4 B;  1RJT A;  1HUM A;  1TA8 A;  2VQD A;  3HFZ B;  5C4X B;  3NE5 B;  1A63 A;  3RUZ A;  3CF5 A;  4EX5 A;  5CYU A;  2A6E C;  5JVH 3;  4HID A;  4LF5 L;  1VKZ A;  3AB9 A;  5LA6 F;  5KX5 F;  3K58 A;  2I80 A;  1E1T A;  4TV8 F;  3WWV A;  4EQP A;  2R7M A;  1EOT A;  5C3W A;  4U67 3;  1SRO A;  3I4N B;  2BH2 A;  1O80 A;  4HIO A;  1VF5 C;  4LWC A;  1PH8 A;  5I5T A;  1YJN A;  1OXV A;  1EU4 A;  4A3J B;  2DY7 A;  1BOS A;  1HZB A;  5GON F;  2PBZ A;  1NJI C;  4BY7 G;  3DLL A;  3MTS A;  1QE6 A;  4PBC A;  3K81 C;  1LAB A;  3FKI G;  1CQV A;  4RGN A;  3S16 H;  2R92 H;  3QQM A;  3MVV A;  2UUC L;  1GUO A;  2EYJ A;  4KJO A;  2UXD L;  5FOB B;  1AZP A;  2EIY A;  2ES2 A;  1JB3 A;  3ETH A;  3F2U A;  4C3I B;  5IT9 L;  1I5F A;  1D1K A;  3AX6 A;  1I4P A;  2GVB A;  1XNQ L;  3S1R H;  2Z6K A;  4JBM A;  4NMZ A;  2DNE A;  3WWH A;  2R3Z A;  3A74 A;  2HGX A;  3HOV G;  2R93 G;  3VPB A;  2DZD A;  4I7Z C;  1N32 L;  3JAM L;  3OMC A;  1PFN A;  1YZ6 A;  1B4O A;  2CWA A;  1EZ1 A;  2CNQ A;  5H1S E;  1PZK D;  4UAI A;  1HJP A;  2F0T A;  4JI1 L;  2W6O A;  1LTG D;  4LUO A;  4N9T A;  2VB2 X;  3Q6S A;  1A0G A;  3EN2 A;  2K4K A;  1KD1 C;  1CQJ B;  1TWG H;  1A3V A;  4KKT A;  5FK9 C;  3PF5 A;  2EJ3 A;  1QOH A;  2A5H A;  4RAU C;  1VBH A;  3ETJ A;  2ICI A;  4O2D A;  1D7Q A;  1VQE A;  4KV6 A;  1FGU A;  4QF4 A;  4B3M L;  2MJ8 A;  5EBC A;  2E75 C;  3KJO A;  4A3C H;  2EE1 A;  3K5M A;  4KHP Q;  2VUG A;  1G29 1;  2O5I C;  3T7A A;  4WJW A;  1PDQ A;  1VQL A;  1BVS A;  3Q0A A;  2R7Z B;  3TRE A;  2UUA Q;  3GJX B;  2WAQ E;  3STB C;  4CC5 A;  3S2D B;  4IFD J;  2K5V A;  1EZ6 A;  3RD4 A;  3I4N H;  5IWA Q;  3UFX B;  2IL8 A;  2OXP A;  5IOD A;  3G48 A;  4DR4 Q;  3NEL A;  2KCT A;  4CGY B;  2E2D C;  4PMC A;  3TY5 A;  4N8X 1;  3HOY H;  1Q82 C;  1C3O A;  1E7Z A;  4F8M A;  2LKV A;  3BAB A;  1BKB A;  2HHH L;  3SXH A;  1UC8 A;  3ORQ A;  1BBU A;  2K03 A;  4EQN A;  5J1Z A;  2PN1 A;  3FVQ A;  4A3J G;  4O2A F;  3I72 A;  3BVG A;  2ZM6 L;  2QEX A;  5EPK A;  4IJL A;  4L5R C;  4OGQ C;  4C3I H;  1A3T A;  3H0G H;  1EKF A;  4DV2 L;  4ZUJ A;  1YVC A;  4DV4 L;  4XIG S;  3ZJY C;  3G6E A;  4A3G H;  4MTK A;  4JI8 L;  5LL6 S;  4C3H H;  3K57 A;  2HT1 A;  2W6Q A;  4P71 A;  3GTM B;  1IYU A;  1DYQ A;  1E2Z A;  2V5A A;  3E9H A;  1NMF A;  2B8G A;  4DUY L;  2B2U A;  3R3O A;  1W6K A;  4DAP A;  2BOS A;  3VR4 A;  2QB5 A;  1M90 C;  2VXW A;  4DR6 L;  2DN8 A;  4O7Z A;  3T51 B;  4RKL A;  1TT2 A;  4H02 A;  2A69 C;  1KTK A;  4GNX C;  2OTL A;  3CC4 A;  1M4V A;  3TSS A;  1KLU D;  2AMC B;  4TKO B;  2IX0 A;  1GSA A;  1AN8 A;  4MA0 A;  1SNC A;  5JVG 3;  1A8V A;  3H3V I;  3UDX A;  3QR8 A;  1CS0 A;  4WFN 3;  4UUG A;  4I4T F;  1PLF A;  2EYL A;  4L63 B;  5T1I A;  1PFM A;  2CQA A;  3CCV A;  2CW0 C;  3SNO A;  4PZ8 A;  2M2L A;  4XZ3 B;  1KTA A;  2R7Z H;  4YCV A;  3HOW B;  3CQZ H;  1K8A C;  5D1O A;  2EYP A;  2K32 A;  4K5V A;  5FNV F;  1Q90 A;  5LMN L;  2F0I A;  1C9O A;  4FDB A;  1VQ9 A;  3R23 A;  5C0X H;  5DM6 3;  2FMM A;  2PQE A;  1PTO D;  5ELO A;  4MV4 A;  5IIF A;  2MUY A;  2ZDG A;  1DOL A;  4MIU A;  2H4O A;  4OO1 I;  2ID0 A;  3V2T A;  4DV1 Q;  3RLF A;  4DV3 L;  2NZ1 D;  5IE8 A;  3VA5 A;  4HN7 A;  2B8F A;  2EZV A;  5IYC H;  5K3W A;  1TWC H;  1M8A A;  3PO3 G;  3G71 A;  3CW2 C;  3HEJ A;  1WTH A;  1F2M A;  1TQO A;  5CBE E;  2VQE Q;  1AUV A;  3KAK A;  1BR9 A;  3F2D A;  4WJ4 A;  2UXB L;  3A8K E;  1PRT B;  2GLT A;  3PUY A;  4X66 L;  1Z6H A;  1IBL L;  4DR5 L;  4LFC L;  1WOC A;  3AFP A;  1S40 A;  2JA6 G;  4JC0 A;  4A3F B;  1NTG A;  1HNX Q;  1TY0 A;  2I8C A;  4IHJ F;  1CK1 A;  3TIG A;  2JXM B;  4DAA A;  1KXL A;  2HGW A;  2ZT9 C;  3GTJ H;  3TZU A;  3U4V A;  4A3E B;  3CEB A;  4A3M G;  5KGU A;  3P75 A;  4AYB E;  5IGF A;  4ZKC B;  1ENF A;  1K73 C;  4P2C B;  1GJX A;  4FFL A;  2NVT B;  2X5R A;  3J81 E;  3HOZ B;  3L3O C;  1STH A;  1JB7 A;  1PH9 A;  3Q23 A;  1EKV A;  3TY9 A;  2Z0S A;  4LF8 L;  2IT1 A;  1GUT A;  3UE0 A;  1MI2 A;  1XTC D;  1QWY A;  2N78 A;  2Z9H A;  3ORR A;  1WD0 A;  3I56 A;  2VNU D;  2RQX A;  5D1P A;  4AQY Q;  4O2B F;  1MSH A;  4L5S A;  1S5C D;  4ME6 A;  2JP1 A;  3ND9 A;  1T5X D;  5E3F A;  4FYD A;  5LYJ F;  1XWE A;  3GLK A;  2X6L A;  4MV6 A;  3HKS A;  1BBW A;  3MZ5 A;  3SE0 A;  4K6L A;  4O0A A;  3TP6 A;  3HP3 A;  4IPD A;  2E5L L;  2FPI B;  3PO2 B;  1KBL A;  2F0N A;  1I4G A;  1H95 A;  4MN3 A;  2NU8 B;  4EGV A;  5BYB A;  3K5N A;  2F0Q A;  1MIU A;  1N33 Q;  2K75 A;  2JEB I;  3U4Z A;  2Q2T A;  2XGT A;  1OXU A;  1NR2 A;  1XMO L;  1UE7 A;  2W6P A;  3JZF A;  2WIN B;  2EQS A;  4HTP A;  5JAV A;  3I55 A;  1S5D D;  4DV6 L;  3ICE A;  4A76 A;  2K52 A;  1AFP A;  3DM1 A;  1X6O A;  2WAQ B;  5KEE A;  1ZAU A;  2DY8 A;  4FO2 A;  1AUX A;  2D9U A;  4LF7 Q;  5ELD A;  5C5M A;  4O84 A;  4P74 A;  2PNR C;  5FO7 B;  1H9R A;  1HZA A;  4E6I A;  3KBG A;  2F0L A;  2WB1 E;  4XYQ A;  2JK8 A;  1LTL A;  1SEB D;  5C3E B;  4ME3 A;  1NR4 A;  5D14 A;  3BS1 A;  2E2J H;  4A3L G;  2YL2 A;  1FR3 A;  3ZYY X;  4DV0 L;  3MXP A;  4CMD A;  2CWP A;  2KVM A;  2KUM A;  4NP5 A;  5HY6 A;  3VYR A;  3IRB A;  4RHS A;  2FXQ A;  2NN6 H;  3LWE A;  1ILP A;  5C1O A;  1I3Q B;  3T16 A;  4K5W A;  3KUP A;  1WTX A;  5FJ8 H;  5BR8 Q;  5KND A;  4EVO A;  1E4E B;  4A3E H;  4KY6 A;  3JSL A;  5BPF A;  1CKM A;  5ELB A;  1H9S B;  1JQY D;  2YS7 A;  2PZT A;  2C00 A;  1L1O B;  2SDF A;  4XDX A;  5I5S A;  2NVT H;  5HGQ A;  3OWE B;  2HIX A;  3T1Y Q;  2BA0 A;  4GKJ Q;  3RZD H;  3HOZ H;  1RL2 A;  2L11 A;  4ZK9 B;  4GOP B;  1XXG A;  3F1Z A;  4HMI A;  1K83 H;  3MEH A;  4DV5 Q;  3UQ8 A;  4IZO A;  1C4Q A;  4ZHQ F;  2EDG A;  4BBS H;  4QY7 A;  3K59 A;  1ASY A;  3HBL A;  5FPO A;  2EY2 A;  3S14 B;  1X65 A;  3RN5 A;  4BBR G;  2GVA A;  1HR0 L;  2WP8 J;  5BN3 A;  4R4C A;  1FNW A;  3SEB A;  5M3F H;  4A3B B;  5IYZ F;  2PZU A;  1GSH A;  1SBB B;  1UNS A;  1JWM D;  3S24 A;  1PFB A;  5GAH C;  2DJF C;  1A2T A;  3AMU A;  3CSW A;  1CSP A;  3TQY A;  3OMG A;  3DAA A;  3PUW A;  2IHE A;  4Q5V A;  4YHH Q;  2PPB C;  5JJL A;  2Z02 A;  4NYE A;  4BA1 I;  1VF7 A;  4FU0 A;  1X9N A;  2O4X A;  3M9B A;  5M5Y B;  1J9O A;  2LY7 A;  2EVB A;  1PTO B;  4A3D B;  4LFA Q;  1W93 A;  2F0V A;  1ZYR D;  4NZO A;  4DUZ Q;  1ZKO A;  2QA4 A;  4WJ3 M;  4X3S A;  1F77 A;  4MV9 A;  1TS3 A;  3EBE A;  4HJ7 A;  4LAA A;  4OO1 G;  2GA4 B;  2CH4 A;  2YTY A;  4YBZ B;  2JE6 I;  1CSQ A;  5D3I B;  3J80 E;  3DUZ A;  4DU9 A;  4NPS A;  4R4Q A;  3ITP A;  2BH8 A;  4PZ7 A;  1V1Q A;  4EG0 A;  2SNS A;  1C48 A;  1FVI A;  1X3G A;  2Z4H A;  4B9W A;  3T1H Q;  5A2Q L;  3NBH B;  1I3Q H;  2I87 A;  1BCP D;  1IW7 D;  1D5M C;  3U9S A;  4KN7 C;  1A48 A;  2J9G A;  4XYM B;  3V4S A;  5GQO A;  4DR3 Q;  5HV6 A;  2YZM A;  5JOB A;  5C8Y F;  4IOC A;  3KDF B;  3WWI A;  1PZI D;  5EBD A;  1LT5 D;  4YY3 Q;  3A5Z B;  1JOQ A;  5IYD H;  3RLO A;  4X62 Q;  4H7B A;  4C56 C;  4IIJ F;  2XRS D;  4QIW E;  4A93 H;  3U9T A;  1KLG D;  3BZK A;  3BYT B;  4PNY A;  1VQN A;  1R4Q B;  1B44 D;  4JG2 A;  4DA2 A;  4HN2 A;  1T5E A;  1UEA B;  1GSO A;  1EYA A;  1CTM A;  3NTH A;  1I94 Q;  2KCM A;  1WI5 A;  2EJ0 A;  1KEE A;  4AYB B;  1RDP D;  5EGT A;  2UXC L;  5DIS C;  4IQZ A;  4M1U B;  3J7A 5;  4DLK A;  3GQB A;  1A3U A;  3S14 H;  3K0Y A;  2EJF C;  2V58 A;  4FE2 A;  2KBN A;  1N36 Q;  1A15 A;  1II3 A;  1WCM G;  4CDE C;  3I8Z A;  4PG3 A;  1QNK A;  2PNH A;  3DWQ A;  4NXM Q;  5AJ3 Q;  4A3B H;  4UCV A;  3RV4 A;  4XQQ A;  3EA6 A;  5CB4 F;  1LT4 D;  3GV6 A;  4G57 A;  4DXG A;  2MFI A;  1LAC A;  2PYK A;  4R1J A;  3S15 H;  4NXN Q;  3GP7 A;  1KJQ A;  4IN3 A;  4CHI A;  2OEO A;  5M5Y H;  4LFA L;  2Q8R E;  3PCO B;  2NVX H;  1I1K A;  1PTO H;  2ZJP A;  3HOX H;  4ZYS A;  5CC4 A;  2DGY A;  4LF5 Q;  1EWC A;  3BDL A;  3U54 A;  4DR1 L;  4E4T A;  2RSN A;  3D6C A;  3PIP A;  1TAE A;  2N88 A;  3AW8 A;  4C5B A;  3VYT A;  3JZ6 A;  4BWG B;  3KK7 A;  4IUV A;  2FPG B;  1JLL B;  1ZXT A;  2A73 B;  3HOU B;  4DK6 C;  5C0X J;  2B63 G;  1DD2 A;  2VZA A;  4KK7 A;  3GB8 B;  1G51 A;  1KAB A;  1JE4 A;  1VQF A;  5CR3 A;  4UCS A;  2WB1 B;  1KRS A;  4O7S A;  1E2W A;  4P73 A;  1CA5 A;  3KLS A;  2CCZ A;  4MTN A;  2RCF A;  4YY3 L;  3BAC A;  2NVY B;  2UUC Q;  3DTG A;  4C3J G;  2UXD Q;  2IJ0 A;  3K5O A;  2EY1 A;  3KLW A;  1PRT C;  3SE7 A;  1ILQ A;  3KF8 B;  1Q7Y C;  5BPH A;  1WRV A;  2B3G A;  4CDC C;  2A68 C;  2JA7 H;  1XNQ Q;  3DMU A;  1E4E A;  2Z8L A;  1DIK A;  1H9S A;  1EQV A;  3MFG A;  4O82 A;  4UCT A;  2XWB B;  2WKD A;  2ZJR A;  1L1O A;  1N32 Q;  2VW9 A;  1Y8O B;  3X3M A;  2QF7 A;  3PV0 A;  5I5U A;  4JI1 Q;  1HRJ A;  2JA5 B;  1B6S A;  4CKE A;  4GOP A;  1U4M A;  4UHV A;  4LFB L;  1YIJ A;  4RMF A;  3TDQ A;  4YAJ B;  1TWG B;  4MV1 A;  1VCI A;  4X64 L;  2D0P A;  1IYE A;  4O42 A;  4OIJ A;  4AYB G;  1VQG A;  2LSS A;  2Q8I B;  2OQ0 A;  3H3V C;  4IPC A;  4C1N K;  2HQE A;  2Z04 A;  4BY1 H;  4FXK C;  4B3M Q;  4HJ5 A;  4JXU A;  2ZDQ A;  3Q22 A;  3WNZ A;  1SND A;  2JEA I;  4POG A;  1KDA A;  5DAU A;  3FPU B;  5CR5 A;  1KUT A;  5KNC A;  2EXZ A;  4F88 A;  2F3V A;  3PQI A;  1KJI A;  2F0O A;  2A6H C;  1N34 L;  4O7R A;  1Y1W G;  4JBW A;  3UDF A;  1X54 A;  4I7A A;  3KAL A;  3AFQ A;  5KIX A;  4CJ2 C;  4ZKB B;  1B3A A;  1QG7 A;  3NXW A;  3PMF A;  1AH9 A;  1K3R A;  4BS9 A;  1U9R A;  3HOU H;  1S5B D;  4Y8V B;  2W71 A;  1LT3 D;  1SAP A;  1SR3 A;  1EHI A;  3HOY B;  3Q1K A;  3T13 A;  4HTO A;  2EPB A;  2B2V A;  4QUC A;  5I5X A;  1TY2 A;  2IY5 B;  4BY7 H;  1LTR D;  2EY5 A;  2B2W A;  2RKS A;  1X55 A;  2HHH Q;  3NQI A;  4KHZ A;  2VL6 A;  2UUB L;  2H5X A;  4GLV B;  1BCP B;  4RCO A;  2NVY H;  3F2B A;  4MV8 A;  3N8D A;  1HNZ L;  3NBH A;  3NC0 B;  2ZM6 Q;  1I50 H;  3S17 B;  3I91 A;  1JC7 A;  3H0G B;  1GXD C;  4H44 C;  4YIJ A;  3Q2O A;  2VUM B;  1EQT A;  3GTG B;  4DV2 Q;  4DAM A;  1STY A;  3VR2 A;  5C4J H;  4L5Q A;  2R92 G;  3HKZ G;  4DV4 Q;  4F87 A;  5I2Y A;  4A3G B;  1KL9 A;  3L2P A;  4C3H B;  2KA7 A;  3HOV H;  4E6N A;  4JI8 Q;  3JSN A;  3OOC A;  4O83 A;  2JN4 A;  4P72 A;  4YJ3 F;  3W1B A;  2L12 A;  3CCS A;  2DWC A;  4TQU S;  1YBY A;  4QIW B;  2JA5 H;  1IKM A;  4LW1 A;  4DUY Q;  1EKP A;  5I60 A;  1SYF A;  2NU7 B;  3WOF A;  1J5E L;  4XQN A;  4S3S A;  2DLN A;  4H0L C;  1L1O C;  3T9A A;  4RA8 A;  4DR6 Q;  2FPP B;  2GN5 A;  3ULJ A;  4CJ0 B;  5CBA E;  2ZDH A;  5BWV A;  3LNN A;  1EUJ A;  3LUL A;  1U4R A;  4BXX H;  4HQ6 A;  1GKH A;  1HFG A;  4KTA A;  1VQ6 A;  4QB4 A;  4LH6 A;  3WOE A;  4X3K A;  1IL8 A;  3TME A;  3LWU A;  4FFP A;  4R8N A;  2HHF B;  1OXX K;  3BZD B;  3M7G A;  2C9O A;  4B3R L;  2PZW A;  1MSG A;  4A3K H;  4GKK L;  3CC7 A;  4TSS A;  4IOA A;  2SCU B;  4FXD A;  2ALY B;  4R8I A;  5BWX A;  1B8A A;  4R4O A;  2ATW A;  1B3Q A;  5COY A;  4A3I B;  2PVP A;  3CQZ B;  1TWF B;  1BXR A;  3HT5 A;  1I6V C;  2Y0S G;  3W2D A;  5LMN Q;  4A3C G;  1GUS A;  5E1F A;  1O7Z A;  5KRU A;  5C4X G;  2A6E D;  1SNO A;  1D6E C;  5LMN W;  1CM9 A;  2NWG A;  2A6H D;  2I5M X;  2FFK B;  1Z2P X;  3BDO A;  4G7O C;  4DV3 Q;  1KT8 A;  4GN3 B;  3NK9 A;  1DXM A;  1TWC B;  3I4N G;  5EKL A;  4C5A A;  2NBF A;  1SLJ A;  2F0G A;  1S5F D;  3HZX A;  4IAL A;  4OWX B;  4Q4C A;  3CCR A;  1U5K A;  1IZ6 A;  2UXB Q;  5BYA A;  3S17 H;  4NZN A;  3HOY G;  2VY3 A;  5IP7 G;  1VQ8 A;  2TSS A;  1D1I A;  4X66 Q;  3J81 i;  4DR5 Q;  1CKN B;  4PV1 C;  3NQT A;  2CQO A;  1QVG A;  1IBL Q;  4LFC Q;  1PTO F;  2VUM H;  3GTG H;  3OIP A;  3OUZ A;  2ENB A;  5ISR A;  1IHZ A;  4TVI A;  2EXD A;  1FD7 D;  2ZJQ A;  1JDE A;  2MP1 A;  3W5O A;  2VR1 A;  1XPU A;  1SYE A;  3KF8 A;  1E24 A;  4O1N A;  1ET6 A;  2Z6K C;  5CV8 A;  3GTJ B;  4C3I G;  3CRK C;  1VQ7 A;  4RHR A;  3CMA A;  2PO4 A;  4TRD A;  5T1G A;  1DCZ A;  2R7D A;  3R2I A;  4YAK B;  2R85 A;  4LF4 L;  1ENC A;  1YNX A;  4LF9 L;  1E0B A;  4C3H G;  2Z6B A;  5K2M A;  4DAY B;  1VQD A;  2YW2 A;  4QMG A;  3CCU A;  1D5X C;  1FJG L;  2R7L A;  4LF8 Q;  3RNU A;  3CCQ A;  1VQK A;  2KEN A;  3GTK H;  1V8Q A;  2F4I A;  2ZTC A;  4RZQ A;  2E2H B;  1O7Y A;  1TS5 A;  4ZQ3 A;  2COJ A;  3QG1 A;  4TM5 A;  1VQC A;  3T99 A;  4DRF A;  4IFD I;  4UCR A;  1TU2 B;  4MNO A;  1G6Z A;  4GLX A;  4A3I H;  1DV2 A;  1TWF H;  1Q86 C;  4K5X A;  3L0O A;  2E5L Q;  5LXT F;  4DAV A;  2AQ1 B;  1NBW A;  4EQ5 A;  1VMP A;  1SYB A;  4APV A;  3QB3 A;  2KJX A;  1SE2 A;  1QIL A;  2G5D A;  1HZ9 A;  1XMO Q;  2R7Z G;  4L5T A;  4JOI A;  3STB D;  1IYJ B;  1HXY D;  4DV6 Q;  2L15 A;  5J39 A;  3PIO A;  3WO0 A;  4JI6 L;  4FF1 A;  2J4X A;  3DM3 A;  3SK4 A;  2AHO B;  4ODG A;  1EFI D;  4FXG C;  4LMQ D;  1HQM C;  3A8I E;  5D3D A;  1CE8 A;  4JW0 A;  3R9R A;  1SXT A;  3KYH C;  3TIN A;  1YNN C;  1STB A;  1EQQ A;  2MQH A;  2GQR A;  4P75 A;  3ULL A;  4DR7 L;  2YRX A;  5LL6 X;  2AWO A;  1EYD A;  1Q81 C;  3ERS X;  2E2J B;  3UI2 A;  2L5T A;  4O4I F;  3U50 C;  1U0L A;  2L0C A;  4IUN A;  5LHY 1;  1K8O A;  5IYC G;  2NTS A;  4NW2 A;  4DV0 Q;  4XYL B;  1L0X B;  1XTD A;  5KYL A;  1DON A;  1BF4 A;  3CC2 A;  3D6W A;  3S9W A;  2BDO A;  2F0J A;  3M4O B;  1CQI B;  2EJ2 A;  3GTL H;  4XX0 B;  2MO0 A;  4OHJ A;  1NSN S;  3K5L A;  5ELC A;  5E25 A;  1TWH H;  1I2L A;  1TS2 A;  2HDM A;  1BUV T;  1C0A A;  3FPP A;  4A3M H;  2F4V L;  3ER0 A;  2PQA B;  1M6V A;  3L7Z C;  1RTN A;  2JA8 B;  2I46 A;  3P1H A;  2LXK A;  3RZD B;  3W3A A;  1NNX A;  3GO5 A;  3SGI A;  2B2U C;  3I4M B;  1KJJ A;  2RHQ B;  3FDT A;  3UDI A;  1K83 B;  1XPO A;  1XK5 A;  5DLQ E;  5LMU L;  4ZCK A;  2IW3 A;  3I73 A;  5DGH A;  2OCE A;  2ZGI A;  2A69 D;  4BBS B;  1RTO A;  4N9P A;  3J80 c;  2K5H A;  5C44 H;  3M7N A;  3QFF A;  2E2H H;  4JK1 C;  1T9H A;  2MNA A;  4GZY C;  3VDY A;  2D62 A;  2IX3 A;  1VQH A;  2WII B;  2Q8T A;  5C1P A;  5M3F B;  1HR0 Q;  4FVM A;  3BG3 A;  3NHH A;  1VDZ A;  3MWY W;  1HR0 W;  5JQW A;  2HHF A;  1EIG A;  1KDC A;  5M3M B;  2CW0 D;  4JI4 L;  3T53 B;  1HNW L;  5LP6 F;  1CHQ D;  3BU2 A;  1LTA D;  3J80 i;  4O4L F;  2HIV A;  2W6N A;  2HCC A;  2K5Q A;  3K80 C;  3J7A F;  4LJZ C;  5C3X A;  3OUU A;  3HOW G;  1EY0 A;  5I6Y A;  1I4Q A;  3HG9 A;  1Q8K A;  2W70 A;  1M0W A;  1PHJ A;  1S5E D;  1XJV A;  3A7A B;  5FLX E;  5C4Z A;  2OWO A;  4B3T L;  1V43 A;  3LGJ A;  1SFO H;  1V1P B;  3D3R A;  4LF6 L;  1WTQ A;  3S1Q B;  2XTI A;  4HJA A;  3UYY A;  3U0G A;  1JIC A;  1N8R C;  2EYH A;  4JOI C;  4EGJ A;  2L4N A;  3MXN B;  4B3S L;  1BNZ A;  3I4O A;  4EQO A;  3PGZ A;  4C2M H;  1XMQ L;  4HIM A;  1B53 A;  5CV9 A;  2K5N A;  5M5X B;  1EIY B;  5JJK A;  5LOV F;  1EFW A;  2V4D A;  4A3L H;  5M5W B;  1VQM A;  3KAJ A;  4K2L A;  4K2K A;  3C3L A;  3R5X A;  1BBX C;  4DR2 L;  4DF7 A;  1BXT A;  3PUX A;  1TII D;  4XYO A;  4JI0 L;  1RKN A;  3M4O H;  1KNE A;  2ZTD A;  2IPK D;  5E7N A;  1YNJ C;  4O81 A;  4LUZ A;  2KHS A;  5DM7 3;  2R61 A;  1B50 A;  2MGS A;  5EQ0 A;  3KFU A;  1CKN A;  1IYV A;  1Y1V H;  1FGB D;  2VPQ A;  1EIF A;  3HRZ C;  5JEA H;  4YWM A;  4V0B A;  3K8A A;  1TR5 A;  1PK8 A;  4TUY F;  2NN6 G;  4A3F G;  2YTV A;  2B39 A;  3LP8 A;  2JA8 H;  4A93 B;  1L0Y B;  2CFM A;  4DPG A;  4OX9 L;  3UZB A;  3T9D A;  3U55 A;  2QKI C;  3GID A;  5KS8 A;  4NZM A;  3I4M H;  1K3B C;  2K6A A;  4A3E G;  3A54 A;  1WYD A;  1XNR L;  4JYA L;  3RZO H;  1A62 A;  1BCP F;  4X6A H;  4TV9 F;  3BVZ A;  2IP4 A;  2EOT A;  2N49 A;  2UXC Q;  3T9E A;  1YJ9 A;  4DAY A;  5IP9 H;  3HOZ G;  3PN1 A;  3K0X A;  1QB5 D;  4RWS C;  1PH7 A;  1WJJ A;  2Z4I A;  3RMH A;  4OWT B;  3AQQ A;  5CM0 A;  3TS0 A;  4L8J A;  2ZXO A;  1K0S A;  5M3M H;  2NVQ B;  1QZH A;  4BBS G;  4X65 L;  3I4L A;  3S15 B;  3TW7 A;  2QEJ C;  3SK6 A;  3J80 L;  4MV7 A;  4PQX A;  4LNQ A;  4IFD G;  1CZG A;  3E5N A;  3LWB A;  1STG A;  2CHB D;  2WKC A;  4OEL B;  3PO2 G;  1SYG A;  2NVX B;  3CCJ A;  5GAG C;  2F0E A;  4CC6 A;  4I65 A;  3HOX B;  3KBX A;  3MXU A;  1X3Q A;  3S1Q H;  1BNC A;  1X3E A;  3NUA A;  3MHB A;  1E2V A;  2B2Y A;  4DR1 Q;  4ILW A;  5EAY A;  1F9P A;  1WTV A;  1EYZ A;  3MFY A;  5JVL A;  4UPA A;  2AUK A;  5M5X H;  5ELN A;  4O7L A;  2W6Z A;  4OO1 H;  2LXJ A;  2WAQ G;  2IWH A;  4RFB A;  1SMY C;  4ZAI A;  4GS3 A;  3VR3 A;  3P20 A;  5M5W H;  1PH4 A;  2PCF B;  3NPP A;  2IHF A;  2QIL A;  2YTX A;  3C1F A;  4JBJ A;  2N3S A;  1EQR A;  4DIM A;  1VQP A;  2NZO A;  1GO3 E;  4JI7 L;  1SNM A;  5BWU A;  4HED A;  4JI2 L;  5C3E G;  3BDC A;  5DNF A;  4JVZ A;  5KYI A;  3RUP A;  1GUG A;  1XDN A;  1RHP A;  3EIV A;  2WV6 D;  4L6T B;  3VNN A;  2LMC B;  5E4W C;  1MKH A;  1B9M A;  1LYL A;  3BAA A;  2F0W A;  3C1E A;  4FFR A;  2JA7 B;  5A35 A;  1PX2 A;  2Q2H A;  2YU9 B;  1ASZ A;  3I90 A;  2A1H A;  4ID6 A;  4FF3 A;  1B9N A;  2K14 A;  4JCV E;  4B9X A;  2KED A;  3O13 A;  4HSP A;  5DMX A;  1STA A;  1K8G A;  2PQA A;  1PA6 A;  1LT6 D;  2VQF L;  4JI5 L;  2I0Q A;  3LQS A;  1IOW A;  1RIP A;  5I5Y A;  5IYB G;  4KD3 A;  4YCU A;  1ET0 A;  2CKZ B;  1EWH A;  4LFB Q;  2EY6 A;  4G4K A;  4GNX B;  4X64 Q;  5IGC A;  2KCC A;  2Q2U A;  3F2C A;  4B08 A;  3C2P A;  2NVQ H;  3PFF A;  1Z9F A;  1I1L A;  4O7N A;  2CH4 W;  1SJH D;  2AKW B;  3CPW A;  2HDL A;  1WTW A;  1FL0 A;  2Z1C A;  4HCE A;  1KAA A;  2E8G A;  3Q24 A;  4BY1 B;  2PI2 E;  3IFD A;  2HDK A;  2HJW A;  2HG8 A;  4FFN A;  3IKJ A;  4A3B G;  3A5U A;  2RDH A;  2YYZ A;  3PUV A;  4RGM A;  2XSC A;  5C5L A;  2FJ2 A;  5JJZ A;  3G8C A;  3A55 A;  5FR9 A;  3NTK A;  1SCU B;  3HO8 A;  4QSH A;  3PSI A;  3OTO L;  1N34 Q;  5KNB A;  4MA5 A;  3K7A B;  4O7V A;  2QW7 A;  1VQJ A;  5FLM G;  1SNP A;  3A7L A;  2K50 A;  5FO8 B;  4A3D G;  5K36 G;  2FP4 B;  4HNT A;  1OBD A;  5CA0 F;  5FO9 B;  3G4S A;  2B2Y C;  2LS0 1;  5D65 A;  3HOX G;  1K9M C;  1JT8 A;  3HB9 A;  1CUK A;  3MXN A;  4DK0 A;  3OYY A;  4Q4D A;  2IX1 A;  3X3N A;  1D8L A;  2B63 H;  2K28 A;  1AZQ A;  4JI3 L;  4HR7 B;  5HGT A;  4BY7 B;  1UE6 A;  3J7A V;  1WD1 A;  5IGB A;  1J8I A;  2X6G A;  3VA7 A;  3FKI B;  2KOL A;  5DAA A;  4C1N I;  2QCP X;  2E2I H;  2UUB Q;  1UC9 A;  2BCO A;  1U4P A;  2C5C A;  1YHA A;  1TWA H;  1HNZ Q;  1I50 B;  3GTP H;  2YS6 A;  4EFE A;  4C3J H;  3E5S A;  4CKB A;  4NB3 A;  2K7V A;  3D0F A;  2DNC A;  2YU9 H;  3M3Y H;  3VR5 A;  1F9S A;  5I47 A;  2YZG A;  5C4J B;  5HUR A;  1QZG A;  1DM0 B;  1SYD A;  1WVL A;  2QDB A;  3FHW A;  4KKU A;  3HOV B;  2R93 B;  3MAQ A;  3RV3 A;  4XQJ A;  1RF2 D;  1CQF A;  4DNR B;  5ELF A;  1B04 A;  2CNV A;  2HGS A;  1G2W A;  2WFW A;  2JA7 G;  3SDZ A;  2AQ3 B;  2F0D A;  1J5E Q;  2E76 C;  5IY0 A;  4I55 F;  3T9F A;  1JJG A;  1I4R A;  2M9V A;  2RVL A;  3E9I A;  4ZLT F;  2Y4R A;  1R9T B;  1JMC A;  1A2U A;  3JAM i;  2P5Z X;  4QUF A;  2SOB A;  3TQT A;  3OW7 A;  1CZW A;  1MJC A;  3TP8 A;  3IL8 A;  3S1N H;  2L55 A;  4IZ8 A;  3ND8 A;  1I4X A;  2JYO A;  4XTC S;  5G3L D;  2RHS B;  4A3K B;  4B3R Q;  1AE2 A;  4J6H A;  5EKK A;  1VMC A;  3MC0 B;  1IBK L;  4IUP A;  4GKK Q;  1QVF A;  3KRE A;  2O5J C;  3OW2 A;  1UE5 A;  2DUD A;  1IOV A;  4O4H F;  2F0S A;  3DTF A;  1Y14 B;  3M4Y A;  3GDE A;  1I2K A;  3K7A H;  3T4A C;  1JDB B;  1Y1W H;  4RKB A;  3D8G A;  3EFX D;  4DV7 L;  3A56 A;  2HD3 A;  5C0X I;  2XWJ B;  1EWI A;  4F7X A;  4HIK A;  3CCM A;  4K0K L;  1LTB D;  4AIM A;  3D4W A;  1CFM A;  4DGZ A;  4GLW A;  1I7N A;  1G2T A;  2VB3 X;  2X0S A;  2R84 A;  5C6A A;  3TN2 A;  4DNT B;  1G8Z D;  1ONL A;  3D4R A;  3FKI H;  2EYO A;  1DAA A;  4DQN A;  1STE A;  2F1M A;  1VS0 A;  3HOU G;  2X69 A;  4YWL A;  2EJM A;  1UE1 A;  4I50 F;  2ASB A;  2NU9 B;  5FPR A;  1OTC A;  4RCN A;  1V9P A;  3D4D A;  2R86 A;  3KLR A;  4A75 A;  2WB1 G;  5DEH A;  4ZUI A;  3KDF A;  2K05 A;  1TS4 A;  1ML0 D;  1PRT D;  3AEV A;  2R93 H;  1SMX A;  3J7Y W;  1TVX A;  2A68 D;  1KJ9 A;  5BWT A;  1YIT A;  5I6W A;  1Z2O X;  3CHB D;  3IAY A;  1EY5 A;  3H91 A;  1CT1 D;  3K5H A;  3MA2 B;  1SNQ A;  3URY A;  1PH5 A;  3DHQ A;  5I5V A;  1JJ2 A;  4JV5 L;  2F0M A;  4CDF C;  2ODT X;  4CJ1 B;  4LF4 Q;  5JEA J;  4DKA C;  2K01 A;  3CPF A;  1EYC A;  4LF9 Q;  1R9T H;  2A8V A;  5I9P A;  4GOP C;  4QGU A;  4XXE A;  5J22 A;  3VPD A;  1EL0 A;  1QVC A;  1FJG Q;  2JA5 G;  1BQQ T;  1NY4 A;  2N55 A;  4GNX A;  3GTK B;  3M4P A;  5CGK A;  2N8N A;  1F9Q A;  1QUQ B;  2A1A A;  2JA9 A;  4U68 A;  1S4Z A;  5BN5 A;  3PIP 3;  4HCS A;  4GLA C;  3M4Q A;  5IT9 E;  4BXX G;  1EY9 A;  1B2T A;  4RGT A;  4RG1 A;  2HVS A;  3BYY B;  2D2C C;  4G7H C;  3JAM E;  1HCZ A;  1Q1B A;  4QQB X;  2PMZ E;  1MGS A;  1JOR A;  1L0W A;  4A3K G;  3MXG A;  1G6P A;  1W6J A;  1HHV A;  3I2Z A;  3NTI A;  1PFS A;  4K6D A;  4DNI A;  2A19 A;  5C4X H;  2HUG A;  3J81 c;  4KHV A;  3N52 A;  1E3P A;  3NBI A;  3EVQ A;  4JI6 Q;  3BA9 A;  1PTO C;  3I3C A;  1HA5 A;  3E3X A;  4PMB A;  5IGD A;  5CE8 A;  1S3O A;  2C35 B;  3PO3 B;  4FP5 D;  1O7I A;  1K28 A;  2B2V C;  3H94 A;  4A3J H;  4DR7 Q;  3CKI B;  1JCK B;  4Z9C B;  2DIK A;  4HR7 A;  4FNF A;  5J3B A;  2B2W C;  1JWU D;  5BMV F;  3DWA A;  3B6Y A;  1ROD A;  3ULP A;  4OIK A;  2B29 A;  5IP7 H;  3BG5 A;  1XX8 A;  1YHB A;  4L1K A;  4MHE A;  2JJQ A;  2CNU A;  2D5D A;  4KKS A;  2NZH A;  2NN6 I;  3DEP A;  1X56 A;  2JA6 B;  4XT3 B;  3ONA B;  3E0J A;  1T36 A;  4MAM A;  1GD7 A;  3GTL B;  1TKW B;  3CAM A;  2AWN A;  2QDL A;  3NBZ B; 
#chains in the Genus database with same CATH homology
 5D1O B;  3UDG A;  3H0G G;  2HIV A;  4YY3 Q;  3A5Z B;  1P16 A;  5IYD H;  3K80 C;  3RLO A;  4GN4 B;  1SRU A;  4X62 Q;  3CP0 A;  2VUM G;  3HOW G;  1TA8 A;  3HFZ B;  1Q8K A;  4IPG A;  4QIW E;  4QL5 A;  5FLX c;  3RR5 A;  1PHJ A;  4A93 H;  1XJV A;  3CF5 A;  3BZK A;  2F4V Q;  1A63 A;  4EX5 A;  1VQN A;  1VQO A;  2OWO A;  4HID A;  4A3G G;  4B3T L;  1V43 A;  3LGJ A;  1SFO H;  4LF5 L;  4JG2 A;  4IPH A;  4LF6 L;  2XTI A;  4HJA A;  1E1T A;  3WWV A;  1N8R C;  4JOI C;  1I94 Q;  3MXN B;  2KCM A;  1WI5 A;  1OXT A;  1SRO A;  4B3S L;  5LMU Q;  3F8T A;  3I4O A;  3PGZ A;  2BH2 A;  2UXC L;  4C2M H;  3CME A;  4LWC A;  4HIM A;  4HIO A;  1XMQ L;  3KJP A;  2K5N A;  1YJN A;  1PH8 A;  3J7A 5;  1OXV A;  1EIY B;  3S14 H;  5JJK A;  2KBN A;  1N36 Q;  1HZB A;  2EIF A;  1WCM G;  1EFW A;  4UCO A;  4A3L H;  4PG3 A;  1VQM A;  2PNH A;  5GRO A;  1NJI C;  4NXM Q;  4BY7 G;  5AJ3 Q;  4EFB A;  4A3B H;  4UCV A;  3DLL A;  4DR2 L;  3K81 C;  3FKI G;  3PUX A;  4JI0 L;  3M4O H;  2ZTD A;  5E7N A;  3S16 H;  2R92 H;  1NMG A;  2MFI A;  4LUZ A;  4JI4 Q;  4GN5 A;  3KFU A;  1CKN A;  1A0I A;  1Y1V H;  4J15 A;  4R1J A;  1EIF A;  3J7Z C;  2UUC L;  3S15 H;  1HNW Q;  2UXD L;  2UU9 Q;  4NXN Q;  1PH2 A;  4KHP L;  2ES2 A;  4YWM A;  1SN8 A;  3K8A A;  1I5F A;  2NN6 G;  4A3F G;  2GVB A;  2YTV A;  1XNQ L;  5M5Y H;  4A3I G;  2Z6K A;  3PCO B;  3S1R H;  5GAD C;  2NVX H;  2CFM A;  4DPG A;  4JBM A;  4LFA L;  4OX9 L;  2UUA L;  2ZJP A;  5JJI A;  3HOX H;  4LH7 A;  3I4M H;  3A74 A;  2DGY A;  4B3T Q;  3HOV G;  2R93 G;  3RN2 A;  4LF5 Q;  1N32 L;  4DR1 L;  1PYS B;  5C0X G;  4A3E G;  4LF6 Q;  3S2D H;  1WYD A;  2CWA A;  1YZ6 A;  1XNR L;  3PIP A;  5IWA L;  4JYA L;  1TAE A;  5H1S E;  3RZO H;  1A62 A;  1P8L A;  3GTP H;  1HJP A;  3PO3 H;  4DR4 L;  4JI1 L;  4X6A H;  4OON A;  3NEM A;  4B3S Q;  4LUO A;  4HJ9 A;  2N49 A;  2UXC Q;  1XMQ Q;  1M1K C;  1YJ9 A;  3EN2 A;  2K4K A;  1YEZ A;  5IP9 H;  2D0O A;  1KD1 C;  3HOZ G;  1TWG H;  3PN1 A;  3K0X A;  4DK6 C;  3D31 A;  5C0X J;  3PF5 A;  2B63 G;  2VZA A;  1WJJ A;  1PH7 A;  3GB8 B;  4OWT B;  1G51 A;  3AQQ A;  1PH6 A;  1UEB A;  3TS0 A;  2JA6 H;  4O2D A;  1D7Q A;  1VQF A;  4IJH A;  4DR2 Q;  4UCS A;  1VQE A;  5M3M H;  1QZH A;  1FGU A;  4JI0 Q;  4X65 L;  4BBS G;  1KRS A;  1KC8 C;  4P73 A;  5DIS C;  2CCZ A;  4B3M L;  4MTN A;  4YY3 L;  3KF6 B;  4HJ8 A;  2UUC Q;  3GTQ H;  4LNQ A;  2UXD Q;  4IFD G;  3KJO A;  4A3C H;  3KLW A;  4KHP Q;  1E1O A;  1G29 1;  1YI2 A;  3KF8 B;  4PZ6 A;  2VUG A;  2HVR A;  1Q7Y C;  4B3R Q;  1HZC A;  1VQL A;  3PO2 G;  1BVS A;  2B3G A;  2JA7 H;  4Y7N H;  3CCJ A;  1XNQ Q;  5GAG C;  4CC6 A;  4OX9 Q;  3AYH B;  3TRE A;  1VQ4 A;  2UUA Q;  3GJX B;  3S1Q H;  2WAQ E;  1X3E A;  3STB C;  4UCT A;  3KOJ A;  4CC5 A;  2ZJR A;  1L1O A;  3GTM H;  4IFD J;  1N32 Q;  4DR1 Q;  2K5V A;  5EAY A;  2VW9 A;  1XNR Q;  3I4N H;  5IWA Q;  4JYA Q;  4UPA A;  5M5X H;  3PV0 A;  3G48 A;  4JI1 Q;  5ELN A;  1IBM Q;  4DR4 Q;  3NEL A;  2KCT A;  4GOP A;  4LFB L;  2LXJ A;  2WAQ G;  3BZC A;  4RMF A;  1YIJ A;  3TY5 A;  1AE3 A;  4GS3 A;  5M5W H;  1VCI A;  4X64 L;  3QWU A;  1PH4 A;  2D0P A;  1Q82 C;  2IHF A;  3HOY H;  1PH1 A;  1E7Z A;  2YTX A;  2HQL A;  4JBJ A;  2N3S A;  3BAB A;  1EQR A;  3TEH B;  1BKB A;  2NZO A;  1VQP A;  1QUQ A;  1GO3 E;  2RF4 A;  4AYB G;  1GM5 A;  2HHH L;  4JI7 L;  1BBU A;  1VQG A;  4JI2 L;  2LSS A;  5C3E G;  2OQ0 A;  4IPC A;  5C44 G;  4X65 Q;  2UU9 L;  4A3J G;  4BY1 H;  3MEF A;  4OXP A;  2ZM6 L;  4B3M Q;  3EIV A;  2QEX A;  4HJ5 A;  1XDN A;  3VNN A;  4IJL A;  4L5R C;  4C3I H;  2KHI A;  1MKH A;  3H0G H;  2JQO A;  1LYL A;  1L2F A;  4DV2 L;  1PYB A;  4POG A;  2JEA I;  3BAA A;  2PI2 A;  1YVC A;  3HOW H;  1IXR A;  2I5H A;  4TVA B;  2Q2H A;  4DV4 L;  1VQA A;  4XIG S;  3ZJY C;  3K7U C;  1ASZ A;  1J6Q A;  3GTO H;  1N34 L;  1Y1W G;  4JBW A;  2K14 A;  3G6E A;  3UDF A;  4JCV E;  1X54 A;  4A3G H;  1NE3 A;  4JI8 L;  2HT1 A;  4C3H H;  3AFQ A;  4P71 A;  1K8G A;  2PQA A;  1PA6 A;  2VQF L;  3E9H A;  1NMF A;  4Y52 H;  1S72 A;  4JI5 L;  2I0Q A;  4DUY L;  1GVP A;  1RIP A;  3RLN A;  1VQ5 A;  1AH9 A;  1K3R A;  5IYB G;  4DV1 L;  1M90 C;  4YCU A;  2CKZ B;  3HOU H;  4DR6 L;  3TY8 A;  4LFB Q;  4QJF A;  4GNX B;  4H02 A;  1SR3 A;  4UP8 A;  4X64 Q;  4GNX C;  2OTL A;  1WFQ A;  4HTO A;  3CC4 A;  4YWK A;  2Q2U A;  2IY5 B;  3F2C A;  4BY7 H;  2AMC B;  2NVQ H;  1Z9F A;  2IX0 A;  1X55 A;  2VQE L;  2HHH Q;  4JI7 Q;  1A8V A;  4KHZ A;  2AKW B;  2VL6 A;  3CPW A;  2UUB L;  2H5X A;  4GLV B;  4JI2 Q;  1FL0 A;  1KRT A;  2V1C C;  2E8G A;  1OXS C;  3UDX A;  2PI2 E;  3F2B A;  2NVY H;  3HKZ E;  1HNZ L;  1JJC B;  3NC0 B;  2ZM6 Q;  1I50 H;  3CCV A;  4PZ8 A;  4A3B G;  3A5U A;  2YYZ A;  3PUV A;  2R7Z H;  4YCV A;  4DV2 Q;  4DAM A;  5FJ8 G;  4A3F H;  4AH6 A;  1HNX L;  2R92 G;  5C4J H;  3CQZ H;  4L5Q A;  4DK3 C;  3HKZ G;  4DV4 Q;  1K8A C;  5D1O A;  1YJW A;  3PSI A;  1Y1V G;  3OTO L;  1N34 Q;  3S2H H;  5LMN L;  1KL9 A;  3L2P A;  3CD6 A;  1C9O A;  3HOV H;  4FDB A;  4JI8 Q;  1VQ9 A;  3JSN A;  4E6N A;  4P72 A;  5JEA G;  3W1B A;  1IBM L;  3CCS A;  1VQJ A;  4TQU S;  5FLM G;  2VQF Q;  5ELO A;  1YBY A;  2JA5 H;  4JI5 Q;  4LW1 A;  4DUY Q;  3I7F A;  2JA8 G;  2K50 A;  4A3D G;  5K36 G;  1J5E L;  3FP9 A;  3G4S A;  2ID0 A;  4OO1 I;  1L1O C;  1Q46 A;  3HOX G;  3RLF A;  4DV1 Q;  1K9M C;  4DV3 L;  5IE8 A;  3I4M G;  1CUK A;  4DR6 Q;  1JT8 A;  2GN5 A;  3ULJ A;  3OYY A;  4BBR H;  2HVQ A;  1I6H H;  2IX1 A;  1EUJ A;  1K0R A;  5IYC H;  1PV4 A;  3BA8 A;  1TWC H;  1D8L A;  2B63 H;  4JI3 L;  4BXX H;  3PO3 G;  1UE6 A;  3G71 A;  3H3V H;  3CW2 C;  4OWW B;  1GKH A;  4A4I A;  1VQ6 A;  4LH6 A;  2VQE Q;  1LUZ A;  3F2D A;  2E2I H;  4AQY L;  2UUB Q;  2UXB L;  4WJ4 A;  5IP9 G;  1YHA A;  3PUY A;  1E22 A;  4R4I A;  1OXX K;  1TWA H;  2Y0S E;  4X66 L;  5M3F G;  4DR5 L;  4LFC L;  1HNZ Q;  1IBL L;  4A3K H;  4B3R L;  4EFE A;  1WOC A;  3CC7 A;  4C3J H;  4GKK L;  3AFP A;  1S40 A;  4IOA A;  3E0E A;  3RTX A;  2JA6 G;  4JC0 A;  2ALY B;  1EYG A;  4NB3 A;  3D0F A;  5M3M G;  2YU9 H;  1B8A A;  4R4O A;  2ATW A;  3M3Y H;  3PO2 H;  1NTG A;  1UWV A;  4BA2 I;  4KLK A;  1HNX Q;  4POF A;  3H15 A;  2Y0S G;  1QZG A;  1N33 L;  1Z47 A;  3OTO Q;  1KXL A;  3FHW A;  5LMN Q;  3GTJ H;  3U4V A;  2F3I A;  4A3C G;  4A3M G;  5C4X G;  1B04 A;  5LMN W;  4AYB E;  2I5M X;  4MZ9 A;  2WFW A;  2JA7 G;  1K73 C;  3PUZ A;  1B7Y B;  1J5E Q;  5IY0 A;  2Q2I A;  1JJG A;  4DV3 Q;  1KIX A;  3UE1 A;  1JB7 A;  3E9I A;  4GN3 B;  1PH9 A;  4LF7 L;  3TY9 A;  2Z0S A;  4LF8 L;  1JMC A;  2IT1 A;  1N9W A;  3JAM i;  3I4N G;  4JI3 Q;  1SE8 A;  3UE0 A;  3CCE A;  4R4T A;  1C7Y A;  1MJC A;  2N78 A;  1SLJ A;  5C3E H;  3CXC A;  3S1N H;  4OWX B;  3I56 A;  2R6G A;  3CCR A;  2VNU D;  1U5K A;  1IZ6 A;  4AQY Q;  3CCL A;  2UXB Q;  5D1P A;  3S17 H;  4XTC S;  4L5S A;  3HOY G;  2VY3 A;  5IP7 G;  1VQ8 A;  2RHS B;  4X66 Q;  3J81 i;  4DR5 Q;  1QVG A;  1CKN B;  1IBL Q;  4LFC Q;  1AE2 A;  2CQO A;  2VUM H;  1IBK L;  3HKS A;  1BBW A;  3GTG H;  4GKK Q;  1QVF A;  3TRZ A;  4O0A A;  4IPD A;  2RCN A;  3OW2 A;  2E5L L;  1UE5 A;  2DUD A;  2EXD A;  5BR8 L;  1EOV A;  3KF6 A;  2ZJQ A;  1H95 A;  1Y14 B;  3W5O A;  3GDE A;  3K7A H;  1XPU A;  3TS2 A;  1E24 A;  4UP9 A;  1Y1W H;  1MIU A;  2Z6K C;  1N33 Q;  3JC6 6;  5IYD G;  2K75 A;  2JEB I;  3U4Z A;  2Q2T A;  2XGT A;  1OXU A;  4DV7 L;  1XMO L;  1UE7 A;  2I5L X;  4UP7 A;  5C0X I;  2EQS A;  4A93 G;  1VQ7 A;  4HTP A;  1EWI A;  3I55 A;  3CMA A;  4DV6 L;  4HIK A;  1MJE A;  3ICE A;  3CCM A;  4A76 A;  4GKJ L;  3T1Y L;  3BU2 A;  2K52 A;  3W1G A;  4K0K L;  4AIM A;  2R7D A;  1X6O A;  5IYB H;  2JA8 H;  4LF4 L;  1YNX A;  3J81 j;  4LF9 L;  1WCM H;  4DV5 L;  4DAY B;  1VQD A;  4UCU A;  4LF7 Q;  1KHI A;  3CCU A;  1FJG L;  4P74 A;  4LF8 Q;  2KHJ A;  3RNU A;  1HZA A;  3FKI H;  3CCQ A;  1VQK A;  2KEN A;  2WB1 E;  4IO9 A;  3GTK H;  1DGS A;  2JK8 A;  1LTL A;  1VS0 A;  1LM0 A;  3HOU G;  2ZTC A;  4ME3 A;  4YWL A;  1UE1 A;  2E2J H;  4A3L G;  2ASB A;  4DV0 L;  1YHQ A;  1X3F A;  2CWP A;  5FPR A;  1VQC A;  5HY6 A;  5GAE C;  1OTC A;  4DRF A;  1V9P A;  4KI0 A;  4A75 A;  3IRB A;  4IFD I;  2WB1 G;  2FXQ A;  4UCR A;  1IBK Q;  4MNO A;  3KDF A;  2YV5 A;  4GLX A;  4A3I H;  1TWF H;  1Q86 C;  2E5L Q;  3L0O A;  5FJ8 H;  5BR8 Q;  3AEV A;  1NBW A;  4EQ5 A;  1W3S A;  4UY8 C;  2R93 H;  1SMX A;  4APV A;  1VQB A;  4YHH L;  2ZTE A;  4A3E H;  3JSL A;  1CKM A;  4PMW A;  1YIT A;  1KQS A;  2F52 A;  1HZ9 A;  4DV7 Q;  1XMO Q;  3Q8D A;  2R7Z G;  1L1O B;  4L5T A;  5FLM H;  4JOI A;  4LUV A;  1IYJ B;  3STB D;  5HGQ A;  4DV6 Q;  1PH5 A;  2L15 A;  1IL2 A;  2NVT H;  3PIO A;  2HIX A;  3T1Y Q;  2BA0 A;  1JJ2 A;  4JI6 L;  4A3D H;  4GKJ Q;  4K0K Q;  4JV5 L;  2R7F A;  4DUZ L;  3RZD H;  1RL2 A;  3DM3 A;  3HOZ H;  2AHO B;  3BJU A;  4LF4 Q;  5JEA J;  4DKA C;  4GOP B;  3CPF A;  4LF9 Q;  2A8V A;  1R9T H;  1S68 A;  3F1Z A;  4GOP C;  1K83 H;  3NBY B;  4QGU A;  4DV5 Q;  3UQ8 A;  3KYH C;  4ALP A;  1QVC A;  1EQQ A;  1FJG Q;  2JA5 G;  2MQH A;  2MO1 A;  1NY4 A;  4P75 A;  3ULL A;  4QY7 A;  3A0J A;  3M4P A;  4GNX A;  4JBK A;  4BBS H;  4DR7 L;  2N8N A;  2AWO A;  1ASY A;  5FPO A;  1QUQ B;  1Q81 C;  3ERS X;  2A1A A;  2JA9 A;  1X65 A;  3NEN A;  3RN5 A;  1W2B A;  4GLA C;  2GVA A;  3U50 C;  4BBR G;  5IT9 c;  1U0L A;  2WP8 J;  3T1H L;  1XPR A;  1HR0 L;  3M4Q A;  4R4C A;  5IYC G;  5M3F H;  4DV0 Q;  1PVO A;  2QGQ A;  1HH2 P;  4BXX G;  3GD7 A;  1XTD A;  3CC2 A;  1JE5 A;  4RG1 A;  4DR3 L;  2HVS A;  3S24 A;  5GAH C;  3JAM c;  3GTL H;  1CSP A;  2MO0 A;  1Q1B A;  2OQK A;  3TQY A;  4QQB X;  2PMZ E;  3U58 A;  3PUW A;  2IHE A;  1TWH H;  1L0W A;  4YHH Q;  5JJL A;  4X62 L;  4A3K G;  1G6P A;  4UFZ A;  4BA1 I;  3I2Z A;  1PH3 A;  4DNI A;  1PFS A;  1C0A A;  2A19 A;  4A3M H;  5C4X H;  2F4V L;  1X9N A;  1B70 B;  3ER0 A;  3J81 c;  2PQA B;  3PF4 A;  3M9B A;  3L7Z C;  1E3P A;  2LXK A;  1Q1E A;  4LFA Q;  4JI6 Q;  3BA9 A;  3GO5 A;  4JV5 Q;  3SGI A;  4DUZ Q;  2QA4 A;  4WJ3 M;  2RHQ B;  1I94 L;  3UDI A;  1S3O A;  1XPO A;  1XK5 A;  5DLQ E;  1VQI A;  2C35 B;  5LMU L;  3EBE A;  3S1M H;  4HJ7 A;  2OCE A;  4OO1 G;  1O7I A;  1Q12 A;  2YTY A;  2K5H A;  5C44 H;  2JE6 I;  1CSQ A;  3J80 c;  3M7N A;  1N36 L;  4A3J H;  2E2H H;  1T9H A;  4DR7 Q;  1CKO A;  2MNA A;  3VDY A;  2D62 A;  4NPS A;  5J3B A;  4R4Q A;  1VQH A;  2BH8 A;  4PZ7 A;  2OTJ A;  1V1Q A;  4NXM L;  5AJ3 L;  3B6Y A;  2BA1 A;  1HR0 Q;  1FVI A;  1X3G A;  3T1H Q;  3ULP A;  2B29 A;  5IP7 H;  1YHB A;  3H3V I;  2JJQ A;  3NBH B;  1I3Q H;  4EEQ A;  1HR0 W;  2NZH A;  2NN6 I;  1X56 A;  4YCW A;  4JI4 L;  1TXY A;  2VS1 A;  5GQO A;  4BY1 G;  4DR3 Q;  1HNW L;  1GD7 A;  1KAW A;  3CAM A;  4NXN L;  4IOC A;  2AWN A;  3M85 A;  3KDF B;  3NBZ B;  3J80 i; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...