3W1QA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with nl-2
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Trypanosoma cruzi
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with NL-2
rcsb
total genus 104
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w1qA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w1qA01
2CLKA 1KV5A 2B7QA 1EIXA 3KRSA 4O16A 4IX2A 2VELA 5AC6A 3RU6A 1SZFA 3LXBA 3Q94A 1OFPA 2YFOA 2X1TA 3T78A 2PC4A 3LV5A 1OF8A 3QQ0A 1I45A 1X6UA 1D3GA 3NZRA 4ZQPA 2Y7EA 2WOQA 3BW2A 3S8HA 1JCJA 3CWOX 1RZMA 4XQ6A 3P8JA 1JCXA 3OVRA 4IUOA 4XKYB 3U8GA 3L5MA 1TYGA 3HJZA 3NPVA 4JYFA 4ZQNA 1TJRA 4HSOA 2D73A 1KM0A 5D05A 4WXYA 3UZ5A 4JYEA 3BG9A 2ZZ5A 3TQKA 3LCFA 3KVJA 1OFQA 1M6JA 3O63A 2ZA1A 4AB4A 3L21A 1TIMA 3QM3A 1NF7A 1DBTA 2JGYA 2TPSA 3ABOA 5CZJA 3NR0A 3JR2A 3GDKA 1TTIA 4PC8A 5BMWA 4BR1A 4UXDA 2YW4A 4O1DA 4O1CA 3NOEA 1FBAA 4ZZ9A 4P61A 2VEMA 1HTIA 4JTGA 1F5ZA 3OIXA 1YADA 1TPUA 3DH7A 4JX5A 1D3HA 1OHLA 2E09A 3B06A 3MI2A 5AYZA 1SO6A 1SR9A 3IVUA 3C3NA 1OK6A 3CT7A 2Q8ZA 5I3IA 4C1LA 4AMAA 1KFKA 2J24A 2NWSA 3TU9A 2P1FA 3ZWSA 4NQ1A 5H2ZA 3TFXA 2DZXA 1OYAA 3ABQA 3UYCA 3W7PA 1M7PA 3N9RA 3O05A 4DQWA 4UTUA 5K9CA 1TPB1 1QPOA 4K8EA 1LBLA 5F4XA 3INPA 3EEGA 3NGJA 1A53A 3MYOA 4Y96A 1JRBA 2C13A 2Y61A 2ZRXA 2V81A 3NQ2A 3NM3A 3SGUA 3UXDA 1WOAA 5E93A 4LT9A 5DXYA 2Y7FA 2ZRVA 3MMTA 2ZCGA 2ZA2A 3MI6A 3NA8A 4K6AA 1T96A 3UY7A 1TMHA 4OU1A 3S1WA 2I1OA 1B3OA 4BI5A 3NEVA 1Z44A 4DPPA 3TA6A 1PVNA 5K9DA 1SQ7A 1JCLA 3LCHA 3QW4B 4MOZA 3EWZA 3GB6A 4KWWA 3L68A 4OE7A 4R53A 4EVZA 4JTSA 2CW6A 1GVRA 2R14A 3W86A 3MW7A 4JTUA 2TSYA 4DEFA 5AB3A 3W83A 3MI3A 1IXQA 1QAPA 3UWYA 3M5YA 1RVGA 3BK0A 1H62A 2V82A 1GWJA 1K7EA 3HG3A 4R7JA 1R2RA 3LRMA 4N9BA 3T44A 5D2TA 3R2GA 3H53A 2QR6A 3FYPA 4JTJA 2DU2A 4LVDA 4MJMA 3ZWTA 1DL3A 1AL8A 1GG1A 3CEPA 3P74A 4MY9A 3KRUA 5DXXA 3EWBX 4O53A 1GVFA 2JKEA 1C29A 3L5AA 3W72A 3FIGA 3UWUA 2VFEA 3C2RA 1F76A 3CTLA 3MP3A 4WZHA 4LTSA 3DFNA 5CPOA 3PBWA 3EWYA 2ZA3A 2ZTJA 1IF2A 3L9CA 4FXRA 2FLIA 5HR6A 5AHIA 3THQA 2F84A 3G3DA 5D02A 2C3ZA 3MBFA 4TMCA 3NQFA 3LI1A 4O50A 2FPVA 4ADUA 3P80A 3R5EA 3STEA 3MUXA 1QOPA 1LROA 1V7YA 3EKZA 2V9DA 1E51A 4ONVA 4MFEA 1I2NA 1U83A 3TX9A 5FEWA 5DY2A 4FNRA 1SW3A 4XTIA 1FCVA 3W76A 4G1KA 2V0TA 1PHWA 1O5KA 3BGJA 3IGSA 2QCDB 3THAA 2FDSA 1QR7A 3BLFA 1YDVA 1SW0A 3ZS4A 1XFBA 3FLUA 1VCGA 3G1XA 3S5OA 2V5LA 3G24A 4WXZA 1O60A 4D2JA 5IBXA 1LRTA 2ZRYA 4PH6A 2EF9A 2X30A 4NU7A 1LDCA 5EYWA 5G2WA 5ABTA 1K7FA 3TIMA 1LLWA 3EWXA 1L2UA 1LOQA 2QJHA 2J9YA 3LLDA 3NL6A 1EA0A 2HS8A 1N8FA 4N4PA 3EXTA 3W1LA 3PUEA 3NQAA 4QSHA 4JTKA 3G1FA 4OV9A 4HSNA 1MEIA 4O8RA 3L67A 4TU1A 4ZQRA 4AHQA 1KM5A 3I7RA 3NO5A 3FJ6A 3C52A 3C2EA 2JGQA 4GXMA 2H3DA 1YXDA 5K7JA 2VOMA 1R30A 3KHJA 3W7GA 1P0NA 4TR9A 2A7RA 2NX9A 3N34A 4QITA 4DO6A 1W5PA 4GE8A 2H6RA 5A5WA 1VRDA 3LGEA 5DBUA 2CWNA 2G95A 5EL1A 2Q8LA 1YDNA 1OFEA 4JTFA 3TE9A 3L5LA 3N3MA 4UR8A 3MHFA 2GPTA 1DORA 3TR2A 2QCFA 2FFCA 3BW4A 5BNKA 4KFPA 2XFWA 1J4EA 1WOBA 3PBUA 1EWDA 4UMBA 4PL2A 4WY0F 4HNVA 3NVTA 5F1VA 1KM1A 4UFMA 2FJKA 2ATSA 4UTIA 3GKAA 4MIMA 3M0ZA 4KKXA 3I7QA 4O12A 2ZFAA 4XBSA 3L65A 3IGUA 3PB2A 5AHNA 4QISA 3EX3A 1YDOA 1Q6RA 4O0ZA 1XBYA 4AH7A 1B4KA 2YCEA 5LNWA 1W56A 1SO4A 4MJZA 1UB3A 4O4WA 4JIPA 5D04C 1JJKA 2Y85A 5I3HA 1ZY9A 5F2LA 5C54A 1VHCA 3AO0A 1XXXA 1WQ5A 3CIWA 1K02A 3TUUA 2GOUA 2PE4A 3BO9A 2QDHA 1L6WA 2WSQA 4FNUA 1XDLA 4O13A 1KA9F 2Y88A 1X1OA 3G8EA 1G69A 3TKFA 2QAFA 3TSMA 3FJLA 1VPXA 4JR5A 1B57A 3DU0A 5FF4A 4S1FA 1B4EA 1H7WA 3M5ZA 1K8XA 4O0KA 1QDSA 3PBVA 1MEWA 4A22A 3GXPA 5D30A 1QNVA 2NWRA 3M1ZA 1QOQA 6ALDA 2J27A 5IBXC 1PCWA 2A1YA 3CEUA 3C2VA 2DZSA 4AVFA 3HPXA 2R94A 1THFD 7TIMA 1KW1A 2P0OA 4UFJA 2B0MA 1K7XA 3DHFA 3G1HA 2OMAA 2P10A 1ZCOA 4KFOA 3TXVA 3G8RA 4Z1BA 1SPQA 3A5VA 2H3BA 5J5RA 1TV8A 1KTBA 3C8FA 1H7OA 1OFBA 4CCCA 3A22A 4UCGA 5J5DA 3NQ8A 4UTWC 2QCHA 4IQLA 3N2XA 3W2JA 1LM1A 5TBOA 4JTIA 2ZQ0A 2ZZ3A 1HUVA 1ICPA 1J5TA 4BWLA 1LOSA 4NVTA 2BWGA 5LNRA 2X16A 1ICSA 1W8SA 2OT1A 2Z2UA 4HHPA 1M5WA 1ZAHA 1OX4B 5EPDA 4M6VA 3TMLA 1U5JA 4ALDA 1KBIA 1LOLA 4FX8A 1K03A 3KRZA 1WX0A 4NT0A 1JCYA 2ATMA 2TMDA 2DORA 3M16A 3LRLA 4BFAA 2A7NA 3LBCA 3QMSA 3LHVA 3PSWA 1ME8A 1YYAA 3PSVA 4MZ1A 3IEBA 3LCLA 1DV7A 1GT8A 4IJBA 1J2WA 5E1QA 3ATYA 1SZGA 3LXCA 4O18A 2QJIA 1SSGA 2HMCA 2GJLA 3WJYA 4K7VA 3PR2A 3PUOA 4BI7A 3BV4A 2H8ZA 1T0OA 2B7NA 3M47A 4FXSA 1W37A 3HOJA 2QCEA 4O10A 4YL2A 1UUMA 5HWMA 2YDAA 1CX9A 4RXFA 3LM7A 4JX6A 1O5XA 3BG3A 1TPFA 1YXYA 3NQMA 5KZEA 1SO5A 3MYPA 3HBLA 4JY8A 3W23A 2EAWA 1JCNA 1LZOA 2QUTA 1ADOA 4ZVJA 5HULA 2ZRUA 1W5NA 1TV7A 5FEPA 1GJPA 2ZZ4A 3NQCA 3O16A 1FCUA 4L4LA 1ICQA 1H60A 3UWVA 3OBKA 3WFAA 1JUEA 4BF9A 3SECA 4GUGA 4NUWA 4WQ6A 3TW6A 4AWSA 1HL2A 2B7PA 3I7SA 2V2HA 3W85A 3NQ6A 2A2IA 1CW2A 1T8XA 1TJPA 4O57A 3TCEA 5G2IA 2YZRA 3TK7A 4EWND 2GVGA 5G4EA 1JULA 3MBDA 2OX1A 3NXFA 1QPRA 3DHDA 2QUUA 1PL9A 2E6YA 3BLEA 3SR7A 1EWEA 2C0AA 1GYLA 4K39A 2NX3A 1AW2A 4UTKA 3M43A 4NJGA 4ZQOA 4YMZA 3P60A 3W87A 3TC7A 5LNSA 3NPWA 2GJNA 4FX7A 1EX5A 1G4PA 4QNWA 1XDMA 2W79A 4DF1A 4Z1AA 1Y0EA 1TPH1 3O6CA 1TTPA 1W5OA 2E6DA 3TNOA 1OFRA 5LGZA 1W3TA 2E68A 1G67A 2RFGA 5F2IA 4Y9AA 3WJZA 2YPIA 2A7PA 2OCZA 3TSDA 2E77A 1WAUA 2PURA 3FKKA 3LTSA 1L9WA 1LRQA 3VKJA 3LV6A 2WSRA 1WA3A 3FA5A 3W7EA 4UFKA 1Z41A 4O54A 1I2OA 5HUPA 3TDFA 1Q6QA 4IPJA 2WO5A 4OT7A 2EPHA 3MJYA 3DZ1A 2UV8G 5CSSA 2QCMA 1BKSA 2CZFA 5D03A 3W7IA 1TB3A 1VLIA 2EHHA 1LBFA 3HB9A 3TROA 3B4UA 2FB2A 3F4WA 1TPC1 1IGSA 5EA9A 4O15A 4UFIA 3KXQA 2PCQA 5C55A 3C6CA 3STFA 3KX6A 3GVGA 6TIMA 4EIVA 4A3UA 1UJPA 2A4AA 2QAPA 3DKLA 3V1PA 1BWLA 2OT0A 2YYTA 3G22A 4C1KA 4ADTA 4WY0B 3TQVA 4WOQA 1GVSA 3GDTA 3GKFA 2AAMA 3UXAA 3H55A 1FXQA 5CKSA 3EX2A 3ATZA 5F4WA 1XI3A 2NX1A 2YX0A 4R34A 3S5YA 3NL5A 1FQ0A 2JKPA 3W70A 1KTNA 1YTEA 3ABSA 4N9CA 3E02A 3M6YA 3PC0A 2E6AA 3RFAA 3W7HA 2WSYA 4LUJA 2QCCA 2QCLA 5CZSA 4DF0A 5C2XA 3GZ3A 1FWRA 1F2JA 2HSAA 3TQ0A 4M19A 4N6FA 2X1UA 2GVLA 3PF3A 5FEXA 3N14A 5T26A 4M5PA 1QO5A 4HNNA 4A2SA 3IVSA 2RHGA 1VYRA 1VQTA 3VCRA 2NXHA 4JGDA 3BGGA 1HG3A 4UC5A 3SY5A 4O52A 3DFOA 4HT3A 1GEQA 5CGQA 3W1UA 3HG4A 3PUDA 5L6UA 5HQEA 2GQ9A 2CLHA 1S5WA 3VFLA 3QRHA 4Z1CA 1KFJA 3AJXA 4TIMA 1LTDA 2FTPA 3Q2DA 4KFNA 1TCDA 2PRMA 3F1QA 5CZ0A 4Z0SA 1OK4A 5AHLA 4FO4A 4U28A 1B9BA 3P67A 4IMCA 3M5XA 1OYBA 4OQVA 2NV2A 4IXXA 2XN2A 3W1MA 4LVAA 2XN1A 3W7KA 3GLCA 3HO8A 4RX0A 4Y6GA 4RZ4A 5D38A 4I7WA 5DCDA 1VHNA 5FF2A 2QKFA 5L9FA 2WNQA 3PS7A 3RNDA 1GTEA 3DKJA 1HO1A 3Q58A 3A24A 1I8JA 3W2UA 1SZNA 2GUUA 4OV4A 3W74A 1KM6A 3E49A 2YR1A 3DBPA 1I2RA 2ZZ6A 1OFAA 3IIVA 4NXKA 1I2PA 2Z6JA 4HKPA 3LXAA 1RR2A 1S5TA 1TPEA 3DFSA 1W1ZA 4JICA 1EUNA 4UTTC 3PWAA 4E38A 4QJ1A 2CFFA 2WJZA 4GUJA 2VEPA 1FDZA 2CU0A 3UPWA 4PL1A 4IOTA 1VYPX 4JX4A 1VH7A 1WXJA 4NX0A 1P0KA 2ZZ1A 1G4TA 4ORMA 5LNVA 3CB8A 4LVFA 1EP2A 4UTTA 3P7YA 2G96A 2QCNA 2Y63A 4FNPA 3S42A 4UMCA 3B0UX 3L0NA 1IIHA 4CNPA 1JCMP 4NJKA 4WUIA 4X9SA 3GAKA 3O15A 1G7VA 3Q37A 4OBTA 1TQJA 3YPIA 4N9DA 3SZ8A 5HR7A 4CCDA 1Q3NA 3C4UA 1L6SA 3R8RA 2C14A 1F6PA 3N9SA 5TIMA 1SU5A 1W5QA 1WV2A 2BZNA 1R46A 3LRKA 4M7SA 1EP1A 1O95A 4IXHA 3TFCA 2Y70A 5F2MA 1SFJA 3W84A 3EX4A 3KVMA 2RDUA 5HWJA 1Q45A 2Y89A 2KZHA 2ISSA 1OX5A 1W31A 3W88A 1A5AA 2V5BA 2FPYA 4XBKA 2WNZA 4AHOA 3W73A 2QCGA 1M7OA 4HNTA 4RXGA 1IIGA 3IIXA 2ZRWA 3CLMA 5C5YA 1A5BA 4N2YA 4MY8A 4O17A 4AWTA 2CZEA 4IMDA 1X8FA 3FOKA 1LORA 2JBMA 4DBDA 1UUOA 3S0CA 4N4QA 4YLWA 3HGSA 2DJLA 5AOUA 3G1SA 5CPMA 3WJWA 1KM2A 1DVJA 4O19A 3G1YA 3P5YA 3QF0A 4WX2A 3NM1A 4RR4A 2C15A 3S1XA 5G1YA 4H6KA 1R2SA 2E1DA 5D2WA 1LRNA 4B5NA 1KFEA 2Q3RA 3CIXA 2C1HA 3RMJA 1H61A 1SW7A 3D0CA 3UZJA 4AAJA 5FF7A 1OFOA 3BPWA 3LHYA 3TAOA 4HPXA 2G97A 1H1ZA 5BRBA 3A5FA 4GUHA 4P2VA 3NQDA 3T4CA 3G3MA 1JQVA 5AYYA 3G1AA 1ONRA 5HJLA 4X2RA 3R13A 4MFDA 3DFPA 1YLVA 3L0KA 4FIRA 2WNNA 1VGAA 4R33A 4FIQA 1D9EA 2EKCA 2B7OA 1VJIA 2E6FA 2ZRZA 1DJNA 5D33A 1OX4A 2CLFA 5G1TA 2H8XA 1XL9A 4MLRA 3ANYA 5F4SA 3W22A 3KAOA 2ZBTA 3I68A 3S6DA 4WD0A 4MYAA 4UIOA 2X1SA 2A6NA 3HPZA 2ISVA 1N7KA 3W71A 1X1ZA 3GDRA 5DCEA 1DKWA 4UTHA 3GDMA 3W1PA 4RJEA 3LHWA 4LU0A 3CHVA 4O4VA 4ICNA 3KVLA 2VFHA 2Y6ZA 3P62A 4XWUA 4ML9A 4IMFA 2J88A 2VFDA 2NUXA 1XKYA 4JDYA 1EB3A 4HIBA 5D2VA 2A6LA 4JTHA 3BW3A 1K3UA 3W1RA 4MZYA 4CQ9A 3GDLA 3GR8A 1PIIA 1R2TA 1W0MA 2DP3A 1FDYA 3M5VA 4I7UA 5D2YA 3NQEA 5HWNA 2V30A 1OABA 2ABBA 1YPIA 3BLIA 1GPWA 1GZGA 4QIUA 2QDGA 2V2CA 3MP5A 2NZLA 4S2CA 3W07A 4PTNA 3OVQA 2YYUA 3OVPA 1F7BA 3N2MA 3GK0A 3O8AA 4QQ3A 1A5SA 4UMAA 1KV8A 5KZMA 4LW7A 1FXPA 3DGRA 3C61A 1MZHA 3ZFHA 4QAIA 2Z0IA 3LLFA 3A23A 4IWWA 1OJXA 3DENA 4NX5A 1IXNA 5EMUA 3W7CA 4K7YA 1DHPA 3DI0A 1AK5A 3B8DA 3GXNA 3EWUA 3IIPA 1AG1O 4IPIA 4GWEA 3GNNA 4AXKA 5AHMA 1P5BA 3W2NA 4UFHA 3B0PA 3M9YA 3OEXA 4JTEA 3DXIA 5LZLA 5MHBA 4PCFA 2JK2A 3HGOA 1VS1A 2GVJA 2I9EA 4LS2A 5HNRA 2HTMA 1IXOA 1XC4A 2YGYA 3USBA 1VCVA 5F1UA 1A50A 2GQ8A 2CLMA 5KITA 5HINA 4Q33A 4UR7A 1SFLA 2EGZA 4A2RA 5F2GA 2DZUA 4ZQMA 1FUYA 1S5VA 2QUVA 2Z6IA 1Z42A 3NAVA 3CQ0A 1S3HA 1W54A 3TMQA 4LV4A 2I14A 4RZ6A 1KLZA 4NJHA 2W0UA 3TXZA 2DZVA 3P84A 3UWWA 1HFBA 1NVMA 4U4MA 4LRSA 3G0UA 2NV1A 4S2BA 1FY6A 2J9ZA 2Y62A 3G0XA 1H51A 1FWNA 4FX6M 2CZ5A 4WOZA 5LHEA 4BI6A 4OGZA 1XBXA 3L2IA 1ZALA 3QYQA 1GQNA 3HGJA 3W2LA 8TIMA 3NL3A 3GIYA 3HQ1A 1I2QA 4FHAA 2TYSA 4CNOA 1NF0A 4FNTA 3F03K 4YXGA 5KSWA 5SWUA 2ZDRA 3GXTA 3P8IA 2WPBA 1F05A 4K8HA 3QPZA 1ML1A 3UNDA 4TX9A 3TH6A 2W6RA 5I3FA 5AC8A 4DXVA 1TTJA 3G0SA 1TRIA 3O1NA 3NQVA 1F73A 1XM3A 3CU2A 4N02A 3C56A 3QSRA 1WYIA 5D09A 3PB0A 2HS6A 5CPLA 5K2ZA 3TJLA 4FNSA 3C2FA 5TQLA 3DI1A 1JRCA 3G18A 2E5BA 4OHQA 3OA3A 5EBUA 1SUXA 1LLZA 4FEZA 2IQTA 3VE7A 4POCA 1BWKA 1VC4A 3EWWA 3NQGA 1OX6A 4JN6A 4Q4KA 1JUKA 1H63A 2BLEA 3O6YX 5BOOA 3QH2A 1XUZA 1ME9A 4NNAA 4UFLA 4M6QA 3IGXA 5KINA 4K37A 4NXSA 3KFTA 4JTLA 4JEQA 4NZFA 3ZR4A 3PVFA 3W1NA 3GYEA 3W7LA 3A21A 3LERA 3HGRA 1DQWA 2VEKA 4UNKA 3EX6A 1KLYA 5K3VA 3EB2A 4AF0B 2LLEA 3PY2A 1W3NA 3L66A 5U4NA 2XN0A 1GOXA 3QW3A 2ALDA 1G6CA 1MSSA 1NFBA 4GC4A 4JIQA 2NXIA 1H7XA 1ALDA 1P1XA 1T99A 2PRLA 4GJ1A 4M7TA 3RK8A 4LV9A 2QEZA 3LCXA 3S5NA 4PODA 5EY5A 3LTPA 3LB0A 3SW6A 5K4ZA 1BEUA 1TTQA 4L4MA 2OZ0A 4UNLA 1OVDA 1H7PA 3E96A 4PFMA 5KMYA 2C18A 3W3OA 3NG3A 3FFSA 4M6PA 3EXRA 1FCQA 4BWLC 4LRTA 2G5WA 2VFFA 3W1AA 2QF7A 3LDVA 1LCOA 3S9YA 2WKJA 1YTDA 4Z08A 4UTWA 3T7VA 2CLIA 1O94A 5AHFA 4JTTA 4XTDA 4DO4A 1EUAA 3NQ7A 1K8ZA 4IGHA 2Z1BA 3IRDA 1BTMA 3H54A 4XZ9A 2JKAA 4H4IA 1FWWA 1RD5A 4JNMA 2FIQA 4O11A 4E2DA 2VXNA 3LX9A 3W1TA 2VKZG 2ZTKA 4LS1A 1RV8A 1GTHA 3QSTA 4CCEA 1G7UA 1H7NA 1YPFA 1TO3A 2NUYA 3W1QA 2O7QA 4O1AA 3IV3A 3E9AA 1JUBA 1P4CA 3I65A 5DN1A 2BXVA 3SIZA 4YCOA 4GUFA 4JDBA 2AQWA 3MWAA 4Q32A 1YTKA 2BSLA 5DCBA 3SSJA 3W7MA 3BG5A 3O6DA 1ZFJA 4O14A 1DQXA 3KOFA 1O4UA 4FB7A 1CI1A 3WK1A 2RDWA 3STGA 1FWTA 2E5CA 1VR6A 1F74A 5C6MA 3LCIA 5K9XA 1EPXA 1AMKA 4NNCA 3N19B 4YCPA 3P5ZA 3WK0A 5DY3A 1OG0A 3W2MA 1UCWA 3NPUA 2YW3A 4OWGA 1WBJA 4WY0A 1MXSA 5FI8A 2YSWA 1TPVA 3CWNA 1G4EA 3SFKA 5LGXA 3EKLA 4K36A 3LCGA 3R12A 1FWSA 3T55A 4MKNA 4O28A 3U2OA 3IVTA 2ABAA 4IX0A 3VE9A 3WJXA 1L6YA 5KZDA 4N9EA 1VZWA 3O06A 1LBMA 1PS9A 1RQEA 1Z48A 3DFTA 1PHQA 1R47A 1XBVA 3E12A 3MHGA 2DJXA 1WDWA 1ZAJA 3WK2A 4RV8A 1TPWA 4GFSA 4CQAA 4ADSA 2ZZ2A 2CLLA 2NXGA 4ZL1A 1OF6A 4EOUA 4LNYA 3VI2A 4FNQA 1OYCA 2C19A 2H90A 3LCWA 2V2DA 1KM4A 1QPNA 3TC6A 3W9ZA 3B05A 3LOTA 1LP6A 5FEZA 3TAKA 2CLOA 1SZEA 4IMEA 4A21A 1KM3A 4YWIA 4RZ5A 2A21A 4LUIA 4AEOA 3JS3A 1RQBA 1MO0A 2C6QA 3M44A 3ELFA 1QO2A 4Y8FA 4EF8A 1KFBA 3NZ1A 1XBZA 5FESA 1MEHA 3HG2A 3HMJG 2J6XA 3F4NA 2J9XA 3GX9A 4TMBA 5E0KA 4MVAA 3OG3A 4GRSA 4RKAA 3O07A 2VEIA 2ZZ7A 3HPSA 1XCFA 3W7QA 5LKYA 5CG7A 3C0JA 4K38A 4BK9A 2C16A 5BW6A 3W7JA 3NDOA 2NUWA 4JY9A 2WQPA 3QJAA 1NSJA 4A29A 1OFDA 2B4GA 2V8ZA 4UTMA 2A85A 3WK3A 4DBEA 3UWZA 3W1XA 1QMLA 3GNDA 4NJJA 5I3GA 2E5DA 3QMRA 5IM51 3CPRA 4NNBA 3UPBA 1QFEA 3ABRA 3KVKA 3L0GA 3LTYA 1WBHA 1YXCA 2ISWA 1SSDA 5FF3A 3FYOA 4FF7A 1I4NA 4LVGA 1AW5A 4MLJA 1X7FA 3QEZA 4NJIA 3FS2A 3VNDA 1HO4A 4RLIA 3W7RA 3CC1A 2VFIA 3LI0A 4E0CA 4UUIA 4DO5A 3R89A 3HF3A 4QM1A 3B0VC 3PBYA 5D32A 5FF0A 2R8WA 5H91A 3W7OA 2ZYFA 4O1BA 2RH9A 3PM6A 4WJEA 5G2HA 3TJXA 1F6KA 1AL7A 4Y90A 3NNTA 5I3JA 1JR1A 1ZAIA 3I6RA 4KWVA 2BX7A 1KFCA 3G1DA 1ZNNA 3QQ1A 4DF2A 2VC6A 3WJSA 3TV8A 3N73A 1N55A 4JXCA 5CPNA 3PG8A 2FQIA 1TSIA 5CSRA 1VLWA 1JQXA 1H1YA 3V75A 5LNUA 4LWWA 3W6YA 1H5YA 1NAL1 1TRDA 3NL2A 3T40A 3IIOA 4DELA 2FB3A 2DZWA 3PG9A 3S5ZA 4X3ZA 2DZTA 3PAJA 1EEPA 2X2GA 1FCBA 3MO7A 2RKXA 4H3DA 4LC8A 4Z0JA 1PV8A 4N6EA 4Z1DA 4EF9A 3NPXA 2PRHA 3IIZA 2DZPA 4LVBA 1ZHAA 4JYDA 5KTLA 5HUOA 2Y7GA 3TSBA 5DBTA 5I3KA 5HMSA 2VFGA 4UTLA 3B04A 3RLUA 3LHTA 1FX6A 5AC7A 2AGKA 3CM4A 1VCFA 1Q6OA 4NZJA 5AHEA 1C9DA 1ZJIA 1AW1A 1LYXA 3UY8A 3PULA 4AHPA 3BVJA 1H7RA 1JVNA 1H50A 3A9IA 3LHZA 1NEYA 4I9AA 4RK8A 5LSMA 4QNEA 3M7WA 5D2XA 4JS3A 3UWQA 4ZQCA 1K8YA 3C2OA 1QPQA 3S1UA 1DOSA 2QJGA 4PA8A 4XKYA 1IXPA 2CZDA 3BARA 1Q6LA 3QPYA 3W7NA 2Y7DA 3W2KA 4MZ8A 1TPDA 3P82A 4CNNA 1ME7A 1UBSA 3QC3A 3GAYA 3U6WA 1SO3A 2WV8A 3P81A 5AN7A 5U7SA 3FEMA 5AYXA 1GG0A 1ZENA 1PE1A 2NLIA 3K30A 3MHUA 5BMXA 2BTMA 1QWGA 4ORIA 2O7SA 5D37A 1RPXA 3W75A 3W7DA 2YXGA 4LC6A 3UD6A 3G1VA 4J9JA 3OHIA 3DAQA 2FPTA 4HN4A 4AWUA 1FDJA 4PEKA 5G5IA 1KBJA 3DFQA 1W5MA 4LS0A 3EXSA 4TO8A 5DELA 4UTJA 5K4XA 3LHUA 5DLCA 3JRKA 3UQNA 4DPQA 1C8VA 2CLEA 4GBUA 1TREA 2QCDA 5LHFA 3SJ3A 3QMTA 3TW7A 1TV5A 1V5XA 4HNUA 1KFLA 4XUGA 4LOCA 4E2BA 5AFDA 4RCXA 5CZTA 5A8GA 4X22A 2A5HA 1GVOA 1KTCA 1QCWA 2RDTA 1EP3A 3NYZA 4LY8A 1PCKA 2R91A 1VYSX 1TQXA 3RLVA 3RF9A 2YFNA 4CQ8A 4GUIA 1W3IA 3MP4A 1G4SA 3B03A 2Q3OA 4MYXA 4MPQA 4I7VA 2X1RA 3LBMA 3S1VA 2A0NA 3HIJA 4HPJA 3E0IA 4ZMGA 3HG5A 5GVJA 3M41A 1XUUA 3GR7A 2TRSA 3EX1A 3SI9A 1RQHA 1GYNA 4JD4A 2OJPA 2GQAA 4AF0A 1GVQA 4W9TA 3FKRA 4IMGA 3SGZA 5G4WA 2F7FA 5EKYA 2VENA 1DJQA 1UASA 3QFEA 4MY1A 3STCA 4CLMA 1A5CA 3P61A 3QZEA 4GNJA 4MUZA
chains in the Genus database with same CATH superfamily
2B7QA 2D20A 3KRSA 4IX2A 3GSMA 3N15A 4KETA 3UXLA 1HKJA 2PLJA 3QQ0A 4ZQPA 4ENLA 4F0RA 3LS9A 2VQUA 1B3YA 1ZBCA 4HK7A 3BW2A 3MTWA 1JCJA 1RZMA 2Z28A 4B5UA 3TLQA 4RNFA 1C92A 2WCSA 1EHAA 3D46A 3WD1A 1UWRA 3TC3A 3HJZA 3NPVA 5C0QA 3MDUA 4EAYA 1KM0A 4AIBA 4WXYA 1DJXA 4AVOA 1VFHA 2BVTA 2ZZ5A 3LCFA 4PMQA 3O63A 4DLMA 2ZA1A 1E73M 1FWHC 3DFHA 3L21A 2XZ9A 3VCCA 3QM3A 1B3WA 3C2YA 3VIMA 4GX8A 2JGYA 4Y8EA 3NR0A 3JR2A 3TOYA 4BS0A 4ASTA 1TTIA 5BMWA 3GZAA 4PTWA 3VILA 3GHRA 3VO0A 2YW4A 4DXXA 4O1CA 3IJLA 3OIXA 2YCLA 3EMZA 3DH7A 4JX5A 1OHLA 2E09A 2ZWZA 1FHDA 1CGWA 4E2VA 4C1LA 1KFKA 3LENA 3ZWSA 1QNRA 2Y8VA 4NQ1A 3QR0A 3GXIA 1A5NC 3VMOA 4GKLA 3N9RA 4DQWA 3FDGA 1RCXB 1DE6A 4B4FA 4J3UA 2E1WA 3DN5A 1LBLA 5F4XA 5MKGB 1R3RA 3INPA 2CCRA 4N0RA 4HA4A 4KGJA 3OYZA 4QDPA 1AQHA 3MYOA 2C13A 2Y61A 3J7HA 2PAJA 2ZRXA 1WOAA 5DXYA 4EPBC 2ZRVA 1G1YA 1EJTC 4S3BA 3LY0A 2FMNA 4OU1A 2I1OA 1B3OA 3T2PA 2ZUUA 4BI5A 1YIXA 4DPPA 3TNBA 1SQ7A 1K6WA 3LCHA 3GS6A 3MT1A 1YRRA 2P76A 1E9IA 1W6TA 3GB6A 4KWWA 3F7JA 3L68A 1XD0A 4EVZA 1GOQA 2R14A 4KESA 3MW7A 4A8IA 4Z1YA 2VT0A 4GGBA 4DEFA 3MI3A 4HSHA 1IZCA 2ISFA 1G9HA 2VR2A 3M46A 2VX7A 3ABZA 3OLGA 5D2TA 3R2GA 4WIWA 4LVDA 2YLAA 3H26A 4JIHA 2XZ7A 3CQHA 1GG1A 2WM1A 4QS6A 1UKPA 4O53A 2JKEA 3T05A 5CC5A 3FIGA 2VUYA 2J7FA 4LTSA 4WZHA 3SO7A 2Z4GA 4HA3A 2ZTJA 1AH0A 3GM8A 4Q8UA 2WJFA 4FLSA 3ECQA 4BA0A 5LIXX 3MBFA 4RPPA 4TMCA 2FPVA 3P80A 3R5EA 3STEA 4B2DA 1CEOA 1QOPA 2DEPA 3K5XA 4DYEA 4AX6A 1F6YA 3EKZA 4ONVA 4MFEA 1I2NA 1S2TA 1SW3A 4K1GA 4CNUA 1FCVA 4MNLA 3W76A 2WHKA 2JIWA 4G1KA 3IGSA 2QCDB 4LFYA 3TW9A 2R24A 4CQDA 3FLUA 4IGSA 2R1MA 3S5OA 1LLOA 2PDQA 2C91A 5IBXA 3NURA 3UU0A 5ABFA 5JBDA 4PH6A 1WDDA 3WH7A 1QBAA 2NVAA 1IHIA 1DP0A 1PYMA 4G8TA 4EPDC 2WZIA 3AC0A 3LLDA 2HS8A 3GWQA 1QK0A 3VGFA 4JTKA 3F5JA 4AHQA 1X96A 1KM5A 3I7RA 1ESWA 1XLBA 1NDYA 4C6PA 2H3DA 3FVDA 2YB4A 3PJTA 3OZMA 1POJA 3VVGA 1P0NA 1US3A 1UA3A 4RPQA 1ZJAA 4GE8A 2H6RA 1VRDA 1RCOB 4LXFA 1TJ1A 4C6IA 4JIIX 5AKQA 1WCGA 3WN6A 4AW7A 4UR8A 3MHFA 2GPTA 2D3LA 3F4VA 2FFCA 3GVWA 2E0PA 4XAFA 4UMBA 2XH2A 1QUMA 4I90A 6ENLA 3SCSA 2ATSA 2DUZA 4O12A 1O6IA 3L65A 4C91A 3LGGA 1PYFA 3WEZA 5AVHA 3C0SA 4O0ZA 1RD6A 2YCEA 3OYXA 4CNTA 1SO4A 1UIPA 4MJZA 4QEEA 4IIGA 5BRPA 4RE2A 3RCYA 3PFRA 3NDZA 5FJIA 2CKSA 1VHCA 4LCQA 1S46A 1UZHA 4K68A 2GGIA 5FSEC 2GOUA 3ZXWA 2QDHA 8XIAA 2PDPA 3S2MA 2ZXBA 2VZTA 2Y88A 1DWJM 4TVCA 1QHPA 1UOKA 3SQSA 4D1JA 5A6KA 3M5ZA 3DUGA 4O0KA 3WMSA 1PKYA 1MEWA 4A22A 2OZ3A 3GXPA 1HP4A 1OD8A 4J2MA 1I9CB 4QJ4B 2XVLA 3WNKA 3M1ZA 1M04A 1QOQA 4M51A 4PUJA 6ALDA 1PCWA 2A1YA 3CEUA 3VKCA 4B16A 2DZSA 2BXZA 4W86A 2R94A 2XIJA 4DNHA 4UQEA 1EQCA 1IGWA 5D9MA 1UJQA 3DG3A 4W4QA 2P10A 5EFFA 2NSOA 3TXVA 4Z1BA 1SPQA 5FJUA 3WH5A 5J5RA 4A8RA 3SM0A 3IPWA 8XIMA 2BASA 3DG7A 3NQ8A 3PZTA 1U5VA 4QG9A 4IQLA 3W2JA 1LM1A 3KUMA 4JTIA 4Z17A 5CC6A 3E0VA 2DSWA 4Q8TA 5DMYA 1ICPA 1KKRA 3RPMA 2Z1WA 3PTMA 2YDQA 1L2QA 3COTA 2DQWA 1MNSA 3GO2A 2DPEA 5I6SA 2XIQA 4YPJA 1PIFA 2X7WA 3GR4A 4IP5A 1U5JA 2XGZA 1KBIA 4Q8OA 1UHVA 2EJ1A 4W89A 3KLKA 3KRZA 1UP3A 1QRQA 2ATMA 4U33A 3M16A 4BFAA 3LBCA 2W4XA 1YYAA 3ZT6A 3LCLA 1DV7A 2I56A 1N82A 1GT8A 2W66A 3GRIA 3SURA 4AD3A 3MCOA 2GJLA 4Q4PA 4C6EA 5TNVA 3QZAA 4HCHA 1LG2A 4AD5A 3M47A 1OZMA 3KL0A 4F3HA 1RP9A 2QCEA 1C3FA 4XKMA 1XP3A 2YA1A 5JBEA 1TA3A 4ZOCA 3CQKA 2YDAA 4RXFA 3LM7A 4G1NA 2OLSA 3BG3A 2YL6A 3RITA 3MB9A 1JCTA 4HOXA 3MYPA 3WMLA 4JTAA 1JCNA 1LZOA 2QUTA 1ADOA 1HIZA 1XW8A 5HMEA 2ZRUA 1M65A 5FEPA 1ZUAX 2ZZ4A 3ARXA 1FCUA 4QG8A 1KWGA 3UWVA 3L4ZA 3KCOA 3WQFA 2R1KA 1J11A 3CUXA 4L9YA 2PZ0A 3GC2A 3OBKA 4XZIA 2HNEA 3WFAA 4XX6A 1JUEA 1K77A 2WVVA 4Y9OA 1ECEA 1HJSA 3QY8A 1P43A 2CPUA 9CGTA 5A6MA 3TW6A 5H1WA 2B7PA 2WZHA 2VCBA 3NQ6A 2A2IA 2HK0A 3N2CA 4J35A 4OOZA 3VDHA 4BZYA 1WKDA 2WKLA 2PD5A 4HTBA 4JFUA 3GW3A 1LG1A 3TK7A 3T8QA 4EWND 3S2CA 1QPRA 3DHDA 1H0IA 3MUZ1 2QUUA 3EA2A 1PL9A 1RALA 3KBJA 1U2YA 4K39A 1AW2A 1MYRA 1E5JA 4CN6A 3A4WA 2H9AA 4FX7A 3LSBA 1G4PA 2UZ9A 4DF1A 3FYYA 3E5PA 4L4PA 3WQ8A 1Y0EA 4M0XA 1KBLA 1TPH1 3MUCA 5A6AA 4DI9A 1V7AA 3VGGA 2RFGA 3AIRA 4EX4A 2Z1VA 1KRCC 4IJCA 3FKKA 3LTSA 1LRQA 3VKJA 1PZ2A 2D2OA 1O1ZA 5GJMA 5HUPA 1Q6QA 4IPJA 1DWFM 2EPHA 2VZUA 3DZ1A 3UG3A 5H8MA 2WHLA 4XUYA 5D03A 3M4HA 4AU0A 5BWFA 4RDYA 1K6AA 1E4NA 3B4UA 3MSRA 2DW7A 2XWDA 5EA9A 1H1NA 4UFIA 3CK5A 3KXQA 2PCQA 3MKCA 4UZUA 3GVGA 1XR2A 1RLDA 2QAPA 5DRIA 3V1PA 1VJSA 3BTNA 3SUUA 1Z8AA 2P3ZA 5IOBA 3G22A 1RJPA 4LJ3A 2Y5SA 3IJ6A 2WYSA 3AWOA 2J74A 4WOQA 1TE6A 4HYVA 1MI3A 1TVNA 4LUSA 1TJ2A 2AAMA 4LH8A 3H55A 2CYGA 2J7BA 2O92A 2YB1A 1IZKA 5CKSA 4JNYA 1FQ0A 1JGIA 2JKPA 3W70A 4PBEA 3ABSA 4M24A 3IJ7A 3M6YA 4L1XA 2E6AA 1XF0A 2UBPC 2QCLA 5CZSA 3L4TA 5XINA 3URAA 5C2XA 3TQ0A 3C86A 1BYBA 2GVLA 3N14A 1KD0A 5T26A 2PUZA 4M5PA 1MVYA 4URIA 3HFTA 2VC7A 4HNNA 1VYRA 4DI8A 1J0ZA 4ERIA 4IP7A 1U33A 4JGDA 3WKZA 1HG3A 4UC5A 1SJCA 4L1WA 2IUZA 2GQ9A 3VFLA 2CHRA 3QRHA 4B4HA 3HA1A 1GONA 3ALGA 2OKOA 1S39A 2FYMA 1PDZA 1Q7QA 3Q2DA 1TWDA 5HQMA 3PJUA 1TCDA 3UCQA 2PRMA 5AHLA 1ITCA 2Z26A 5A1AA 5M2FX 3QLDA 4IMCA 4LVAA 3IACA 3SCQA 3GG1A 2XN1A 3GLCA 3H7RA 1QWKA 4XZMX 1VHNA 2QKFA 2WNQA 3RNDA 3TONA 3N25A 3DIPA 1I8JA 1SZNA 3K4WA 3T2QA 3W74A 3KWXA 2ZZ6A 2PWUA 3SCOA 4S3EA 1HJXA 3O2LA 3VINA 1XIJA 2Z6JA 3W02A 3LXAA 1R6WA 1RR2A 1S5TA 1UPPA 4JBRA 4LF1A 1W1ZA 4AZIA 1Q13A 1UP0A 4UTTC 1AODA 1UWTA 3PWAA 3CASA 2WJZA 4QTGA 2CU0A 3LPPA 3RM9A 1VYPX 1VH7A 5LNVA 1P0KA 1G4TA 4ORMA 1UR4A 2HROA 2PP3A 2VGBA 4JFSA 2G96A 2QCNA 2G3IA 3S42A 4UMCA 2R82A 2DT3A 1SFTA 2WC3A 1GORA 3G6MA 4YHGA 4GX9A 1H3GA 4BQ3A 3LD5A 1G7VA 1W1PA 4OBTA 3YPIA 3SZ8A 5HR7A 4CCDA 5I24A 3WDIA 4CU8A 4ZOBA 3BMVA 1OY0A 3FV9A 1F6PA 4HB7A 3T8LA 3N9SA 5TIMA 1SU5A 4JKMA 4F0SA 3LRKA 4M7SA 5CPSA 4W84A 3B9DA 4S23A 1AFSA 1NFPA 4UBPC 3EX4A 5DRCA 5HWJA 1RXOB 1V3KA 4HTYA 3LN3A 1Q45A 2HJPA 4PYSA 2W63A 2VQTA 4QCFA 3PHAA 1W31A 5M3WA 3RO6A 4XBKA 4A05A 4AD0A 5FD0A 4X63A 1W1IE 2PDFA 2QCGA 1KXVA 3C8NA 4GQBA 4AIUA 4I6VA 2WW5A 3H7UA 1GQIA 3CLMA 1E6QM 2GWNA 4N2YA 4MY8A 4AWTA 2CZEA 2JEPA 4GZEA 3FOKA 1DXEA 2JBMA 4PUMA 3P0WA 3S0CA 1J12A 4YLWA 3N2BA 4R9OA 3S2NA 1VBUA 5AOUA 4U31A 1E3ZA 1VBGA 3T0CA 2FH8A 3HZ3A 3MMUA 1DVJA 3G1YA 4PR4A 4LYQA 2V5KA 3F2CA 4RR4A 2C15A 5G1YA 3U5UA 3APTA 4TVUA 5D2WA 3TN3A 1UR1A 3ZJ8A 2VEFA 2NQ9A 3CIXA 1V6XA 4AD1A 4TOQA 2O56A 1H61A 1SW7A 2PDMA 1RCQA 3GTXA 1Z7AA 2IW0A 4C6DA 3TQPA 3W01A 3TTSA 4G7FA 2OU4A 3A5FA 4P2VA 3NQDA 1VF8A 4TUFA 3UJRA 4C6FA 4KMQA 5AYYA 3Q67A 2YBTA 4C6BA 2V5JA 1UD4A 1YLVA 3L0KA 4QROA 3TTQA 4FIQA 3DECA 1H09A 5BXTA 1EYWA 2O4QA 1JYVA 2B7OA 1BXNA 4EKJA 5G1TA 1F3EA 2ZBTA 9XIMA 4GYPC 5JQ9A 2X0HA 4WD0A 1XDJA 1WKYA 3KOYA 1BTCA 5HANA 5KEZA 3GDRA 5DCEA 4DUOA 3W1PA 3LHWA 2JALA 3PP7A 4O4VA 2NV9A 3VXGA 4L9XA 3P62A 1B3VA 1GZJA 5A3HA 1W17A 5C8BB 2J88A 1XKYA 4F66A 3KP1A 4DBWA 1EB3A 4HIBA 3VOIA 2P8BA 2A6LA 2OTDA 4ZO8A 1PB0A 4DWSB 2PDJA 5BXSA 1K4GA 4P8UA 4CQ9A 4Q4QA 1PIIA 1HVXA 1NFGA 1R2TA 2OG9A 4I7UA 4HU4A 2HVOA 3XISA 1S5NA 3WLHA 3PAOA 1GPWA 4QIUA 3R0UA 2V2CA 3MP5A 4S2CA 3W07A 2OOGA 4PTNA 2DV0A 2YYUA 5LIYX 4QQ3A 4Q6XA 2YL8A 4LW7A 3WDRA 3C61A 1WPCA 3N17A 3U5YA 4QAIA 3A3WA 4KWSA 5JU6A 3UJSA 2YZ5A 3DENA 5DT7A 3LQLA 1IXNA 1KCLA 5A8OA 3W7CA 3CNYA 4HU3A 3DI0A 4K7YA 4ZE4A 4MJ2A 3B8DA 1AG1O 4C65A 1Q8AA 4GWEA 1P6CA 2Z29A 5AHMA 1P5BA 3WDJA 3B0PA 4PCFA 4CD7A 3CZGA 1YBQB 2GVJA 4LS2A 4KIRA 4S3DA 3R0KA 1F4HA 2OX4A 3FN9A 1Z3NA 1A50A 5KITA 1SFLA 4A2RA 1EJUC 4DBUA 4LV4A 4US5D 4RZ6A 5IXEA 2DZVA 1NVMA 4U4MA 4LRSA 4TV6A 3G0UA 2VDIA 1B5TA 5FKYA 2ZXQA 2MANA 1FWNA 3PN8A 4B5VA 3CXOA 5A6JA 5LHEA 3WF2A 1V93A 3P2VA 2OXNA 4S39A 3W2LA 3NL3A 2QF8A 3WMBA 4AZCB 4FNTA 3WNLA 3F03K 4YXGA 3D3FA 2VZSA 2ZDRA 5C71A 3GXTA 4CN1A 2WPBA 1F05A 1LT8A 1HJUA 1ML1A 3UNDA 1TG7A 4DXVA 4LANA 4F9DA 1C9WA 3IJQA 3ZJKA 4D1IA 4GZJA 2DY3A 4IFKB 4LALA 1XM3A 4N02A 3C56A 3ITLA 3THCA 1Q63A 3PB0A 3OVGA 6REQA 4FNSA 3C2FA 5TQLA 3DYMA 4A6GA 4AEFA 3CH9A 2E5BA 3G18A 1RA5A 3EB3A 3MSDA 3VE7A 3VGHA 4POCA 4LY4A 4C6NA 1F61A 4JN6A 3BC9A 3WDQA 4NY2A 2BY1A 7CGTA 1EXPA 2V6AA 3BUVA 1UKQA 2XM2A 4W7WA 2CNCA 3CIVA 4NXSA 5CZKA 4NZFA 3ZR4A 4K8GA 3GYEA 2W62A 3W7LA 1XYCA 2VEKA 1KLYA 3AAMA 4Q7NA 1HZYA 4LSBA 4AF0B 2LLEA 3L66A 4YTTA 3H2FA 1Q66A 3QW3A 2ALDA 3W37A 1F3XA 4XBJA 1NFBA 4GC4A 2NXIA 2VCCA 3S9IA 2V5CA 4U2ZA 1H7XA 1ALDA 1P1XA 1J18A 1WZLA 3DBNA 1D8CA 2FVKA 3S5NA 5EY5A 3LTPA 4Q22A 2OZTA 4KW2A 1XCXA 4P8VA 1BEUA 3QPEA 1JPIA 1TTQA 4LX4A 2OZ0A 4MWAC 1OVDA 3POCA 1EQPA 4ZOEA 1C7SA 4M6PA 3MSGA 3W1AA 3LDVA 1J0JA 4LAUA 4HZ6A 2CLIA 4L5ZA 4RDZA 2VR4A 1IR1A 2AL2A 3F2BA 1PBGA 5FACA 4RE0A 3TYAA 4GVIA 1K8ZA 1E4LA 3H54A 4HNOA 1EJSC 1FWWA 4WSKA 4GY0A 4E2DA 1AZ1A 3GG7A 1GTHA 4CCEA 3OU8A 1H49A 1V3IA 2OSYA 3QY7A 3GTNA 3W1QA 3ZR5A 3V5FA 1UD5A 3IV3A 4F79A 1TV3A 2WMHA 3NO1A 4L65A 4M1BA 2HNHA 3AS2A 4WGHA 1NDWA 1YTKA 3KOXA 4L1GA 2BSLA 2VX4A 3BG5A 3O6DA 1ZFJA 4O14A 4GYFA 2RGLA 1O4UA 3WK1A 2RDWA 3STGA 4W93A 1VR6A 3UCDA 1F74A 3CZKA 3GH4A 1G0CA 1OM0A 5K9XA 1AMKA 2B31A 3EMCA 1TVLA 1XYLA 3WK0A 4H00A 1FWJC 4GOAA 2D69A 1OG0A 4AXNA 3AXKA 3OGVA 1WBJA 3MV11 4AYSA 3B8IA 4BEUA 2QGHA 4QRNA 1I0DA 5HOSA 4K36A 3Q45A 5B80A 3O6AA 4NASA 2EJAA 3MZNA 4IX0A 3FXGA 3E0WA 1L6YA 3P14A 1VZWA 3WH8A 3DFTA 1Z48A 1R47A 1V3LA 1JYNA 1D8WA 1JZ4A 4GFSA 4B91A 1EA9C 2OWXA 1OB0A 3R8HA 2IKJA 2VD8A 4EOUA 4LNYA 2CHNA 2H90A 2BB0A 2FVLA 3TC6A 3WCZA 4H9YA 3LOTA 1JEZA 2ESCA 3TAKA 2CLOA 1SZEA 4A21A 4V27A 1EFZA 3BANA 3FK4A 4YWSA 2WJEA 1MO0A 4HOZA 2E8ZA 4KH2A 2D24A 1E72M 1XBZA 3HG2A 4J2PA 2QVNA 4D71A 4YTRA 2OELA 2F6XA 2ZZ7A 4R5EA 2PWFA 2GOKA 3OGRA 5LKYA 4H41A 2NUWA 1B30A 3I4EA 2F6UA 5D9PA 4A29A 1OFDA 4UTMA 2PEVA 1Q8JA 1CWYA 3EPNA 3CUHA 1X6NA 4ZOAA 3QMRA 1E1CB 3C0LA 5IM51 3CPRA 3L0GA 3LTYA 2XDFA 3MVTA 3MSYA 1U1JA 2ZUNA 3FYOA 4FF7A 3U2ZA 1I4NA 1AW5A 1AJ0A 4YTUA 4Y2WA 5HJXA 2XH0A 3VNDA 4ACZB 5LIKX 2D23A 4F0HA 3W7RA 3LI0A 3QTGA 4E0CA 4GVGA 4UUIA 1LT7A 3HF3A 2WLZA 3UWEA 4Z42C 5FF0A 3OW1A 5H91A 3SFWA 3HV9A 3QY6A 4M81A 1ZBVA 3W7OA 2ZYFA 2Z00A 4PMDA 3IAPA 4P7OA 3Q65A 1XYMA 4H6EA 4EWJA 1US0A 1X8CA 2E67A 4REQB 4BF5A 5C9ZA 3G1DA 3QQ1A 2VC6A 3TV8A 5CBIA 1N55A 3VC5A 4C5ZA 2FQIA 1TSIA 5CSRA 4JPGA 1K9DA 1H1YA 1UQYA 3V75A 1J0HA 1H5YA 4QLJA 4DELA 4HU0A 3PG9A 1OZQA 2X2GA 4H3DA 1MNZA 1PV8A 3AU6A 4AISA 4KBXA 3AJ7A 1IT8A 2PODA 3NPXA 2PRHA 3W00A 1HN1A 2DZPA 2DFAA 5KTLA 1RVKA 3T1GA 1W1TA 1RP8A 1YQ2A 2CIPA 3TN5A 3LHTA 3BWWA 3CM4A 2SFPA 3EPOA 2FZDA 3EWDA 4CD4A 3PULA 1H7RA 1JVNA 1H50A 2Q09A 3JU2A 3VMNA 1DJWA 5LSMA 4QNEA 3GG0A 4W7VA 5D2XA 3UWQA 3C2OA 4BJHA 2G50A 1Q6LA 2HQAA 1AJZA 1TPDA 3GAYA 3U6WA 3KTSA 4ZFMA 3P81A 4IISA 3XIMA 5DEZA 1ZENA 5C7HA 1KXTA 3RAOA 4I9MA 2BTMA 2O7SA 5D37A 3W75A 3UD6A 4J9JA 3BOXA 3OTRA 4NI8A 5LA2A 3AI0A 3FCPA 4D6FA 5K4XA 2J7DA 3B9NA 1XYZA 1M9HA 5LHFA 3OOQA 4N7QA 1DTNA 2DT2A 3HN3A 2E3ZA 2QUMA 3G6LA 5A8GA 4X22A 1ISWA 5FOOA 1EP3A 5HAOA 3NYZA 3F4DA 4PTVA 3VGBA 3UZYA 2FKPA 1G5AA 3RLVA 1QATA 1XLMA 1W3IA 2HPIA 4GCAA 3UA4A 3CJPA 1LWJA 2X1RA 3ONCA 4LF2A 3LBMA 4PBFA 4H9MA 2VP8A 1AJ2A 2CETA 4HPJA 1SFSA 4ZMGA 4GLEA 4DHGA 2G37A 1XUUA 1RQHA 1FFQA 1XIMA 1GVQA 4H9UA 3AXXA 1DXIA 4FA3A 4F40A 2EPKX 3BJTA 3OG2A 5EKYA 1A5OC 1UASA 4GO9A 3B9OA 1KXHA 3STCA 1A0EA 3RO8A 1JI2A 3K8LA 2HWGA 3EDEA 1Q6EA 1KCZA 2CLKA 1KV5A 4LB3A 4O16A 2VELA 4QJ5B 1SZFA 1OT1A 2YFOA 3DG6A 3AHTA 1OF8A 4GMEA 2OVLA 3DESA 3CYJA 1D3GA 3K46A 3NZRA 3RX4A 3VPLA 4PSRA 2AKZA 2OSXA 1M3UA 4LUTB 3S8HA 1J0KA 3P8JA 1JCXA 3OVRA 4WDXA 1DJHA 4NZ3A 1BRLA 1TYGA 4I5XA 4JYFA 4ZQNA 3QN3A 4HSOA 4JYEA 4ZXLA 1E0VA 3KVJA 2OO6A 1OC6A 1KGUA 1M6JA 5CEWA 1RBOB 2L5HA 1TIMA 4DNMA 2FHFA 2TPSA 1ITUA 1VFSA 2XFRA 1XKJA 3GDKA 4GNKB 1V79A 4WKFA 5BOEA 4S3JA 4BR1A 2ZX5A 4UXDA 1W9DM 3NOEA 1FBAA 4P61A 1RK5A 1X38A 3RJYA 1KO0A 3V5CA 3TVAA 1YADA 3DHUA 1D3HA 1KCKA 1E56A 1OCQA 3FW6A 1SO6A 3UYIA 3IVUA 3C3NA 1VENA 3MMDA 5I3IA 1NM9A 3TU9A 3KDOA 4E8DA 5H2ZA 3SCNA 2DZXA 5EGRA 4IIBA 3ABQA 4CEXC 3TCSA 1M7PA 2Y5EA 1FRBA 4UR9A 1FP8A 5K9CA 1TPB1 1A0CA 1QPOA 3CWHA 3L2LA 2IPFA 4LAKA 1XLHA 4MKSA 3R79A 2WZMA 1A53A 1W9UA 3NQ2A 3NM3A 5CGMA 5IDIA 2AMGA 3ANVA 2Y7FA 4PCNA 3MI6A 5AZ0A 4K6AA 1T96A 3GNPA 2XM1A 1H5VA 2GVYA 1WKFA 3I6TA 5K9DA 1JCLA 4PRRA 1K70A 3AZSA 2PS2A 2YLLA 1X97A 2QNEA 4D8LA 4BY3A 2J4GA 1GVRA 1REQA 4YNGA 3ISIX 3KOZA 1NH6A 1M7XA 3FDKA 1QAPA 3UWYA 3TTOA 4MAVA 1ISYA 1V08A 3M0VA 3CT2A 2XHYA 3AHZA 3RXZA 1GWJA 1K7EA 3SUWA 1R2RA 4UQDA 2QHAA 4KRTA 3UG4A 2J13A 2OGJA 3FYPA 4JTJA 2DU2A 4GINA 1CT5A 1IYXA 1RHCA 3P74A 1XYFA 3KRUA 3EWBX 1BAGA 1GVFA 4YVPA 2YXOA 2GGEA 2Y24A 4MDPA 4HCDA 4L61A 4H8HA 1C8QA 4QE1A 3DFNA 1A47A 1NDVA 3PBWA 3EWYA 3QV7A 3L9CA 3ZLFA 1W2VA 1BF2A 1XLEA 5D02A 2C3ZA 1AQFA 1XWYA 1M01A 3GQYA 4FZIA 4JTRA 1UQZA 4I8DA 3VZZA 1UH4A 5C70A 4E4PA 5ABGA 1JDAA 3FEQA 4B92A 4AEEA 3TX9A 4XD5A 1ONEA 1HJVA 4OOUA 4MF4A 4PB5A 1O5KA 3THAA 2FDSA 3ARYA 1QR7A 3BLFA 4RW3A 5HNUA 2I5IA 3ZS4A 3BV7A 4RE3A 2EPOA 1O1HA 1U1HA 3G24A 4OKDA 2E28A 3BLKA 2OEJA 4D2JA 3V3WA 2D0HA 2ZRYA 5KZ6A 2EF9A 4NU7A 4QXIA 5CSUA 5G2WA 3EBVA 1K7FA 4DYKA 3EWXA 4M3PA 1QNQA 1L2UA 4KQNA 4Q4SA 5FA5A 3W1LA 3PUEA 1I0BA 4QSHA 1PZ0A 2GGGA 3G1FA 1MEIA 4TU1A 4ZQRA 3NO5A 3FJ6A 4JCMA 1L6FA 4QG6A 1YXDA 2A79A 5K7JA 4FOUA 3KHJA 3W7GA 3MDWA 3N34A 4QITA 1T6MA 4AC7C 1P7TA 3NFUA 2CESA 5CG0A 3LGEA 1WNOA 1NWUA 3GTFA 3GNOA 3R4IA 5EL1A 1YDNA 1OFEA 4JTFA 2ZUMA 4HZ7A 3KS5A 2PU1A 3MKVA 3BW4A 5BNKA 1SJAA 3PBUA 3T09A 2HPMA 2FMOA 1V3HA 1KM1A 4BQ2A 3M0HA 1HKMA 4UTIA 3M7SA 3TJIA 4KKXA 2AAAA 2HBXA 3T2OA 4QISA 3EX3A 1Q6RA 4AH7A 4CUCA 1B4KA 3KL5A 5RUBA 1W56A 4O4WA 3EPMA 2Y85A 3D47A 1ZY9A 5A69A 2WVUA 2OPJA 3PZNA 4IQJA 1XXXA 1NWSA 3CIWA 2EG7A 2E8YA 2PE4A 3ZJ6A 4O13A 1XDLA 2EG6A 1J79A 3G8EA 3TKFA 2WZTA 2PF8A 3H8AA 4PTDA 4JR5A 3PTDA 1JAEA 1SVDA 2WANA 4ACZA 5CLWA 3PBVA 4XV0A 4S3CA 2J27A 5IBXC 3WYZA 1KR1A 3C2VA 3FAXA 3HPXA 5I5RA 1KW1A 2B0MA 3DHFA 4XO6A 5C2CA 5A95A 2H3BA 2FJUB 2RJGA 4QCEA 4CCCA 3A22A 4UCGA 4B9YA 4AZHA 5J5DA 3N2XA 5TBOA 3WBEA 1PWMA 1HUVA 3DDMA 3KWSA 1TR1A 3GNRA 1LOSA 4UQAA 1JYWA 3NDYA 2X16A 4IH3A 5HBFA 3RJXA 4AWEA 4L6OA 3UR8A 3BOFA 2JE8A 1OX4B 2DIEA 1XICA 3TMLA 3WD4A 3SCPA 1N8WA 4ALDA 3EAUA 3DC0A 4FX8A 1DIDA 1P7TB 1C91A 1WX0A 1VPQA 4NT0A 3KCLA 4GC3A 3QMSA 3IEBA 1JPHA 4WDUA 1J2WA 1HL9A 3ATYA 1SZGA 4O18A 1SSGA 2HMCA 2BMBA 4JQAA 3WJYA 3PR2A 4BI7A 2F2KA 4DZIA 2H8ZA 1IEXA 2B7NA 2DDXA 1QHZA 2VX6A 3UG5A 1FH8A 3HOJA 3ARVA 2VC9A 4YL2A 4GIAA 1TV2A 1E6ZA 4GIEA 4DJDA 3UXIA 1I6NA 4JX6A 1O5XA 1UW9A 1TPFA 1YXYA 3NQMA 4HHLA 4A3YA 4FMVA 1MUCA 2FHBA 4ZVJA 1XLGA 4E8CA 1GHSA 1UR8A 2W67A 3NSMA 2GYIA 1GJPA 1RK6A 3O16A 3I6EA 3BSGA 2NSXA 1WZAA 2C71A 1ICQA 4CKQA 1YMYA 2X0SA 4G7EB 4J3SA 4BF9A 1O12A 2NT1A 3EOOA 1JDEA 4NUWA 3I7SA 1B31A 3W85A 1E15A 4DZHA 1CW2A 1IEVA 1ZRQA 4WJ8A 2AQVA 1W9VA 5G4EA 1JULA 3MBDA 3NXFA 3AYTA 4U3CA 2Q02A 4BKNA 4CNSA 4H6QA 2EKGA 1EWEA 1DHKA 4ZXOA 2WQDA 2DSVA 2RAGA 2XSAA 4DY1A 2OQLA 1Q5MA 3R8GA 3P60A 1QI2A 4JL1A 2CEQA 2GZXA 2X7VA 3K1GA 4QNWA 1M53A 1XDMA 6REQB 4NF7A 1SGJA 1TUFA 4HBKA 4JIRA 4NAEB 3OA5A 5H8PA 3O6CA 2QPSA 2YCIX 1BG4A 4LQ1A 5AECA 1MQPA 2E6DA 3N2OA 1YE4A 5LGZA 1W3TA 1G67A 5F2IA 4AZBA 4AG0A 2P5NA 3WJZA 5CSYA 5CC3A 2PURA 3WNMA 3LV6A 2WSRA 1WA3A 3FA5A 4JTCA 1GZ1A 4O54A 3VNZA 1I2OA 3TDFA 3BXWA 4QQUA 1UOZA 4OT7A 3OB8A 5JIWA 4C7GA 1BKSA 2V38A 2CZFA 4QDWA 3CUFA 1S2UA 3W7IA 3C5QA 1VLIA 2EHHA 1Q2SA 3MC5A 3ARSA 3II1A 4A35A 2FB2A 3F4WA 1S1PA 1TIWA 1IGSA 1ZBKA 3CV7A 3ZVHB 2CBJA 6TIMA 1J10A 4UZSA 5AY7A 1QK2A 3DKLA 2D0GA 3FAWA 2VM8A 2YYTA 4C1KA 1UH2A 3E0FA 3GDTA 3CUJA 1QASA 5HPCA 3ATZA 3GXDA 3NGFA 4YN5A 2YX0A 1JD9A 3NL5A 1V3JA 1KTNA 2DIJA 3RFAA 5IDZA 4LUJA 3V4BA 4DF0A 2I7GA 1F2JA 2HSAA 2Z24A 5AYBA 3V0UA 2YOCA 3PF3A 4Y9PA 1FHUA 1QO5A 2RHGA 3VCRA 4H8UA 2CBUA 4MB5A 4MAZA 3DFOA 1X7IA 4HT3A 5CGQA 3W1UA 5L6UA 4PRTA 1MWOA 2BGQA 1DIEA 4QEHA 2VZOA 4NP7A 3AJXA 4PULA 1LTDA 1BVWA 1XRSA 1ONXA 2Q71A 1M03A 4PMYA 1TKKA 2YDRA 3F1QA 4Z0SA 2HV5A 2X1IA 4FO4A 4U28A 3WH6A 1R87A 1OYBA 4OQVA 1ADSA 4IXXA 4G56A 2CHOA 3W7KA 4RZ4A 1YE6A 2O9TA 5D38A 3WLNA 3FVMA 3PS7A 1GTEA 1E43A 3H4XA 3A24A 5CLTA 4GNVA 1E0TA 4WR3A 3DBPA 4NYUA 4W7UA 4NXKA 2J7EA 2Y2WA 4HKPA 2YL5A 3KBMA 3A64A 3AHXA 4W5ZA 1EUNA 3H2EA 1AUSL 4GUJA 2VEPA 1DJGA 4MTVA 3EA3A 4W8BA 3CB8A 4JZ5A 4UTTA 2DT0A 1EO5A 4FNPA 5HATA 4DZ5A 1Z6KA 3QHOA 5HXMA 1IIHA 3ME3A 4CNPA 1XLCA 4ZB2A 3VX0A 4XVEA 2F61A 2GFTA 1R9XA 3WF4A 1WV2A 2O9PA 2Z2AA 3OP2A 1V77A 1EP1A 2GQ3A 2Y70A 1NARA 4IIDA 1DQUA 3H24A 2HXUA 2XU2A 3RYSA 2XSBA 9RUBA 2R1NA 3VIPA 5DX7A 3I3DA 4F0KA 3E2SA 1OX5A 3WQWA 1A5AA 2V5BA 4EPEC 2FPYA 3EEZA 1ZS2A 4AHOA 4KCWA 3GU2A 1XLJA 3W73A 4KEZA 4F4RA 1WXZA 3REQB 1MW1A 1A5BA 2OLAA 3UNTA 1JNEA 1X8FA 4GCXA 1LORA 2HDJA 3GH7A 3E38A 3MUY1 3NVDA 4HN8A 4IGMA 4FOKA 3WJWA 1ZLPA 5IHRA 3AMCA 2F8QA 2ZVIA 4O19A 4WX2A 4H6KA 1P0DA 3CV2A 1KRMA 3N6QA 1ODZA 1JXKA 3RMJA 4AAJA 1OFOA 3BPWA 3MQTA 3ONBA 4DYJA 2PDUA 2ZE0A 3OLIA 3CUGA 3GVRA 1EDTA 1JIBA 3WBWA 3MPGA 1UZDA 3G3MA 1JQVA 4E4FA 2D1ZA 3SBFA 1ONRA 4TXEA 3GXFA 2DSKA 3FJ4A 1PWLA 4X2RA 3PZQA 4R7OA 1KBKA 1JZ6A 4TV5A 1VGAA 4R33A 4NRSA 4L4OA 2EKCA 1VJIA 3E2RA 2E6FA 3LMYA 1MW3A 3TN6A 2V3GA 3TOPA 1IZJA 1R3TA 1TV4A 3AS3A 3UF9A 2A3LA 2WXDM 4MYAA 2X1SA 3HPZA 1US2A 1N7KA 4H9XA 4GKTA 3N3TA 4UTHA 4MNMA 3HPAA 4DIAA 3LPOA 4LU0A 5C9XA 3CHVA 4QDMA 4IPPA 2VFHA 2Y6ZA 2V3DA 3GUGA 4ML9A 1TZ9A 3VD7A 1K3UA 3VFCA 3GVVA 5G4HC 1JGMA 1E4IA 3CHCA 3TR9A 3DC8A 3SN4A 2DP3A 4PMJA 3TYZA 3SIMA 2XVGA 2PLKA 5HWNA 3U0HA 1OABA 4NYYA 1U5HA 2QDGA 1BSLA 2ONEA 4JN8A 2XYLA 3OVQA 1F7BA 3N2MA 4Z2GA 1HX0A 3WNOA 2WCAA 4UMAA 2Z7KA 2GGJA 3ZFHA 2Z25A 2J62A 3MA8A 3A23A 4IWWA 3POHA 1OJXA 1JPMA 3ITCA 3MY9A 2WVVB 1TWIA 1NU5A 3OHMB 1GW9A 1AK5A 4XSMA 3EWUA 1KFWA 4Q4MA 3T0AA 1QHOA 2GGHA 3HMCA 1V6WA 2J8GA 4NAFB 3W4RA 1B3ZA 3S47A 3FHAA 3W2NA 4RDWA 3M9YA 3OEXA 1HVQA 3DXIA 5TF0A 2BBFA 3K1DA 3JZEA 4AUBA 2YGYA 1CXLA 4PMOA 3SCRA 4UR7A 4ZEPA 2EGZA 4OUIA 9XIAA 1Z89A 4ZQMA 2C79A 1HKKA 2H9AB 2QUVA 1HKIA 2Z6IA 3PUGA 3UVIA 1Z42A 4YYCA 1W54A 4JHMA 4RL3A 3AMKA 1NOFA 4KERA 2G3NA 3P84A 1HFBA 4S2BA 2J9ZA 2Y62A 3G0XA 1GHRA 4FX6M 4BI6A 4OGZA 4UQCA 2NT0A 3W24A 3L2IA 3UGRA 1ZALA 3QYQA 4M1RA 4FP1A 3HJEA 4GYPA 1I2QA 2TYSA 4CNOA 2BNJA 3GIQA 2QIWA 1UG6A 5KSWA 1S2WA 2EPNA 5SWUA 1DJIA 1ISZA 1QI5A 3QPZA 1ZGDA 1IV8A 1PX4A 2PTDA 4MADA 3G0SA 1TRIA 1EGMA 3RLHA 4FR1A 1JPKA 4A4AA 3CU2A 5FJJA 1K1DA 5D09A 1SYTA 2HS6A 2RUSA 4PUUA 4WEVX 5CPLA 3TJLA 1VIZA 1BXBA 3V0TA 3DI1A 2INZA 2Y1HA 3BSMA 4Z2KA 1SUXA 4HHHA 1BWKA 1VC4A 1C8YA 1OX6A 4F48A 5HA7A 1H63A 4NHVA 2VRKA 5LXEA 2RJHA 2VYOA 1PEZA 2ZC1A 1WDPA 4PCPA 2MUCA 4G6CA 4UFLA 4M6QA 3IGXA 1FWFC 4DVOA 3E2VA 4CGTA 4JEQA 3HQPA 3W1NA 3PVFA 1BRLB 3AMLA 5D8ZA 4ILSA 1BYCA 1J01A 1GOOA 3PY2A 5JH2A 2XN0A 5EBAA 4JQ4A 2OOFA 5FSDC 4HNLA 4JIQA 4HNCA 4LGXA 4ZB5A 1T99A 3BQ6A 4GJ1A 1C7TA 3RK8A 2ZXDA 4QBXA 2PDHA 1W9BM 3LCXA 2F6KA 3T0BA 4PODA 1NP2A 2WAGA 4YVXA 4L4MA 4UNLA 2MNRA 4GY7A 3W3OA 2IQ0A 3AOFA 1S2AA 4C6QA 3NOYA 4U5KA 1LCOA 1E6XM 1YTDA 4YVVA 3B8TA 4UTWA 2DZBA 2GWGA 3T7VA 4PMXA 3VZYA 4JTTA 4DO4A 3UJEA 3RPTA 6PTDA 3TZNA 3ZIZA 3NQ7A 1BTMA 1EDGA 4H4IA 2PWGA 1RD5A 2FIQA 4O11A 3N29A 3PPFA 2W91A 3W1TA 2VKZG 3LX9A 1XIDA 1P6WA 5CGTA 3WELA 2NUYA 3QGAC 1BQCA 3I65A 3NWRA 1TCMA 1MUWA 1IEIA 3SIZA 3KDNA 3BJSA 4GUFA 4JDBA 3MWAA 4YCOA 3VUPA 4Q8NA 1KBBA 1L6GA 2R1LA 2Q6ZA 1DQXA 3STPA 3KOFA 2Y0FA 4H9VA 2E5CA 3ZVHA 4E2OA 2WMIA 5TAOA 3N19B 4YCPA 3RIKA 2OQYA 1IEWA 1UCWA 3NPUA 2YW3A 3H6OA 4IJRA 3NO3A 1UZ1A 4PEEA 2NQHA 3RGTA 1BYAA 1G4EA 3E2QA 3I3EA 3EKLA 3T55A 4BQ5A 3U3HA 4O28A 3VE9A 3S4TA 4EPKA 3O06A 4DUVA 3RX2A 2WMJA 1LBMA 1PS9A 3QV6A 1RQEA 4L9ZA 3E12A 4I8YA 2R1PA 4RV8A 1V0KA 1MDLA 4HP5A 4ZL1A 3APYA 4PUNA 3LCWA 2V2DA 2G3JA 3CL8A 1LP6A 5A2BA 4RZ5A 2A21A 1TFVA 4LUIA 3L4VA 3UERA 5XIAA 4AEOA 1BGGA 2JEQA 3R1ZA 2C6QA 3M44A 4RDVA 4EF8A 1P0BA 3NZ1A 5FESA 3HMJG 1J96A 1XC6A 2J9XA 1DIOA 5E0KA 4AIOA 4MVAA 2ACQA 1FA2A 2BHUA 4DUWA 3O07A 2VEIA 2E9BA 2FHCA 3CGTA 5CG7A 4HU8A 4BK9A 1Y65A 3R0DA 4JNZA 2XWEA 1ISVA 4JY9A 3QJAA 1UWSA 1F9CA 2B4GA 3WK3A 1CXFA 3W1XA 1QMLA 3GNDA 1N2VA 2E5DA 5LA1A 3LMZA 1QFEA 3ABRA 3AZTA 4C6OA 4GABA 5GJNA 4JIEA 5I09A 4LVGA 4WDWA 1XPGA 3DGBA 1BKHA 4NJIA 2ZIDA 2YCKX 3VDCA 4J40A 2VFIA 1B90A 3E74A 2YCLB 3VUSA 3WLOA 3SAZA 4HK6A 1ZBWA 2DGAA 4C6JA 4D6CA 2CERA 4O1BA 3VM7A 2VVSA 3OO2A 4DJFD 3NNTA 1NELA 1ZAIA 4KWVA 4XIAA 2BX7A 4P7NA 2WZEA 2X0YA 3M0LA 5MKGA 4CQCA 4WK9A 3URQA 1Q4WA 3MWCA 4OIFA 1SZRA 2DUXA 3NSNA 4GVHA 3ITVA 4ZGYA 3PG8A 1H4PA 4N42A 1XIHA 1JQXA 4EXAA 2WJDA 3WENA 1NAL1 4PMVA 4DWSD 3IIOA 1DPMA 2FB3A 2NQZA 1CGTA 2UY5A 3CTTA 3S5ZA 2DZTA 3RX3A 3PAJA 1S1RA 1EEPA 1S3TC 2RKXA 4N6EA 1I1XA 2E40A 4EF9A 3IIZA 2PBGA 3T08A 3CAKA 4JYDA 2QGYA 1S2CA 3WZ0E 4MWAB 4LCRA 3OPSA 1LWIA 5DBTA 5DO8A 3VU2A 1NP0A 1OCJA 2A3BA 2Q01A 1A5MC 1FX6A 5AC7A 1QW8A 2P53A 4AZGA 2XUCA 1SR0A 3W53A 3TLLA 1VKFA 4CN4A 7REQA 1LYXA 3UY8A 3UA3A 5BU9A 3CUIA 1OADA 4V28A 1R3VA 1H41A 2I9UA 1UH3A 3LK6A 3ZOAA 3S1UA 1DOSA 2QJGA 4PA8A 4XKYA 1CGYA 3B8WA 2CZDA 3BARA 3QPYA 3W7NA 3W2KA 2PTZA 4MZ8A 1ME7A 3KS6A 3V0SA 2VHLA 1U1UA 5BMXA 2JQXA 1JI1A 2D2GA 3LU2A 1RPXA 1BF6A 2INFA 5GPRA 3WBAA 2ZUTA 4HPNA 4YHEA 3G1VA 3VIFA 4PUWA 1RJQA 1J5SA 4HN4A 2PWEA 1KBJA 4PCTA 1E6SM 4ZENA 3CH0A 3EDFA 5DELA 3CO8A 3LHUA 3JRKA 4XAGA 3RMEA 1ZTVA 3R94A 3QR3A 3DHPA 1TREA 2QCDA 2WNWA 1YBQA 2JIEA 1AZ2A 3A4XA 4IL2A 4RCXA 4EXBA 4C6LA 4H7CA 2QJNA 1JZ7A 1KTCA 1QCWA 1W1A1 1EDQA 2J7CA 1AMYA 3VNYA 1VYSX 1OGSA 1TQXA 1XISA 3RCNA 2ZICA 1CIUA 2ZX8A 1G4SA 1KXQA 2Q3OA 3IK2A 4MPQA 2TAAA 4I7VA 1KC7A 3S1VA 5HNTA 3T0DA 2POTA 2IXUA 5GVJA 3WQOA 2WK2A 5AC4A 4M8UA 2BV9A 3GR7A 1UWUA 3EX1A 3SI9A 3H23A 1GYNA 3LUTA 1QJWA 2GQAA 4U5IA 4AF0A 3WQEA 1RAKA 3W81A 3SRHA 2JFEX 4JTDA 4W85A 3VAVA 1GYMA 4MB1A 1XLAA 1MMFA 4GZ7A 2ZX9A 5A6TC 2PTWA 2ZOXA 3QTPA 4MWAD 2DVTA 1CXHA 1OFPA 3ZZ1A 4OJYA 2PC4A 2YBVA 5CQ1A 1I45A 2FZMA 3SCVA 3PZIA 4DN1A 3ARUA 2ADAA 3CWOX 1AQMA 3QHMA 5HPOA 4XKYB 4PN2A 2AL2B 2O9OA 3L5MA 1W91A 4MMWA 2OFJA 3VOJA 1TJRA 4GIYA 2D73A 5D05A 3UZ5A 1CXIA 2FGBA 4XZLX 3NZPA 4UTFA 4MM1A 4AB4A 3S1GA 2FGLA 5AZ1A 3UW6A 1E0XA 3PZ9A 3R11A 3CAVA 3HTWA 5GNZA 4E6MA 4PC8A 4DJEA 5FJTA 1GCYA 1O68A 4DJED 1QOXA 1O7AA 4JTGA 3N13A 2NLYA 1TPUA 4Z2JA 5E6YA 3MI2A 1XLFA 5AYZA 4MUPA 3LG3A 1SR9A 4RW5A 2NWSA 1CCWB 4EP8C 5EMMA 2VGIA 4D6GA 1HKWA 3WLMA 3GD6A 4A3QA 4NAEA 3WF3A 4ATLA 4LAMA 3ITYA 3QV9A 1PXGA 4JQ3A 4INFA 1KGWA 3AISA 3NGJA 4Y96A 3WO8A 1JRBA 2V81A 3UXDA 5A6BD 2BDQA 1NY1A 2XISA 5E93A 4LT9A 1WUEA 5A6BA 4XVDA 1RA0A 4A8NA 4RE4A 2ZA2A 1JF6A 3NA8A 2AQOA 2CBIA 3WLQA 3S1WA 3LBOA 3NEVA 5C9WA 1PVNA 4O1FA 3BQ5A 2XFYA 1A80A 1Y7VA 3EWZA 3W27A 4OE7A 1QVBA 3HPFA 1WDRA 3ZT7A 3WLSA 2HBVA 1K9FA 1CNVA 3W86A 4JTUA 1CGVA 1REQB 4KWOA 3AMDA 3CS2A 3M5YA 4Q6JA 1RVGA 1R7AA 3BH4A 2PU0A 4DX3A 4AMCA 4M80A 3NQBA 3ABXA 3WQ5A 1FTXA 1XLDA 3H53A 2QR6A 4EANA 3ZQ9A 4ICMA 4JKKA 1I60A 1F8IA 3ZWTA 1Q6CA 3H22A 1AL8A 1A0DA 5DXXA 2VGGA 4AZ6A 1LQAA 4LEQA 3L5AA 3W72A 1JZ8A 1GQKA 4DBSA 1F3WA 4QE5A 5A8PA 3MP3A 3CTLA 2VUNA 4HJFA 3G77A 1G01A 4NZ1A 1HF6A 2ZA3A 3N04A 3TA9A 5CJMA 1IF2A 3G1RA 3VCNA 2FLIA 5AHIA 3THQA 2F84A 2C0HA 2R9RA 2V68A 3NQFA 2BGNE 4ADUA 3MUXA 3QLLA 2HRWA 3VNMA 3ZM8A 1V7YA 3BAJA 2C1GA 1U83A 3WLTA 5DY2A 1Y5XA 4FNRA 3UZXA 3LM3A 3WQVA 3VD3A 1SMDA 4DWSC 2V0TA 3WFZA 1PHWA 3GXMA 4DJEC 3N1AA 1Y8BA 2Z2BA 1YDVA 3VIIA 1SW0A 4PTXA 3SN0A 1VCGA 4L7ZA 2UY2A 1XH1A 4IL0A 4PUEA 2GJXA 3BMWA 4WXZA 4LNCA 4PTMA 1EH9A 2PTYA 2X30A 4IT1A 5EYWA 1OCNA 1QNPA 3TIMA 1LLWA 2CXEA 1NOWA 1XLLA 4MDOA 3N4EA 2QJHA 4MNKA 4HZ8A 4KRZA 3NL6A 1RJRA 1N8FA 4N4PA 3EXTA 2D2JA 3WQ4A 4NZCA 1D3CA 2KX9A 2ZVRA 4HSNA 3L67A 3VNLA 4M56A 3C52A 3C2EA 1MXGA 2JGQA 4GXMA 4OFCA 1GK8A 4J4KA 2VOMA 4GGHA 3M0XA 4TR9A 2A7RA 2NX9A 1G94A 3LA4A 4DO6A 1W5PA 3BAIA 2YIHA 3L4YA 1CBGA 5DFAA 2G95A 2WMIB 1VBHA 2OWWA 2Q8LA 3VKKA 3N3MA 5ABEA 1DORA 4I3GA 3VOCA 2UY4A 2PPGA 2HISA 1VIWA 4UOJA 4KFPA 1UR9A 1J4EA 4PL2A 5HDRA 3NVTA 2WCGA 5F1VA 3ALFA 1X1NA 2WM0A 2FJKA 3P6LA 4XZHA 3M0ZA 3GC4A 3I7QA 4GI8A 2ZFAA 4XBSA 2F2HA 3IGUA 3PPGA 5AHNA 3BLPX 3HV8A 1EKOA 2V69A 3TEVA 1XBYA 3KZPA 2FGZA 4ZO7A 4D6HA 1UMYA 3IJ8A 5LNWA 4FI4A 2Z1SA 4IG2B 5I3HA 5F2LA 1GOKA 4JQ2A 3AO0A 3RR4A 1EPVA 1PDYA 3TUUA 1YX1A 1L6WA 4YYFA 1OT2A 4GH1A 2WSQA 1A49A 5KETA 1KA9F 1X1OA 3KZSA 1B57A 1ZSXA 1M41A 4S1FA 3QV8A 3KE0A 1K8XA 4GK8A 4KIEA 2V63A 1I1WA 2NWRA 3TWBA 4PMRA 2BS9A 3QKZA 1CXKA 3H2OA 4OVXA 1THFD 5E9XA 7TIMA 4UFJA 2FTYA 4C1NA 2OMAA 4I5RA 3M64A 4DUXA 1TV8A 2PGFA 2BG5A 4UOZA 2PZNA 5I78A 1H7OA 1OFBA 3H70A 2ZADA 3V36A 3MCNA 2ZQ0A 4HVXA 2GJRA 3WDPP 4YTSA 4CVUA 4NVTA 1KQYA 5LNRA 4J3WA 5E0FA 4HHPA 3W28A 2G3FA 1VB9A 1ZAHA 1B3XA 1EC8A 4M6VA 4KEVA 3HQOA 4XG1A 4RNHA 2EPLX 1K03A 4C6MA 2VVNA 4LB4A 2TMDA 2DORA 3LRLA 3F2DA 3LHVA 1ME8A 3PSVA 4MZ1A 4MSSA 3L7RA 2VDHA 4IFKA 4HOWA 1KNWA 4IMAA 5E1QA 4I5UA 4UB9A 3LXCA 4MWAE 4FXJA 2QJIA 1FP9A 3ZLHA 1XIGA 2G8ZA 4HJWA 3U48A 2WKGA 2VR5A 1T0OA 3CAQA 3PTQA 4FXSA 5JH1A 3PBGA 1VBRA 5HWMA 1T40A 1PKMA 1E9YB 1CX9A 5BZAA 5AYIA 2IKHA 1IEQA 1W32A 5KZEA 2P0IA 1KRAC 4IF2A 4DRSA 1SO5A 3AXMA 2E9LA 3W23A 4IFOA 2EAWA 4DWDA 1LQ2A 2EBNA 3RRAA 3KTXA 4ZSTA 1K4HA 4X2PA 3NQCA 2FTWA 2NQLA 1H60A 1UC5A 2W5FA 4ICCX 1GGOA 1TWWA 1KCXA 1CYGA 3ARTA 3GNXA 1K9TA 2VRQA 3SDOA 3SECA 2GDUA 4WQ6A 4AWSA 1C90A 2OODA 4S38A 5J8LA 4EAMA 1V02E 4HMCA 4O57A 3TCEA 3OLEA 5G2IA 2YZRA 3ARRA 3NJ3A 2GSHA 2OX1A 1VFMA 2E6YA 3BLEA 3JVAA 1E6RA 1WAWA 3SR7A 1RLCL 2C0AA 1W3KA 1GYLA 2NX3A 3AHYA 3WEOA 1KQZA 5LXXA 4NJGA 3CQJA 4YMZA 1S5MA 3W87A 3A9BA 2GJXB 3KOWA 3NPWA 2BGSA 1EX5A 5ECVA 4V2XA 4H1ZA 2VC5A 1XINA 3WUGA 1E55A 5XIMA 2FVMA 1XJBA 3N11A 5JMUA 3VA8A 1W5OA 1GOMA 1VFFA 4QE4A 1PZ1A 3WSUA 1OFRA 1F8MA 2I5GA 1ADDA 3QHNA 1Z69A 1V51A 3IS4A 4XD3A 2ZDSA 2OCZA 3TSDA 1WAUA 3SN1A 1HKVA 4UFKA 1QNOA 3IK4A 2INEA 4TVDA 2VL4A 3IUIA 4B3KA 4MGGA 5IFTA 3TYUA 2QCMA 2XIOA 3OJGA 4XO7A 4IIEA 5HJYA 3UETA 1LBFA 3HB9A 4RNIA 3TROA 1EHNA 2NQ5A 4ZE5A 2CZVA 3NTYA 1W1YA 4K2SA 2EPMX 4GPNA 3FGCB 5C55A 1ECQA 3C6CA 3KX6A 1Y5VA 3K8KA 4IUGA 1FVPA 4EIVA 1UJPA 5FL0A 1M7JA 1A5LC 1BWLA 1PTDA 5FAGA 1NDZA 1UD6A 1UPMB 4XAZA 3A3XA 1NIUA 1UIOA 3GKFA 3WUBA 1LJYA 1C8XA 3WMCA 4C5YA 1KB3A 3S5YA 3VDGA 4QR6A 3WFLA 3PZGA 1YTEA 4EXQA 3R43A 2FFIA 3W7HA 3V35A 3WLIA 1EBHA 1FH9A 3GZ3A 4AIEA 1E9ZB 2X1UA 5FEXA 1J0YA 1KGXA 1B2YA 2XPKA 2HVMA 1BVZA 3IVSA 2NXHA 1PTAA 3BGGA 3RU8X 3SY5A 3EKGA 4O52A 1GEQA 3D3AA 3HG4A 2YBUA 3PUDA 5DQPA 2CLHA 3VIHA 1XHGA 4ROPA 2J7GA 1KFJA 4PSPA 1V4YA 1N8IA 1RBLA 2DQXA 2FTPA 3RN6A 3ZO9A 5ABHA 2AKMA 4XZBA 1OK4A 1B9BA 3P67A 1AA1B 3KBSA 3LGDA 1B1YA 2NV2A 2XN2A 1XIFA 4GIRA 5CBBA 1E70M 5M5DA 2HE5A 3QQWA 4Y6GA 4I7WA 5DCDA 3TYDA 5FF2A 3DKJA 3IJDA 2QQ6A 4OV4A 1PKLA 1KM6A 3E49A 1I2RA 2WVSA 1OFAA 3B9EA 1TMLA 2ACUA 1V6YA 1OBAA 5DMMA 2Z1KA 3DFSA 1E5NA 1XGZA 4JICA 3M0JA 5CJ5A 4E38A 4QJ1A 3GY1A 1FDZA 2ANUA 4PL1A 1TX2A 4W8LA 3N6HA 4IOTA 4JX4A 5HMDA 4NX0A 2ZZ1A 2IPWA 8RUCA 5IHSA 3P7YA 5I0DA 5REQA 3A4JA 2O9RA 3BGAA 4WUIA 5EB8A 3GAKA 4AVNA 1WUFA 1Q3NA 2OR2A 1L6SA 3R8RA 2PTXA 5FJOA 3VIOA 1OSEA