3W1QA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with nl-2
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with NL-2
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 104
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w1qA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w1qA01
1H63A 3R2GA 2GQ9A 2ZRXA 2QKFA 3L67A 3G18A 3M0ZA 4LRSA 4PFMA 3MHUA 1QPRA 1O95A 4JDBA 1FCVA 3L0KA 1QPQA 4JIQA 1TJPA 1RQEA 2W79A 3DKJA 4BI7A 3PUEA 4JDYA 3SW6A 1I4NA 3GKFA 1A50A 4O18A 3BO9A 2Y62A 4NX0A 3GK0A 1SSDA 1OFDA 1QMLA 1QPNA 4HKPA 1OYCA 4L4LA 3OG3A 3LRKA 5H2ZA 2GPTA 4DBEA 5HQEA 2ISWA 3A5VA 5E0KA 1SO4A 1OX4B 4A22A 4TU1A 2QCCA 4UTIA 3C3NA 2PRHA 2BLEA 3LLDA 1VJIA 1AK5A 2GVGA 4O11A 2QJIA 1FXPA 4JY8A 4QISA 3TC6A 2ISVA 2C13A 1LYXA 1TREA 1W5NA 4M7TA 3UPWA 3HPXA 1H7WA 3B0UX 4HPJA 3C56A 4IJBA 3CWOX 3DFOA 3PSVA 3KXQA 4E0CA 3WK0A 4HNVA 1HL2A 1OHLA 4DF2A 4NXKA 1GYLA 1XBYA 4O15A 4UIOA 1PE1A 5AYZA 3UNDA 4ZQNA 2ZRZA 2FQIA 4LC6A 1W3IA 4A21A 4O28A 4O12A 4GUGA 3IVTA 4LNYA 4BWLA 5K4ZA 3TX9A 4L4MA 3C2VA 4XWUA 4LS1A 3SFKA 3EWYA 1GG1A 3C2FA 3EX1A 3O6YX 1VPXA 3LB0A 3LBMA 3M5VA 4N02A 1ZJIA 2WNNA 4R33A 6ALDA 4N9EA 1A5BA 3BLEA 1UUOA 4JTUA 1WV2A 3LI0A 2DZTA 1I2RA 3TMQA 1U83A 5BOOA 5K2ZA 1GVQA 1DQWA 1YTKA 1GVSA 2QDGA 4FXSA 3KHJA 1HO4A 3NPXA 4CQAA 1SU5A 1MEHA 4ALDA 2QAPA 1XDMA 3DHFA 3GX9A 1TCDA 4MVAA 5U4NA 3NXFA 4Q33A 4ORMA 4NJIA 5LGZA 4LS0A 3KX6A 3ABOA 1K8ZA 4BWLC 4DXVA 2NWSA 1TPEA 2ATMA 4A3UA 3TK7A 1FCQA 5FEWA 3RK8A 1G4PA 3W7PA 1M6JA 2A4AA 5KINA 1R47A 4OE7A 3DENA 4E2BA 2R91A 3L21A 1G69A 3C4UA 3E49A 4UTTC 1XI3A 3VKJA 4RR4A 3NYZA 4N9CA 4JNMA 2Z1BA 4O1BA 4HSOA 2NXHA 2R94A 3PSWA 1G4SA 3SJ3A 2BTMA 1S5WA 2DJLA 3G1HA 4Q4KA 4DO4A 4Z0JA 3M47A 3TJLA 3RFAA 3IV3A 3RF9A 2BWGA 1K02A 2V8ZA 3G1SA 3LHUA 3W7EA 1TO3A 2FPVA 2FPTA 5D32A 4LW7A 3MP4A 3A21A 2VOMA 2PRLA 4DPPA 1XUZA 4AWSA 3B04A 4Y96A 1LOLA 1TV5A 3CB8A 3NA8A 3CC1A 3NQFA 1GEQA 2YXGA 3BG9A 3SY5A 1WBHA 3NDOA 1IGSA 2ZA1A 3TAKA 1YDVA 3P5ZA 2EAWA 3R13A 3W7RA 4JX6A 1N8FA 5CPOA 1KFEA 4NVTA 2AQWA 1TIMA 2VFHA 5DBUA 4HNNA 5FF0A 3UY8A 3BGGA 4HHPA 2Q8LA 4GUHA 1EA0A 5EBUA 3F4WA 1SZNA 3DU0A 4M6VA 1YDOA 1Q6RA 3CEUA 3GKAA 4NZFA 3UQNA 3GIYA 5HUOA 4HN4A 3QQ1A 3QC3A 2GUUA 1O60A 3PB0A 2XN0A 3TROA 4WZHA 4QIUA 3SGZA 4C1KA 1OYAA 4FNUA 4NZJA 5TQLA 1VCGA 2VFDA 5AHIA 1VCVA 3F4NA 4FEZA 2YFOA 4IWWA 2VFGA 5BNKA 3L0GA 3S8HA 3HF3A 1T99A 2YDAA 1JR1A 1OX4A 2EKCA 1TPH1 3O07A 2ZZ6A 2ZBTA 2Z2UA 5D30A 1VLIA 1JCYA 3DHDA 1AW1A 2GJLA 1GZGA 3C2OA 3BLFA 3TE9A 5DN1A 3CTLA 5C54A 5HMSA 3UXAA 1TTQA 1KBJA 2J9ZA 2ZTJA 3W7DA 2WNZA 5BMXA 2Y7FA 3SZ8A 4NU7A 4IX2A 3KOFA 5KZMA 1L9WA 3IVUA 5TBOA 1K3UA 3VNDA 1GOXA 4S1FA 5AHEA 1VHCA 4G1KA 4NXSA 4JTJA 3M9YA 3W6YA 2EF9A 3RLUA 1PHWA 3W1LA 2TYSA 4UTJA 1Q6OA 3BW4A 5D33A 4JYDA 2ABBA 3A22A 3O8AA 3WK3A 1EUAA 3P80A 4AMAA 3AJXA 3G1YA 3LX9A 3W9ZA 2C14A 4IMFA 1E51A 3EKLA 2Q8ZA 4FB7A 1ZHAA 3S1UA 3STEA 1V7YA 3TXVA 4IX0A 3M5ZA 4O0ZA 1T0OA 4UTMA 3CT7A 2RHGA 5D2TA 3HIJA 3UZ5A 3LHYA 4PA8A 4DF0A 3TSMA 1M7PA 5LZLA 1FDZA 3KAOA 3FEMA 3HO8A 2Y6ZA 1P4CA 4CNPA 1WQ5A 3NM3A 4OV4A 1ME7A 3USBA 4CLMA 1H51A 1G4EA 1PCWA 3UWQA 5I3KA 1HO1A 1VC4A 4PODA 5AHLA 1H1YA 3DAQA 2ZFAA 4M19A 1JQVA 1KTBA 2CLIA 3A23A 3VI2A 2V30A 5AC7A 2E5DA 1XC4A 4LOCA 4UTUA 2DZUA 4AVFA 5KTLA 5CPNA 1SW3A 2ZA2A 3GDMA 2QDHA 4POCA 1TPC1 1X7FA 1ALDA 3LV6A 2HS8A 5CGQA 1OF6A 1TTIA 3LRLA 3MP5A 4NJJA 3G0XA 1SO5A 3TMLA 5AHNA 1AMKA 5C5YA 1C9DA 3MBDA 1K7XA 4K7VA 4OT7A 4WOQA 3W7MA 2VEMA 3QH2A 3W7CA 1LRTA 4FO4A 3U8GA 3GR8A 2FIQA 3PUDA 1W0MA 3FKKA 2NXGA 3W7KA 5IM51 3NQEA 2NZLA 3A9IA 1JCJA 5E93A 2VXNA 1H62A 2Z6IA 2Y88A 3C6CA 1F76A 1P5BA 1XKYA 2OMAA 1ZFJA 3W2LA 3PBYA 1DKWA 4JTEA 4XUGA 4JTGA 4LY8A 4AF0B 4Y6GA 1THFD 3G3MA 4FX6M 4JICA 1LZOA 3CPRA 3AO0A 5HUPA 3DI1A 4S2BA 3L5AA 4PL1A 1VYPX 2V5BA 1JRCA 4RZ5A 3Q37A 4FX7A 3QPYA 4MFEA 1TB3A 3I7RA 3QW3A 2TPSA 5D03A 3Q2DA 2QCFA 3RNDA 2RKXA 1OFPA 2CZDA 1QR7A 2X2GA 4LU0A 3NQAA 3LI1A 4GFSA 1JCXA 2HSAA 2EGZA 5EYWA 5BW6A 4I7UA 2QCGA 4UFIA 5C2XA 3DI0A 3STFA 2H3BA 5AYXA 3PM6A 3IEBA 2YW4A 2Y63A 1KBIA 1VS1A 3G1VA 3W1RA 3UWVA 1GVFA 1Z42A 3QYQA 1UJPA 1DBTA 5D05A 2FB3A 5IBXC 1FXQA 3S5NA 1YPIA 1IXQA 4Z0SA 3W83A 1HUVA 3NQ6A 1VCFA 3I7SA 1R2TA 4OV9A 1GVOA 1A5CA 4N2YA 1WYIA 4OGZA 2J9XA 3W1TA 1F7BA 3MYOA 3N9SA 4O10A 2JKAA 3B06A 1S3HA 3QF0A 3T78A 1YDNA 4TMCA 4FNSA 3W74A 4MFDA 3M5XA 2YR1A 3PULA 2FPYA 4NQ1A 1KLZA 2Z6JA 3NZRA 4QM1A 4DF1A 3TV8A 4M6PA 1W5MA 2ISSA 7TIMA 1LBMA 3W2MA 1QO2A 4FX8A 4UFHA 4IOTA 3KRSA 3BPWA 4BI6A 1EB3A 1GG0A 1Z44A 5LSMA 3W1QA 1WXJA 2OX1A 1SW7A 3GR7A 5CZJA 3ZWSA 3DFNA 4LV9A 3G22A 3HG2A 1AW5A 4H3DA 3G3DA 5LNWA 5LNRA 2V81A 2J27A 3GXNA 1SSGA 3NQCA 1YXCA 4PC8A 3W1AA 4HT3A 5L6UA 5HNRA 3W70A 5D2WA 2ZA3A 3W72A 1D3GA 1DV7A 1FWWA 3Q58A 4BF9A 2VEKA 3S1VA 3M16A 5D02A 3O16A 2VENA 4HNUA 1X8FA 4MZYA 2P1FA 5AHFA 1OFRA 3KRZA 4GNJA 1SO6A 1VZWA 2JBMA 5ABTA 3OVRA 3EWBX 2V5LA 2E68A 1UBSA 4N9BA 3M43A 3W75A 4JIPA 4P61A 5CZ0A 3NGJA 1B4EA 1TPFA 3G1XA 4MY9A 1KM6A 4UCGA 1VQTA 5AFDA 1IXNA 4GXMA 2ATSA 3NQGA 2VELA 3S1WA 3N73A 3F1QA 4RXGA 3H55A 2CLLA 1Q6QA 3G1FA 4ZMGA 2JGYA 4EWND 2B0MA 1VGAA 3LCLA 1Z41A 1H61A 1EIXA 2QJHA 4PEKA 3HJZA 2CWNA 3MP3A 3W7NA 2VC6A 2WSQA 3HG4A 1TMHA 6TIMA 3W7LA 1BTMA 4GUFA 3EB2A 3STCA 1K8XA 4KFNA 3W07A 3P84A 3D0CA 3RMJA 5L9FA 3GVGA 5KZEA 5LHFA 3TH6A 4O1DA 2RH9A 2JKPA 4WXZA 1ONRA 5EA9A 3BGJA 3OHIA 1Q45A 3N2MA 3R8RA 2X1RA 2A21A 4RZ4A 4WD0A 1X1OA 2OZ0A 5D37A 2A6NA 3DFQA 4UTTA 2Y7EA 3B8DA 1AL7A 3O6CA 4N4PA 3W1UA 2QJGA 2YZRA 3EX3A 1GVRA 2RDWA 4OQVA 3BARA 2X1TA 1ZAHA 3W2UA 5AB3A 3O6DA 2I14A 5BRBA 3FKRA 4JX5A 2D73A 2CW6A 1SZFA 4EOUA 4RX0A 4UR7A 5F2IA 4FNRA 1EPXA 3L65A 3KVLA 2FTPA 3K30A 4LTSA 4MYAA 4XBKA 2NUYA 4S2CA 1MO0A 2WKJA 4UFJA 4ZQRA 4QJ1A 4WY0F 1FWTA 1AL8A 5DXXA 2C19A 3LERA 3CQ0A 3A24A 2H3DA 4LC8A 1DL3A 3HQ1A 3ZS4A 1EUNA 3IIVA 5LKYA 1OFOA 4AEOA 4ML9A 4H4IA 1W31A 4CNOA 1RPXA 1Y0EA 3MWAA 1PCKA 1VH7A 3IIZA 2A0NA 2FJKA 2ZZ7A 1D3HA 1KFBA 2H8XA 2PURA 5K9DA 2A5HA 2HTMA 3C52A 3WJXA 4FIQA 3NQVA 5G4EA 2OCZA 3ELFA 3P74A 3V75A 3PR2A 1ZALA 4KWVA 1GTHA 2NXIA 5C55A 3NPWA 3PWAA 3B4UA 3JR2A 1W3TA 1S5VA 1R2SA 3GNDA 3OEXA 4UUIA 3WK2A 3CEPA 1XBXA 1LOSA 2A2IA 4TMBA 3MMTA 4ORIA 1LTDA 1WOAA 1KA9F 4QNEA 4DO5A 3KRUA 5FF3A 1G7UA 1I2OA 3W7QA 2C16A 3LHTA 2TRSA 3P61A 4RZ6A 3DFTA 3C2RA 3NAVA 3S5OA 1XBZA 5T26A 4UNLA 3FYPA 3TFXA 3NO5A 1LBLA 2VFFA 3G1AA 4Z1AA 1KTNA 3BV4A 1SFLA 4K6AA 1B57A 1NFBA 4ZL1A 1OK4A 4UFKA 4AHPA 2YYUA 2GVLA 3QJAA 2O7SA 4K36A 1PV8A 4AHOA 1ZENA 2V2HA 4B5NA 1H7PA 1FX6A 3FS2A 3UZJA 2NV2A 2ABAA 3M5YA 1JUEA 1EP2A 4CCDA 1ZAJA 1A5AA 4E2DA 4UTHA 4QNWA 4QSHA 4MY1A 5KSWA 3GDKA 1H7XA 4LVDA 2EPHA 3S6DA 3GXPA 3LM7A 4RKAA 1RR2A 1HTIA 2E1DA 1L6WA 2VFEA 5CZSA 3P8JA 3JS3A 4JR5A 1IIGA 1WBJA 3MO7A 1TPVA 3VFLA 1FCBA 4O53A 5CSSA 1O5XA 2J88A 1OVDA 3WJYA 4R7JA 1FWRA 2NWRA 2YCEA 1BWKA 2W0UA 4UMCA 5CSRA 2BSLA 1SR9A 4O1AA 3TSDA 4M7SA 3U6WA 1H7RA 4RV8A 4J9JA 3LXAA 2V9DA 3EEGA 3ABSA 1FBAA 3E0IA 2DZVA 4TIMA 3W7IA 3PB2A 4AHQA 3PUOA 1JULA 3ATYA 3GNNA 1MSSA 3TR2A 2GVJA 3TXZA 4ZQOA 4X9SA 4LRTA 2GJNA 3E9AA 1C29A 4IMEA 5CPLA 5DCBA 1SUXA 3LBCA 1KFLA 3GDRA 2WQPA 4HPXA 4HIBA 2DZPA 2ZYFA 4QAIA 4YXGA 4E38A 3R12A 1F74A 3W86A 1ICPA 1H60A 3N34A 4IUOA 4BR1A 2V2CA 4MZ8A 4RK8A 4EVZA 4GUIA 3UD6A 3NOEA 3HMJG 1ML1A 1LCOA 3W2NA 2QUVA 3E02A 2R14A 3LCFA 1BKSA 1MZHA 2ZRVA 3W76A 4TO8A 4JGDA 4O54A 4XQ6A 4MPQA 2C3ZA 3UYCA 5AC8A 4OHQA 5H91A 3R89A 2ZRWA 5D2XA 1A5SA 2DP3A 2H90A 4DBDA 3MI6A 3P82A 3PS7A 5A5WA 1ZY9A 1FWNA 1IXPA 1SW0A 3TNOA 3N14A 2A1YA 1O4UA 3L9CA 8TIMA 4K7YA 1J5TA 4NNCA 5HJLA 3L0NA 4JX4A 3RU6A 3T40A 1CX9A 3P62A 4IMCA 3PG9A 1TV7A 1IXOA 3CIWA 1DOSA 3PBVA 3TQ0A 3L5LA 4Q32A 4NJHA 3MW7A 4RCXA 4JXCA 3O63A 1EX5A 3KFTA 1NF0A 2QF7A 4PCFA 1C8VA 1CI1A 4ONVA 1DJNA 1QPOA 1DORA 3BW3A 2JKEA 3NR0A 4M6QA 3A5FA 2A85A 3RLVA 3EWXA 2A7RA 2B7OA 2DZSA 2QUUA 3W1NA 5FF4A 2BXVA 3LTPA 2JGQA 4TR9A 3L2IA 1O94A 3FOKA 5CZTA 1QOPA 4N4QA 3IGSA 5C6MA 3HG5A 3NEVA 1J4EA 1PL9A 1A53A 3CHVA 1KLYA 5HWJA 1YPFA 2WSRA 2P0OA 3S5ZA 5I3GA 1KV8A 3M41A 5DY2A 1UCWA 3P7YA 3LCWA 1AG1O 3THQA 1W3NA 4IXHA 3THAA 5HINA 3S42A 4WXYA 3B03A 5AC6A 5K9CA 2X16A 4KWWA 1GJPA 3FLUA 4XBSA 4CCEA 2DZWA 4AXKA 1YADA 1QDSA 5FEZA 2KZHA 3LGEA 1TQXA 4JTKA 4XKYB 4Y90A 4DELA 2CZEA 1BEUA 3P81A 3W7JA 3OBKA 4GRSA 4I9AA 1JCMP 3STGA 1QFEA 4YL2A 3T55A 1H7OA 2WNQA 3LRMA 1S5TA 4EF9A 5IBXA 4RJEA 3BK0A 3M7WA 5HWNA 4MIMA 4X22A 1XDLA 3HGRA 1NF7A 1NVMA 4JTIA 3TIMA 3EXRA 3TAOA 3W1XA 1KFJA 1KM5A 2B7QA 1B3OA 4ZQCA 5I3FA 2ZQ0A 3NL5A 1JCNA 2Q3OA 1RQBA 4O52A 4LV4A 2ALDA 2JK2A 1P0KA 1VHNA 2CFFA 3LCXA 2C15A 2ZZ1A 2PE4A 3E12A 2NUXA 2FDSA 4GJ1A 2P10A 5U7SA 5I3JA 1EEPA 2RDTA 2O7QA 5E1QA 2F7FA 4XZ9A 4FXRA 2HMCA 2Y7DA 4O57A 4WOZA 1RV8A 1QOQA 3PG8A 4JTSA 4GE8A 3SGUA 3MHGA 4WX2A 1O5KA 2OT0A 4NT0A 1IF2A 1GQNA 4MLRA 3NL3A 4MLJA 5AYYA 2E5CA 1W5OA 3FA5A 2W6RA 4Z1BA 3P5YA 1OK6A 2Y85A 3MBFA 3Q94A 4U4MA 2CLMA 4D2JA 2YPIA 1T96A 4JTTA 3HGOA 2E6AA 1Z48A 1B4KA 3LCIA 4MUZA 4WY0B 3N9RA 2NX3A 3QM3A 1W37A 1H1ZA 5KZDA 3W7HA 2TMDA 2GQ8A 4UTWC 3NG3A 1Q3NA 4AAJA 2CZ5A 3HPZA 4O14A 3B05A 3B0PA 1ICSA 2YYTA 3CIXA 1M7OA 3PBWA 4I7VA 5A8GA 3TQKA 4TX9A 4NX5A 3VCRA 3T7VA 3LHVA 4CNNA 4UMBA 4JD4A 3GZ3A 1LROA 4K39A 4HSNA 3SI9A 1VYRA 3ABQA 2Y7GA 3C2EA 3UWYA 1F2JA 1K8YA 2C18A 4GC4A 4FNPA 2DJXA 3LXBA 4KFPA 1TJRA 3EX4A 4IMDA 4DO6A 1F73A 3LHZA 1M5WA 4NNAA 4PH6A 3I6RA 2C0AA 3ZR4A 2R8WA 4K38A 2ZTKA 1W54A 1GYNA 1XXXA 1JUBA 3T44A 1EWDA 4HNTA 3KVJA 1KFKA 5CKSA 1R2RA 1WAUA 1YTDA 2ZZ3A 1F6PA 2QCHA 3PY2A 3WK1A 4RLIA 4JTFA 1FCUA 3G0UA 4O0KA 1LORA 1KTCA 3TW6A 1NSJA 2QEZA 3EXTA 1W1ZA 5EKYA 5EY5A 3C0JA 2DU2A 1EP3A 1G6CA 3KVKA 1IIHA 2E6FA 4LVFA 1FY6A 5FESA 3N2XA 1ZNNA 3VE9A 2WO5A 2CLKA 2QCEA 4WQ6A 5GVJA 4O4WA 3V1PA 1QAPA 3EKZA 4LWWA 3QW4B 1MXSA 1Q6LA 2NLIA 3O1NA 3TW7A 3M1ZA 2GOUA 4K8HA 3SR7A 5K3VA 4NJGA 2QR6A 4O50A 2ZRUA 5AHMA 3NVTA 2XN1A 3HBLA 3C61A 2QCLA 1B9BA 1G7VA 4ADUA 4JTLA 2E5BA 1G4TA 3EX6A 3GB6A 5DBTA 2NUWA 3NL6A 4GWEA 4XKYA 3TJXA 1PS9A 4M5PA 3BVJA 3W1PA 1SPQA 4OBTA 4AF0A 2QAFA 4IMGA 1XBVA 1U5JA 1RQHA 4LS2A 2B7PA 4RXFA 1X1ZA 5HWMA 3DGRA 4R53A 1XCFA 3IGXA 1ICQA 4BK9A 2OT1A 2ZZ2A 2PCQA 3W22A 5KITA 3CM4A 4UC5A 3HGJA 1R30A 4NNBA 3GYEA 1FDJA 3W85A 3U2OA 3LTSA 3SIZA 3P8IA 1TQJA 4UFMA 4KFOA 3VE7A 2AAMA 1H7NA 2PRMA 2C1HA 5K7JA 4CQ9A 4NUWA 3GDTA 4QQ3A 1ADOA 1CW2A 3EWZA 2CLEA 4A2RA 4FIRA 2QCMA 2WV8A 3MUXA 2J6XA 4UMAA 1VR6A 2CLOA 4FNTA 4U28A 3IRDA 1LOQA 2QCDB 3FJLA 1LDCA 5I3IA 3KVMA 1JRBA 4EF8A 2ZCGA 4JYEA 1NEYA 4AWUA 1JCLA 1JJKA 1TPDA 3E96A 1OYBA 2Y61A 1L6YA 4Y9AA 1F5ZA 3LDVA 4UNKA 3F03K 1I2QA 4MZ1A 4CCCA 3IVSA 5EL1A 3HGSA 3W23A 3MJYA 1FUYA 3TC7A 3OA3A 1TPWA 1TV8A 2F84A 5TIMA 5F4SA 4CQ8A 4WY0A 1VYSX 3NZ1A 1LM1A 3CU2A 2V0TA 3OVQA 1W56A 1VLWA 2QCNA 2UV8G 4PL2A 4AH7A 4O8RA 3W7GA 1WDWA 4YMZA 3BG5A 3FYOA 1I8JA 2Y70A 3DH7A 4OU1A 2X1SA 4BFAA 1HG3A 3H53A 1UASA 5F4XA 1KM3A 1EP1A 3PAJA 4MOZA 3PVFA 3YPIA 3GAKA 5BMWA 1ZAIA 5LNUA 5FF2A 3TFCA 2PC4A 4FF7A 3FIGA 2NX1A 3S5YA 1QCWA 4Z08A 3UY7A 2RFGA 5D2VA 4N6FA 1RD5A 4YCPA 4X2RA 1TPUA 4MY8A 4WUIA 3CLMA 1YXYA 4YWIA 4FNQA 3ZWTA 1ZCOA 1DHPA 1K7EA 1OFAA 1VRDA 3CWNA 5F2LA 1AW2A 4ICNA 3UWWA 5LHEA 1YTEA 1F6KA 1MEWA 1EWEA 1LLWA 3W3OA 3IIOA 3NQDA 5HR6A 4K37A 2A7NA 3OVPA 2VEIA 3IIXA 1KM0A 3W2KA 3QRHA 1TRDA 3L68A 3I7QA 5F2MA 3W2JA 5F1UA 3R5EA 1R46A 2J9YA 5F1VA 2NV1A 2FFCA 3GXTA 5G5IA 1PVNA 3MYPA 4DPQA 3FJ6A 3W88A 3DKLA 2V2DA 3DBPA 1FWSA 1GWJA 5AOUA 1OF8A 4N9DA 4O1CA 3QPZA 3EXSA 5SWUA 3I65A 4I7WA 1KV5A 4N6EA 2CLHA 4GUJA 2QUTA 2BX7A 1KW1A 1JQXA 1H5YA 1JVNA 4NJKA 1OJXA 3H54A 3BG3A 2E6YA 3TU9A 5D38A 3ANYA 2YW3A 1XM3A 4K8EA 3T4CA 2LLEA 3NM1A 3NQ8A 1HFBA 4O16A 4AB4A 2A7PA 5G1YA 2E77A 3O05A 4IPJA 1WA3A 2YGYA 4P2VA 1LLZA 2VKZG 1I45A 3NQ2A 3TSBA 4LVGA 1N7KA 4YLWA 1NAL1 3INPA 4ADSA 3W71A 3EWUA 1V5XA 4O4VA 2E6DA 2A6LA 3PC0A 2B7NA 1UB3A 1JUKA 3QEZA 1I2NA 1KM4A 3MHFA 5G4WA 2CU0A 3QSRA 2WOQA 5FF7A 1WX0A 5CG7A 2I1OA 4Z1CA 1F05A 1LRQA 1DQXA 3P60A 1OFBA 1RVGA 1OX5A 3S1XA 2B4GA 3DXIA 5F2GA 2ZDRA 3BW2A 3UWUA 5G2HA 1XFBA 3NPVA 2RDUA 4X3ZA 2BZNA 3GDLA 4JY9A 2VEPA 4O17A 2E09A 3W84A 3TA6A 3W1MA 1P1XA 3LCGA 4GBUA 1YYAA 1ME9A 1QWGA 3N3MA 1FDYA 2V82A 1OG0A 3S0CA 1W8SA 5K9XA 1K03A 3EWWA 3QMSA 3DFSA 2C6QA 3LXCA 4JTHA 3M6YA 3G1DA 3LOTA 1SZGA 2ZRYA 4MJMA 4A2SA 4LUJA 4JN6A 4JEQA 2QCDA 3NQMA 5J5RA 3WJSA 1H50A 2YFNA 3TCEA 4UTKA 4PTNA 4MJZA 3W7OA 5LGXA 2EHHA 4QITA 1K7FA 2WSYA 3L5MA 4IQLA 1OFQA 3FFSA 2YX0A 5I3HA 3LHWA 3WJZA 3LTYA 4JYFA 4MKNA 4ADTA 1TRIA 3QMTA 3NL2A 1TTPA 5FI8A 2FLIA 4IPIA 1SQ7A 2ZZ4A 3N19B 5G2IA 3QFEA 2J24A 3UXDA 1BWLA 1WOBA 3G24A 3NPUA 3TKFA 3G0SA 3QZEA 2FB2A 1MEIA 4XTIA 2GQAA 4FHAA 1W5PA 1RZMA 5EPDA 4BI5A 4LVAA 3S9YA 4Z1DA 4JS3A 1OX6A 4UTLA 4LVBA 4Y8FA 3WJWA 5DELA 5DY3A 5KMYA 1KM1A 3L66A 1I2PA 1SO3A 3JRKA 3PF3A 5DCDA 2X1UA 3O06A 1L6SA 2AGKA 2H6RA 2H8ZA 3G8EA 3TQVA 1XL9A 5AN7A 3BLIA 2HS6A 3UWZA 3O15A 3ZFHA 5LNVA 5LNSA 3W73A 4UFLA 1X6UA 2I9EA 2NX9A 1J2WA 4UTWA 5D2YA 1KM2A 3GAYA 3HG3A 5G2WA 5FEXA 5HULA 4ZQPA 1W5QA 3EX2A 4W9TA 5K4XA 4DQWA 3MI3A 2Y89A 1DVJA 1TYGA 2YSWA 1N55A 1LBFA 4IGHA 3W87A 4A29A 2Q3RA 3OIXA 1QNVA 3SSJA 2ZZ5A 3LCHA 3LLFA 5J5DA 1P0NA 4OWGA 5D09A 4LT9A 4C1LA 3DFPA 1TSIA 4H6KA 4DEFA 3IGUA 1GT8A 1SFJA 2G96A 1ME8A 5EMUA 5HR7A 4MYXA 3NQ7A 1KFCA 2DORA 1PHQA 4UXDA 3P67A 3G8RA 4ZQMA 5DCEA 5FEPA 1UUMA 5MHBA 2TSYA 1LP6A 2G97A 2XFWA 2IQTA 1YXDA 3ABRA 3QMRA 3WFAA 4O19A 1PIIA 5F4WA 1LRNA 5D04C 1DJQA 1XUUA 5DLCA 5G1TA 2OJPA 3LV5A 2DZXA 3TDFA 3HPSA 3NNTA 3B0VC 3IIPA 3PBUA 1SZEA 4ZVJA 2X30A 3ATZA 3DZ1A 4AWTA 1YLVA 2G95A 3C8FA 1OFEA 1QO5A 4R34A 1OABA 3I68A 5CPMA 3UPBA 1D9EA 2WJZA 3QQ0A 2CLFA 3HB9A 3M44A 4UR8A 1GPWA 3QSTA 2G5WA 1G67A 3HOJA 1L2UA 1FQ0A 1TPB1 3SECA 2XN2A 4WJEA 2Z0IA 4O13A 4EIVA 1TTJA 1T8XA 1GTEA 4LUIA 4ZZ9A 2WPBA 4IXXA 4XTDA 2CZFA 3GLCA 3MI2A 4KKXA 4YCOA 3TUUA 5DXYA 2VFIA
chains in the Genus database with same CATH superfamily
3EMZA 3R2GA 2BGQA 3C3UA 5GQBA 3G2GA 2IQDA 3VIJA 1J79A 2OKOA 3M0ZA 5E0FA 1WO2A 2XHYA 3MHUA 3ZR6A 1XIHA 5CGTA 5FJRA 3L0KA 3UR8A 5M3WA 4S3AA 4BI7A 3PUEA 2GJRA 3IJ9A 1DIDA 1A50A 1HNYA 1CGVA 4XZNX 3E2RA 4WDTA 3FGCB 5I06A 1C9WA 1QPNA 2G4FA 1QVBA 4Z2KA 3QV9A 1XYCA 4ZO8A 4PUUA 3VILA 3OG3A 3LRKA 4MWAC 3TTOA 3VDBA 2VGBA 3F7JA 3TJIA 3N9KA 4ATWA 2ISWA 4Q4RA 5E0KA 4M51A 1SO4A 3BLOA 1OX4B 4WDWA 1HVXA 3TLLA 4HD5A 2BLEA 3O3RA 5AC5A 3DYPA 1AK5A 4TTUA 1HP4A 2XUCA 3SRFA 1B1YA 1FWFC 3STPA 3GIPA 2PDYA 1ZP4A 4EE9A 3B0UX 1UD4A 4IJBA 3DFOA 3KXQA 1IHIA 3UR2A 4DF2A 5AYZA 3VIGA 1DE5A 3CZEA 4BWLA 3IVTA 3AC0A 4BQ5A 1SJBA 3C2VA 1S2CA 5BXTA 1E72M 3HZ3A 3O6YX 3V36A 4JNZA 1RLCL 3CQJA 3SJNA 1UKPA 3PZOA 1A5BA 1J0ZA 3BLEA 3ITTA 4O8AA 1CZ1A 4DYKA 1U83A 4ZODA 2QDGA 1GQKA 4CQAA 2O9OA 5FJTA 3GX9A 3QR3A 4MVAA 3FDGA 3NXFA 4ORMA 2WZMA 1ODUA 1GNXA 1R3YA 1NIUA 3LSCA 4RZBA 3EDFA 1W2PA 1VJSA 3K4DA 1A5LC 2I5IA 3WF3A 4H8VA 3RK8A 3ONBA 1MQPA 4R27A 3SEPA 1M6JA 2ASHA 3TZNA 5KINA 2O56A 3E49A 1XI3A 2J7CA 5DT7A 3VKJA 4RR4A 1R3RA 4O1BA 4QDMA 2ZUVA 1EPVA 3KTSA 3SJ3A 3LLXA 3VNMA 1S5WA 3G1HA 4GACA 3T0AA 1HL9A 4H9UA 4BA0A 4J3ZA 1K02A 1RUSA 2V8ZA 3G1SA 2FPVA 2FPTA 3KEHA 3CPUA 4KS0A 2XM2A 4CUCA 3BWWA 3EB3A 3UA4A 3CB8A 3NA8A 3NQFA 3SY5A 2YXGA 4Q4QA 1Q8AA 2ZA1A 2HNHA 1PO9A 4UNIA 2YJQA 2E9MA 1F8IA 3IJDA 4X60A 3H23A 3W7RA 4X9YA 2VGIA 1N8FA 4D6JA 3BCFA 3WNLA 2AQWA 1TIMA 2ACUA 2VFHA 4BJHA 2YLAA 1EL3A 5CC3A 4GH1A 3CL7A 4HHPA 1JPDX 1DHKA 3DU0A 3IAQA 1U2YA 3I3DA 4NZFA 1A0DA 3QQ1A 3VD4A 1O60A 3PB0A 3ZYZA 3TROA 2RGMA 3F5KA 3RJXA 4C1KA 1K9EA 4FNUA 4DJED 3MUCA 3LQLA 4A3RA 2YFOA 2PTZA 1HGYA 1QBBA 4IWWA 2ZVRA 3AMCA 1T99A 2WK2A 1OX4A 3O07A 2ZX5A 3GIQA 1JCYA 2GJLA 3TE9A 3M0IA 5DN1A 4HNOA 6ENLA 1P1MA 1UPPA 2ZTJA 2WNZA 1UWRA 4NU7A 3MO4A 4YVVA 4QAWA 1K3UA 1V02E 3VNDA 1Q7QA 3IS4A 2VZSA 2NSOA 3E74A 4IM4A 5AHEA 2VEGA 4JTJA 2AQOA 1PUDA 1KRBC 2FKPA 1Q6OA 2ABBA 3A22A 3WK3A 3LU2A 3AJXA 3LX9A 5I24A 1XLIA 3DESA 1E51A 4LAMA 3EKLA 2QNEA 2AGTA 1ZHAA 3S1UA 2BXYA 2J62A 3UCCA 1JXKA 3ZVIA 3WUFA 1R5YA 3WQ8A 3HIJA 1W1B1 4HMNA 3GWQA 3TSMA 1FDZA 1TWZA 4S3BA 2Y6ZA 4IPPA 3NM3A 3CV7A 5HK4A 1G4EA 3ENLA 1PCWA 2ADAA 3UWQA 5I3KA 4WKFA 3N2OA 1VC4A 4LUSB 2ZFAA 4M19A 5CEWA 3BJFA 1JQVA 2JQXA 3VI2A 4GKTA 1W91A 5A6AA 4LOCA 1SW3A 3GDMA 2QDHA 2CITA 4POCA 2FZ9A 3S3GA 4BZYA 1OF6A 4H00A 4B2DD 2ZDSA 1KRAC 2YCKX 4MUPA 1AMKA 2Z27A 1C9DA 1J5SA 3A4JA 3OU8A 4Q3MA 1BXNA 4OT7A 4GYKA 3D46A 3QH2A 1V6XA 2FTYA 1LRTA 3GR8A 5EMJA 3V4BA 1VENA 3W7KA 1IT0A 3QKEA 4AD3A 5LIKX 4FF5A 5M5DA 2HCVA 1JCJA 4I9TA 2VXNA 1D7KA 1W3KA 2DSVA 2QUMA 2Y88A 4H2HA 1U33A 1F76A 1P5BA 4LB3A 3W2LA 1DKWA 3TQPA 4KCWA 1E40A 3U3HA 5FL0A 4AY8A 4FX6M 3CPRA 3UW6A 3AO0A 4XO7A 3BAYA 3GHUA 4FS9A 5CC5A 4C6KA 3T8QA 3NDZA 5TNVA 3WD3A 2F61A 3QPYA 4H19A 3I7RA 3SSZA 5PTDA 1XH2A 4FP1A 1V6VA 1EJSC 3RNDA 4WGXA 3L12A 3V16A 4F0KA 2X2GA 3F2BA 2VRJA 3BURA 3LI1A 4FALA 3E2VA 1UHVA 5EYWA 5BW6A 3BCDA 2QCGA 1YQ2A 5AYXA 1E6ZA 3Q65A 3PM6A 2YW4A 1SJAA 2Y63A 3WFLA 1UMYA 1C93A 4ASTA 3ARZA 3V35A 1GVFA 1Z42A 3QYQA 1KFWA 5IBXC 2FMOA 4QGCA 4D1IA 1R2TA 1RXOB 4HJWA 5CJ5A 2F2KA 3VDGA 3W1TA 3MYOA 1B5TA 3KBMA 2DPEA 2X7VA 3M5XA 4LQ1A 1ZJHA 3PULA 4WEVX 1BPLB 4AZCA 1EC9A 3RDKA 2Z6JA 1TJ0A 2BXZA 3KWXA 4DF1A 4QG6A 4H41A 3S47A 3TV8A 4M6PA 1DPMA 1Y5WA 4MAZA 3DUGA 1EOMA 4FX8A 4QS5A 3R43A 3KRSA 3B8UA 1EB3A 2VP8A 1JYWA 3NCOA 1WXJA 4URIA 1W9BM 3MB9A 3UA3A 4LBUA 5CZJA 1E4LA 5LNWA 1TZ7A 1NQ6A 4BQ2A 5LNRA 2V81A 4NZ4A 1HJVA 1SSGA 1FHVA 2OWWA 1DJIA 2TODA 5BCAA 4ZGYA 5D2WA 4RNJA 2UWFA 3BXWA 1DV7A 4IPLA 2PSNA 3S1VA 1OBAA 2AMGA 4JCMA 4LUSA 3T8LA 4BEQA 5D02A 1X7IA 4MZYA 1RJPA 1VZWA 2JBMA 1DWAM 4H04A 4XZWA 3KWSA 3OVRA 2V5LA 2O9PA 4GX9A 4JIPA 5AVNA 1T40A 4ZENA 5AFDA 3MVTA 1IXNA 4GXMA 2PDQA 4LAOA 3BV7A 4JQ2A 2CLLA 1Q6QA 3NQBA 2WCSA 2BB0A 3T81A 4PMZA 4XZLX 2QJHA 4B92A 1PX4A 2BVYA 2CWNA 2YBVA 1IZCA 3WMLA 1XFCA 3HG4A 2YB4A 3EZ4A 2GGEA 4GUFA 2VVSA 1LQ0A 3W07A 4L6DA 3VOCA 3FW6A 2F2HA 3KBJA 5BOEA 3H7RA 4Q22A 3PZIA 1ONRA 3BGJA 1IZKA 3A4AA 1JG9A 3VOHA 4H6QA 2WMJA 2G3JA 3N2MA 1CDGA 2PTWA 2A21A 1M04A 3PBGA 2XIOA 5D37A 4A3YA 2W67A 1ITCA 1TUFA 4C6CA 3VIIA 1CXFA 1UJQA 3W1UA 1Q8JA 3T08A 2RDWA 1E9LA 3SCUA 3UZXA 2XDFA 1ZAHA 2PAJA 4MKSA 3AHTA 3CGTA 5BRBA 1E0WA 4MDPA 4AQLA 3FKRA 4JX5A 2D73A 4JN7A 1SZFA 2PEVA 4B3KA 2Z28A 4UR7A 5I02A 1EPXA 2OPJA 1C92A 2QS8A 3L65A 3GHSA 4RV3A 2E0PA 4C6DA 3K30A 4XSMA 4DUXA 4LTSA 3TC3A 2NUYA 4EPKA 3IAPA 1XPGA 1AD1A 1MO0A 4UFJA 4XO6A 4TVDA 4WY0F 1ZQ5A 4R9OA 4MNLA 3A24A 4D6HA 2AL1A 4NZ1A 1OFOA 4ML9A 4PBFA 3AXXA 3ARRA 4V1YA 2ZXQA 3KOWA 1Q5MA 3GNXA 2GSEA 3P74A 2XG9A 1T41A 4QLLA 3RO8A 2NXIA 4H9VA 3PWAA 3AHYA 4C6OA 4ZE5A 1S5VA 1R2SA 3GNDA 3OEXA 4UUIA 3PZVA 3WK2A 1LOSA 2PDFA 3MMTA 1LTDA 1WOAA 2V3EA 2J78A 4KCUA 2ACRA 4KESA 1A3WA 4QNEA 4DO5A 1KGWA 3KRUA 5FF3A 4IZGA 3RX3A 1G7UA 3W7QA 2TRSA 1NP0A 3DFTA 4J2MA 3C2RA 3S5OA 1XBZA 5T26A 5C9WA 3EGJA 4TXEA 1LBLA 4O0QA 1NARA 4K6AA 1GOMA 1OK4A 2YYUA 4HA3A 4HMCA 1ZENA 2V2HA 3SCNA 3BAIA 2D2JA 4Z17A 3URBA 3FS2A 2NV2A 1JUEA 3AZSA 3PTDA 5I03A 1R7OA 4DBUA 4E2DA 3UETA 2WSPA 4MY1A 4A8LA 3ME3A 3APTA 3CAVA 1YX1A 4EPEC 3H2OA 1QTWA 1L6WA 1YE6A 3P8JA 1IIGA 3GXIA 3VFLA 2GLKA 3RAOA 3LENA 1JCTA 4O53A 1JYNA 2OZ8A 2XIMA 2J88A 3WJYA 3QOMA 7A3HA 2YCEA 2W0UA 4O1AA 4W7VA 5C7HA 3U6WA 4E4FA 1TA3A 3LXAA 3FAXA 3EEGA 4QLKA 3QKZA 4JQAA 3ABSA 3DIPA 3GM8A 3E0IA 1KWGA 2DZVA 3QV6A 3KLKA 2V67A 3PUOA 2XFYA 4RPPA 2OLSA 3TXZA 4LRTA 3E9AA 1C29A 4JIEA 3LBCA 1TR9A 1WAWA 1Q65A 2ZYFA 4B3LA 4QAIA 1F74A 1W17A 4IUOA 2V2CA 2XIQA 3VU2A 1SFTA 3LCFA 1EJ7L 4D72A 1OC5A 2PWFA 4O54A 2XYLA 4XQ6A 2V63A 1OEPA 1G0CA 4Q8TA 1TVLA 3OIHA 2WVVB 4W87A 3UG5A 2DVUA 1VIZA 4CU6A 1FWNA 1IXPA 3D3AA 4GIRA 4MNMA 1CYGA 4OBRA 1J5TA 1DJXA 4B5WA 1GQJA 3DX5A 3T40A 4IMCA 1CX9A 3P62A 1TV7A 2WC3A 1ZJAA 3WH7A 3CYJA 4Q32A 4NJHA 1BG4A 3BOXA 1GHRA 4JXCA 1UZ4A 1EX5A 3VIKA 1UIPA 2CLPA 1HKKA 2X8RA 3WKZA 3MA8A 3WLMA 3BSGA 3NR0A 4QCEA 3CHDA 1J0IA 2QUUA 4GQQA 4WIWA 4GH3A 8RUCA 3BSMA 3B8SA 3IK4A 4BHYA 3KRBA 4YS1A 3IGSA 5C6MA 3WQPA 3HG5A 3NEVA 3PJWA 1PL9A 6PTDA 1JZ3A 3OB8A 3CHVA 4ZFCA 3K8MA 2WSRA 2PGFA 4HA1A 3CZLA 5DY2A 3DOPA 3MSGA 5EFDA 4EAYA 3THQA 2CXGA 1CB7B 1QHZA 3S42A 2X16A 2EPNA 4KWWA 4NRRA 1RBAA 2RJHA 4AZGA 1TQXA 4Y90A 1GOIA 1E73M 1PB0A 3W7JA 4IGNA 2WJDA 1UPMB 2WBGA 2HXUA 1JCMP 3BOLA 1PZ0A 3CWHA 1QFEA 2J74A 1H7OA 1A49A 4HU4A 2GZXA 1S5TA 2TAAA 3BK0A 4GQGA 1E9IA 3C2YA 3HGRA 1NF7A 4JTIA 5HPCA 2B7QA 5C0QA 1B3OA 4AIOA 2QGYA 3MV01 4ZQCA 1F3WA 4FOJA 4MAVA 5I3FA 3GTNA 3NL5A 2BVTA 5A6TC 4A8IA 2ALDA 2CFFA 2C15A 2OQLA 4GJ1A 1WXZA 4DJEA 3U7VA 1QI2A 2E4TA 3ARQA 1UKQA 2WAGA 1EHNA 4DWSB 2FDMA 2A3HA 4WX2A 2XGBA 4NT0A 1IF2A 1V0LA 3GR4A 1HGWA 1W5OA 3FA5A 1J93A 2BMBA 1B0IA 3AYSA 4D2JA 2Y8KA 4DUVA 3HGOA 1E6RA 4YVXA 1B4KA 4X61A 3LCIA 3N9RA 4CU8A 1W37A 3H4XA 5KZDA 3VK5A 2TMDA 1BXBA 3H6OA 3HPZA 3CIXA 1M7OA 4I7VA 5M17A 4UOJA 2BHZA 1ELSA 4UMBA 1UWUA 3LK6A 1PTDA 4HMDA 1VYRA 4REQB 2VGGA 1UD3A 2XWDA 2HQAA 2PGRA 1F2JA 1K8YA 5DFAA 1E0XA 2WLYA 4KFPA 2YA0A 2ONEA 4DO6A 1F73A 2WVVA 2HV5A 1IEVA 1EJRC 2VT0A 2C0AA 4W89A 1W54A 5FD0A 3GDBA 1R2RA 1WAUA 4JTRA 3NGFA 4EACA 1BSIA 3GE7A 4J3VA 2Y0FA 1QI3A 3PY2A 1CTNA 3V0UA 3DBNA 1W3HA 2VYOA 1HIZA 4TV6A 3FHQA 1IGWA 4PMYA 1AVAA 2OOGA 1I75A 4IIDA 4YN5A 3H7UA 2CKRA 1W1ZA 3FAWA 2R1PA 4HPGA 5EKYA 1Y7VA 5EY5A 4B2DA 1C3FA 4W86A 1X6LA 5BOFA 2CHRA 3TTSA 1FY6A 5FESA 4G9PA 4AD1A 4P8XA 3VE9A 2GJXB 5GJPA 2DVTA 1NWUA 4FLRA 3V1PA 4O4WA 2WZHA 4PSPA 1RD6A 1Z6KA 3QGAC 5A6SA 3O1NA 3TW7A 1NDYA 3SR7A 1PDZA 1L6GA 2QR6A 1JD7A 1H3GA 2ZRUA 2XH2A 3HPFA 1Z89A 1W1YA 2XN1A 3V18A 3C61A 4JTLA 1G4TA 5TD4A 1TWIA 1VB9A 4B91A 3TJXA 4D6FA 4YTSA 4S3KA 1SPQA 1U5JA 1RQHA 3TOPA 1X1ZA 3WLIA 2OTDA 4RPQA 4R53A 4U31A 3VUSA 5H6HA 3BUVA 1XCFA 4IG2B 1J0JA 3IGXA 1ICQA 1XH1A 1F8MA 3IUHA 4DAFA 3LD5A 3S2LA 4GABA 2UY5A 1O5RA 1CGYA 3CM4A 1MDLA 4DY1A 3LZ5A 1OQFA 1QRQA 4H7CA 4NNBA 4H1ZA 2CIPA 3P8IA 4UFMA 4KFOA 4DJFC 2OYLA 1OC6A 3SUWA 1RY8A 2DY3A 3RLHA 4EX4A 2QVNA 4QQ3A 1POKA 4JQ1A 4NYUA 1M53A 3CV6A 2QCMA 2QULA 2WV8A 4BF5A 1NH6A 2BBFA 4UMAA 1VR6A 1V3JA 4FNTA 1FHLA 1LOQA 4GQBA 1DJHA 1JDDA 4PRRA 1LDCA 5I3IA 4KH2A 4JYEA 1WB0A 2V3GA 4NY2A 3L4VA 1JJKA 1GQIA 1TPDA 3E96A 2RUSA 3A47A 5IFPA 4UNKA 1N8WA 4CCCA 4C6PA 4FMVA 3HGSA 3W23A 3MJYA 2P8BA 2PLJA 1TPWA 1TV8A 4KEVA 1S2WA 2EKGA 3CMFA 3BICA 1JPKA 3CHCA 2XTKA 4O8RA 1WDWA 5DX7A 4JTQA 4YMZA 2INZA 2VGFA 2WHKA 1E4MM 4OU1A 2PWUA 3WD1A 6REQB 1TMQA 4GYPA 3H53A 3IPWA 4F2TA 1CXKA 5F4XA 2PF0A 4REQA 1EP1A 2GVYA 5ECUA 3WQWA 3EB4A 4C6MA 2ZICA 2INEA 5BMWA 4WRHA 5LNUA 3TFCA 2D69A 4QHRA 2VUNA 5A6JA 1G94A 4LUTA 2NX1A 1ZBKA 3S5YA 3RUBL 3VD9A 4KCVA 1UD6A 4YCPA 4WUIA 4FNQA 3ZWTA 2VX7A 3JVAA 4TOQA 3IARA 3UWWA 1YTEA 3VNIA 3OQEA 2PLCA 3EOEA 1MEWA 3AU2A 3W3OA 1HJWA 2A7NA 2FH6A 3OVPA 4GI8A 3AICA 4V2XA 3L68A 1DQUA 5D9OA 3PJTA 4AEEA 2GL5A 4LAKA 1OC7A 2CCRA 5JH2A 3R5EA 1O1ZA 2A3LA 1R46A 2IXVA 1QK2A 5F1VA 5FA5A 2FFCA 3APYA 3F5LA 3GUGA 4BKNA 3VGFA 4Z2IA 4HBKA 5AC4A 3DBPA 1GWJA 1L8NA 2OSYA 1OF8A 4Q6JA 2F6UA 5SWUA 2VX6A 2Z25A 1XYAA 2CLHA 4GUJA 2QUTA 1CXIA 2C7FA 2IKHA 3RPMA 4Y8EA 4U2ZA 1OJXA 2XJ7A 3RM4A 1XRSA 2E6YA 2R1NA 3TU9A 3ARTA 3ANYA 4LYKA 4JL2A 3I4EA 1KBLA 5G1YA 1OIFA 2D3NA 4P2VA 1LLZA 2EJAA 2WHLA 3H12A 1SFSA 2XH4A 1GOWA 5TF0A 4EPDC 2DT3A 1K4HA 7REQA 3TYDA 3W71A 5BXRA 1GVYA 3CO8A 1UB3A 1XYZA 3KS6A 4U2YA 4IG2A 1IE7C 1DWJM 4W8BA 2CU0A 3QSRA 4HHLA 3P93A 4P8WA 4YHEA 1WX0A 1XD0A 5LXEA 2I1OA 4GXPA 4DO7A 1LRQA 1OX5A 3S1XA 1BQCA 2B4GA 3UWUA 2G8ZA 4X3ZA 1EXPA 1G1YA 4V1XA 3TA6A 4GBUA 4AWEA 1B90A 1ME9A 3N3MA 1OG0A 2BHYA 2YBTA 1Q6DA 4LXFA 4GY1A 5K9XA 3ZVHA 2BNJA 9CGTA 3OTRA 1UW9A 1MFVA 4KWUA 4TUFA 1UA3A 4JN6A 4FLQA 4BS0A 1O7AA 4PTNA 3GBEA 3FX4A 3TN6A 3UFYA 2X0HA 4CEUC 4QITA 4TVCA 3WNPA 1R9ZA 3ARUA 4IMAA 4OUEA 2WSYA 4GBDA 1A0EA 3GFXA 4H6RA 1JZ7A 3POCA 3B0YA 2EPKX 3NL2A 4M24A 2BVDA 3TOYA 2J24A 1CXEA 1VFFA 3G24A 3TKFA 3QZEA 2FB2A 2F6XA 3VIPA 5CBJA 4P7QA 1ZRQA 1R0MA 1H0GA 2OELA 3WLLA 3R0UA 4ZB5A 1OX6A 1LQ2A 3GHTA 4KEZA 2X41A 1KM1A 4AZ6A 1XGDA 1SO3A 3JRKA 2AGKA 3NJ3A 4AYSA 4W4QA 1J11A 1XL9A 2QMKA 1WPCA 1NP2A 1ZJBA 1RPKA 2I9EA 2NX9A 1J2WA 4A35A 4IQDA 2I5GA 4MM1A 2A3EA 3RRXA 3VKDA 4M0XA 3NEHA 1B54A 5HULA 4AIUA 3OOQA 1JL8A 3T9PA 2J4GA 1TYGA 2ON3A 3WCZA 4I6KA 2Q3RA 3OIXA 4K2SA 4PB5A 3LCHA 2ZX6A 4PUDA 4QEEA 5J5DA 1TJ1A 1S2UA 1S39A 4HOWA 3DFPA 2BGNE 1SFJA 1XDJA 5EMUA 4MYXA 1FP9A 2FZMA 1KFCA 2FVKA 3F2DA 4DLFA 4UXDA 3P67A 4M1RA 5FEPA 5CCZA 2G97A 1QHPA 1ZS2A 4JHMA 1YNPA 1LRNA 4PMQA 5D04C 2OJPA 3KE0A 3UG4A 3NNTA 4NHVA 3B0VC 3IIPA 3N25A 1I6NA 1J0HA 1FRBA 1H0IA 3ZLHA 4AWTA 1BKHA 2VZUA 2D2HA 1E6PA 1OABA 4GD0A 1RCOB 1HT6A 2CLFA 5JQ9A 2Y8VA 3OW1A 3FVDA 5AYIA 5HNNA 4WJEA 4EIVA 1TTJA 1T8XA 2OB3A 3W24A 5D8ZA 4ERIA 3B9OA 2FZ8A 1V6TA 4IXXA 2WPBA 1BHGA 3R58A 1H5VA 2VFIA 2QKFA 3UJFA 3BLDA 3RGTA 3WG6A 3QY7A 3SCOA 5J8LA 4KF1A 1QATA 1OD8A 2Q71A 2W79A 3DKJA 4YNGA 1G5AA 2XM1A 2YCLB 2GOKA 2AL2B 3SW6A 3MU7A 1C7TA 4O18A 1QNRA 3V5FA 4ZXLA 3GK0A 1W1PA 1OFDA 2PPGA 3L4XA 1QMLA 1OIMA 1X1NA 1XRVA 3LPOA 1VP5A 4L4LA 4B4HA 5HAOA 1Z69A 2GPTA 3E1F1 1UYQA 2C79A 3SN1A 2QPSA 2EPLX 2QQ6A 1PKMA 3VFCA 3TYBA 2NQ9A 4TU1A 1ZUAX 2W9MA 4CD4A 3SFWA 4ZOEA 1U5HA 5A6BD 1LUCA 1CGUA 3RX2A 1FXPA 2CPUA 4JY8A 2OSWA 2ISVA 1U30A 1UROA 1LYXA 3VD3A 1RP8A 4M7TA 3SCPA 1ZZMA 9XIMA 3WF2A 4I90A 4HPJA 3C56A 3EBVA 1FHDA 3VDAA 1PZ3A 4Q4SA 4I9JA 4BY3A 1PIFA 2YL9A 4UIOA 1V79A 1F3XA 4B90A 1W3IA 4O28A 3ZQ9A 4GUGA 5ECVA 3A4WA 3TX9A 4XWUA 2ZIDA 3AXMA 2F6KA 3K2GA 4A8NA 3BTNA 1V77A 3SFKA 1GG1A 4H83A 3MQTA 4DI9A 1M01A 3DG3A 4J4KA 2OWCA 3M5VA 2FGBA 4N02A 6ALDA 1RAKA 4JTUA 1WV2A 3EYPA 3CUIA 3G6LA 1I2RA 3TMQA 5K2ZA 4IFOA 5JIPA 1YTKA 1X39A 4WJ8A 2CHNA 1GVSA 4FXSA 1FP8A 4QFUA 5LA2A 1SU5A 2Q8XA 4QP0A 2QAPA 5U4NA 1TCDA 2WC4A 4L80A 4XD3A 3TN3A 4NJIA 5LGZA 4GK8A 3LS9A 4C90A 3KX6A 2J7DA 2X40A 3ABOA 4WKHA 4GJJA 4PGLA 4BWLC 2X7WA 3RCYA 3TK7A 3WDHA 1FH7A 1AZ1A 1FCQA 1MI3A 3UJEA 3MMDA 3M0XA 1XH0A 2A4AA 3SM0A 1PTAA 3RLGA 2EG6A 1G69A 1XLCA 5HMFA 4IJCA 5FJUA 1K9FA 1SM9A 4N9CA 2VC9A 3JUGA 3PSWA 1G4SA 4Q4KA 3ORWA 1W3LA 1FWBC 3LGGA 3TJLA 3RFAA 3EOSA 2ACSA 1TO3A 4OFCA 5D32A 2AQVA 4LW7A 3LM3A 4MGGA 5CSYA 4DPPA 4Y96A 3U5UA 2ZC1A 5KZ6A 3BG9A 3FYYA 1QASA 4LAUA 3T2QA 4HK6A 2EAWA 2E9LA 1P7TA 3DG6A 4GKLA 3R13A 1M1BA 4AX6A 1J6PA 2ACQA 5BROA 1KFEA 3A3HA 3AZTA 3WF1A 5EMYA 4PUKA 4K1WA 5DBUA 3PANA 2FHBA 1Q63A 2W4XA 3ITGA 2UBPC 3Q4DA 5I0DA 2W63A 4M6VA 4UZUA 2GVEA 4C60A 3UQNA 1EYEA 4HN4A 4IL0A 4GY0A 3TEVA 4OIFA 4QG8A 2OQHA 4XD4A 4KGJA 4IFKB 1DP0A 1OADA 5A3HA 1OYAA 2VCAA 2V3DA 5TQLA 1FTXA 1VCVA 1U22A 4FEZA 1A3HA 4ZOCA 3GU9A 2AKZA 2PWDA 2XGZA 1KXHA 3DHDA 3E5BA 3C2OA 1KCXA 1HJXA 5HMSA 1TTQA 1KBJA 1PZ2A 3QGKC 4DJDC 1EJWC 3A6OA 3EDEA 2G50A 7ENLA 2Y7FA 1Q2SA 1KRCC 3PK7A 1VHCA 1BVWA 4M80A 3WQDA 4NXSA 2P0IA 3W6YA 4GIAA 2EF9A 3GS6A 1PHWA 3R4IA 4AUBA 1AUSL 4AMAA 3E5PA 3PPCA 3OVGA 1FWEC 3MKCA 3UP8A 4MB1A 6TAAA 1MNSA 2Q8ZA 1I0BA 1V7YA 3M0MA 5D9MA 2W27A 4O0ZA 4XAGA 4H9XA 5D2TA 3LHYA 4J35A 4DF0A 3CHFA 1P4CA 1WQ5A 4OV4A 4CLMA 2VC7A 3VZXA 3GTXA 5IFTA 3RCNA 1VD6A 4UCFA 4S23A 3SQMA 1H1YA 5T8GA 1A4MA 1I1XA 4UOZA 2J7BA 1E1EA 4Y2WA 3NURA 4QDPA 4D71A 1IEXA 2FHCA 1JZ8A 1TPC1 3GH4A 1ALDA 3WDRA 3LV6A 3LUTA 1V3HA 4GYFA 3MTWA 3ECQA 3NOYA 1XR2A 2F9RA 1XV8A 3G0XA 1NDWA 1OY0A 3DC0A 3S4TA 4NZCA 3MBDA 4D6CA 3VOIA 3AI0A 4J40A 4C6QA 3A3XA 3DHPA 3HV9A 3MUZ1 3PUDA 1W0MA 3OA5A 5IM51 4ROPA 1S5MA 2G0WA 3A9IA 1V8EA 3BE7A 5E93A 3F4CA 1DYSA 1VBGA 1H62A 2Z6IA 1FA2A 1XKYA 4C6BA 3MANA 3PBYA 5JH1A 1YRRA 1EQCA 3N6HA 2PODA 4WKAA 4XUGA 1XQKA 4RDWA 4LY8A 4MHBA 2XVPA 4JBRA 1TKKA 1LZOA 2P5NA 5HUPA 3S9ZA 3N6QA 2WANA 1DXEA 1VYPX 1QWKA 2V5BA 3SCRA 2I17A 4QQUA 4M3PA 1WDDA 4IPNB 4QE4A 3LMYA 2TPSA 4AX7A 1V6UA 4LB4A 2QCFA 3WENA 1OFPA 5EBAA 2IPGA 3BJSA 4LU0A 4DB7A 3AIRA 2J79A 1Q4NX 3PZQA 4I7UA 1REQA 4UFIA 5C2XA 3LG3A 5A2AA 2QW5A 2H3BA 5FJIA 4IFKA 2NQJA 2BS9A 4GVHA 1KBIA 3G1VA 3W1RA 2HNEA 1XG3A 3IJIA 1US3A 5DMYA 4V27A 4K1GA 5D05A 1FXQA 1IXQA 1HUVA 3EDKA 3GU1A 4Z2HA 2XIJA 1A5CA 3BAKA 3SY8A 3BQ5A 4OGZA 1E4NA 2ZXDA 1E6XM 1F7BA 2J9XA 3N18A 2NLYA 2ZVIA 1S3HA 3T78A 4FNSA 4MFDA 1UMLA 7PTDA 2NVDA 2YR1A 5HMEA 3GTFA 1M9HA 1ITUA 2YL6A 1OCQA 2XFFA 4QM1A 3VOJA 1J10A 2VD9A 4JZ5A 5C9XA 4C7GA 5GPRA 4XD5A 1BYDA 5ABGA 1S38A 3BPWA 4BI6A 2PDBA 5C2CA 5LSMA 3SURA 2NQZA 3NWRA 2DSZA 3N13A 3ZWSA 6XIAA 1AH3A 3DFNA 2J27A 1CNVA 3IUDA 1GKQA 4IQEA 1H09A 3FHAA 3NQCA 3THCA 1HF6A 2XVLA 4QROA 3W72A 3NO1A 3Q58A 1IQ8A 3M16A 2PDCA 2VQUA 3O16A 4HZMA 2VENA 1W9DM 4CVWA 1OFRA 3KRZA 4GNJA 4HVXA 1UD5A 5FJPA 1P43A 1HJSA 3D6NA 3WDJA 2NVAA 4AFYA 3ZLFA 4IP7A 5CZ0A 2J8TA 1UZHA 4UCGA 1EX1A 1VQTA 4ZEPA 4QG9A 3NQGA 1EOKA 3N73A 3G1FA 2JGYA 2B0MA 3LCLA 1Z41A 2IMRA 1EIXA 2WSQA 5I07A 1VJZA 3W7LA 4MJ4A 3EB2A 1QI5A 5E0CA 4WGHA 4S3CA 3EDDA 3EWCA 3GVGA 5KZEA 1OGSA 2OO0A 1EF3A 3GG1A 3H22A 3O0KA 3BMWA 2JKPA 1EEXA 1UD8A 4WXZA 3VIHA 5EA9A 1H49A 1V3KA 3R8RA 5F7UA 4RZ4A 3K1GA 3C0LA 3XIMA 1C8QA 4C5ZA 1Q4WA 3O6CA 4N4PA 4PTMA 2PP1A 3EX3A 1GVRA 3UZWA 1G01A 1E0TA 3VZZA 3UJSA 4AXNA 2I14A 3LMZA 3A64A 1PZ1A 4DLMA 2CW6A 3R0DA 4AD0A 4RX0A 4TX6A 3LNMA 4PCNA 4HHHA 3GFYA 4MYAA 1DIOA 4S2CA 5FAJA 1XSKA 4M8UA 4AZIA 2XWEA 4QJ1A 1WP6A 4NAFB 3MDWA 1AL8A 3TYZA 3CQ0A 4YU1A 3WSUA 2DZAA 5C9UA 4XAPA 3HQ1A 3EOUA 4S3EA 1XYLA 5LKYA 4H4IA 2BV9A 3K4AA 1RPXA 1S1RA 2FHFA 2VI0A 1T7LA 3IK2A 3ITVA 1MVYA 3BZGA 3GNOA 5G4EA 3ELFA 3V75A 4RNFA 1GTHA 2PDGA 5C55A 4EANA 1GPFA 1A47A 3TYAA 1XBXA 5HQMA 2A2IA 4TMBA 4XIAA 3QC0A 1EZWA 2ZX7A 3REQA 4JAWA 2ZE3A 1HJUA 2VDHA 1H1NA 4DNHA 1TFVA 2D0HA 2FH8A 1GONA 1F3TA 1GK8A 3CMJA 1X8CA 3EA3A 2FZNA 4UNLA 1RY0A 3URAA 3TFXA 4E4UA 2VFFA 1KTNA 2PTXA 2ZC8A 3MCNA 4K36A 5DMMA 1OCNA 1S5NA 1BLIA 1VKFA 4B5TA 4ACZA 2ABAA 3DG7A 3WQ5A 1ZAJA 3GDKA 4AD4A 4LVDA 2EPHA 3R8GA 3GXPA 3LM7A 4RKAA 2J7HA 4RUBA 1VBHA 4GIYA 1HTIA 2VFEA 1AQMA 3B9EA 3MO7A 1WBJA 1TPVA 1FCBA 4LF1A 1P0BA 1A80A 4R7JA 1FWRA 3ZM8A 4UMCA 3TSDA 4M7SA 3URQA 1H7RA 2HE8A 4J9JA 3M0VA 4PUWA 4FOUA 1EGZA 2V9DA 3TYEA 5MKGB 4L9XA 1FBAA 3WDQA 3O2LA 4DIAA 3W82A 4TIMA 3W7IA 4AHQA 1JULA 3WQ4A 3ATYA 3RO6A 5A6BA 3TR2A 2QVHA 1E6QM 3SIMA 2DFAA 4B4FA 5DCBA 1SUXA 1KFLA 4HPXA 4L4PA 1VEPA 4IIFA 3UERA 2PFHA 2WBKA 3CAKA 3R12A 4J1OA 4KQNA 1LG1A 1ICPA 1H60A 1JF6A 1WUEA 1CGWA 4RK8A 3IGHX 3NFUA 3IJ7A 4GUIA 4LEQA 3UD6A 1E43A 3S46A 3NOEA 3HMJG 1ML1A 1GZJA 1SR0A 4HZ7A 1MZHA 2ZRVA 3W76A 1FWIC 1R3QA 2DDXA 4HQVA 4MPQA 3UYCA 3OGRA 3IJ8A 3ANVA 5H91A 3KBWA 4LEFA 1HKJA 2DP3A 4RE4A 1QI0A 3PS7A 3F4DA 1ZY9A 3W01A 2Y24A 2Z1VA 1BYBA 3L2LA 4A4AA 1TZZA 3E3HA 3PZNA 1BXCA 2VL4A 8TIMA 3L0NA 4JX4A 1E5JA 3PG9A 3CIWA 3PBVA 4DM1A 3QLDA 3KDOA 3UG3A 1NM9A 3MW7A 5D4YA 1XLAA 4RCXA 1ZBWA 3DYOA 3O63A 3KFTA 4M56A 2QF7A 4PCFA 1C8VA 3CLWA 4NAFA 5CQ1A 4F4RA 3AWNA 3TP4A 8XIMA 6A3HA 2JKEA 4M6QA 1UC4A 1DXFA 2A7RA 2B7OA 1VFHA 4XUYA 2QIIA 4TR9A 3L2IA 3FOKA 2XZ7A 3KDNA 2BY3A 5CSUA 2DUZA 1J4EA 2C91A 1A53A 3T0CA 2E28A 1KLYA 2IXUA 5HWJA 4KEMA 1YPFA 2MANA 1JGMA 1KV8A 1MRAA 1TUXA 3P7YA 4N42A 4ZO7A 1AG1O 1VFMA 4C6IA 3BAWA 4IXHA 3VOGA 3THAA 4WXYA 4DJFD 3FLUA 4CCEA 2DZWA 1YADA 1KXQA 1QDSA 5FEZA 3VMNA 3LGEA 1UR8A 4JTKA 1I1WA 4DELA 1BEUA 3VPLA 1TE1A 5A8NA 4DUWA 1AQ0A 4I9AA 2C1GA 1PKYA 1I60A 3STGA 3TVAA 3VNZA 5HXMA 1XGZA 1WE5A 3LRMA 3H26A 4EF9A 3GXMA 2XH7A 1LWHA 5IBXA 3TYCA 4ICMA 2XIIA 3C86A 3EDJA 3WUBA 4MIMA 4X22A 4CU7A 1XDLA 2JIEA 1NVMA 2XSXA 3TAOA 3W1XA 1W9UA 2BDQA 1J01A 1EKOA 2BOFX 4XSLA 4YYFA 4QE1A 1RBLA 5AYBA 3PAOA 1JCNA 4LV4A 1Q66A 2E67A 2JK2A 1VHNA 1EJVC 3G1RA 2PE4A 1Q13A 4U5KA 5E1QA 4Q8MA 5D9PA 2GGHA 2HMCA 1RV8A 5GJNA 1TG7A 4CD5A 2QV4A 2JFEX 5MKGA 3FJNA 2OT0A 4RDZA 1NJJA 1GQNA 2VM8A 4YIWA 4MLJA 1JZ2A 2W6RA 1OK6A 4ZOAA 1XKJA 4U4MA 2CLMA 1VFOA 1YMYA 1DEDA 4JTTA 1AH0A 1Z48A 4KW2A 4MUZA 1W3JA 2NX3A 3QM3A 1NFGA 4UTWC 2XVKA 4R88A 3NG3A 1AMYA 3CIVA 4AAJA 4O14A 1SZRA 4DJEC 3UXIA 4LPCA 2YYTA 4NX5A 1FH9A 2PGWA 3KL5A 3L4ZA 4JD4A 3PZUA 4JFVA 3BAXA 4E4PA 4AC7C 4GC4A 2C0HA 3VINA 1DIKA 3UCQA 1UP3A 5C71A 4DN1A 1WZAA 4YTUA 4LANA 1M5WA 2PCEA 4PH6A 3I6RA 3WH6A 5DANA 2ZTKA 4ROQA 2PMQA 1XXXA 5CBBA 2GWGA 5M03A 5T9BG 5CKSA 1UKOA 4NZ3A 2ZZ3A 1AD4A 1F6PA 4GINA 3WQGA 3FXYA 3VVGA 2QCHA 3WK1A 4YTTA 4RLIA 4WVXA 3W00A 1C8XA 4JTFA 2QMJA 1FCUA 1VEOA 4O0KA 6XIMA 3MSYA 1PJ9A 5XIAA 5JVLA 3WH8A 4UQEA 1GOOA 1YDYA 2PBOA 4QR6A 4UQ9A 5A8OA 4JHOA 2JF6A 5D9NA 3EXTA 3C0JA 1MDRA 1ADDA 1G6CA 3KCJA 3CYVA 3OJGA 2E6FA 3E0WA 3G5EA 1QT1A 2JF7A 1BFNA 2PDLA 1WKDA 4US5D 1SMDA 4LWWA 3UJ2A 1Q6LA 2NLIA 5HOSA 2BG5A 5K3VA 4NJGA 5AKQA 4O50A 3MZNA 3AZRA 4JIHA 4OOZA 2MUCA 1QW9A 2QCLA 3UCDA 1SYTA 5ENLA 3MT1A 5CG0A 3FXGA 3N2BA 1KCKA 1XLBA 4D6EA 2F8QA 1X98A 3SRKA 3WEOA 5BWFA 1RP9A 3NL6A 2PC8A 1R86A 4GWEA 5DRCA 5I23A 1PS9A 4ERAA 4AF0A 2QAFA 2DGAA 3T2OA 3I3EA 1UR1A 3WQEA 1X96A 2VVNA 4BK9A 3LZ3A 2G3MA 2ZZ2A 3W22A 1Q85A 5KITA 5CPTA 4UC5A 2PBGA 4E8CA 1LF1A 3S2JA 2AOSA 3CNYA 3KZSA 3KUMA 1FDJA 3W85A 1OWQA 2DSWA 3U2OA 1NWTA 3LTSA 3WLNA 1XD1A 4JFUA 2AAMA 2ZX8A 2C1HA 3M46A 3OGSA 1ADOA 3TUUA 3AS2A 1CW2A 2CLEA 3RM9A 1WZKA 3W28A 5BYWA 4HPHA 2CLOA 4U28A 5CJNA 2PDXA 3IRDA 4P5UA 3H2CA 4NF7A 3FJLA 4AWUA 1NEYA 2D1ZA 3K5XA 3CZKA 3NYDA 1OYBA 3WBXA 1F5ZA 4XVEA 3F03K 1I2QA 4MZ1A 5EL1A 3B8TA 1ZBVA 1FUYA 3V0SA 3TC7A 3OA3A 2F84A 2PB1A 3AMGA 3GNRA 1WDPA 4GX8A 4IT1A 2V0TA 3OVQA 1VLWA 4PL2A 2UV8G 4D1JA 1DJGA 3OODA 2F38A 4MF4A 3BG5A 3DH7A 4WJXA 1GVIA 3USZA 1K9DA 1ECEA 2Z7GA 1IEIA 4DWSC 1UASA 1RA0A 3RU8X 3AU6A 1KM3A 3M0YA 3PVFA 1Q7ZA 5AZ0A 2GGIA 4IGSA 1WKEA 1IWBA 4UQDA 3UY7A 1RD5A 3C8NA 1TPUA 4MY8A 1YXYA 1KQZA 3MMUA 1PYFA 1ZCOA 1GYMA 4PFHA 1DHPA 1VRDA 1ZP3A 3CWNA 1GCYA 1LWJA 2PDKA 5E5CA 4D8ZA 2ZUMA 1EWEA 3NQDA 5HR6A 5HQLA 4K37A 5LIYX 1DWGM 3BZJA 1RCXB 4GYPC 2OQYA 1TWSA 1Z32X 1KO0A 4MB4A 2J9YA 1XLKA 2FVLA 4JTAA 4DPQA 3AIVA 3DKLA 4CQBA 1R8LA 2H9AB 1FWSA 5AOUA 3TA9A 4N9DA 4KETA 2NVCA 3QPZA 4AZ7A 5BRQA 3I65A 4N6EA 4LJ3A 4E2OA 2BX7A 1KW1A 1XLMA 1CWYA 1H5YA 4NJKA 3QBUA 2E25A 3KL0A 4Q4MA 5D38A 2WQDA 1XM3A 2CC0A 3T4CA 1MMFA 2LLEA 1M68A 3NQ8A 4GNVA 4ZXOA 1J6OA 2A7PA 3RXZA 1WA3A 2VKZG 3NZGA 3NQ2A 1PYMA 3EPMA 1TWDA 4AZCB 2D0GA 5E9XA 1N7KA 2VRQA 1NAL1 3EWUA 2E6DA 4E3TA 3P2VA 1W9PA 1KM4A 2D23A 3VM5A 5FF7A 1VRXA 1F05A 4B5SA 3DXIA 3SCWA 5G2HA 2BZNA 1UQYA 1OT2A 1DE6A 2WVTA 3AIBA 3W84A 1BGGA 5IHSA 4NI3A 4W5UA 1P1XA 3LCGA 1VFLA 4NG3A 4ZSTA 1FDYA 2D20A 2V82A 3S0CA 1W8SA 1K03A 3H7VA 1EQPA 3DFSA 4GYJA 3GYCA 2C6QA 4CNTA 4JTHA 3VKBA 4F9DA 3LOTA 4AY7A 2ZRYA 4A2SA 3GRIA 3KCOA 5J5RA 3WJSA 1H50A 2YFNA 3GH5A 2PDNA 1UWSA 1PSCA 2EHHA 1KCLA 4E8DA 4KRUA 1NDZA 1B3WA 1KRMA 2Q01A 4PMXA 3L5MA 1MW3A 1QHOA 2YX0A 1R6WA 3LHWA 4PUEA 4R9XA 2HDJA 3U57A 2DW6A 4ADTA 3IWPA 2J13A 5FI8A 1ISWA 1J9YA 4XV0A 3CB3A 1C7SA 1WXYA 1NWRA 3L7RA 1BF2A 1BWLA 1WOBA 1XX1A 3LQGA 2WPGA 4NAEB 2PA6A 1BSLA 1GJUA 1MEIA 4XTIA 5HA7A 1Z3NA 4FHAA 1W5PA 1RZMA 5EPDA 4BI5A 3S9YA 4JS3A 3VO0A 2HVMA 4LVBA 5DELA 5DY3A 5REQA 3L66A 3ICJA 2OKTA 5DCDA 1L6SA 1TX0A 3O06A 2H6RA 4C6LA 1WUFA 4HP5A 1UD2A 1FH8A 2CYGA 3UWZA 3O15A 3LYEA 4B16A 1OB0A 3ZFHA 3VX1A 1M7XA 1X6UA 4HU0A 3TWBA 4WHBA 1XWYA 1KM2A 3SAZA 4U33A 5A6LA 2FZBA 1W5QA 3EX2A 2CHOA 4LUYA 4W9TA 1ISYA 3MI3A 3OYXA 1DVJA 4QTGA 3N4EA 5E9AA 3GY1A 1QW7A 1EGMA 3W87A 2WYSA 1QNVA 3SSJA 2ZZ5A 3LLFA 3WQVA 1DWHM 4ES4A 3T0DA 3U7BA 3GTIA 5D09A 2GGJA 2H9AA 3COTA 1J0KA 4LT9A 4D9PA 4H6KA 4ZFMA 4DEFA 4GFIA 4KRZA 4GC3A 3II1A 4Q8VA 2QJMA 1SGJA 1YBQA 5XINA 3EMQA 2TSYA 3W53A 2W61A 4DYJA 1S1PA 2XFWA 3EA1A 5DO8A 4O19A 5M2FX 1PIIA 3OHMB 2WZEA 1XUUA 5DLCA 3WL1A 3LV5A 1EDQA 1MWOA 3PBUA 1OZQA 1JDAA 2ZADA 1VBUA 2ZX9A 1QXLA 2X30A 3DZ1A 3P6LA 1YLVA 3VOFA 3MSRA 3ALGA 3GBDA 1QO5A 1IYXA 4R34A 1QNQA 4QX4A 3HB9A 3K8LA 3MCOA 3OBEA 1FWCC 4A05A 1MXDA 3O9NA 1G67A 1FQ0A 2NQHA 4AIBA 4C6NA 3SCSA 2W3ZA 4PULA 4ZE4A 1RJQA 1CECA 3BMXA 1H63A 4ICCX 2VDIA 4ERGA 2ZRXA 3L67A 3M0HA 2CERA 3HTWA 1V0KA 4LRSA 1OSEA 1VBRA 1QPRA 1O95A 4JDBA 3S6TA 4HTBA 2VWSA 1P6WA 1QPQA 3PTQA 3NO3A 2DT1A 2GDUA 1BTCA 1IWAA 4DJDD 4JDYA 5J04A 1I4NA 2I16A 1CGTA 3BO9A 1PAMA 1TVNA 2I57A 2Y62A 4NX0A 1KC7A 1SSDA 9XIAA 3LPGA 3R10A 4M82A 4HKPA 2NQLA 1PIGA 5ABFB 3R0KA 3H21A 5H2ZA 3NIYA 2XZ9A 3NDYA 3WNOA 5HQEA 4JIIX 1TA3B 1O5QA 3SADA 4A22A 5DT5A 1JI1A 2P3ZA 2QCCA 3UT0A 1NFPA 4UTIA 1XCXA 3C3NA 1OT1A 3WL0A 2QPUA 4X0VA 1B9ZA 2IKJA 1HJQA 4GISA 4GO8A 4YVPA 4D8LA 5HPOA 1DJWA 2J8GA 2RAGA 5EGRA 4DJFA 1R38A 3TC6A 2POZA 3QXBA 1TREA 1UC5A 3W25A 3PZTA 1H7WA 1UH2A 3JZUA 4JL1A 2HPMA 1S2TA 1FHUA 1JZ5A 1M7JA 4E0CA 4HNVA 4NAEA 5E6ZA 4C7DA 3DDMA 4O15A 1PE1A 1CENA 4ZQNA 3KLLA 4CGTA 2FQIA 4LC6A 1V93A 4O12A 1XSJA 4LNYA 4PTWA 3THDA 1JNEA 2PDHA 4LS1A 3VNYA 3EX1A 3QHOA 3AMLA 4AW7A 3BJTA 2IUZA 3KP0A 1FFQA 4AVNA 1ZJIA 2WNNA 4R33A 2OFJA 1IZJA 1AJ2A 2V5DA 5JBEA 5BOOA 2J7FA 1DQWA 1P0EA 1UA7A 1QW8A 1HO4A 1UH3A 3RN6A 3UWEA 3GC4A 1XDMA 4J5NA 1NWSA 3FK4A 4M29A 3U48A 3UU0A 3CZGA 2NWSA 1TPEA 1WNOA 2ZXBA 4A3UA 4RE2A 5FEWA 3UG8A 4AC1X 1G4PA 2I7GA 3L4TA 2QJJA 1R47A 4IL2A 3L21A 3C4UA 4UTTC 2ANUA 3NYZA 2NXHA 2R94A 4OOUA 3QTPA 2BTMA 1R3VA 2DJLA 4Z0JA 4MTVA 3M47A 3RF9A 2BWGA 2FZDA 2YA1A 5LIXX 3LHUA 3W7EA 4F0LA 3HQNA 4OTKA 3CO4A 3MKKA 1UIOA 3MP4A 4GG9A 2VOMA 2PRLA 4AWSA 1TV5A 4CN4A 5A8QA 3UZZA 2DVXA 3MUIA 3NDOA 2JEPA 3P5ZA 4NI8A 4IIBA 1C91A 2J75A 1TIWA 4ZOBA 4GVGA 2ZUTA 2G37A 2OG9A 4JQ3A 4HYWA 4JX6A 5CPOA 4MWAE 2UY2A 2A3CA 3ZT7A 4B15A 4PRTA 3UY8A 3BGGA 3WF0A 4GUHA 2VOTA 1EA0A 3APGA 1QI4A 2CBUA 3F4WA 4IQJA 1SZNA 2HE5A 2YIHA 1Q6RA 4ZB0A 4DHGA 1XIJA 3GSMA 4UOQA 5HUOA 1MW0A 2GJPA 2REQB 1UR4A 2GUUA 4S38A 3K4WA 2UY3A 4WZHA 1ODZA 2Y1HA 5ABFA 4M1BA 4QE5A 3F4NA 4WSKA 3M6DA 4US5A 1U1UA 1B31A 5EMMA 4G2DA 3S8HA 2EKCA 1TPH1 2ZZ6A 2Z2UA 5FJOA 5D30A 1VLIA 3PWIA 1GZGA 3BSHA 3CTLA 3MY9A 3CAQA 5EFFA 3B9NA 2P8CA 3DCPA 2J9ZA 1AJZA 2EBNA 3W7DA 5BMXA 5CPQA 4ZTXA 4IX2A 3KOFA 5KZMA 1SJDA 1L9WA 3WEMA 2R9RA 4Z1YA 4S1FA 4W93A 3FA3A 4G1KA 3QV7A 2VCBA 3QGVA 3M9YA 1WKFA 1XC6A 3A3WA 3RLUA 4CNSA 2TYSA 5AY7A 4UTJA 3BW4A 3MMWA 1E6SM 4QXIA 4JYDA 4GI9A 2FGZA 4Q7BA 3O8AA 3QZAA 4TX8A 3P80A 3G1YA 2C14A 1QOXA 4IMFA 3HURA 4EP8C 1T5AA 4FB7A 3STEA 1EGVA 3TXVA 4HK7A 4Q4PA 2A3BA 1T0OA 4UTMA 2RHGA 3UZ5A 4L6HA 4EXAA 2PD9A 1QNPA 1M7PA 5LZLA 3KAOA 3FEMA 1H51A 4P7OA 3AROA 2E3ZA 2PLMA 4PODA 5AHLA 3DAQA 3CUZA 1E3ZA 2CXEA 1KTBA 2CLIA 4HB7A 3V7PA 2V30A 5AC7A 4F8XA 1XC4A 3ZJ6A 3ZJ7A 5CPNA 2C1IA 1J0YA 5GJMA 3E2SA 4HZ8A 2YKKA 4ZTYA 2X05A 3VIFA 2HS8A 5CGQA 3VXGA 4K3ZA 4UQCA 1MQRA 2ESCA 2P3EA 2G3FA 3QN3A 1TTIA 1UH4A 3V3WA 4R3UA 3TMLA 1HL8A 3LGDA 5AHNA 5HANA 5FOOA 4K7VA 1CXLA 3WBYA 4WOQA 4LBRA 2VEMA 1EDTA 5E6YA 4AISA 2AMXA 2FIQA 4I5RA 3JU2A 3S6OA 3NQEA 3J7HA 2Y4SA 3PP7A 3PPFA 3FSUA 3VABA 3WMCA 4G56A 2OMAA 1ZFJA 8A3HA 3DHUA 1W2VA 3L2MA 5I79A 5BRPA 3QTGA 4JICA 3KOXA 4OZOA 3DI1A 2I5QA 3L5AA 3N17A 4PL1A 4UQAA 3E38A 3SRHA 3TTQA 1JRCA 2WB5A 1YIXA 4GNKB 2EQDA 4F79A 3WUEA 4FX7A 3B9AA 3AS0A 1TB3A 1WDQA 3QW3A 5D03A 3Q2DA 3VDHA 3RILA 5H8MA 1QR7A 4RNHA 1O68A 2HBVA 4D8AA 3UESA 2OYMA 5C8BB 4GFSA 2HSAA 5IXEA 3JW7A 2WJEA 2REQA 5C7VA 5GNYA 3PFMA 2WWCA 4AYGA 1ADSA 3IEBA 2ZUUA 3RX4A 1VS1A 3LSBA 4WR3A 1CXHA 1UJPA 4HNCA 1DBTA 3S5NA 1YPIA 4Z0SA 4AZHA 2FJUB 4WSJA 4S39A 1TV2A 1XIEA 1W1TA 4N2YA 1KQYA 1TJ2A 5IDIA 2WMFA 1YDNA 4HA4A 4Q8PA 5ABEA 2YBUA 1E4IA 1MUMA 4NQ1A 3AXIA 4R5EA 3ISIX 2QHAA 1KLZA 3NZRA 1W32A 4AG0A 2OEJA 1VEMA 3W37A 3GXDA 1W5MA 1V51A 1NQKA 1LBMA 3W2MA 1QO2A 4IOTA 5CXPA 1VFTA 1AODA 4YWSA 1GZ1A 1GG0A 4QJ5B 2QGHA 3ANUA 3W1QA 5I6SA 4H9ZA 1SW7A 4LV9A 3G22A 1AW5A 4H3DA 3KZPA 4LUTB 2EG7A 3PZ9A 2J8FA 3MS8A 1YXCA 4KERA 3W1AA 4PC8A 4HT3A 5L6UA 3GW0A 5HNRA 1EO5A 3W70A 2ZA3A 1SVDA 1FWWA 2BGSA 3AS1A 2VEKA 3ARSA 2GYIA 2EG8A 4HNUA 2VRKA 2D22A 1LL7A 5LIWX 2P1FA 4WF7A 1SO6A 2Y5EA 3NUKA 4E6MA 3UJRA 1K1DA 2E68A 1UBSA 3M43A 5LIUX 1B4EA 1IT8A 2ATSA 1XYMA 3S1WA 3F1QA 3H55A 1RBOB 7ODCA 2WMIB 4BF7A 1EJUC 3ZOAA 1H61A 1NOFA 4PEKA 3HJZA 3W7NA 2VC6A 5FKYA 4A3QA 2OVLA 4BEUA 4MPKA 6TIMA 1LT8A 1K8XA 3P84A 3H2MA 2Z2AA 3RMJA 3KOZA 2B31A 4KIEA 5LHFA 4O1DA 3OLIA 4PZVA 1MW2A 2W92A 1KBBA 3ZR5A 4JQ4A 1QNSA 3OHIA 1ITXA 7REQB 2WSKA 1CT5A 3RR1A 1UP0A 2VNCA 4G5DA 2OZ0A 2A6NA 2OEKA 4TV5A 4RW3A 2ZE0A 4E3VA 1S2AA 2Y7EA 5EMKA 4L56A 4LY4A 2QJGA 5CZKA 2PTYA 5GNXA 4PUJA 3BARA 3FN9A 2X1TA 3W2UA 3SCVA 3O6DA 3XISA 3WNNA 1JAEA 3OZYA 5F2IA 4OECA 3LEPA 3M64A 3PJUA 2KX9A 3EOOA 3CUHA 2FTPA 4KPLA 3ZVHB 4ZQRA 2IS7A 2WKJA 2VCCA 2ZWZA 4AD5A 5DXXA 2C19A 5T91A 2H3DA 1DL3A 1KGUA 5IOBA 2YDSA 3ZS4A 4JKKA 1EUNA 3IIVA 1L8PA 3PPGA 1Y0EA 3IIZA 2A0NA 2FJKA 2ZZ7A 1D3HA 2PURA 2A5HA 1JDFA 1YW1A 3WJXA 4P7LA 3NQVA 5DQPA 3B9DA 4KWVA 3NPWA 3JR2A 1W3TA 2WMHA 2JE8A 2E9BA 4LALA 1BYAA 3S1GA 4TQTA 4XZBA 4I8YA 3WIJA 4PCSA 1DJZA 1E70M 3URNA 2E40A 3QY6A 4XISA 3EA2A 1I2OA 3UXKA 2C16A 3LHTA 3P61A 4RZ6A 3QVQA 3WH9A 3CJPA 3HU7A 4GCXA 3G1AA 3BV4A 4AY1A 1SFLA 1B57A 4KWSA 2Q09A 2YCIX 4AHPA 2GVLA 2WVUA 2O7SA 2Z00A 4AHOA 1K4GA 4ZB2A 1H7PA 3UZJA 3M5YA 1V4YA 1EP2A 1ZSXA 3BANA 3O6AA 1ESWA 3NSXA 3ARWA 4RL3A 4H2CA 1ECQA 1H2JA 1R85A 2Z29A