3W1LA

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with 5-chloroorotate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Crystal structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with 5-chloroorotate
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 108
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w1lA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w1lA01
1H61A 3LCGA 4NU7A 4JDBA 1PCWA 4DF1A 3O6CA 1W0MA 2HS8A 5EY5A 1P1XA 3LHYA 4YMZA 3BW3A 1G7UA 2V5LA 1R2RA 3DKLA 4ZQRA 3WFAA 1OK6A 1TPUA 2VFEA 2FIQA 3TROA 2Z6IA 2YFOA 2ZA1A 5CZSA 5LGZA 2RFGA 2BWGA 3PB0A 4PA8A 4S2BA 1YTDA 3QQ1A 4IXHA 4KWVA 1VZWA 4FX6M 4UFLA 3DHFA 3P62A 1JCXA 1GYLA 2A7PA 3CM4A 2VENA 5EL1A 5F2IA 3TQ0A 3S1UA 3QZEA 5HR6A 3BARA 2QJHA 1IXQA 3STCA 3NAVA 3P61A 3M44A 3EKLA 3F4NA 1LOLA 1OABA 1HG3A 2ISSA 5DELA 4HN4A 3HG4A 3TR2A 1I2QA 1JRCA 3KX6A 1M7OA 1KFKA 2ZA2A 1FCQA 3QW4B 1DQWA 1XL9A 1H7XA 3TV8A 3NZ1A 1KW1A 1GG1A 3BG5A 1ZENA 3L2IA 5SWUA 2NX1A 4M6PA 3PBVA 1LORA 3TW6A 1DHPA 3W22A 4IX2A 1IIGA 4O53A 3TIMA 3LHTA 3FEMA 1JVNA 4ZQCA 4JXCA 4OGZA 2QEZA 3C2VA 5H91A 3BGJA 5IM51 3W7CA 5EKYA 3NPXA 3DENA 1WA3A 3ABRA 1A50A 4U4MA 3P84A 3R12A 4KFPA 2ZBTA 5T26A 1K7EA 3EX2A 3G0UA 1W5NA 3KRUA 5ABTA 5HUOA 1THFD 6TIMA 2YSWA 4A29A 1SO6A 1OG0A 3C0JA 4H6KA 3C56A 3V75A 1PS9A 4QAIA 1QPQA 2QR6A 1FCVA 4A2RA 3LHZA 1FBAA 1YTEA 1GVRA 3GXPA 4QIUA 1LRNA 2DZVA 2GVLA 4OHQA 1RQEA 3IIVA 5KITA 3MWAA 4DXVA 1G67A 3GX9A 2VFIA 5F4SA 3NGJA 2RHGA 4J9JA 1DV7A 5AC7A 1I2OA 3O63A 4Y9AA 4LC6A 3SR7A 2O7QA 3GK0A 4AWUA 3GXNA 4E2BA 5BOOA 1AW5A 2ZZ4A 4UFKA 3OVRA 5KZEA 3NL5A 1A5CA 3N9RA 2PURA 2RKXA 1CX9A 2XFWA 1SUXA 3W7EA 1LTDA 1VCVA 3GVGA 4JIPA 2BX7A 3E02A 4JTHA 3EKZA 3BW2A 5EMUA 1KFEA 4EOUA 1LRQA 3HJZA 3P5YA 5I3JA 1WBJA 5D04C 2Y7GA 4XQ6A 3W7MA 3VCRA 4BWLC 1X6UA 1Q6OA 3M5XA 2PE4A 1RQHA 4AF0B 3QMRA 5DXXA 5K4XA 3S8HA 4PEKA 1OYBA 2J6XA 1OVDA 1JUKA 3DBPA 4UCGA 4L4MA 3TUUA 1LRTA 4FNUA 3TC6A 1GT8A 3Q58A 5G5IA 2CWNA 1JRBA 3UXDA 2CW6A 2A85A 4NZJA 4KFOA 1FX6A 3HIJA 1Z44A 3W7HA 2ATSA 3H55A 4LVAA 1NEYA 1F76A 1K3UA 4MJMA 4AMAA 5KSWA 3M0ZA 3L68A 2WNQA 3I65A 4DELA 4MVAA 3NPUA 2NV1A 5HJLA 2QKFA 2Y85A 4DBDA 4NJGA 3NL6A 1XUUA 4GJ1A 2QJIA 1P0KA 2WV8A 3PWAA 2RDUA 4ORIA 3G1HA 3QMTA 3QRHA 4O1DA 3DXIA 3HGJA 3B04A 4XTIA 5LHFA 3INPA 4OE7A 2B7NA 3HMJG 3M16A 1RPXA 4X9SA 3W1TA 3NXFA 4JY9A 2ZA3A 4MYXA 4WY0B 4LTSA 4K8EA 1GTHA 1ZALA 1VJIA 5DCEA 4N9DA 3FKKA 1QCWA 1O60A 3NL2A 4FXRA 1GVOA 2DJLA 4Z1AA 3EWBX 2E77A 3W2MA 3LLDA 5K4ZA 1XUZA 3IVTA 3TJLA 2E6FA 4QQ3A 5J5RA 1NF0A 3P7YA 3HGSA 3LTSA 2UV8G 3M5ZA 2E6DA 2HTMA 2YYTA 4WY0F 2VKZG 3HBLA 3B05A 4LWWA 5DY3A 5BMWA 4GE8A 1P5BA 4XKYA 4X22A 1ZAIA 2QCCA 4ADUA 4MY9A 5L9FA 2GQ9A 1L6WA 4U28A 1T96A 2VXNA 4B5NA 1TPDA 3DFQA 2ZZ1A 2C19A 2VFFA 1SZEA 4DF2A 4C1LA 5BNKA 3ZFHA 1W3IA 5HMSA 3EX4A 4M19A 5AHLA 1GJPA 3NOEA 5DLCA 4K39A 4NVTA 1VYRA 1NAL1 1X1ZA 3NEVA 3OVPA 1FUYA 2ZZ5A 3TXZA 3OA3A 2R14A 5I3GA 3NQAA 1YPIA 3RMJA 3S9YA 1SU5A 1HUVA 5D2XA 4R7JA 3I6RA 3LCWA 3BLIA 5G2WA 3ABOA 4FB7A 5BMXA 3TJXA 1A5AA 3O16A 4BK9A 5D37A 3E9AA 4CNPA 5LKYA 1W5PA 1S5WA 1SSDA 3P81A 1JCNA 5AHIA 1XC4A 3DHDA 2BXVA 3DU0A 4A22A 3TAOA 1N8FA 2QCFA 3W7RA 1Q6LA 3IIZA 4UFJA 1DQXA 4MOZA 4O4WA 5E0KA 1B57A 1FCBA 3VI2A 1LOSA 2WSRA 4N9BA 1T8XA 5TIMA 3UZJA 5I3FA 4K37A 4DO4A 2X16A 4E2DA 3STEA 1QO2A 1KM4A 4WQ6A 4KWWA 2Y7DA 4AXKA 5F1VA 4ADTA 1JQXA 3HOJA 3GNNA 4CNOA 2FB3A 3W86A 1IXOA 3C3NA 3DGRA 3W3OA 1OYCA 1RD5A 4G1KA 3FJ6A 3LX9A 3O05A 5DXYA 1B9BA 3QF0A 2QF7A 1YDVA 5G4EA 3OG3A 4WUIA 4FXSA 4UFMA 1LOQA 4ZVJA 1OFRA 2J24A 2XN1A 3LOTA 1OJXA 2XN2A 3C4UA 5DY2A 3ATZA 4H3DA 3S5ZA 4RV8A 2OJPA 4LVBA 1XBYA 3P80A 1JUBA 2Q8LA 3I68A 2V2HA 2R91A 1TRDA 1YADA 4O57A 2C6QA 4NNAA 2YX0A 1QPOA 4WD0A 2E6YA 2ZCGA 3BG3A 3V1PA 1EP3A 4GUHA 1ML1A 3S1XA 5KZMA 3DH7A 3EWUA 3MMTA 1YXDA 5HUPA 1Z41A 3PR2A 3TH6A 5FEZA 3BPWA 5G1YA 4RLIA 4HNNA 2E1DA 4UXDA 1PIIA 3UY8A 4BWLA 4TX9A 1SW7A 1PHQA 3IIXA 4K6AA 2J9XA 3L0GA 4D2JA 2TPSA 1ZFJA 3NQVA 2ZTKA 3OVQA 2G97A 2J27A 2CLEA 4FX8A 3B0UX 4O1BA 1SQ7A 4AF0A 2QCHA 3RFAA 1B3OA 5DBTA 1B4EA 1GWJA 1GYNA 4RKAA 5EPDA 1OX6A 3BGGA 5K3VA 2DZTA 2WSYA 1W31A 3FKRA 3W7DA 1TPEA 5CZ0A 4XZ9A 2NUYA 1HL2A 4UNKA 1EP1A 1DKWA 3W7KA 3W7LA 1WOAA 3T44A 4JTKA 4M7SA 4Q33A 1H5YA 3PBWA 3L67A 2A1YA 5CG7A 1F74A 2DZWA 2QCMA 3LCXA 1UCWA 3SI9A 2OX1A 3N2MA 2YZRA 1GEQA 3AO0A 3PG8A 4TU1A 1VYSX 1KFCA 3TX9A 3ANYA 4ZMGA 1D9EA 4LRTA 1VLWA 4YLWA 4N4QA 1QPRA 3TU9A 1H7RA 3BW4A 4ZQOA 3TFCA 5D2WA 1CW2A 4M7TA 2CLKA 3W7QA 4XBSA 3NR0A 2ISVA 3CEUA 2I9EA 4UMBA 5E1QA 3TXVA 1YLVA 3T78A 1Q45A 3ELFA 3QW3A 4RJEA 5DBUA 3TC7A 5D2TA 4YXGA 3W1LA 2X30A 1XBVA 1XFBA 3UD6A 2C1HA 4EIVA 5KMYA 2O7SA 4O11A 4NJIA 3LTPA 2BLEA 4O10A 3HG5A 4HSOA 5U4NA 4L4LA 1KM1A 4C1KA 1ADOA 4WY0A 3UWQA 1MEWA 3THQA 2VEPA 4WOQA 2VELA 3KVMA 4UTWC 1JUEA 3P8IA 3S1VA 3QJAA 2AGKA 2Y6ZA 3A22A 1FWNA 2E68A 1FXQA 1YYAA 2H8XA 1V7YA 1VHNA 2EGZA 5TBOA 3BLEA 2NX3A 2V2CA 2YR1A 3W2NA 2FDSA 2R94A 3A9IA 2OT1A 2CLFA 3KVJA 3YPIA 3W83A 3UYCA 1G4TA 4IMFA 4WXYA 4HSNA 3HGOA 3W2UA 4N4PA 2NXGA 3F1QA 3G18A 3R5EA 2TRSA 1TRIA 2ZFAA 4UR8A 1A5BA 1MEHA 2H6RA 1PV8A 2P10A 2WJZA 3G1FA 4ALDA 2QCDB 4IPJA 1ME8A 4UR7A 1QWGA 3CB8A 4A3UA 4GWEA 5EYWA 2NX9A 5E93A 1K03A 1CI1A 1ZAHA 2ZRVA 1C8VA 1DL3A 1ZJIA 2RDTA 5IBXC 2CLMA 4PTNA 1I4NA 3LV5A 1O95A 4LVGA 3MW7A 3S6DA 3E96A 2GQAA 1DBTA 1XI3A 1XDMA 1OFDA 5FEXA 2WO5A 2VFHA 5D05A 4N6EA 3IIPA 2CZFA 3S5OA 4Q4KA 4GFSA 2Y89A 5D38A 4WX2A 1KA9F 5F2MA 1IXNA 1VYPX 1G7VA 2FTPA 5AHFA 5MHBA 1TJPA 2WOQA 4R34A 4HNUA 1TB3A 3SGUA 1TV7A 1W5QA 3MO7A 4M6QA 4RCXA 4CCDA 4N6FA 3T4CA 1O4UA 2Y88A 5D33A 3W72A 3C6CA 2CU0A 4X3ZA 2JGYA 2PRHA 4DO5A 2QCGA 1R47A 4DO6A 2GOUA 2ZTJA 4IMGA 3DFTA 4JR5A 4FF7A 4AH7A 1RQBA 3W71A 4JX6A 3QFEA 1QNVA 2CLIA 4QNEA 5C5YA 3VFLA 2E5BA 4IMCA 4MYAA 1TTIA 1PVNA 3MP5A 2Z2UA 3W7OA 5K9XA 3TKFA 3SIZA 5DCDA 2DU2A 5G1TA 3KFTA 4JGDA 3W1XA 4M6VA 1OFAA 2QCEA 3I7SA 1KTCA 1KV8A 2DP3A 3BK0A 5D30A 4PFMA 1KFLA 2QUVA 3OIXA 4LNYA 2ZZ6A 3NO5A 1ZHAA 3GR7A 3W84A 3NQDA 4CNNA 1H1YA 4HIBA 1EUAA 3G1AA 1ONRA 4ZQPA 1IIHA 2H90A 4TIMA 3FYOA 1F05A 3WK2A 2PC4A 4MLJA 3EWWA 1RZMA 4UTIA 3W6YA 3MI6A 2ATMA 3WJXA 4Q32A 4LC8A 4JN6A 4ONVA 3S1WA 3S42A 1H7WA 4UIOA 3TE9A 3ZWSA 3PUDA 1K8YA 5CGQA 4IMEA 3CQ0A 1FXPA 1TPB1 2NWRA 5FEWA 1U83A 2Y63A 4IXXA 4UTTC 3IVUA 2WSQA 5LGXA 1D3GA 1X7FA 2V82A 3GNDA 2ZZ2A 2RH9A 2ABBA 3G0XA 1FWSA 4QSHA 1PE1A 1BEUA 2NLIA 3NPVA 3LBMA 5H2ZA 3F4WA 5EA9A 3I7QA 2IQTA 3W1MA 3R2GA 5CZJA 1V5XA 3GR8A 4JY8A 1OFBA 1G4EA 1GOXA 3W76A 1G6CA 2AQWA 5LNUA 3W2LA 4OV4A 2QAPA 1G69A 4UTKA 3UQNA 4O28A 1FDZA 3LCIA 4IOTA 1RV8A 3B0PA 4O14A 3EXRA 1HFBA 1R2SA 1TTJA 2X1SA 3C8FA 1TMHA 1KM0A 3KVLA 4CQ8A 1WQ5A 4FNSA 3DFSA 4JTUA 3H53A 3S0CA 4Z1BA 3SGZA 1SR9A 4JTJA 3PY2A 3MYOA 1JCMP 3TSBA 1LBMA 1FWWA 1W3NA 3QPZA 2ZZ3A 1QOQA 4IMDA 1HTIA 3N3MA 4RZ4A 1YDOA 4Y6GA 3NPWA 4CLMA 1P4CA 3CU2A 1VPXA 1P0NA 2QAFA 3HF3A 2TSYA 3NDOA 3N9SA 4FIRA 3TAKA 1OHLA 2EPHA 4HPXA 3LERA 1VS1A 2E6AA 1OFEA 3M5YA 4NJJA 5CSSA 3C61A 3LRMA 4PL2A 2ABAA 3MI2A 3MI3A 3NQGA 1X8FA 3U6WA 1H60A 3HPXA 4O1AA 5A8GA 2YGYA 4O1CA 4O15A 3G1XA 3LBCA 1W37A 3LCHA 4AHQA 3TSDA 4S1FA 1SZNA 3GXTA 4ICNA 3W2JA 2EAWA 5CPLA 3CWOX 4WJEA 1VLIA 4NNCA 1YPFA 1PCKA 1A53A 3W1NA 2X1UA 4O12A 4BI6A 3MUXA 4MFDA 3PAJA 1JCJA 4UTUA 3OHIA 4I7WA 1XBZA 5LHEA 3B0VC 3CWNA 3UNDA 1Z42A 2GUUA 2D73A 1C29A 2ZQ0A 3UWVA 3EXSA 3ZR4A 1G4PA 5K9CA 2YXGA 4MIMA 3R13A 5HQEA 3DFPA 1UUOA 2WNNA 2NUWA 5LZLA 2PRMA 1QMLA 3ATYA 4IQLA 8TIMA 3QSRA 3LCLA 3T55A 3ABQA 5HR7A 2QCDA 1OYAA 2OMAA 2Y7EA 5G2IA 4JD4A 4JDYA 4PODA 3W75A 3CTLA 4MPQA 1XBXA 1AW1A 3MHGA 1RR2A 1LP6A 1H7OA 3W73A 1H51A 3W1AA 3W23A 3CIXA 3G3DA 1JR1A 3PUOA 1W1ZA 3LM7A 4JYFA 1I2PA 4MFEA 3G22A 4LU0A 1KLYA 4ZQNA 3NVTA 3TCEA 2I1OA 4XWUA 5F4WA 2F7FA 3UY7A 2A21A 1OX4B 1TPWA 2DZSA 1XXXA 1H63A 4JICA 2H8ZA 3L5AA 3C2FA 4DQWA 3G8EA 3N2XA 3W85A 3RF9A 2P1FA 4Z08A 3OEXA 2B4GA 4OT7A 4NXSA 3P67A 1R46A 2B7PA 2HMCA 4O19A 1W54A 1SFJA 1TCDA 3M7WA 1OF8A 2FFCA 1U5JA 2GJNA 2AAMA 4OQVA 5C55A 2A5HA 3GDKA 3PUEA 3G3MA 5KZDA 1OFOA 4FNRA 2ZDRA 2B0MA 5I3KA 1MEIA 1EP2A 2HSAA 5F1UA 1G4SA 2TYSA 3L65A 3G1DA 3GKFA 1TO3A 3W1UA 3FS2A 5AYXA 3LV6A 4AB4A 5AN7A 1VR6A 4EF9A 3LRKA 3QYQA 1WBHA 3USBA 1ICPA 4MUZA 1WXJA 4XUGA 5J5DA 4YCOA 2FPTA 4GBUA 3DKJA 3O07A 1EWDA 3LB0A 4EWND 2V8ZA 4P2VA 3W7GA 3LRLA 4LW7A 5KINA 2NXHA 1UB3A 3DI1A 2DJXA 5AYYA 1OFPA 3KHJA 4MZYA 2EF9A 3LXBA 4O4VA 2A6NA 2QUUA 1WAUA 3NQEA 2V0TA 4HNTA 4MLRA 3G1VA 4UTHA 3KVKA 1LCOA 5D02A 3EX3A 3NA8A 1TV8A 3JR2A 5D03A 4N02A 4UTTA 3IEBA 3NG3A 3CPRA 3P74A 4NX5A 3C52A 3E12A 1NF7A 2YPIA 3NQMA 3TMLA 5HINA 3NQ2A 2CLHA 2CZDA 1WOBA 1GVFA 1ZAJA 1B4KA 3PBYA 3L0KA 1LLWA 4YWIA 1SW0A 5CPOA 2KZHA 3MP3A 4BR1A 4EF8A 1PHWA 4MY1A 2NUXA 2CFFA 4LV9A 4NZFA 3IVSA 5KTLA 1Q6QA 4ADSA 1N55A 3GDLA 2J9ZA 3PSVA 1GVQA 2ZRYA 6ALDA 1SZGA 5CPNA 3SZ8A 5LNRA 2NXIA 1AMKA 1GVSA 5AOUA 3LI1A 3K30A 2C13A 5AYZA 3O8AA 1DJQA 4LUIA 3U8GA 3NQ7A 1WYIA 5FF3A 3TDFA 1K8XA 5HWNA 4QNWA 4R53A 3B8DA 4OBTA 3O15A 1DORA 2C16A 1T0OA 2C0AA 2PCQA 3HPSA 1R30A 3VE9A 4I7UA 1LROA 1FWRA 5CKSA 5FEPA 3P8JA 3PVFA 5D2VA 2DZPA 1SSGA 3TSMA 4MZ8A 1W56A 2A6LA 3WK3A 1H62A 1IF2A 4GNJA 3PG9A 3RK8A 1L6YA 4FNQA 1ZNNA 1OX5A 3IGXA 4PCFA 4FO4A 3GAKA 2Q3OA 2X1TA 5BW6A 3BO9A 1TTQA 2V81A 3UXAA 1QR7A 1QO5A 4NX0A 2Y62A 1KBJA 4TR9A 3A23A 1Z48A 1K02A 3GDRA 3LHUA 5LNSA 4JS3A 3RNDA 1WX0A 2Q8ZA 5AHNA 1R2TA 1AL8A 4O13A 2VOMA 3HO8A 4Y90A 3WK1A 2ISWA 4JYEA 4UUIA 4JYDA 3VNDA 3LXCA 4RX0A 4NNBA 1KFBA 3GIYA 3WJWA 3DFOA 4I9AA 5D32A 4ZZ9A 1LYXA 2QJGA 2XN0A 4FNPA 3QSTA 7TIMA 1KM2A 2BSLA 3O6YX 4K7YA 3W7JA 1NFBA 2EKCA 1TPFA 3D0CA 2X2GA 4FHAA 4S2CA 1GQNA 3M5VA 1FCUA 3UWZA 3KAOA 3FOKA 5BRBA 1NVMA 1XDLA 3CLMA 2Y7FA 2FPVA 3O06A 3CT7A 1E51A 1JQVA 1L6SA 4XBKA 5D09A 3HQ1A 3SW6A 1LLZA 3P82A 3PB2A 3P60A 3DAQA 3H54A 2JKEA 5DCBA 4NXKA 1UASA 2C3ZA 4E38A 2I14A 5HULA 3N34A 1GPWA 2DZXA 4LRSA 4IWWA 1OFQA 2BZNA 3NQ6A 1O94A 2F84A 1ZY9A 2RDWA 4LS1A 3GLCA 2OT0A 5K9DA 3M1ZA 5F4XA 3W7NA 1F6KA 2Q3RA 3NYZA 1FWTA 1ZCOA 4Z0SA 3LXAA 3IV3A 2A4AA 3ZS4A 1OX4A 1RVGA 1GG0A 1LM1A 5FF0A 3KXQA 3HPZA 3QC3A 4JTGA 1H50A 1OK4A 3DZ1A 3S5YA 3NNTA 1JJKA 4DF0A 3LTYA 1I45A 3W87A 2WPBA 5C6MA 3OBKA 1H7PA 5I3HA 3GDTA 3FFSA 4HT3A 4NJKA 1EX5A 4GUFA 4P61A 1EPXA 5I3IA 1TPVA 2JKAA 5G2HA 3KRZA 2VEIA 4AVFA 1W5MA 1VCFA 3DFNA 3VE7A 3A5VA 1H1ZA 3L5LA 3W2KA 1N7KA 1TIMA 2ALDA 1DJNA 1S3HA 2YCEA 2E5DA 3VKJA 3C2OA 2VFGA 3HB9A 3TQKA 3N73A 3G0SA 3GAYA 4JTEA 4JTTA 4IUOA 1BKSA 1TYGA 2C14A 2CLOA 3SFKA 3NQFA 4FIQA 3IGSA 3EX1A 4Z1CA 3UPWA 3S5NA 4UTJA 2FJKA 4JIQA 4IX0A 3RLUA 3JS3A 2GVGA 2NWSA 1VCGA 3QH2A 2JK2A 4FNTA 1TPH1 1UBSA 1K8ZA 2ZRXA 1MSSA 1KTBA 3O6DA 2FB2A 1SO3A 5C54A 1W5OA 1EWEA 1LDCA 4TMBA 1S5TA 2JKPA 3Q94A 2NZLA 4AWTA 2JBMA 2W79A 1QDSA 4M5PA 1LBFA 3NL3A 5CSRA 4UMCA 3NQCA 4WOZA 4A2SA 3MBDA 3W1PA 5AFDA 3RLVA 2ZRWA 2YW4A 3W88A 1EA0A 3LGEA 4PC8A 5CPMA 1F5ZA 4O54A 4JTFA 1QOPA 4RZ6A 1IXPA 4O18A 3TA6A 5FF2A 1EEPA 5EBUA 3KOFA 1NSJA 1M7PA 1KFJA 3R8RA 3EWXA 2EHHA 4NUWA 2QCLA 5AB3A 3EWYA 3GB6A 1KTNA 3QQ0A 3RU6A 4UNLA 2PRLA 5D2YA 4ZL1A 4JTIA 2GJLA 2YDAA 4JTSA 2YYUA 1ME9A 1AG1O 4JX4A 4O0ZA 4R33A 3CIWA 4MKNA 2JGQA 3L5MA 3P5ZA 2QDGA 3TNOA 1K7FA 2WQPA 3PM6A 2V9DA 5G4WA 4BF9A 2LLEA 3G1SA 1PL9A 1LBLA 1TJRA 2QCNA 3EX6A 1D3HA 4NJHA 2A7NA 4GUJA 3MP4A 1KM6A 2BTMA 3WJSA 3IGUA 1SO4A 1KV5A 4UFIA 3LHWA 4NQ1A 5HWJA 3THAA 5AC8A 1YXYA 2C18A 1ICSA 3M41A 2VEMA 2WKJA 4UTWA 3C2RA 4IPIA 1F73A 2DZUA 1DVJA 3NM1A 1SW3A 2H3BA 1TQXA 2GQ8A 1I2RA 1J2WA 4N9CA 1C9DA 2J88A 4LUJA 3IRDA 2R8WA 1T99A 3HGRA 3C2EA 3WJYA 3CC1A 4RXGA 1SZFA 3B06A 3PSWA 1AK5A 3EB2A 2C15A 4DBEA 1XM3A 2VC6A 4MY8A 4PL1A 4DPQA 5DN1A 4DPPA 3MJYA 4BFAA 1SPQA 4UFHA 2V2DA 5AHEA 2ZRUA 5C2XA 5FI8A 3N19B 4K36A 5TQLA 4QISA 2G5WA 1GTEA 1VGAA 1W8SA 3BG9A 2G96A 3TFXA 3W1QA 3HG2A 3BV4A 5AHMA 1AL7A 4POCA 3W7IA 5F2GA 4MJZA 4HPJA 1KM5A 1L2UA 4AAJA 3SECA 1M5WA 1HO1A 5IBXA 1BWKA 2HS6A 2FLIA 4TO8A 3ZWTA 1I2NA 5F2LA 2WNZA 1QAPA 3PULA 1JCLA 3UWYA 4PH6A 3W70A 1J4EA 3UZ5A 3DI0A 1FQ0A 3A24A 4GRSA 3QPYA 5FESA 1SFLA 2QUTA 4GXMA 4RXFA 4N2YA 1JULA 3MYPA 4K7VA 1YTKA 1KBIA 1VRDA 4XTDA 1IGSA 4LOCA 4RR4A 3LHVA 1H7NA 1ICQA 4KKXA 1WDWA 1VC4A 3CEPA 4O8RA 3E0IA 3N14A 3UWUA 1X1OA 4QM1A 1VH7A 1TPC1 2CZEA 4LVDA 4RK8A 3M43A 4I7VA 4YL2A 4CQAA 1TQJA 3BVJA 3TW7A 3STGA 3FYPA 1KM3A 4W9TA 3QEZA 1VQTA 3MBFA 2G95A 3LCFA 4CCCA 2J9YA 5LNWA 2E5CA 2FQIA 4DEFA 3M47A 3A5FA 2W6RA 5GVJA 1YXCA 4O16A 1Q6RA 4MZ1A 1F7BA 1DOSA 3A21A 2A2IA 4ORMA 3UWWA 3U2OA 3LDVA 5HWMA 3GZ3A 4Z1DA 2Z6JA 5K7JA 4LS0A 4AEOA 3W7PA 4LV4A 3Q2DA 3L0NA 5AC6A 1EIXA 3G8RA 1KLZA 4QITA 4AHOA 1MXSA 1J5TA 1F2JA 1BWLA 3WJZA 3L9CA 4Z0JA 2GPTA 4A21A 1LZOA 3B4UA 3FJLA 3EXTA 5A5WA 3HG3A 2VFDA 1QPNA 1M6JA 2V5BA 4K38A 4ZQMA 2Y61A 3W9ZA 3FA5A 4TMCA 3MHFA 4JTLA 4BI5A 3UPBA 3B03A 4HKPA 2A7RA 4JEQA 3FLUA 1Q3NA 3EWZA 3SSJA 3WK0A 3JRKA 4Y8FA 4KFNA 5LNVA 1K7XA 2YW3A 3CHVA 2YFNA 3IIOA 3AJXA 1TSIA 4OU1A 3BLFA 3M9YA 4X2RA 1SO5A 4IGHA 3EEGA 1ALDA 2B7OA 1JCYA 3G24A 4EVZA 1S5VA 2FPYA 1TTPA 1FDYA 2VEKA 1F6PA 4GUIA 2Y70A 1YDNA 2ZRZA 3PC0A 4NT0A 1HO4A 3NQ8A 4GC4A 3G1YA 1AW2A 3W07A 3GDMA 3NM3A 3I7RA 1MO0A 1UJPA 2W0UA 2QDHA 2H3DA 4WZHA 1EB3A 2E09A 1UUMA 4Y96A 4UMAA 1QFEA 4JNMA 4ML9A 3NZRA 4UC5A 2DORA 2CZ5A 2V30A 5K2ZA 3QMSA 3GKAA 2ZYFA 4UTLA 5L6UA 4HNVA 4JX5A 1XKYA 3L21A 4AHPA 4YCPA 3PBUA 4FEZA 4O52A 1WV2A 5FF4A 5U7SA 2NV2A 2ZZ7A 3SY5A 2OCZA 3F03K 5LSMA 4LT9A 3TMQA 2Z0IA 1XCFA 4OV9A 3M6YA 5HNRA 4BI7A 3STFA 1TREA 3MHUA 4HHPA 1FY6A 3W1RA 3T7VA 2OZ0A 1W3TA 2GVJA 5FF7A 3PF3A 3T40A 2P0OA 3Q37A 5CZTA 4N9EA 3TQVA 1BTMA 1EUNA 4RZ5A 4LVFA 4IJBA 2CLLA 3R89A 4E0CA 1I8JA 1O5XA 1VHCA 4CCEA 3L66A 4WXZA 1OF6A 4GUGA 1GZGA 4QJ1A 1TV5A 3GYEA 3QM3A 4LS2A 3TK7A 4OWGA 2A0NA 2X1RA 4LY8A 3LLFA 1Y0EA 3LI0A 4CQ9A 4FX7A 4AWSA 3PS7A 1A5SA 2TMDA 3FIGA 4K8HA 4O0KA 3SJ3A 4UTMA 4XKYB 1MZHA 3ABSA 1ME7A 1L9WA 2B7QA 1O5KA 2Z1BA 3E49A 1FDJA 3W74A 4O17A 4O50A 3O1NA 3KRSA 4H4IA
chains in the Genus database with same CATH superfamily
3GNPA 3LCGA 3IUDA 3VVGA 3KOZA 1YEYA 3LHYA 2V5JA 3B97A 1A80A 2V5LA 1R2RA 4ZQRA 3TN6A 1OK6A 4XAYA 4YYCA 5DF0A 1YPXA 1B9ZA 2XGIA 4GOAA 2IQ0A 3USZA 4QEHA 2YFOA 3DYOA 2CZVA 2RFGA 1PPIA 2NSOA 3AHYA 4S2BA 4NAFA 4FX6M 1JFHA 3DHFA 3GFZA 4XZMX 4XZIA 1X39A 2A7PA 3CM4A 2OWCA 4BA0A 2ZC1A 3F4NA 4GIRA 5CC5A 2J79A 3O2LA 4HN4A 3FSTA 1XICA 4JTAA 1KQYA 1E0XA 3HQNA 4H9TA 1KFKA 4U5KA 3SADA 5I23A 2WCSA 1LT8A 5CJMA 5AKQA 1DQWA 1UPMB 1EZWA 1KW1A 3R58A 3L2IA 4M6PA 3PBVA 1HGYA 3TW6A 4ZR8A 1DHPA 3W22A 4D6IA 3EMZA 4OGZA 4I6VA 5IM51 4HMNA 3MWCA 3P84A 5T26A 3N2OA 1K7EA 3EX2A 1UJQA 4W4QA 1UH2A 3ERPA 4ZOEA 1THFD 1J6OA 2YSWA 1IWAA 3H22A 3AICA 1PS9A 3R10A 4QAIA 3M0VA 1VPQA 1Z3NA 1UG6A 1FCVA 3UR2A 4ZO8A 2Z7KA 4H1ZA 1Z8AA 3BV7A 1LRNA 1K4GA 1W6TA 2GVLA 4DXVA 1G67A 3TTEA 3BAYA 2RHGA 4QBXA 4J9JA 1EDQA 2YBTA 1H41A 3FVDA 5AC7A 4PMVA 1XJBA 5HMEA 1V3LA 4LXFA 1I2OA 4WVXA 4Y9AA 2OLHA 4IF2A 4GMEA 2O7QA 1HNYA 3R0DA 3CUFA 4ATLA 3GXNA 4WJ8A 2FVKA 2ZZ4A 4UOJA 5CJNA 5BXRA 2VDGA 1A5CA 3N9RA 1CX9A 4M0XA 2WK2A 4NILA 4QDPA 1LTDA 1VCVA 2Y8UA 3NZGA 4GXPA 3E02A 2EKGA 3LN3A 1MW3A 4OECA 4M1RA 3P5YA 1CIUA 1X96A 1RD6A 2CESA 2ZX8A 1X6UA 4JFVA 3M5XA 4U31A 5C70A 2J6XA 4QEEA 4FNUA 4ZO9A 4HZ7A 3Q58A 2D3NA 4O1EA 3W27A 3IJ8A 1E0WA 4K3ZA 4RDZA 2CW6A 3M0YA 1W2VA 1CGWA 4YU1A 1FX6A 3PANA 4XZHA 1CXIA 4LVAA 3VNJA 3OIHA 4DLFA 1F76A 4AMAA 2V38A 1HVQA 3M0ZA 1RCOB 1HKIA 4KERA 4AFYA 3OZYA 3M0KA 1D2KA 1VBHA 3E38A 1A0DA 1E3XA 2PWVA 5J04A 4DBWA 1PIGA 2J7FA 1P0KA 1UMLA 2RDUA 4ORIA 1UWSA 4GY0A 3QRHA 3HM7A 2VZUA 2AQOA 3S9IA 2DT3A 2WBGA 3UW6A 3HGJA 4XTIA 1F4AA 1QBBA 3THUA 2B7NA 4Q6JA 4C65A 2UBPC 4X9SA 2WMKA 3GH5A 3NXFA 4LTSA 4K8EA 1ZALA 1AD4A 4JTDA 3AXXA 4FXRA 4AX7A 3GTFA 1PO9A 5MF5A 2VYOA 3EWBX 2DVXA 4CVWA 3ARUA 3LLDA 3UR5A 2YLLA 5AVNA 4IMAA 3OTRA 2GWGA 4F79A 5FSEC 3BZGA 2UV8G 4PB4A 2E6DA 1WP6A 4WY0F 3ZIZA 2ALRA 3U5UA 3HBLA 4HP5A 5DY3A 3GIPA 3PJTA 4BKNA 3SCTA 2QCCA 4MY9A 5L9FA 4P5UA 1L6WA 3SRFA 3L4TA 2ZADA 3DFQA 3OG2A 2VFFA 2XU2A 1JDEA 2PODA 1SZEA 1R3VA 3URQA 1RCXB 3CV7A 2PLKA 3N6JA 2J7GA 1O68A 3BC9A 5BNKA 4C6LA 5AHLA 3BANA 3WQPA 4NHVA 1VYRA 2OVLA 2BVYA 2PTZA 1FUYA 3TXZA 5I3GA 5H6HA 2NQLA 4AY8A 3RMJA 1CZ1A 4YVVA 3K8KA 4QCEA 3AALA 3UGVA 4JFUA 3BLIA 3RILA 4IIFA 5G2WA 6TAAA 2HE8A 5FACA 1BXCA 3WMCA 3OU8A 4XK2A 3WLHA 4KEVA 1SSDA 4C1NB 3P81A 1WDQA 1JCNA 2WMGA 2PGEA 5AHIA 3DHDA 3MUAA 4PYSA 1H09A 1N8FA 1NOFA 1H5VA 1US2A 4UFJA 4HYVA 3VDBA 1SFSA 4O4WA 5E0KA 4PMDA 1FCBA 3ABZA 3IJ6A 3UZJA 1JNDA 2X16A 4GACA 3PNZA 3STEA 1CT5A 4ZTYA 3UYIA 1SJAA 2PD9A 3OOQA 4Q3MA 4DWSA 3MU7A 4CNOA 1Q66A 3NJ3A 5EU9A 1XH0A 4M29A 3VOJA 1OYCA 1Q63A 4G1KA 3CS2A 3O05A 4XUYA 3LSBA 1B9BA 3QF0A 3BAKA 2VZVA 3ONCA 1KFWA 4WUIA 4FXSA 1UHVA 3PK7A 4UFMA 1OFRA 4AD4A 2PI6A 2VRQA 1SMDA 5GJMA 3AQUA 1G1YA 1Q6EA 5DY2A 2OOFA 3VIPA 2OJPA 1DWFM 2BY2A 1JUBA 3F5KA 2Q8LA 5I24A 1X6NA 1YADA 5FKYA 2C6QA 3DGBA 1UWUA 2ZCGA 2GWNA 3SCVA 3V1PA 1EP3A 3S1XA 1WZLA 3DH7A 1A3XA 4LUSB 2VVNA 3D5HA 1VFUA 1IR1A 1UOKA 1VEPA 3FY1A 2E7FA 3UGRA 5G1YA 4HNNA 4UXDA 3IJQA 4QCFA 3VUSA 5T9CE 4B9ZA 4D2JA 1MDLA 3NQVA 2J27A 4NP7A 2GFTA 2CLEA 1E70M 1R38A 3AZRA 2O4MA 4O1BA 5CC6A 1SQ7A 4AF0A 4JPGA 4RKAA 2QDDA 1OQFA 2DZTA 2WSYA 4ROPA 1W31A 1T8QA 1TPEA 4CCZA 5CZ0A 3MV01 6PTDA 3QGKC 5C2GA 3W7LA 1WOAA 4WHBA 5HA7A 4HYRA 1LQAA 2A1YA 5CG7A 2DZWA 3REQA 2OX1A 1VYSX 1KFCA 3W28A 1NWTA 1OC5A 3WDQA 1XP3A 4LQ1A 2EPNA 4YLWA 4AD2A 2F6XA 2YL5A 4M7TA 4LCRA 2RGMA 4IISA 3AHZA 4AC7C 3DEQA 1VFLA 1XLBA 2YBVA 4FALA 1XFBA 4JFWA 3FYYA 1GOMA 4EIVA 4O11A 4NJIA 2W67A 4P8XA 4R7OA 3N4AA 3ARYA 3HG5A 4HSOA 4MG4A 1ADOA 2Z28A 3UWQA 1MEWA 3NSMA 2VEPA 4WOQA 2VELA 2XVGA 3OVGA 1M7XA 2DIKA 3QJAA 2AGKA 3AIUA 3POCA 1LWJA 3ITGA 4NYUA 2WZHA 4JIRA 5JU6A 1FXQA 1VHNA 1R5YA 2OGYA 2NX3A 1TA3B 2YR1A 2VC7A 2FDSA 2R94A 3LEPA 3KVJA 4WGHA 3W83A 1FH8A 4IMFA 3TR9A 1XH1A 3PHAA 4HSNA 1P1MA 2NXGA 4P7QA 4UOQA 5IFTA 1KD0A 2GUYA 2TRSA 4UR8A 5LIUX 1DE6A 1A5BA 1MEHA 1VFTA 4KGLA 1PV8A 2P10A 1LL7A 4PUKA 2ZX6A 4CU7A 3AI0A 4A3UA 2NX9A 2INFA 1K03A 1ZAHA 1MW0A 3GXDA 1C8VA 1DL3A 1ZJIA 5IBXC 3K1GA 1R7OA 2POZA 2OQYA 4D8LA 2PDPA 5CEWA 1PZ1A 2HEJA 1XX1A 3ARZA 3S6DA 3E96A 1DBTA 5H8PA 1OFDA 1UR1A 3WY1A 2TAAA 3C0QA 3RO8A 1P0EA 1EH9A 3BSMA 3MSDA 5C9WA 4F66A 1XGZA 4Q4KA 4GFSA 3CH0A 5HANA 1KWKA 2F2HA 4A8RA 2V3GA 2IPFA 1G7VA 3GU2A 4G2DA 3SFWA 3RM9A 1TV3A 4GKLA 3SGUA 1W5QA 3EDFA 4M6QA 3CH9A 6ENLA 3T4CA 1YRRA 5D33A 5GJPA 3C6CA 2CU0A 3KTSA 4GK8A 2JGYA 3M0XA 4KCTA 3CMJA 4DO5A 2QCGA 5CLWA 2ZTJA 3MQTA 2VM8A 4JR5A 4UQDA 2WKGA 1DIEA 4JX6A 2GSJA 5C5YA 2E40A 4H8HA 3VFLA 4MYAA 3NWRA 1XGEA 5A8NA 1TTIA 3ZQ9A 3ORWA 2O9TA 2J7DA 3OJGA 1UIPA 1EX1A 5A2AA 4AX6A 1QHPA 1WXZA 3WEZA 3TA9A 3UZWA 1DXEA 3GR7A 3CO8A 3VIGA 5CC7A 1XRFA 1R3QA 1A5NC 3AYRA 3Q45A 5LYRA 3RPTA 2NQZA 4HOWA 1A4LA 4JN6A 3ZR5A 2XH0A 2PDYA 1DIDA 4X63A 2WWCA 5A6KA 1C90A 1QPKA 1U22A 1OINA 1U83A 4S39A 3S2CA 3URNA 5LGXA 4NRSA 1WPCA 1ISXA 2ZZ2A 2RH9A 2ABBA 3G0XA 1BEUA 1W3LA 2IS7A 2PDWA 3O7UA 3GSMA 4M80A 1ITUA 4F0MA 5EA9A 2G4FA 2IQTA 3W1MA 3VGHA 4ACYA 1V5XA 3FA3A 1OFBA 3F4VA 1S5NA 1IV8A 2BHUA 3CL8A 2AQWA 4NZ5A 5LNUA 3H2NA 1UP3A 4K68A 5D8ZA 1BYBA 4IQDA 4UTKA 5AY7A 3SGGA 1K6AA 1PAMA 1TR1A 1FDZA 4CN6A 1RALA 1JPHA 4TOQA 1S38A 1R2SA 1TTJA 1KM0A 2Z1VA 3DG3A 3DFSA 3V36A 1J01A 2PZNA 4Z1BA 3MT1A 2C7FA 4JTJA 3BL3A 3QQWA 3MYOA 1JCMP 1LBMA 3QPZA 8A3HA 2ZZ3A 4IMDA 1HTIA 1HX0A 1LQ2A 1V79A 3NPWA 1A0CA 1P4CA 4CLMA 5JVLA 4G7EA 5CSUA 3FXGA 2Y0FA 1BG4A 3NDOA 3N9SA 5AECA 1LF1A 4GYPA 3PJWA 3LERA 1TV2A 2E6AA 1VS1A 1OFEA 1XSJA 2ABAA 4OJYA 3QKZA 5A8GA 3HPXA 4A05A 1RY8A 2DUAA 4OFCA 4DWDA 3HJEA 1R9XA 1W9PA 3GXTA 1KXVA 4I5UA 1H0GA 1YPFA 1A53A 2AGTA 4F3HA 3AISA 4O12A 4UTUA 1AA1B 1X6LA 3CWNA 3PP7A 4GA8A 1XRTA 1G4PA 4AEFA 5A6LA 2IMRA 5HQEA 3W6MA 1BRLA 1LT7A 3DFPA 1UUOA 4Q7IA 5LZLA 1QASA 3WSUA 1V3MA 2OEKA 2PRMA 1G0CA 1ZBVA 3UA3A 1OC6A 3ABQA 3ITOA 3JVAA 1J93A 4B91A 2DV0A 3T09A 3BQ6A 5C8BB 3ARQA 4MPQA 1YNPA 1XBXA 4Y9PA 4DLMA 2Q01A 1LP6A 1SJCA 3KL0A 4PZVA 6REQA 3FGCB 1H7OA 3W73A 1H51A 1S2AA 3AXHA 4XO6A 3G3DA 1PSCA 3PUOA 1LG1A 3QYSA 1W1ZA 5M03A 3LM7A 1I2PA 1I1WA 3BMVA 3M46A 4RE2A 1KLYA 3U7BA 1RPKA 1YIXA 4S3DA 2I1OA 4XWUA 4FP1A 2F7FA 4EE9A 1TPWA 1Q8AA 3N15A 1XXXA 3PZ9A 2H8ZA 4JICA 3V0TA 3CUJA 4DQWA 1W9XA 4LALA 4UZUA 3RF9A 4ICCX 1W1YA 1GOOA 4LEFA 2O56A 3MMDA 2FFCA 1U5JA 1K9FA 2J7HA 3LPGA 1OG6A 4W88A 3KUMA 1TR9A 3QPEA 3PUEA 5KZDA 1B2YA 4FNRA 2B0MA 2ZX5A 3RLHA 1MEIA 1XIJA 1Q13A 1E3ZA 4LAUA 1UD4A 1YX1A 3W1UA 4FLQA 4JQAA 3MSRA 4AB4A 1KKOA 5AN7A 4EF9A 1ICPA 4B5WA 4AY1A 2FPTA 2V8ZA 5KINA 1KRAC 4OVXA 1XLEA 4L4OA 3OQEA 3P14A 3LXBA 4O4VA 3PZUA 3VOFA 5IDIA 1WAUA 4F2UA 2D2HA 1NP0A 4MLRA 9XIMA 3EX3A 1DWJM 5D03A 4N02A 3LNPA 4CNTA 1XRSA 1EZ2A 3E5BA 5CQ1A 4GY1A 1RAKA 3PPGA 4PGLA 3UCCA 4BZYA 4UWMA 3E12A 2EPLX 2YPIA 1X38A 3V1HA 3TMLA 1HT6A 5HINA 3NQ2A 1QVBA 2VR4A 3UESA 2CLHA 1VF8A 1GVFA 1XSIA 1B4KA 1FHVA 3PBYA 4UB9A 1CCWB 1A5OC 3GVRA 2DSVA 1PUDA 2IPJA 4FA3A 1BSLA 5T9BG 2JALA 5BXSA 3L4UA 5BWAA 4B3ZA 3LZ3A 2WZTA 3F4CA 4K1GA 4XAFA 1OCNA 4E8DA 3LK6A 3GDLA 2J9ZA 2PLCA 2WCGA 1S5MA 4REQA 3R6IA 4V1YA 5LNRA 2FZBA 2ZXQA 2HXUA 5AYZA 2YCLA 3PTQA 1DJQA 4GYFA 3U8GA 1XLFA 5FF3A 5I79A 3TDFA 3RX4A 1K8XA 2CBUA 1BXNA 3AS2A 3B8DA 3O15A 1RBLA 3CPGA 1DORA 1UKQA 3ZMRA 2PCQA 4UQEA 3VIIA 3VE9A 3VX0A 3IS4A 3SCWA 3BURA 2UY4A 3P8JA 1SSGA 4A8LA 4NIRA 3DC8A 2F38A 1W56A 2A6LA 4MPKA 1H62A 4TUFA 3FK4A 1ZBWA 3PG9A 4GH1A 3WLMA 4FNQA 3SQSA 4PCFA 4FO4A 2WBKA 1HZYA 2Q3OA 3UXLA 3BO9A 2V81A 5D9NA 4NX0A 1MYRA 2Y62A 1EHNA 4TR9A 1Z48A 3GDRA 5LNSA 4JS3A 4QE4A 1NQKA 3W00A 1ODUA 5I07A 1AL8A 1VJZA 2VOMA 3SQLA 3K8MA 1GYMA 5E9XA 4JYDA 4PCTA 4HPNA 4QDMA 1M53A 1GCYA 1B90A 4I9AA 5D32A 3KTCA 5DRCA 1LYXA 1OGSA 2QJGA 2XN0A 3WDIA 4FNPA 3QSTA 4FOKA 7REQA 1TJ1A 2FGLA 3O6YX 1NFBA 2EKCA 3RITA 3D0CA 1R85A 1GQNA 1NH6A 1GVIA 2WM1A 4WKHA 3CLMA 3UBPC 2KAUC 2Y7FA 4GI6A 3VNZA 2J8FA 5FJJA 3I4EA 1U33A 1UROA 4XBKA 4S3BA 2V5KA 5D09A 1LLZA 4CD7A 1F6YA 3DAQA 4PMNA 3H54A 2JKEA 3W6LA 4NXKA 1DIKA 2I14A 5HULA 3N34A 3U0HA 1S2UA 2P76A 3CAWA 1O94A 1CGVA 1FWGC 2F84A 3VK5A 1PDYA 2RDWA 4QS6A 2Z4GA 1F6KA 4UQAA 3WQFA 1ZCOA 3IV3A 1OX4A 1DTNA 2VMFA 3VPLA 4LAZA 3DZ1A 4ZXOA 2OQHA 3NNTA 2PDLA 4DF0A 3WH6A 5C6MA 3WN6A 2D0HA 4HGXA 3IK4A 4J7RA 2DT0A 3VKKA 3IJDA 3PTMA 1IZCA 4IG2B 4Q4QA 2X05A 1JDAA 1W1VA 3WL1A 3CUZA 4KRTA 1EJUC 2XIIA 2VFGA 1D8WA 3ZJ8A 3TQKA 4JTEA 4IUOA 1BKSA 2OLAA 2PWEA 1TWSA 3SFKA 1AZ2A 1OT2A 3IGSA 4AISA 4ROQA 2A3BA 4JIQA 2OQLA 3GU9A 4AYSA 1MSSA 3AMKA 2O9RA 2D2JA 1SO3A 1XLJA 4F8XA 5ABFA 1EWEA 1JF6A 1S5TA 3Q94A 2JBMA 1Z9AA 3GG7A 3CHEA 4M5PA 2G41A 5CSRA 3NQCA 3MBDA 3RLVA 2YW4A 3DX5A 5CPSA 4O54A 3T08A 3AIBA 1FKWA 4JTQA 1IXPA 2BASA 4C6NA 1J0KA 4O18A 3H70A 3TA6A 4W7UA 1EEPA 2WVUA 3TN5A 1NSJA 4C6PA 1KFJA 3R8RA 3EWXA 2E67A 3WLIA 2WC7A 2PRLA 5D2YA 3PPCA 1XIFA 1N8IA 3W0KA 4JZ5A 1PBGA 2FTWA 1HKKA 4NASA 4O0ZA 5A6JA 4P8WA 3OLEA 4L5ZA 4PUJA 2FZ8A 1K7FA 1KO0A 2QW5A 3W02A 4EPKA 3MCMA 4FOUA 5G4WA 3G1SA 1UZDA 1PL9A 1LBLA 3HPFA 3MDUA 4BEQA 2FZNA 3MKCA 1KM6A 5TD4A 2OO0A 3ZLGA 4L9YA 2NQHA 3THAA 1ZJHA 4GX8A 4TQTA 4IPLA 5A1AA 4R5EA 3N17A 1F73A 1CXFA 2DZUA 3CO4A 4HA3A 2V68A 1EGMA 1SW3A 2J74A 2Y1HA 1C9DA 2J88A 4LUJA 4HU0A 3E0WA 2PDFA 4JHZA 2R8WA 1T99A 1XCXA 3PPHA 3FSUA 2PDCA 3BWWA 3I10A 1SZFA 3RR4A 1EC9A 3B06A 3PSWA 5DT5A 3EWDA 1AK5A 3KBSA 4DBEA 1XM3A 3MB9A 4PL1A 5DN1A 1MNZA 1HN1A 1XD0A 3GW3A 1RSCA 2FGZA 3UZZA 1QOXA 5XIAA 4H6QA 1GQIA 4RDVA 4QISA 3L4WA 1SM9A 1HIZA 2XINA 3F2DA 4GLEA 3QXBA 1M03A 4WGXA 1FWDC 3ZLHA 4I9TA 3T42A 2QVNA 3E2SA 3WLLA 3D3AA 3KZSA 2VNCA 4HPJA 1L2UA 1M5WA 3A3XA 4GI8A 5IBXA 1LLOA 3L4VA 1QAPA 2XSXA 1DQUA 2G37A 5BOFA 3PWIA 1P0BA 3UZ5A 3DI0A 1JD7A 1J10A 1JXJA 3EOEA 4RXFA 3QR3A 3SN0A 1JULA 4PUWA 1KBIA 4DJFD 4R3UA 2V6AA 1C9WA 4IM4A 3DECA 1G94A 2ISFA 3RCYA 4MDOA 1WDWA 2X0SA 3UCDA 7CGTA 4JKKA 3ZR6A 3A4XA 3U4AA 2E1WA 1UWAA 4DVOA 1Z32X 1X1OA 4Z1YA 3UZYA 2WQDA 1TPC1 1JZ6A 4YL2A 3GQYA 4CQAA 1SZRA 3TW7A 3FYPA 4GZEA 2HPMA 4W9TA 3GTIA 4H7ZA 4XIMA 2QJMA 4XBJA 1J5SA 3LCFA 4CCCA 1JZ4A 1EOMA 4DEFA 3M47A 5GVJA 2R1MA 1YXCA 4O16A 4MZ1A 1JZ7A 4C6BA 2FVLA 3UWWA 4HZ6A 2XDFA 4YWSA 3U2OA 1XYLA 3CUGA 5HWMA 4Z1DA 4AYGA 5F7UA 2D23A 4LV4A 1EBGA 1J0HA 3AU2A 1MXSA 4FF5A 3L9CA 4Z0JA 3M7SA 2GPTA 1LZOA 2VFDA 4YVPA 1M6JA 4K38A 2BOFX 1XINA 4JTLA 4BI5A 3UPBA 1BHGA 4X2PA 5BZAA 1QHOA 5I00A 4DZ5A 2XTKA 3JRKA 4Y8FA 5JIWA 3VGGA 4CUCA 3KDOA 3CWHA 4MB5A 3AJXA 3TN4A 5GNZA 2X1IA 1ADDA 1AJZA 5HJXA 5M5DA 1CDGA 3H4XA 5BCAA 3R0KA 1FDYA 3W37A 3LA4A 5I7GA 4GC4A 4E4FA 4DXXA 1JPDX 2XM2A 4XAZA 3TYBA 1UJPA 2W0UA 2QDHA 3WNNA 2DIJA 4TV5A 1UUMA 1DTUA 4UMAA 2I57A 3NDZA 2J62A 1QFEA 4KEMA 3B0XA 3T9PA 1S2CA 1AUSL 4UC5A 3WDPP 2O9PA 3SUTA 4J3TA 4C7DA 2VP8A 2OGJA 3GKAA 3HQPA 3H26A 2XVPA 3L21A 1RCQA 4AHPA 4DJED 3CUIA 4FEZA 3B8TA 5U7SA 1E6RA 2ZXDA 4RNHA 3SY5A 3O6AA 4LT9A 3WX7A 2YXXA 4XKMA 3MJMA 1Y65A 1Q2RA 3PZOA 4HHPA 2OZ0A 1DJIA 2PDMA 3Q37A 1J11A 1EUNA 5LIYX 4E0CA 3G1RA 1I8JA 2FVMA 4B5UA 3EOLA 3MY9A 2PLMA 3GHRA 4GUGA 3EWCA 2JEPA 2QHAA 1D3CA 4CQ9A 2QMJA 4AWSA 3PS7A 1A5SA 2DSWA 1R9YA 4O0KA 3WYZA 3KEHA 3SJ3A 5CGMA 2J7CA 4F4RA 4WKFA 1ME7A 2BG5A 1RY0A 4CN1A 3E49A 1FDJA 4AIOA 4O17A 3HFTA 3KRSA 3LM3A 1D8CA 5CCZA 1B5TA 3OA5A 4ZBCA 3HN3A 4NU7A 1DIOA 2OODA 3O6CA 3IUHA 3N18A 3WDJA 4KCVA 1OD0A 3C0LA 1GOWA 1GW9A 3OPSA 1TPUA 4CEXC 2FIQA 3TROA 3KHDA 3RRAA 5CZSA 5LGZA 1OEPA 3MCNA 4C7GA 3QQ1A 4IXHA 1VZWA 4UFLA 1T6MA 2PU0A 3P62A 1JCXA 2RJGA 4B4HA 2HISA 3TQ0A 4RNIA 3S1UA 2Z00A 1GKPA 1IXQA 3STCA 5I3DA 1LOLA 2ISSA 1HG3A 4NKCA 3EZ4A 3GD6A 3HG4A 3TR2A 1U1HA 2YCIX 3QR0A 3RYSA 2GSEA 5A95A 3ZT5A 3MV11 1GVEA 1XLKA 4QXIA 4FLSA 1FWBC 3WQWA 1GNXA 2NX1A 3VNIA 2YKKA 3P0XA 4ZOCA 4XZLX 5A2CA 4ZQCA 3SEPA 3W4RA 4JXCA 2QEZA 5H91A 3BGJA 5EKYA 1UR8A 1WA3A 3GH7A 3ABRA 4U4MA 3AMCA 2JF6A 2ZBTA 2H9AA 4J28A 3ZO9A 3G0UA 4NAEA 3KRUA 4OOZA 3SRHA 2VX7A 3U57A 4H6KA 1IHIA 4LSBA 2VX6A 3UXIA 3MPGA 1RBAA 1W17A 3AIRA 2DZVA 4OHQA 4S3GA 3IIVA 3MWAA 3E74A 3GX9A 2VFIA 1I1XA 5F4SA 3AWNA 3N04A 3ARVA 3NGJA 1LUCB 1DV7A 2WJDA 1VRXA 3G6LA 2CC0A 3UG5A 4LGXA 4PRTA 4AWUA 3VOHA 3QR1A 1E0VA 3CZJA 4L1WA 5BOOA 4L6OA 4UFKA 5DFAA 3U9IA 3W81A 3NL5A 2PURA 3W7EA 4Q8NA 1PTGA 3KTXA 3GVGA 1F9CA 1N82A 3CHCA 4JTHA 3BW2A 1KFEA 3EDDA 1WBJA 2R24A 3W7MA 2HXTA 4BWLC 4ZB5A 1LG2A 3B9DA 3AWOA 4JHMA 2ZKMX 5E9AA 1QI4A 5DXXA 5K4XA 4B9YA 4PEKA 1CEOA 1C93A 4KESA 1OYBA 4M8UA 3AS1A 3GVQA 4UCGA 1LRTA 1W1IE 5PTDA 1XQKA 1MZRA 3GWQA 2MNRA 5G5IA 4IFKB 3UXDA 2A85A 4LAMA 3O9NA 4KFOA 3SCQA 2WXDM 2ATSA 3H55A 1EO5A 4B5VA 4MB4A 3LZ5A 3L68A 5EFDA 3I65A 4W5UA 4MVAA 2XYLA 3AHVA 5HJLA 1CGUA 5D4YA 3ECQA 1B3XA 2ZWYA 1XUUA 4GJ1A 1FTXA 2YDRA 2QJIA 3APYA 2WV8A 1AQMA 3G1HA 1EJRC 3QMTA 4TTUA 1TWWA 1RBOB 2QUNA 1B30A 4UQCA 4PMOA 3INPA 3OLDA 1PJ9A 3EOSA 4H04A 1R7AA 4WY0B 1GTHA 1VJIA 3NXLA 5DCEA 3H2MA 1QCWA 3BUVA 1GVOA 4Z1AA 3EA2A 4MM1A 3KCOA 1FA2A 1HKWA 1M65A 2CNCA 1XUZA 1HP4A 3LNMA 5J5RA 4IIGA 3R8GA 1J0JA 2CXEA 3HGSA 2G4JA 1HJUA 3LTSA 4WJXA 1F3EA 5IHRA 3M5ZA 1S2TA 3ZVHA 2YYTA 6A3HA 2DQWA 2X7VA 4MMWA 4WDTA 2PGWA 2WKLA 3CZ8A 3RN6A 4XKYA 4GKTA 2CYGA 2WWDA 1ZAIA 4X22A 2DH3A 1B3VA 4U28A 4B5NA 1TPDA 4NZCA 1QATA 2C19A 1M01A 2XZ9A 4FS9A 4ENLA 4NG3A 1W3IA 3KS5A 2ZC8A 3EX4A 1OGGA 3GUGA 4H9MA 1NAL1 3SN4A 4US6A 2VQTA 3LPFA 3CZGA 3OA3A 1CLVA 4HMEA 3VCCA 2CBVA 1XG4A 1YPIA 4IL0A 4R7JA 3I6RA 4EANA 2CXGA 4WKAA 3LCWA 3TVAA 2HPIA 1UP0A 1E6ZA 1O7AA 3TJXA 4XD4A 1A5AA 3QTPA 4BK9A 2G0WA 4D8ZA 5LKYA 1W5PA 1S5WA 4KCUA 1H4PA 3SBFA 4JFTA 2ISDA 4YTSA 2BXVA 3TAOA 2NQ5A 2QCFA 2PSNA 3IIZA 1JYWA 1DQXA 2PDGA 3VI2A 1LOSA 2WSRA 4N9BA 5BOEA 5TIMA 2W9MA 5I3FA 5C9RA 3AJ7A 1XYCA 4YTUA 2G3IA 1QO2A 5I06A 1V03A 3VABA 2Y7DA 4AXKA 2YB1A 4LUTA 4ADTA 1JQXA 1A4MA 1V0MA 3W86A 1FKXA 3C3NA 3DGRA 3VTRA 1RD5A 2VL4A 3FJ6A 2CHNA 3CYVA 2QF7A 3R79A 5G4EA 4D6GA 4AY7A 3OG3A 3HFYA 1I0BA 2XN1A 4GVIA 4QG9A 2GK1A 3LOTA 1OJXA 5FAJA 1Q4NX 2XN2A 4ASTA 3C4UA 3ATZA 5J8LA 4RV8A 1XBYA 3LG3A 5LIWX 1HKMA 2R91A 4JN8A 1IQ8A 4O57A 2Y5JA 3AZTA 3MVTA 5AYBA 2F8QA 2C8NA 5KZMA 3TYZA 4H9YA 1JL8A 4RPQA 3MMTA 1YXDA 1NWRA 2F6UA 3TH6A 3LYEA 4RL3A 5MKGB 3BPWA 4LYRA 2Y4SA 4RLIA 4MWAB 4TX9A 1K9TA 5B80A 2WHKA 3BLPX 2NVDA 3IIXA 1GJWA 4K6AA 2J9XA 1ZTVA 1DWGM 3L0GA 4P8VA 3FHAA 4J2PA 4N0RA 4ACZB 2FKPA 4BS0A 3RFAA 5DBTA 1R87A 3NO1A 1KC7A 1V77A 3BGGA 4XD3A 3T0TA 1U1JA 1OBAA 5FJTA 1XYZA 1JDFA 3UZXA 1MVYA 1DKWA 3W7KA 4GO8A 3AHTA 3PPFA 1ITCA 2XWDA 5A6AA 1REQB 3ALFA 3L67A 3N6HA 3PBWA 1UCWA 3FDKA 1A5UA 2XHYA 3N2MA 5G4HC 3PG8A 1D7KA 4QAWA 3OW1A 1V02A 2D69A 3BSHA 1EHAA 1NFPA 4LRTA 3VNYA 1VLWA 1BVWA 4E8GA 2Z2AA 3BW4A 4ZQOA 5E5CA 4GQQA 2CLKA 2WSPA 3W7QA 4XBSA 4GJIA 3NR0A 2ISVA 1V3IA 4AIBA 4GVFA 4UMBA 3TXVA 4Q4SA 1B1YA 3AS3A 3T78A 4Z2GA 1Q45A 2Y24A 3ELFA 4RJEA 2NVAA 5DBUA 3TC7A 1FWJC 5D2TA 2X30A 4DJDD 1IGWA 3UD6A 3WUBA 5KMYA 1W9VA 1GHSA 1OD8A 1TVPA 4PMJA 3AYSA 1GEHA 4OZOA 1ONXA 3S1VA 3H2FA 2E68A 1YYAA 3DDMA 2H8XA 2EGZA 5TBOA 2P88A 1BYDA 3U5YA 2OG9A 4X9YA 2EPMX 3WF0A 1XV8A 4S3JA 3A9IA 3Q65A 1RLCL 3H4WA 1AFSA 1VD6A 4N4PA 4C5ZA 3F1QA 1OGBA 1TRIA 2PDUA 2GJXB 2OLSA 1E4NA 1E43A 2VUYA 4ALDA 2QCDB 3AMLA 4IPJA 1G5AA 3SRKA 4AEEA 5EYWA 1YMYA 2DW6A 5IHSA 4IH3A 1W3HA 2WMIA 1HQTA 2CLMA 4S3CA 3MW7A 1DJHA 1XI3A 2Y8KA 2ADAA 5HDRA 2VFHA 1BPLB 5D05A 4CQCA 3KCLA 2GDUA 3IIPA 3S5OA 2CIPA 3H2OA 4AUBA 2Y89A 3APGA 4AZ6A 4UNIA 4R34A 5GPRA 2PB1A 1NU5A 3K1DA 1TV7A 3MO7A 3BLDA 4RCXA 1O4UA 4W84A 4X3ZA 2FHCA 2OSXA 4PR4A 2VZOA 3QLDA 3KWSA 1BVZA 3TNBA 4DO6A 5AZ1A 1JG9A 4FF7A 3F5LA 4A6GA 3W71A 3QFEA 4BQ4A 4QNEA 4QE5A 4O8AA 1KCLA 4YYFA 2R1NA 1JYNA 1BWVA 2Z2UA 4YS1A 3W7OA 5K9XA 4QP0A 5DCDA 2GLKA 4ZE5A 2GVYA 4ERIA 2DU2A 3CV2A 3WG6A 2PA6A 3KFTA 4MGGA 3F5JA 1PYMA 4JGDA 3W1XA 2F6KA 5EBAA 1OZQA 3I7SA 1KTCA 1KV8A 2DP3A 5D30A 4DIAA 3V5OA 3WO8A 3UEQA 1L8PA 3NO5A 2HVNA 3OB8A 1ZHAA 3W84A 3C3UA 1B3WA 3BH4A 1FWAC 1EUAA 2EXOA 8XIMA 2Q6ZA 4TIMA 1QK0A 4MLJA 1RZMA 4UTIA 3QV6A 1UKPA 1B54A 4LC8A 2JEQA 3S1WA 1FWCC 4UIOA 2EJAA 3ZWSA 1F4HA 4EPDC 1K8YA 5CGQA 4IMEA 1FFRA 2ZUNA 4MF4A 4W89A 1FFQA 1XFCA 5FEWA 1JNEA 4Z42C 4XV0A 3IVUA 1J0IA 2WHMA 5I6SA 2ACSA 4KEZA 3UR7A 1DJYA 1EJXC 5A94A 7ODCA 5HNUA 2I56A 3UJFA 1R3RA 3WCZA 2NLIA 5I78A 3GS6A 2PDBA 5H2ZA 4MJ2A 3I7QA 3R2GA 3G5EA 3GR8A 4GYJA 4JY8A 4MNKA 1GOXA 2BY3A 1G6CA 1E15A 3VKDA 3W2LA 3QGVA 5AZ0A 5JIPA 3UERA 3CUHA 3UQNA 1D7FA 3G6MA 4QE1A 1VAHA 1RV8A 2BGSA 4O14A 2OX4A 3EXRA 1XC6A 3WKZA 3KM8A 1HFBA 5E0CA 2X1SA 5IRPA 1KQZA 3BMWA 4FNSA 4JTUA 4CQDA 5T8GA 3EA3A 4G7FA 1SR9A 3KW3A 2UWFA 3FX4A 3TSBA 1W3NA 2CITA 4DZAA 3POHA 4AWEA 3WBAA 2QAFA 4C6IA 4D8AA 4ERGA 4EXAA 3F2BA 3V3WA 3ABXA 4FIRA 4IT1A 1B3YA 2EPHA 1VP5A 4HPXA 4XB3A 1AJ2A 4Q8MA 4D6CA 3M5YA 4FR6A 3LRMA 4E3VA 1YHTA 3B8WA 3MI2A 1PX8A 1YW1A 1X8FA 5CBIA 1POJA 2YGYA 1YBQA 3LBCA 1W37A 3W53A 4S1FA 4EPEC 5H1WA 3D46A 5A6BD 2GGHA 5I5RA 1I9CB 3W2JA 2EAWA 4NZ1A 3N2BA 3CWOX 3EDEA 4AZCB 4NNCA 1PCKA 3ZOAA 3L2LA 4H9VA 1CENA 2WPGA 5LHEA 1XIBA 5CGTA 1CXKA 4LAOA 3ZYZA 3UNDA 4NL1A 2D73A 1C29A 2ZQ0A 4ZA0A 2ZUVA 3ZR4A 4G9PA 5FJIA 3W29A 1PKLA 2EG7A 2VO5A 2YXGA 1DXIA 1XYMA 4MIMA 2OOGA 3R13A 1QRQA 3V35A 1QMLA 8TIMA 3MZNA 3QSRA 3T55A 5E70A 4F0SA 1OYAA 2Q71A 2Y7EA 4BQ2A 4JD4A 4PODA 1BKHA 3RXZA 1AW1A 2HDJA 3MHGA 5HNTA 3EPNA 3GHTA 1E4IA 4ZGYA 4LBSA 4V15A 4C6QA 4KRZA 2I16A 3CIXA 4TTGA 1YQ2A 4EX4A 1A5KC 4MFEA 4TXEA 1DWHM 2FMNA 1B0IA 3G22A 3LS9A 4EP8C 4BEUA 9CGTA 1RA5A 3TCEA 5BRPA 1W1PA 3WQ5A 1TE6A 3I4KA 2YBUA 2O4QA 2A3EA 1H63A 4JIIX 1G01A 3MUZ1 3VGBA 3L5AA 2P3EA 2D0FA 1AODA 3OEXA 1R46A 2WJEA 2HMCA 1PKNA 1W54A 3U3HA 4JIHA 4CKQA 2A3HA 1OF8A 3L4YA 4PBGA 2R1LA 2AAMA 2PWHA 5C55A 4IGNA 1S2VA 2F9RA 3K46A 1RHCA 3ARRA 2A5HA 1WCGA 3PJUA 2AOSA 5CXPA 2E25A 4L9XA 2B81A 3KOWA 4H9XA 2QPUA 1PB0A 1EP2A 2HSAA 5HMDA 1S1PA 1P7TA 3VO0A 3GKFA 1TO3A 3SUWA 5JUVA 5XIMA 3LV6A 3MDWA 1WBHA 4ZFCA 6XIMA 3GUWA 5BU9A 4HK7A 2BGQA 3O07A 3W7GA 3DHPA 2ICSA 1V6TA 3DI1A 2DJXA 1VBUA 5E6ZA 3L4ZA 3ARPA 4MZYA 4WCJA 1O1HA 2QUUA 3CUXA 4TV6A 3F2CA 1ELSA 4LUYA 4UTHA 1HW6A 5REQA 1GONA 3KBJA 4KIEA 5ENLA 5AC4A 5M2FX 5JMUA 3VOGA 4UTTA 3IEBA 3NG3A 3CPUA 4GCXA 1ISVA 4NX5A 3E2QA 4M82A 3NQMA 1JXKA 1GW1A 4JFSA 1MQRA 1XIDA 1WOBA 3OBEA 4Q8UA 1KR1A 1SW0A 5CPOA 5FOOA 3V18A 4BR1A 1XW8A 1J8VA 1PHWA 2NUXA 4B15A 3IVSA 2XM1A 1BXBA 3DBNA 3WNPA 4PTDA 2KX9A 1V7AA 3PSVA 5HATA 3VKBA 1N8WA 3WDHA 1XLMA 1XLCA 1BVNP 2C79A 3RCNA 4GZIA 2QZRA 5AOUA 2X41A 2DUZA 3K30A 2VQUA 1QW7A 3T07A 3RDKA 4LUIA 3GBEA 1KXHA 3G2GA 3FVMA 1NOUA 4R53A 4JHOA 4OBTA 4KF1A 3IWPA 3IANA 3UA4A 2DH2A 3HPSA 3UNTA 3U7VA 1NWUA 4I7UA 4XX6A 4B2DA 2QJNA 1LROA 1J9YA 1FWRA 3WH9A 1XPGA 1KB3A 5CKSA 4L80A 5FEPA 3GNRA 7A3HA 3PVFA 5D2VA 3TSMA 4HK6A 1HP5A 1VFFA 3GXMA 4GNJA 4L56A 1L6YA 2E8YA 4CVUA 4L61A 4NSBA 4A4AA 5LA2A 3LENA 1TTQA 4YTQA 3UXAA 1M41A 1QR7A 1QO5A 3ITLA 5G1MA 1KBJA 1MW2A 2L5HA 2BXZA 4FSAA 5AVHA 2OYKA 3RNDA 2D3LA 1WX0A 3VKCA 1H1NA 5CBJA 3B9OA 1R2TA 1E73M 4O13A 4TVCA 3HO8A 3VZXA 1CBGA 2ZVIA 1KFBA 3GVWA 4H2CA 2Z1KA 3GG8A 1AH0A 4HTYA 4C7FA 1KM2A 4WEVX 2BSLA 1E55A 4K7YA 4UR9A 1TPFA 2X2GA 2NLYA 3RU8X 4S2CA 3GC2A 2GUBA 3GNXA 1E5JA 1UZHA 3CLWA 3R11A 5BRBA 5CPQA 1Y5XA 3GXIA 1AJ0A 4DBUA 4RUBA 3P60A 4X60A 3GHUA 1UASA 2NSXA 4E38A 3STPA 2VX4A 2DZXA 3DFYA 1DWAM 1XLIA 1ZY9A 4LS1A 2OT0A 5K9DA 2Q3RA 4GBDA 3FA4A 3UG4A 3WLSA 1FWTA 1TUFA 2REQA 3ZS4A 1OIMA 1RVGA 1GG0A 1LM1A 3KXQA 3HPZA 1L8NA 1EBHA 3KCJA 4JTGA 1OK4A 3SM0A 1M7JA 4H83A 3LQGA 3LTYA 4S3FA 3OBKA 3L7RA 3GDTA 3MUY1 3FFSA 4NJKA 1EJ7L 4I8YA 4GUFA 1EPXA 1XIIA 2J66A 2JKAA 5G2HA 3KRZA 1VCFA 3DFNA 2J75A 3A5VA 3TOYA 1UWIA 3W2KA 4C6CA 4XAGA 2ALDA 1DJNA 1S3HA 2YCEA 2E5DA 1EOKA 3HB9A 1P6BA 3N73A 4P7OA 3SQMA 4JTTA 1Z7AA 2DZBA 5FCZA 1ONWA 1NTHA 5H8UA 3WD0A 4YTTA 3EX1A 2HWGA 2PMQA 4Z1CA 3GW0A 1AVAA 3FEQA 4GXWA 3AXKA 1JFXA 2VC9A 3JS3A 2GVGA 1JPIA 4FNTA 1KTBA 3GY1A 3H7RA 3O6DA 3MCOA 2OPJA 1TELA 4HNCA 3A6OA 4ZFMA 4JEJA 3SRDA 3NL3A 4AQLA 3W1PA 5AFDA 2ZRWA 4QQUA 3LGEA 1A3HA 1F5ZA 3OZPA 2DVUA 4JTFA 4JQ4A 1M9HA 4RZ6A 5FF2A 3KL5A 3KOFA 3LMYA 4NUWA 4EAYA 2XFYA 3KL3A 4WRHA 5AB3A 4KGJA 3EWYA 3GB6A 1JAKA 1KTNA 4H8UA 3RU6A 4UNLA 3KZPA 4F0HA 5A8QA 1V6UA 2YDAA 3A3HA 1EGVA 3R25A 2AKMA 1AG1O 3VGFA 4R33A 1XLLA 2IUZA 3CIWA 3BICA 3P5ZA 2QDGA 4HSHA 1O5RA 3S2JA 4CNSA 1FP8A 2E4TA 2G3JA 4HHHA 5FD0A 3TC3A 3EX6A 4AD3A 3VZZA 1SFTA 2PDXA 1SO4A 2Q09A 3E0LA 4HD5A 4DM2A 4NQ1A 5HWJA 2E0PA 2O92A 4LCQA 2WKJA 3C2RA 2H3BA 1J2WA 2XH4A 3E0VA 4JKMA 1ZRQA 4U3CA 1CLXA 3HGRA 3WJYA 2ACRA 4DN1A 4RXGA 4V27A 1RJQA 1TCMA 2C15A 3RJYA 2VC6A 4PSRA 4DPQA 3GG1A 3MJYA 1R6WA 2R6OA 2YA0A 4BFAA 4UFHA 5AHEA 5JH1A 1SYTA 3T2PA 1S39A 4K36A 5GQBA 2OEJA 3LPPA 1T7LA 5M3WA 4NAFB 1WDDA 2OR2A 3PBMA 3GC4A 4D6FA 4Z2KA 3M07A 3W1QA 9XIAA 3HU7A 2CCRA 3AMDA 1RK5A 1UA7A 4O0QA 4R9XA 3V7PA 3QZAA 5F2GA 1Z89A 4MJZA 1XIMA 4HA1A 1BWKA 2ZDSA 4JCMA 4OBRA 1ECEA 3NCOA 3T0BA 4TO8A 4Q8TA 4PMYA 5F2LA 3PULA 1RP8A 2OWWA 3UWYA 3QTGA 3QPYA 5FESA 4JBRA 1JPKA 2QUTA 3BLLA 4GXMA 4L6DA 4CD6A 4N2YA 4GY7A 3TYEA 4R88A 3IAPA 4K7VA 1IGSA 4IZGA 1KGUA 4EACA 4RR4A 3XIMA 1V08A 5EMMA 1ZCCA 4I9MA 3E0FA 4KKXA 1UH3A 3L12A 2QLYA 3LMZA 1VC4A 3CEPA 2AL2A 3E0IA 4A3HA 2XSBA 1SMAA 5D9PA 2PTYA 4QM1A 2GDQA 1VH7A 4QROA 4A8NA 1WDRA 4C6KA 1GQJA 3GFXA 1Q6DA 1KM3A 4A3QA 1GVYA 1GKRA 4F9JA 3MBFA 2P8CA 5LNWA 4O1FA 3CXOA 2RDXA 1E6XM 1IEXA 2A2IA 4ORMA 3LDVA 1QI0A 2Z6JA 5C9ZA 3B8SA 2GL5A 3NYDA 3W7PA 4E6MA 5IOBA 3S9ZA 2HBVA 3BOXA 1T40A 5AC6A 1EIXA 3G8RA 5FSDC 4RV3A 1R86A 3WJZA 3BOLA 3QY7A 1DPMA 4A21A 3MKVA 3B4UA 4MB3A 2WSKA 1QPNA 5C7HA 2Y61A 1FHDA 2EPOA 4KCWA 3W25A 4ZODA 1OC7A 5CSYA 4KFNA 3SCUA 5LNVA 2YW3A 4XSLA 3IIOA 1E6QM 4CNUA 3BLFA 3M9YA 4X2RA 1SO5A 2CPUA 3WZ0E 1UD3A 3UG8A 1GQKA 3JW7A 1S5VA 2FPYA 2VEKA 8XIAA 1EJSC 3N4EA 3QN3A 1YDNA 1HO4A 2W63A 3KBMA 4D1IA 2JFEX 3S6OA 5DMLA 1K8CA 2D24A 4WZHA 2H3DA 3L2MA 3VFCA 4JNMA 4BHYA 3CZLA 1UW9A 3NZRA 3P6LA 3RM8A 1ENUA 2ZYFA 4UTLA 3SY8A 4JX5A 4XZNX 2HROA 3C0SA 3PBUA 5LIKX 4LB4A 4S3AA 2ZZ7A 5C9XA 3F03K 5LSMA 1XCFA 1W1A1 4OV9A 1XWYA 2HV5A 4BI7A 2PC8A 1PYFA 1FY6A 2WVSA 3W1RA 3T7VA 4C6MA 1EQCA 3BQ5A 2C1IA 3T40A 2P0OA 2ZX7A 1E1CA 5CZTA 5DX7A 4AZGA 2PF0A 5I77A 3NFUA 1BTMA 1RK6A 4IJBA 1O5XA 3UVAA 4CCEA 3L66A 3RX3A 3GTNA 4QJ1A 4DAFA 3GYEA 4G56A 2NQ9A 4LS2A 2A0NA 3QBUA 3LLFA 1WZAA 5C2CA 3LI0A 4K8HA 3VIOA 4E4PA 4X0NA 4UTMA 1XIEA 1R0MA 2B7QA 2Z1BA 1V6VA 4YHEA 4F0KA 1ZP4A 3WQDA 2YL9A 3V4BA 1PWMA 1BF6A 1ZUAX 4QR6A 1W0MA 2Z7GA 1P1XA 2OKTA 3IUIA 2QPXA 1QI3A 3TN3A 4UZSA 3VM7A 4JIEA 3R43A 1GOKA 4PRRA 3SCPA 3WBYA 1XR2A 1YKWA 2RGLA 2Z6IA 4DJDC 3S5SA 3VDGA 3NZQA 3PB0A 1YTDA 4KWVA 1GQLA 3GU1A 2B31A 1JDDA 2R9RA 3ZXWA 8CGTA 4DBSA 1GYLA 1KCXA 1ZQ5A 2VENA 2TODA 5EL1A 5HR6A 4AZHA 1R8LA 3EKLA 3WFLA 4C90A 3U2EA 5ABGA 2P8BA 3W82A 3UVIA 2VDHA 4XIAA 1W9UA 4ML4A 2GSHA 1FCQA 3QW4B 1FRBA 1XL9A 5I0DA 1H7XA 2OB3A 4GISA 3NZ1A 5DO8A 1GG1A 3CAVA 2IW0A 1LORA 4XD6A 4DWSB 4IX2A 3FEMA 1JVNA 1JEZA 2V67A 4QX4A 3V0SA 4B3LA 3W7CA 3EPMA 4FOJA 3NPXA 3LLXA 1V0NA 3DENA 2JF7A 2UZ9A 3TZNA 2ZUSA 5LXEA 3CQKA 3R12A 2XIMA 4DUXA 4DWSC 3WLTA 4GI4A 4HOXA 1W5NA 5ABTA 1UKOA 4A29A 4H01A 3C56A 1RUSA 1L2QA 3N9KA 4Q8QA 1YTEA 1GVRA 2GJRA 5BWFA 2HQAA 4GQRA 3IK2A 2BHYA 2W3ZA 1RQEA 1ONEA 2IKHA 5KITA 2VRKA 4DJFA 2ZUMA 2VEFA 4J3ZA 4LANA 1E4MM 3S4TA 4LC6A 3SR7A 2YA1A 1AW5A 3D3FA 1U2YA 2XFWA 4FMVA 1SUXA 4DYEA 1UD2A 1FOBA 2BX7A 1UKTA 3PZIA 2MANA 3EKZA 4FI4A 3WH5A 1W9DM 3MUIA 4W8LA 5HQLA 3BAIA 5D04C 3IARA 2QS8A 4G5DA 2UY5A 3WLRA 2PE4A 4AF0B 3QMRA 4JQ3A 3S8HA 3MO4A 2PBOA 1IT0A 2FHBA 1EF2A 3CT2A 2WVVA 3TWBA 1OVDA 1CGYA 1JUKA 1S1RA 3DBPA 1KBLA 3WNMA 1GT8A 3MKKA 2CWNA 3N2CA 4NZJA 3LPOA 1KXQA 1A49A 1MNSA 1Z44A 1A5LC 5BRQA 3QV9A 1JGIA 4QLJA 1NEYA 1L0PA 2VWSA 3REQB 2WNQA 4G8TA 4DELA 3AMGA 2FMOA 1JYXA 2OKOA 1NIUA 3OYZA 2QKFA 2Y85A 4DBDA 4NJGA 3FCPA 3NZPA 1TJ0A 1VFOA 2BOGX 3FNDA 4B2DD 4O1DA 1QWKA 3FV9A 4ZO6A 5LHFA 2PWDA 4OE7A 3THCA 4KBXA 3HMJG 4NY2A 3EB3A 3W1TA 4JY9A 2ZXBA 2DPEA 1MW1A 2J8TA 3N3TA 4ECLA 4H2HA 3FKKA 4ICMA 4V1XA 2HVMA 2DJLA 4PFHA 1BGAA 1VFMA 5K4ZA 3A4WA 4QQ3A 1Q7ZA 3RLGA 1O6IA 4IGMA 3N6QA 2D2OA 4DJEA 3VMNA 2XGBA 4LNCA 2GZXA 1UR0A 4DM1A 3CGTA 3URAA 3WDRA 4GE8A 1P5BA 2HZGA 4ADUA 2PGFA 2GQ9A 4PULA 3C86A 1T96A 2VXNA 1UWTA 1WDPA 1VEMA 3WLNA 2VCCA 2Z29A 1WDSA 4DF2A 2HBXA 4W7WA 1F3XA 1UQZA 3ZFHA 1W32A 5HMSA 1UC5A 4M19A 5JBEA 1Q7MA 1GJPA 2Y2WA 3NOEA 1LJYA 4NVTA 3M0MA 3KWXA 4IUGA 4GINA 2PAJA 4AZ7A 3CL7A 2IKIA 3ID7A 3S9YA 1XLHA 1HUVA 5D2XA 2AMGA 3E2VA 1PKYA 4FB7A 4GJJA 2PTDA 3H21A 3O16A 1MI3A 2WHJA 3E9AA 2ZE0A 3EEZA 4IFRA 5DMYA 1XC4A 4NF7A 3CZKA 1ZB5A 3W7RA 3DYPA 4MOZA 3TLQA 4DZHA 5CAHA 3EMCA 5HNNA 3DCPA 4K37A 4QTGA 1FP9A 4WQ6A 1LL6A 1XIGA 1A5MC 4PEEA 2FB3A 3RCMA 2FJUB 3W3OA 1UD8A 2C91A 2X0YA 3LX9A 2PDNA 4F0LA 4LBRA 2OTDA 1EJVC 2CKRA 4W8BA 4ZVJA 4B5XA 4AZIA 1YE4A 3IJ9A 2X7WA 2G50A 2VDIA 1K70A 2YCJA 1H49A 3P80A 4W5ZA 2ACQA 3I68A 2V2HA 1TRDA 4YVXA 2YX0A 3VCNA 2E6YA 1UR3M 4IP5A 4Q4OA 3S83A 2O9OA 3BG3A 4YN5A 1ML1A 3EWUA 1RJPA 1Z41A 3UPMA 3EDJA 3PN8A 1PIIA 3L4XA 4IIBA 1PHQA 3HURA 3DIPA 3GC5A 1WKDA 1AD1A 4AXNA 4DHGA 1ZFJA 1SJDA 2WW5A 2BVWA 4IJRA 3WQCA 1GJUA 3M6DA 1IR2A 2QIWA 1TG7A 3CBWA 1WKEA 2X0HA 3UJ2A 2YOCA 1B3OA 3VM5A 1B4EA 3TCSA 1GYNA 4GI9A 1OX6A 5EPDA 2A3LA 1V6YA 1K9DA 1EDGA 3FKRA 3H24A 5DQPA 4MAVA 3VKAA 4UNKA 5HJYA 1EP1A 4Y9OA 3MA8A 2FZMA 2GQ3A 1BTCA 4AD0A 3T44A 2P50A 4JTKA 5HPCA 4M7SA 4Q33A 1H5YA 3WD2A 3LCXA 3SI9A 2YZRA 1GEQA 4KQNA 4I90A 3ANYA 3WFZA 4ZMGA 1XG3A 2ANUA 5D9OA 3R94A 2QV4A 4Z2IA 1QPRA 3TU9A 5D2WA 3RX2A 3J7HA 4PE8A 1HF6A 4JTCA 2I9EA 3CV1A 3S1GA 4M51A 4G7EB 4I6KA 3D47A 3OODA 4DAIA 2DVTA 4YXGA 3W1LA 1IZJA 1TE1A 3LTPA 4X0VA 2XIBA 5U4NA 4L4LA 1W9BM 3C5QA 4FXFA 2G8ZA 4HZMA 3THQA 3EDKA 2P5NA 3KVMA 4L9ZA 1XSKA 3P8IA 3UJSA 1QI5A 3SDOA 2BMBA 3RMEA 3A22A 1TWZA 2XGZA 1FWEC 2Z1XA 5HQMA 4I3GA 4RW5A 3TQPA 1V7YA 3WMSA 3OZMA 3W2NA 3F7JA 2XVNA 4IPPA 2WZMA 1UWRA 2OZ3A 3VGEA 2OT1A 3QOKA 3MMWA 2V69A 3UYCA 1VBJA 2Q02A 4YIWA 1G4TA 2YIHA 3HGOA 4WR3A 5E0FA 3W2UA 3B8IA 3GHSA 4FZIA 1CXEA 1X8CA 4GYKA 1BRLB 3G18A 4WLCA 4KETA 4PB3A 4LF1A 2JIEA 1KR0A 2WJZA 3NDYA 3K4AA 4UR7A 4ERAA 1XGDA 3CB8A 4GWEA 5CAKA 2QNEA 3GG0A 3XISA 1CI1A 4HOZA 4GG9A 4FR1A 3TTQA 3MSGA 1XISA 1CB2A 1I4NA 6REQB 3LV5A 1O95A 4LVGA 3QHOA 3WQGA 2GQAA 5FEXA 1YNQA 2WO5A 3M64A 3WNKA 3TYDA 4PUUA 4R27A 2CZFA 1RJRA 4JL1A 4E2OA 4ZEPA 1RA0A 3ZSSA 4WX2A 1KA9F 5F2MA 1N2VA 1IXNA 1VYPX 3ANUA 4C1NA 1UD6A 3WEOA 3TEVA 4DXKA 4Z2HA 2Y88A 2GYIA 1XRVA 2DW7A 2FZ9A 2OWXA 4C6FA 3QHNA 3ARWA 2V5DA 2PRHA 2HNHA 5AYIA 4PMXA 1R47A 1P48A 4EPBC 4IMGA 3WLOA 3DFTA 2PD5A 1FHUA 4AH7A 4FLRA 1ZJAA 1HGWA 1QNVA 2CLIA 2EJ1A 2EQDA 2INZA 2A3CA 3TKFA 3FW6A 5G1TA 4QS5A 2QCEA 2V3DA 3FXYA 4PFMA 3ONBA 2PTXA 1NP2A 3NQBA 3BOFA 3OIXA 4RDWA 4EK7A 1H1YA 5C7VA 1JF5A 3Q4DA 4V33A 1NELA 3K4DA 4WIWA 1CB7B 4J3UA 1JCTA 1ONRA 1IIHA 2H90A 5CG0A 4AW7A 2Z27A 2PC4A 3EWWA 4C6JA 3W6YA 3MI6A 2ZX9A 4LCSA 3WJXA 4LUSA 4ONVA 1UYQA 2V5CA 1H7WA 3TE9A 1UOZA 2DGAA 3K8LA 1FXPA 3DC0A 5CJ5A 1TPB1 4PMRA 1K4HA 2J7BA 2Y63A 1ISWA 2PP0A 4IXXA 1D3GA