3W1QA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with nl-2
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with NL-2
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 104
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w1qA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w1qA01
3PC0A 4CCDA 1W5NA 3GDKA 1HUVA 1MSSA 1Z42A 1OK6A 3C0JA 3FOKA 3FS2A 5BMXA 2QUTA 3PG9A 3EKLA 1NF7A 1SW0A 3F4WA 4DELA 2BSLA 3SGUA 3KVLA 1L6YA 1VR6A 5LSMA 4AAJA 5D09A 5I3IA 3W1RA 5LHFA 2WPBA 5AHNA 4CCEA 3CPRA 5D2YA 3FYPA 5A8GA 2RHGA 4JTIA 5BW6A 2Q8ZA 4ADSA 1SZFA 4UFKA 4PCFA 4CNPA 3DGRA 4R53A 3S6DA 3NQ8A 1W5PA 1GPWA 3TROA 4M6VA 2YZRA 3T4CA 1LOLA 5LHEA 1XM3A 2BZNA 4OQVA 2A7RA 2ZA2A 4LVGA 3W88A 2CZDA 3NQEA 1H63A 2WSQA 1W3TA 2X2GA 3NQVA 1H1YA 4UFHA 1SR9A 3I6RA 4ONVA 1SPQA 3R89A 3UD6A 2QUUA 3BW3A 3LTYA 3VE9A 1DHPA 3E12A 1R47A 1W1ZA 3INPA 1KLYA 2Y7EA 2JK2A 4IUOA 2YYTA 1S5TA 1FCVA 3WK0A 4UTJA 1TB3A 2E6AA 2CU0A 5EYWA 3G8RA 3LV6A 1UUOA 3S1VA 3G1YA 4HPJA 3MO7A 3OVQA 2QCMA 1HG3A 4TU1A 4RXFA 2VFIA 2ZTKA 5D38A 2V82A 2WNQA 1G7UA 2ISSA 2ZRZA 4HPXA 1ME7A 1UB3A 2CFFA 3NXFA 3NZ1A 4GUFA 4QNWA 1H61A 3LCWA 5AHIA 3IV3A 4X3ZA 5LNWA 3M9YA 3W85A 3NQMA 1RZMA 3TUUA 2VXNA 2ZRYA 3DAQA 4GFSA 3HG3A 1EIXA 4QSHA 2ZYFA 4FIQA 3N3MA 2BTMA 5AHEA 4FXRA 1IGSA 3R8RA 1SUXA 3IIPA 1G4SA 4O0ZA 3G1FA 4XKYA 5D33A 5LGXA 5G2IA 5C54A 3P5YA 1KW1A 4UTTC 3EX3A 1Z44A 4K6AA 3IEBA 2C16A 2O7SA 5FF2A 3EX2A 4WOZA 1H7PA 4B5NA 3LB0A 3MHUA 3NQ2A 1VHNA 1ZAIA 5F1UA 2EPHA 3MI6A 2YR1A 1P5BA 1QO5A 4O1BA 4RJEA 3M7WA 4IX2A 3G1AA 3HIJA 4IXXA 3PS7A 5E0KA 3N9SA 3C8FA 1P4CA 3OBKA 3LDVA 1ZENA 1LLWA 3DENA 3S1UA 1RQBA 1WDWA 3O6YX 3WJXA 5FEPA 1TQXA 2CLFA 1CI1A 2B7NA 2VFEA 1WXJA 2C0AA 1LROA 4HN4A 3GKAA 3M6YA 1LOSA 2RDWA 3GDRA 4N9DA 5AOUA 3BLIA 3PBWA 4CQAA 4A29A 1N8FA 2Y7GA 3LERA 1B9BA 2OT1A 4O54A 4AF0A 1SO3A 4XWUA 1FDJA 3USBA 3NYZA 2P1FA 5K4XA 4KFPA 5I3FA 4ZQMA 1WOBA 4NXKA 4UTMA 4EOUA 2Z1BA 3WJYA 1GYLA 1TIMA 3KRZA 4O14A 2CLIA 3DKJA 3L0GA 3ELFA 3P67A 4I7UA 3UWYA 3QQ0A 3B4UA 3CU2A 1L6WA 2HMCA 1JUBA 3TJLA 1GJPA 4ADTA 3L2IA 3CQ0A 2PRLA 4P61A 1M6JA 2R91A 2J24A 4ORIA 4A21A 3CHVA 3TSDA 5D02A 1BTMA 3W7JA 1DQXA 4FF7A 4UXDA 1NAL1 2FQIA 4AEOA 3LXBA 4LS2A 5E93A 2E09A 2DJLA 3S9YA 1S5VA 3PF3A 1TTIA 4R34A 3W76A 4J9JA 3VCRA 3UWWA 3K30A 1NFBA 2FPYA 5C2XA 3RLUA 3JRKA 1GZGA 1U5JA 1W37A 1DJNA 1AMKA 4MYAA 4RK8A 5AN7A 4UTWC 3F03K 4AVFA 1SZGA 4IMFA 5DCEA 1YYAA 1ZFJA 2H3BA 4JY9A 3NGJA 3BG9A 5G5IA 2YFNA 1TPB1 1ME8A 2VC6A 3PUEA 3EXRA 3OG3A 3UNDA 4QJ1A 2V30A 2QR6A 1TREA 5TIMA 3W2NA 3SR7A 4O13A 2NX3A 4QM1A 1RVGA 3V75A 1KFJA 5CGQA 2BXVA 1PVNA 2CLOA 1YTDA 4O17A 2CLEA 1A50A 1WA3A 2QEZA 2A21A 4YL2A 3OVRA 4GRSA 4U28A 2Q3OA 1GQNA 1ZNNA 4W9TA 4DPPA 3NQDA 4DF2A 3G1XA 4JTFA 4LVFA 3SZ8A 3S5YA 5AYXA 4Y90A 4O16A 5SWUA 5J5RA 3NZRA 1GTHA 3TH6A 4JGDA 2B0MA 1LBFA 1N55A 3N14A 5CPOA 4C1KA 3LTSA 4JN6A 1YPIA 1XCFA 1KTNA 4ML9A 3QW4B 2C18A 4UMBA 4LC6A 4Y9AA 4RZ5A 4N6FA 3W72A 1K7XA 2QCCA 5CPNA 3FEMA 2YXGA 4ZL1A 5FF4A 3N2XA 2J9ZA 3WK2A 1K8YA 2JKEA 3N9RA 3HGJA 5HNRA 1WAUA 5MHBA 2EHHA 1K03A 4X9SA 2ZRXA 1E51A 2E6FA 3O07A 3S42A 5AC7A 3NL5A 5FEXA 1XXXA 3M5XA 4EIVA 3M41A 3T55A 5HR6A 1D9EA 1GEQA 4TIMA 2NXHA 4UFIA 2YCEA 3N73A 2DZUA 1VJIA 4M19A 3Q37A 4O19A 2V81A 4M7SA 4NZFA 1N7KA 1DL3A 1KFCA 4NJJA 3VFLA 3L65A 4LVBA 3O63A 2PURA 1NSJA 3DI0A 1OFQA 4NJIA 4UMAA 5A5WA 5I3JA 5AYYA 3UY8A 4O28A 5CSRA 3G1SA 1IXNA 2YFOA 1VCGA 3HG4A 4N9BA 2JKPA 1J5TA 3CIXA 5EL1A 4WJEA 3EWUA 3HQ1A 3GVGA 1QOQA 2C14A 2CZFA 3ZS4A 4DEFA 4NJKA 3GXTA 2YW3A 3E02A 1W5OA 1EA0A 3TC6A 4AXKA 4CNOA 4GUJA 4PTNA 1TTPA 1O95A 2RKXA 3UWQA 3NDOA 3ATYA 1GVOA 2CZ5A 5EY5A 1WQ5A 1OFBA 1B4EA 1QMLA 3L68A 3L0KA 4FNPA 4Z1BA 4DBEA 3CB8A 1TV5A 2C1HA 3S1XA 3C4UA 5F1VA 3IRDA 2V9DA 7TIMA 3DFPA 2FTPA 4TMBA 2OT0A 1FXPA 2Z6IA 3CIWA 3M16A 4DXVA 3KVJA 5AYZA 5HWNA 1OX4B 3L67A 1FCBA 1T0OA 1VYRA 5AHLA 3NPWA 4K39A 2IQTA 1PIIA 4FNQA 1PE1A 2VEMA 4KWWA 2QF7A 2J88A 2QCEA 1WX0A 4O50A 1F73A 3W7GA 3TQKA 4JYEA 1T99A 2CLKA 3NR0A 4JYFA 4JTEA 5E1QA 3VKJA 3SGZA 3T40A 3M47A 1H5YA 3O6DA 4TR9A 3LRMA 3ANYA 2GVJA 1QAPA 4LS0A 1KM6A 4ZVJA 2H3DA 2NXIA 2CWNA 1TPUA 2G96A 1G4EA 3S5NA 1DJQA 1KBIA 1MO0A 1OX4A 2F84A 5KINA 1ICSA 3W7IA 3LLDA 2GPTA 4MLRA 3A5FA 1VLWA 4LU0A 3L5MA 3CLMA 4UIOA 1TYGA 1R2SA 1KM3A 1FWNA 2I9EA 3MHFA 3BGJA 3O8AA 1FCQA 5HR7A 1OYCA 2GOUA 2VOMA 5LNSA 3P74A 1K8XA 1KTBA 3EKZA 3PB0A 1YTEA 5IM51 1AL7A 1F76A 1JCJA 3ZWTA 2EKCA 1GT8A 2VEIA 4D2JA 3EXSA 5F4WA 3DFOA 4HNUA 1Z48A 2F7FA 3IGUA 2HTMA 1XUUA 1MXSA 1EEPA 2JGYA 3FKKA 5J5DA 2PRMA 2XN0A 3BK0A 2A1YA 4N9CA 4MOZA 4NZJA 2GQ8A 4QISA 3W75A 3W74A 3GZ3A 2Y7FA 4FX6M 1LBMA 3TE9A 2A85A 3NQ6A 3M5VA 3W7PA 2VEKA 4JX6A 3DFTA 5DXXA 3SW6A 3QMSA 1TPWA 1XC4A 4HNTA 3GXPA 2ABAA 2CLMA 3TSBA 4Z1CA 3TQVA 4QITA 1F05A 3THAA 2ZZ7A 1W54A 4O53A 4FXSA 3HPXA 1AL8A 1H7NA 2H6RA 1O60A 1Q6QA 1B4KA 1IF2A 4AB4A 5K9CA 4QAIA 4A3UA 1QPOA 3BW2A 3HG5A 3CEPA 1BEUA 3W1PA 2Y7DA 1YDNA 5D05A 2H90A 2NLIA 4O15A 1H51A 1NVMA 1SFJA 4BI7A 1OX5A 1JCYA 1Q3NA 1R30A 2NXGA 3UWUA 2OX1A 5K3VA 5LNVA 4GC4A 3HMJG 3MP4A 1R2TA 2VKZG 1H7OA 4UCGA 2Q8LA 4N6EA 3DHDA 4E2BA 2J27A 4KFOA 4R33A 2ZZ4A 1UCWA 1ICPA 3M5YA 1SZEA 4G1KA 4MUZA 4IGHA 4QIUA 4WXZA 1IXPA 3STFA 1GVFA 3GNNA 4O18A 3IIXA 2C13A 4WUIA 2DZVA 1P0NA 4WD0A 5CZSA 1HO1A 4Y8FA 5IBXA 3LBMA 1M7OA 2C6QA 1FX6A 3DFQA 4CLMA 1JRBA 3P7YA 3RFAA 2E6YA 4FB7A 3NQ7A 4O10A 2FPVA 2YPIA 1W31A 4OT7A 2C15A 1WBJA 5CZ0A 4BWLC 3G22A 3NPUA 3CWOX 3N2MA 1KLZA 3KRSA 4XTDA 4AH7A 4XKYB 3A9IA 2J6XA 3L21A 3WJSA 4JXCA 1G7VA 4M6PA 4RR4A 5F4SA 2E77A 1KM2A 3W7EA 1L9WA 1O94A 2WQPA 4NXSA 2E5CA 3GAYA 3N19B 3W7HA 2TSYA 1XBXA 4FX8A 3MYPA 3NQAA 3C2FA 1C29A 4X2RA 3RMJA 2B7OA 3TU9A 2WKJA 1UUMA 2V0TA 1O4UA 1T8XA 3W1UA 1Q45A 3W86A 4OV4A 3B06A 1HO4A 1W3NA 5DY2A 1GVSA 5FF3A 5GVJA 1LBLA 2E6DA 1EP1A 3TSMA 1OFRA 4FNTA 3W6YA 5EBUA 4M6QA 3R12A 3TIMA 1F6PA 1OFDA 2NV2A 3OEXA 4AF0B 4NVTA 4K37A 2ZFAA 1RQEA 1KV8A 3PBUA 2Z0IA 1GVQA 3M44A 3W23A 5F2GA 4RV8A 3HB9A 3DHFA 3BLEA 3PVFA 1JVNA 3W2LA 1VQTA 4XZ9A 4AHPA 2I14A 2CLLA 5H2ZA 4H4IA 4IPIA 5U7SA 2WSRA 1QDSA 5CZTA 5I3KA 3NM1A 4OU1A 4O8RA 3QSRA 4N4PA 3KXQA 4HKPA 3WFAA 1TCDA 3EWWA 3N34A 5KTLA 4BK9A 4M5PA 4RCXA 3NQFA 4LRSA 4UNLA 4JTGA 4XBSA 5AB3A 5CKSA 3C61A 4PL2A 2YSWA 2AAMA 4WX2A 4MPQA 4OGZA 1QPNA 3PBVA 4DQWA 5DBUA 3LCHA 4K8HA 2WJZA 1BKSA 1ZALA 3WK1A 3G1HA 2W0UA 3W7OA 2DZPA 5FESA 5HMSA 1KBJA 3CT7A 4UR8A 3LXCA 1VH7A 3W1QA 3IIOA 1WV2A 1XDLA 3DI1A 4I7VA 3NAVA 4U4MA 3E9AA 3PG8A 3STEA 2UV8G 5G1TA 1UASA 2ZZ5A 4H6KA 1A5AA 2GVGA 5LZLA 2ZA1A 4MY9A 5FEWA 1TPH1 2E5BA 4YLWA 1ZCOA 2H8XA 3QSTA 1GG0A 3LHUA 2ZRUA 1LRNA 4UTHA 1THFD 2QJHA 4DPQA 4IOTA 2A7NA 1ZAJA 2WNZA 5G4WA 4ZQOA 3HGOA 5F2IA 4HHPA 3DU0A 1I2QA 3W7NA 5G1YA 4ICNA 1TRIA 1R46A 5H91A 1XBYA 1T96A 3I7RA 4HSOA 4GUHA 1OYBA 3W7QA 1NEYA 4O4WA 4MY1A 1OG0A 2DZSA 4IMGA 3STGA 1G4TA 4K8EA 2GJLA 5FEZA 2A5HA 3P8JA 1I2OA 2V5BA 3FYOA 3QPZA 1F5ZA 1DV7A 5F4XA 3SFKA 3C2OA 1P1XA 1FUYA 2OCZA 2XFWA 3W1XA 1SZNA 3A5VA 3PWAA 2X1UA 1AG1O 5CSSA 2QCGA 2NUYA 1FDZA 4WZHA 3H53A 2YDAA 5AHMA 1H7RA 1DOSA 3C56A 3SIZA 2W79A 2EF9A 1GTEA 3C2VA 3AO0A 4E38A 4MLJA 2XN2A 3LCIA 3TAOA 3KOFA 1BWKA 2ZQ0A 4RXGA 3KVKA 1JCMP 4LWWA 2ZA3A 1H1ZA 1KM1A 3SJ3A 3VE7A 1H60A 1VZWA 2A6LA 4JTTA 4LUIA 2PC4A 4LC8A 2W6RA 3HG2A 3RK8A 5K9XA 4WOQA 3NOEA 4Z1DA 3EWXA 3E96A 2Q3RA 3U2OA 4AWUA 3EXTA 4Z08A 1K3UA 2VFFA 3O15A 3GK0A 4UNKA 2YW4A 1XI3A 2VFGA 5EKYA 1FWWA 1RR2A 5L6UA 2Z6JA 3C3NA 1M5WA 3I7SA 1QFEA 1XDMA 1SU5A 1PCWA 4IWWA 4LT9A 4O1DA 2JKAA 4ZQRA 2VFDA 3EX1A 3CM4A 4MZ1A 4Y6GA 3SY5A 4NU7A 1KA9F 3GDTA 3GNDA 3TMLA 1MEWA 3C2RA 3EWYA 4OWGA 1D3HA 3LCGA 3VI2A 1EB3A 1A5BA 2VENA 3W7DA 3KRUA 4TO8A 4GUIA 4TX9A 3GB6A 1TV7A 3L66A 1IIHA 4MKNA 4K7YA 3H54A 3M5ZA 1ICQA 3NQGA 4GUGA 5CPMA 1K8ZA 3P62A 3S5OA 2X30A 5I3HA 4H3DA 1G67A 3TKFA 1W56A 4JIQA 4UTUA 4JR5A 5BMWA 1JJKA 1LM1A 4EF9A 3W2MA 3BO9A 2OMAA 3G18A 3AJXA 3G1DA 3W1TA 4LW7A 1KM0A 2DZTA 4UFJA 2GUUA 1QR7A 1VS1A 3LHYA 1H7WA 2ZZ3A 3M0ZA 1OF8A 2VEPA 5DELA 1F6KA 1FWRA 5K9DA 1YXDA 2X1TA 5D32A 3MW7A 1QO2A 5DN1A 1JR1A 1I45A 2P0OA 3F1QA 3NNTA 1JUEA 2ZZ2A 3NEVA 1EUAA 1CW2A 3G8EA 3QZEA 2BLEA 4ZZ9A 3DXIA 2Y61A 3BG5A 4QNEA 3NPXA 3L0NA 2Y85A 5CPLA 3P60A 4RZ4A 1VYSX 1RV8A 5KZEA 5D30A 3W87A 2BWGA 1BWLA 4JX4A 4LUJA 1X8FA 3WJZA 5C6MA 2QCFA 4JTUA 3RNDA 3OHIA 3R5EA 3W83A 3Q2DA 4O0KA 2CZEA 1YADA 2X1RA 4AMAA 4WY0F 3LGEA 3MYOA 1GWJA 2QKFA 5HWJA 3DZ1A 6TIMA 4R7JA 3UZ5A 3PBYA 4WXYA 4RKAA 4NUWA 3BV4A 4ALDA 1B3OA 5AC8A 5K7JA 4L4MA 1XBVA 1WYIA 1HTIA 4Q32A 1XFBA 3G0UA 1M7PA 5AFDA 3OVPA 5AHFA 5T26A 2O7QA 3NA8A 3QJAA 1PHQA 3W70A 1EUNA 3B8DA 3G3MA 1U83A 4UTTA 2NZLA 5HUPA 3W7CA 4O57A 3NVTA 4CQ8A 1K02A 3B03A 3LHWA 3O05A 1V7YA 4IQLA 5D2VA 2G97A 4MZYA 4HSNA 1OFAA 5C5YA 2GVLA 3W2UA 4OHQA 1XL9A 1VCVA 1I2PA 1SO4A 3FA5A 3P5ZA 3QF0A 2EAWA 1B57A 2FDSA 1OFPA 1JRCA 4JEQA 2AGKA 3U6WA 3NL2A 1S3HA 2PE4A 1MEHA 3W73A 3R13A 4BR1A 3GAKA 4PFMA 4S1FA 2EGZA 4S2BA 3UXDA 1OJXA 1ZY9A 1QWGA 1X7FA 4HIBA 3GLCA 1OK4A 1SSDA 1KFEA 2QCHA 5HQEA 3UQNA 1FQ0A 4PODA 3I68A 5HWMA 4HT3A 4POCA 3HF3A 3W2KA 3G24A 3H55A 2WSYA 3W1NA 4WQ6A 5TQLA 4LY8A 1HFBA 3ABQA 3LI0A 5DLCA 2RDUA 2A2IA 4UR7A 2QDGA 3MWAA 2R8WA 1FWSA 4LS1A 1H62A 5KZMA 5EPDA 3EEGA 2GJNA 4NX0A 3O6CA 3VNDA 5EMUA 3UZJA 3THQA 4UTLA 3PB2A 3TR2A 1ZJIA 1OABA 3HGRA 1ADOA 1I2RA 3IIZA 3QEZA 4PC8A 1PCKA 3KAOA 2HSAA 3GR8A 1F74A 1YXYA 4UTIA 4Z0JA 1V5XA 3P61A 2PRHA 1QOPA 3LI1A 1F2JA 1TJRA 2X1SA 1UJPA 1IXQA 3G0SA 4NT0A 1W5MA 1LOQA 3TFXA 4S2CA 1TRDA 3EB2A 5ABTA 3ABRA 1AW1A 5FF0A 1RPXA 2ABBA 2QCLA 2NX9A 5CG7A 4UTWA 1CX9A 2FLIA 4A22A 1A53A 3ABSA 4K7VA 1TV8A 1OFEA 2G5WA 3NQCA 2FB2A 5TBOA 1IXOA 3YPIA 5D2XA 3GDMA 2ATSA 4IXHA 1G6CA 2DZWA 1DBTA 4MYXA 2NWRA 3TNOA 5DBTA 3LCFA 3RU6A 3CEUA 2B4GA 3G3DA 2XN1A 1GOXA 5G2HA 2A7PA 4MIMA 5D03A 4MZ8A 1SW3A 4JDYA 2I1OA 4IJBA 4N02A 3MBFA 4JY8A 2Y70A 3NL6A 5I3GA 2ZRVA 3C6CA 3GYEA 1Z41A 4NNCA 5FF7A 1OHLA 1W3IA 1AW2A 1A5SA 4OBTA 3ATZA 3TV8A 4NJGA 3MJYA 3PAJA 1YDVA 2Y62A 2X16A 2Z2UA 2QCNA 2ZBTA 1GYNA 1IIGA 2AQWA 4FO4A 3FJLA 5HUOA 2JBMA 5EA9A 2D73A 1SO6A 4MJMA 2TYSA 1LYXA 2E68A 2KZHA 1O5XA 3LCLA 4DF0A 1MZHA 1KFLA 3TXVA 3IVSA 2P10A 3P84A 3FFSA 5LGZA 5DXYA 3EWZA 3MMTA 4XTIA 3TAKA 3W2JA 2ALDA 2V2DA 3C52A 2V5LA 5D2WA 5DY3A 3DFNA 1HL2A 3LRLA 3DKLA 3U8GA 4BFAA 1X6UA 3MI3A 1JCLA 4IMCA 4O1AA 3QQ1A 3FIGA 4O12A 3W71A 2QUVA 1H7XA 2NX1A 4Q4KA 3S0CA 2BX7A 2GQAA 4BI5A 4Z1AA 3A24A 5U4NA 3PSVA 3WK3A 4JIPA 3A22A 4FNSA 5KSWA 3WJWA 4LTSA 3GKFA 4Q33A 4EVZA 4OE7A 1OX6A 4NX5A 3T7VA 1W5QA 3LX9A 4A2RA 3MP5A 4PL1A 4ORMA 1QPRA 1S5WA 1FCUA 2VELA 3GXNA 2DU2A 2RFGA 5D37A 1W0MA 2A0NA 1ALDA 4XUGA 5KMYA 4NJHA 4CNNA 1ME9A 4L4LA 3CC1A 3L5AA 3TMQA 2FB3A 3P81A 1XKYA 4DBDA 4NNBA 4O1CA 1F7BA 3TXZA 4ADUA 2R94A 4UUIA 3PULA 4E2DA 4PEKA 1FWTA 2YYUA 3A23A 2NUWA 1QCWA 3P80A 4N9EA 2QAPA 6ALDA 3QRHA 3SI9A 3QH2A 1DORA 4IPJA 4AWSA 2DORA 1O5KA 4ZQNA 4JICA 1ONRA 1AW5A 3CTLA 1L2UA 2HS6A 1TTQA 3M1ZA 3O06A 4OV9A 3W1MA 3LOTA 2ISWA 1LP6A 4FNUA 1EX5A 3E49A 4GNJA 4KWVA 3M43A 1WBHA 3Q94A 4JNMA 4ZQCA 4FNRA 1TTJA 4DO4A 1TQJA 4EWND 1OYAA 3UPWA 4Y96A 1JQXA 1KFBA 3I7QA 1MEIA 3T44A 3GR7A 1TJPA 2G95A 3HJZA 4MFDA 1YDOA 5C55A 1P0KA 3KHJA 1K7FA 3MP3A 3BARA 2E1DA 4YXGA 2Y63A 4WY0B 1W8SA 5LNUA 3MUXA 3W1AA 4JTLA 1KM4A 3IIVA 1SSGA 1YTKA 1PV8A 3QMTA 3LXAA 4RLIA 5K2ZA 5IBXC 1QNVA 4X22A 3TCEA 1A5CA 5D04C 3W84A 1YLVA 1KV5A 4LOCA 5FI8A 2QCDB 1D3GA 3EX6A 3QW3A 2ZZ6A 1J4EA 3STCA 3TDFA 3UWVA 3LHTA 3NPVA 1VPXA 3FJ6A 3W22A 2QJIA 3LHZA 3S1WA 3G1VA 3PR2A 3BW4A 1J2WA 4A2SA 2A4AA 3QC3A 4UMCA 4CQ9A 4WY0A 5LNRA 3UWZA 1VRDA 3GDLA 3I65A 5DCBA 1EWDA 5BRBA 3PSWA 1I4NA 2NWSA 1JUKA 3EX4A 3W7KA 2ZTJA 3Q58A 3TFCA 1LRQA 1L6SA 3OIXA 5HULA 1LDCA 1XBZA 3ZWSA 3W07A 4JTKA 1KTCA 3W3OA 4MJZA 2ZDRA 2QCDA 1JULA 3B0PA 1PS9A 3HGSA 5KZDA 3TA6A 4ZMGA 2NV1A 1FY6A 2ISVA 1C9DA 1RQHA 2ZCGA 2WV8A 3W7LA 3TJXA 3O1NA 3KFTA 1KM5A 2YGYA 2V2CA 3E0IA 1VYPX 3LBCA 4FX7A 2OJPA 3B0VC 1VGAA 1I2NA 2C3ZA 1GG1A 2ATMA 4IX0A 4M7TA 1Q6LA 1FXQA 2QDHA 3L9CA 3B04A 1UBSA 3LHVA 1DVJA 4I7WA 1DQWA 3V1PA 1ZAHA 1JCXA 3TC7A 1EP2A 1C8VA 3NG3A 1ML1A 5HINA 4JYDA 2R14A 3P82A 3PM6A 4MFEA 4AHQA 5K4ZA 2DZXA 3LRKA 2OZ0A 3LTPA 3IGSA 1VCFA 4GXMA 1TPVA 4AHOA 4O11A 3W9ZA 1Q6RA 3SSJA 4XQ6A 1G4PA 2YX0A 1R2RA 3QPYA 4BF9A 4P2VA 2FPTA 3LV5A 1YPFA 3QMRA 1FDYA 3UYCA 4UFMA 4DO6A 3MHGA 1VLIA 4JTJA 1TPEA 2ZRWA 3F4NA 3NO5A 4LV9A 3QYQA 1X1ZA 4UFLA 2CLHA 4HNVA 5D2TA 4RZ6A 3EWBX 4O4VA 4JDBA 3UXAA 3TQ0A 1TPFA 2B7PA 2PCQA 3BLFA 3IVUA 1QPQA 3LLFA 1OVDA 5F2MA 4LVDA 4ZQPA 3GIYA 3MBDA 3R2GA 2DP3A 4XBKA 1TO3A 2FFCA 1Q6OA 3KVMA 1EPXA 1PHWA 2DJXA 3HOJA 1EWEA 4AWTA 4O52A 1YXCA 5CZJA 2WOQA 4N2YA 3HPZA 4I9AA 2CW6A 3B05A 3ZR4A 3SECA 3S8HA 1I8JA 4C1LA 4YMZA 4BWLA 5G2WA 5G4EA 1SFLA 3ABOA 3CWNA 3W1LA 5KITA 3HBLA 3D0CA 3W7RA 3S5ZA 4UC5A 2C19A 2VFHA 3TW6A 4TMCA 1LCOA 2V8ZA 3UPBA 1PL9A 4CCCA 2LLEA 3A21A 4YCPA 1XUZA 4FIRA 3OA3A 3C2EA 4MY8A 1OFOA 2Y88A 1TSIA 4FEZA 2A6NA 4JX5A 4NNAA 4FHAA 2JGQA 1JCNA 2TMDA 3PY2A 4DF1A 3FKRA 1NF0A 3RF9A 1JQVA 1K7EA 1KFKA 4PH6A 1LRTA 4EF8A 3JR2A 3PUDA 1OF6A 3QM3A 5HJLA 3DH7A 4JTHA 1G69A 2B7QA 4GJ1A 1Y0EA 3QFEA 4K36A 2E5DA 2WO5A 2H8ZA 4JD4A 4DO5A 4IMEA 5L9FA 1LZOA 4NQ1A 1RD5A 1SW7A 3UY7A 3JS3A 1FBAA 1H50A 1SO5A 2Y6ZA 2FIQA 2QAFA 1WOAA 3TX9A 3HPSA 4KFNA 4MVAA 1SQ7A 3TW7A 4N4QA 5LKYA 3G0XA 3LCXA 3W7MA 3IVTA 1VC4A 4UTKA 4GE8A 2HS8A 2GQ9A 2J9YA 4IMDA 2NUXA 4LV4A 4BI6A 1AK5A 3L5LA 2ZZ1A 3DFSA 4GBUA 4LNYA 3HO8A 4QQ3A 3DBPA 4JTSA 1LTDA 1TPDA 5DCDA 4RX0A 1VHCA 3ZFHA 3PUOA 1TMHA 5BOOA 1LLZA 3O16A 3P8IA 5BNKA 2QJGA 4JS3A 1X1OA 4KKXA 3FLUA 4YWIA 2WNNA 1EP3A 3NM3A 2FJKA 4Z0SA 3RLVA 3BVJA 4PA8A 3B0UX 8TIMA 3BGGA 3KX6A 4LVAA 4E0CA 1TPC1 3NL3A 5F2LA 4GWEA 1ZHAA 2V2HA 3GX9A 3BPWA 4HNNA 1GVRA 4LRTA 3TK7A 3MI2A 3T78A 2Y89A 4K38A 2J9XA 1LORA 4YCOA 2TRSA 3IGXA 3LM7A 2RH9A 1DKWA 3BG3A 2TPSA 2RDTA 5AC6A
chains in the Genus database with same CATH superfamily
3CZEA 3PC0A 1W5NA 1HUVA 4F9JA 2DW6A 5BMXA 1V0LA 3PG9A 3EKLA 1NF7A 2E28A 3MMWA 3C86A 2CKRA 4O1EA 4IPPA 3MCMA 2BODX 2XSBA 4NILA 1VR6A 5CZKA 5LSMA 5D09A 3W1RA 1QRQA 1CDGA 4J3SA 3SCWA 1AJ0A 1K9FA 3UXLA 3S2LA 4XO6A 5AHNA 3QHOA 1K8CA 1EJVC 3GFZA 3IJDA 2Q8ZA 4PB3A 4UFKA 1HF6A 3DGRA 3S6DA 4QAWA 1Y5VA 1JDCA 5A8PA 1LOLA 4OBSA 5LHEA 1GNXA 3HTWA 3M46A 2V3DA 3BMVA 3DX5A 4AZCA 3GTXA 1QATA 3QV6A 2CZDA 2HNHA 5AYIA 1H63A 1X6NA 2X2GA 5DRCA 3V4BA 1SR9A 1HGYA 3NTYA 1XLLA 3ZR6A 1SPQA 3AMKA 3BW3A 3LSBA 3VE9A 4H2HA 5H8MA 3E12A 4HK7A 4RPPA 4PR4A 3NEHA 2NVAA 2VX6A 1W1ZA 4ZSUA 3TYAA 3ABZA 4C65A 4V15A 3G8RA 1UBPC 2ZX9A 2PA6A 4WDTA 3MO7A 4TU1A 2VFIA 5D38A 2WNQA 4HU0A 2W27A 3H6OA 3ZVIA 1ME7A 2CFFA 3NXFA 4GUFA 1M7JA 2OGJA 1XH2A 1XLCA 4HCDA 1H61A 2YOCA 3ITYA 3N4AA 4PULA 5LNWA 5BXRA 3WBYA 3BLDA 2BFGA 3TUUA 2ZRYA 3DAQA 3N6HA 5DT7A 4IGMA 2OVLA 4H01A 3VIOA 4QSHA 4FIQA 4PCSA 1EDGA 1GK8A 2FTYA 4FXRA 3R8RA 4E8GA 2OODA 4ZOCA 3T08A 1KW1A 2PDUA 4YTQA 4UTTC 4Q7NA 3IEBA 3HFTA 1F61A 4WOZA 1S38A 2FH6A 1H7PA 4B5NA 3D46A 2P8CA 2PD5A 3ZM8A 3S4TA 3UFYA 1BFNA 3FGCA 3AALA 1J93A 2YR1A 3MS8A 2FYMA 3TYDA 1P5BA 1QO5A 4IX2A 4AVNA 1ZP3A 1YRRA 4US6A 2Z00A 4JFUA 3PWIA 3CIVA 3LDVA 3OBKA 3RPDA 2YXXA 3ARWA 3WJXA 5FEPA 1TQXA 2CLFA 2C0AA 1LROA 5CLTA 2X0YA 4HN4A 4A29A 4B15A 1N8FA 1PTGA 4AF0A 1FTXA 1SO3A 3W82A 3CUZA 1C8XA 3IWPA 4NXKA 2HXTA 2PDCA 3FX4A 1W9DM 3KRZA 1MYRA 2CLIA 3ELFA 1S2AA 1NWRA 4DJFC 4LBRA 2PDIA 3DUGA 3JZEA 2HMCA 1JUBA 4GY1A 1RY0A 2HXUA 4KMQA 4P61A 4DJEA 3WL0A 5H8PA 4L80A 1XIJA 3CHVA 1QNOA 3GH5A 3APYA 1DQXA 3GQYA 5PTDA 3EDKA 1RJPA 3CL6A 3LXBA 4P7OA 4LS2A 2E09A 1PEZA 5AYBA 3W76A 4J9JA 3VCRA 3VTRA 3BSMA 4AD4A 3A64A 2V5KA 1NFBA 2FPYA 3NDYA 5C2XA 1UD2A 3JRKA 4GCAA 1TWSA 2XDFA 3HMCA 3BAKA 1AMKA 1MZRA 4RK8A 4UTWC 4AVFA 1TWIA 1A5OC 3ITOA 4LYQA 2PTWA 3SUWA 3H7VA 5BCAA 5G5IA 1JDFA 2YFNA 3OBAA 4HA4A 3U5YA 5D9MA 4HN8A 2EKGA 1UQZA 4DWDA 1TREA 3WEOA 3R94A 4O13A 3WF1A 4XVEA 1RVGA 3C0QA 4O17A 5FACA 3APGA 1AD4A 2CLEA 2QEZA 1ISXA 1OT2A 5LYRA 3E2SA 2Q3OA 1KXTA 1EYEA 4W9TA 3NQDA 1GOIA 4LVFA 5AYXA 5SWUA 5GJNA 1LQ2A 3OIHA 5J5RA 3W6MA 5IHRA 3TH6A 4IQDA 1TKKA 1LBFA 5CPOA 4CD7A 1YPIA 2XVGA 3LMZA 3FN9A 5GQBA 4Y9AA 4N6FA 2V3FA 7XIMA 1XISA 2BP1A 4QE4A 3N17A 1POKA 5CBBA 2JKEA 3N9RA 2OSYA 5HNRA 4F40A 5BXPA 3ARTA 2XH4A 1JDAA 1ONEA 2ZRXA 2E6FA 1FWEC 1Q4NX 1XXXA 3M41A 1LT7A 4KESA 2DSZA 4IQEA 4Z17A 5HR6A 4WDWA 4O1FA 4LSBA 3LMYA 1VJIA 4J2PA 5IFPA 1N2VA 3NGFA 3NYDA 4H7VA 1KC7A 2AL1A 3K4DA 3W01A 3VIKA 4NJJA 1XQKA 4NRRA 3GWQA 3O63A 4TVDA 1KO0A 1K6WA 5I3JA 3UY8A 5AKQA 4BEQA 8RUCA 3G1SA 3VNKA 2YFOA 1VCGA 4N9BA 3VDHA 3VKKA 1WXZA 3KBSA 2WM0A 4HYRA 3UCDA 8XIMA 2YLAA 2WCAA 2C14A 3ZR5A 4ZXLA 3ZYZA 3TC6A 1EA0A 1SJAA 4RNIA 1RA5A 1TTPA 4I5XA 4DO7A 3OGRA 3N12A 1J0YA 4FXJA 4D6DA 3L68A 3ZXWA 4MJ2A 4FNPA 3ZSSA 1A3WA 1ZBVA 2C1HA 3C4UA 2I5QA 1NOWA 2V9DA 4LYPA 4TMBA 2OT0A 2FZMA 3M16A 3WLJA 1UC5A 5HWNA 2GGJA 2DIKA 1UR1A 1AQMA 4E8CA 4GYKA 3L67A 1FCBA 2E8YA 3SCSA 1BTCA 4U2ZA 3AMDA 2IQTA 2O92A 1ZL1A 1PIIA 2DVTA 1PE1A 4KWWA 2J88A 2Y8KA 1WX0A 4O50A 3GY1A 3VZXA 3VA8A 3KCLA 3W7GA 1T99A 4JYFA 1T8QA 3VKJA 3SGZA 5FD0A 1WDQA 1XCWA 1UA3A 2CWXA 3VMOA 1H5YA 3O6DA 5EU9A 4AIEA 1RP8A 2NV9A 3MMUA 2WKLA 4LS0A 3NIYA 2NXIA 3W00A 3OVGA 1NY1A 1G4EA 1OC7A 1HT6A 1MO0A 2F84A 1JZ2A 3LLDA 2X0SA 2VEFA 4A8NA 3L5MA 1KQYA 1TFVA 2VRJA 2ZX6A 3HV9A 5GNXA 3AZRA 3VNYA 1VJSA 3KE0A 1R2SA 2I9EA 1FCQA 5HR7A 2D0HA 4CD8A 5LNSA 3MZ2A 4Q8PA 3TN5A 2BOFX 3A6OA 3KOWA 1F76A 2WW5A 1O1HA 1JCJA 3ZWTA 4GXWA 4HNUA 2WZTA 2YA0A 2HTMA 3UCCA 3AIWA 2VDGA 1EEPA 2WC3A 2JGYA 3T2PA 1DIEA 7A3HA 3TJ4A 4D71A 3CMFA 2XN0A 2A1YA 2FMOA 1G01A 4NZJA 4QISA 2VDHA 3GZ3A 1LBMA 3TE9A 2A85A 3E5BA 4DYJA 3E0WA 3NQ6A 1KCZA 3H4GA 3VNLA 2VWTA 2UBPC 4J3UA 5FJOA 4HNTA 3ARRA 1EIBA 3TSBA 1FHUA 2ZZ7A 4FXSA 4PE8A 3WO8A 1AL8A 1MW3A 3CMGA 1B4KA 2R9RA 4A3UA 4JTCA 4PFHA 1K6AA 2DSVA 3VIIA 2G8ZA 2V6AA 3GG8A 2GJRA 4AD3A 4BI7A 4IIDA 1IHIA 1R30A 3UWUA 4C6IA 5K3VA 3MP4A 4N6EA 5TD4A 3DHDA 3FV9A 4E2BA 5REQB 1E1CB 5CJMA 1E6XM 1AODA 4Q8WA 4G1KA 1UA7A 4IGHA 4B3KA 1DQUA 4H8VA 1IXPA 4HHLA 6XIMA 4WD0A 3LPOA 4V27A 4Y8FA 3KS5A 1M7OA 4L4OA 3RILA 4WDXA 3XIMA 4O10A 3HQNA 2IQDA 1MRQA 3B40A 1XYAA 3VOFA 1WZLA 3W37A 2OZTA 3WD4A 1TZ9A 3NPUA 1KLZA 1FWDC 5JVLA 1XRFA 3KRSA 3WQEA 4XTDA 4AH7A 3A9IA 2J6XA 3L21A 3WJSA 4JXCA 4M6PA 5F4SA 2E77A 2QT3A 1J2BA 2Z1SA 4PN2A 3GAYA 3N19B 4BEUA 2R6OA 2IPWA 1BSIA 3U2CA 3MYPA 4PRTA 3F4DA 3LQGA 2NW0A 2WKJA 2GSJA 2C1IA 4C6FA 1CEOA 2V0TA 1O4UA 5LIUX 4H8NA 3B06A 2Y5JA 1HO4A 4I9TA 3OTRA 5DY2A 2FZBA 3UETA 3WLLA 2I16A 4QS5A 3TSMA 1OGGA 7ENLA 4FNTA 4LPCA 4KIEA 2GDUA 1IZKA 3TIMA 2XM1A 1OFDA 2NV2A 3OEXA 4XAPA 5AVHA 3NSNA 3M44A 2CZVA 2D0GA 4H7ZA 5F2GA 1CTNA 4IGSA 4C6NA 2XIBA 3B9OA 1J0ZA 3PVFA 2IKIA 1VQTA 2I14A 2WMKA 3IACA 4H4IA 3IJ6A 4HMNA 4AD5A 4IPIA 3ZJ8A 4D6CA 2PB1A 4N4PA 1A4LA 1E0XA 2GGHA 4PMDA 4HKPA 4RNFA 4KWUA 1KRMA 2VD8A 3MMDA 3WFAA 4GQQA 2WVVB 4LY4A 3N34A 5KTLA 1Q7QA 4M5PA 3NQFA 4LRSA 4UNLA 4JTGA 3ONCA 5CKSA 5ABFA 4WX2A 4MPQA 3PBGA 3LCHA 3BSHA 3M0LA 1RJQA 5E6ZA 4B92A 3EKGA 2OWXA 4ICMA 2DZPA 3VO0A 1US3A 5FESA 4BQ5A 4XD5A 1KBJA 4ZFMA 2X40A 3QKZA 3LXCA 3W1QA 3N2OA 1U1JA 1WV2A 1KKOA 1XDLA 3NAVA 3PG8A 3KUMA 4M82A 2GK1B 4QE1A 4UQCA 2ZZ5A 5HAOA 2W61A 4HSHA 4ZE4A 1TPH1 3WDIA 2OG9A 4U3AA 2H8XA 3PJUA 4QE5A 1GG0A 3LHUA 3NXLA 3A47A 4KRTA 4UTHA 3PP7A 2ZICA 1XLFA 1NDZA 3WQGA 1P0DA 4HHPA 4GKLA 5C0QA 3TWBA 4WGXA 3GVRA 1GJUA 4HK5A 4WGHA 4HSOA 4AZHA 4L9YA 4X0VA 3CQJA 2DZSA 4JQ2A 1G4TA 2PLKA 3VOIA 3E0LA 4QHRA 3MY9A 5FEZA 3H4WA 4IIHA 2BB0A 1E56A 5BU6A 5AC5A 1F4HA 4HA3A 3TLLA 1XLJA 1PKYA 3C2OA 2OCZA 2XFWA 4XZHA 3PPHA 4JKMA 3W1XA 1SZNA 3A5VA 4YTRA 3N1AA 1K1DA 5DMMA 1RBAA 1X98A 3EEZA 2QCGA 2BHYA 3H53A 3E3HA 2YDAA 5AHMA 2WSKA 5C71A 3E38A 5JH1A 1VIZA 2FZ8A 3SQSA 4DY1A 3EOEA 3HA1A 1PZ1A 1JNEA 3BOLA 2XN2A 3H24A 4RXGA 3DOPA 1UR4A 3GD6A 1H60A 3QY6A 2ZXBA 3ARQA 4H9UA 4LUIA 3WENA 2PC4A 2HCVA 4ES4A 3HG2A 4H9VA 4KERA 1KNWA 1DJZA 1NELA 2XIOA 3KW3A 3E96A 3ENLA 4AWUA 1DTUA 2ZOXA 4PRWA 1S2UA 1XSJA 4NF7A 1TMLA 4UNKA 2HZGA 1XI3A 5EKYA 1FWWA 1VFSA 4REQA 2B81A 1RCXB 4LJ3A 3I7SA 3KTSA 4PRRA 4OECA 1SU5A 1B90A 4O1DA 1R3TA 5I6SA 4MB5A 3G2GA 1Q63A 3GNDA 3TMLA 1Z7AA 2QVNA 3LCGA 2EG7A 4OOZA 3VI2A 2VENA 4TO8A 3T05A 1RBOB 4TX9A 1EJWC 1ESWA 1EC9A 4K7YA 5HNUA 1QNRA 3NQGA 1FWGC 4GUGA 2DEPA 3LU2A 4AISA 1LJYA 1WXYA 2X30A 3SRDA 4B16A 3ZVHB 1CPUA 1W56A 5I00A 4UTUA 4GKTA 4R3UA 1LM1A 3L4WA 1GVYA 4B90A 1V8EA 3CTTA 4GXPA 3KRBA 1KM0A 1ZSXA 4XG1A 2ZZ3A 2WLZA 1R5YA 1F6KA 3PNUA 2VX5A 2QPSA 1YXDA 5A6TC 3GXDA 5D32A 3VINA 1QO2A 4EANA 1R3VA 4PSRA 2P0OA 1YKWA 4HU4A 3F1QA 1JZ3A 3NEVA 2D3LA 2DY3A 4DZIA 2QJNA 4F2BA 3QZEA 3W02A 2BLEA 1JDEA 1MWOA 1RVKA 4ZZ9A 4QNEA 4WIWA 3NPXA 5KZEA 4OIFA 4GVGA 1NARA 3QV7A 3UU0A 4KQNA 5C6MA 4JTUA 2QLYA 2REQA 4ZB0A 2CZEA 1HP5A 2X1RA 2Q02A 4WY0F 4LCSA 1NP2A 3VK5A 4H6QA 1WDRA 3VABA 6TIMA 3UZ5A 3PBYA 4HMDA 3VD5A 4MNMA 3WCZA 4GK8A 5K7JA 1WYIA 3G0UA 4KPLA 4PZVA 2OXNA 3WH5A 4JIEA 4LGXA 3OVPA 5T26A 5A8MA 1FHDA 2A3EA 2ASHA 3W70A 3G3MA 1U83A 3FYYA 1K02A 3P6LA 3O05A 2DUAA 3QZ6A 4HSNA 5C5YA 3W2UA 1FOBA 2CYGA 2WMHA 4FR1A 4JEQA 2WXDM 1MEHA 4BR1A 4S2BA 3UXDA 1QWGA 1ZBWA 3AUOA 1ECEA 1RY8A 1L6FA 4E4UA 1KFEA 2QCHA 5HQEA 4M51A 3MT1A 3UQNA 4PODA 5HWMA 4GACA 2QVHA 3HF3A 3H55A 3WD3A 1F8IA 3O9NA 4GZIA 4J2MA 4S3EA 4IZGA 1HFBA 2DQXA 4LYRA 1BLIA 4LFYA 4HJFA 3DYPA 3ECQA 2OSWA 4G6CA 2E25A 1MXDA 2R1LA 5EMUA 3UZJA 3RM9A 2PP0A 2ZC1A 3OGSA 1S5MA 5E0FA 3HGRA 3PK7A 3LZ5A 4PC8A 3ZQ9A 4UTIA 4Z0JA 1CNVA 3CH9A 1QOPA 3WLQA 1F2JA 3KOZA 1F3EA 2NQJA 1UJPA 1MNSA 4BY3A 1W5MA 5CC6A 3SGGA 5TAOA 1OINA 3N2BA 1JNDA 5DQPA 1RPXA 1ZCCA 1J0JA 3TN6A 2NX9A 5CG7A 4IFKB 3BANA 3BZGA 1VBGA 4A22A 3ABSA 5TBOA 3SUTA 5D2XA 2QULA 2WWCA 3AFBA 4L5ZA 1RBLA 3TNOA 1UKSA 2NT0A 3LCFA 4UWMA 4PTDA 2XN1A 1BRLB 2A7PA 3N29A 1S2VA 2I1OA 3VM7A 3MBFA 4OTKA 1CENA 4NNCA 2XIIA 3D5HA 2JE8A 3V5FA 4NJGA 4KEVA 1WNOA 2ZBTA 3VGEA 2QS8A 4ZTYA 5JUVA 1GYNA 1IIGA 2ZUNA 3AS3A 5HUOA 2JBMA 2A79A 3ITGA 4IP7A 1TWWA 3TLQA 1XLKA 1KFLA 3EWDA 4HNLA 3IVSA 3SDOA 3P84A 2QIWA 4L56A 5H1WA 1XLGA 1NM9A 5DXYA 1CXEA 3EWZA 1SM9A 3IJ8A 3MMTA 4XTIA 3TAKA 3W0KA 1S2TA 5RUBA 3W2JA 2PDWA 4NZ1A 2V5LA 2J7DA 1V6VA 1HL2A 3DKLA 4F0SA 4BFAA 2IUZA 4K3ZA 1JCLA 4IMCA 5D8WA 4DJFD 4O1AA 3QQ1A 4MKVA 4S3KA 3W71A 1AH0A 3I4KA 3S0CA 1E0UA 2BX7A 4C6BA 3GS6A 4HNCA 3QQWA 2EPKX 3WK3A 3A22A 4J3VA 1RXOB 1GOQA 3OO2A 4LTSA 2P88A 2A3HA 1K9TA 4EVZA 3V0UA 1OX6A 1W5QA 2QMJA 3LX9A 1A4MA 2DIJA 4PL1A 4FAMA 3UVIA 3QY7A 4YIWA 3GXNA 2RAGA 5D37A 6REQB 1VBUA 1V0KA 4NJHA 4CNNA 4L4LA 3CC1A 4DBDA 2HISA 4FK9A 3PFRA 3K8LA 3VGDA 3CUXA 2YB1A 4E2DA 3VMNA 4A8LA 4PEKA 1VBHA 1RK5A 2YYUA 1ZQ5A 3QRHA 1DWAM 3WQ8A 2DORA 1O5KA 1GZJA 1ONRA 1SGJA 3RO6A 3VDAA 4DI9A 2OOGA 1TTQA 3M1ZA 2VMFA 3LOTA 5FL0A 3S6TA 3M43A 1BAGA 2TAAA 3CO4A 3Q94A 4JNMA 1R9ZA 1L0PA 3EDDA 2XUCA 1QI4A 4L1GA 4QG6A 5I03A 3HU7A 3VM5A 2GWGA 1JQXA 4Y96A 3I7QA 1D7KA 3HJZA 5C55A 3KHJA 4IGNA 3BARA 2E1DA 4W8BA 4LAUA 4LEQA 2Y63A 4KETA 3IIVA 3WKZA 2PTXA 4N7QA 4RLIA 4GABA 2POZA 5IBXC 4XSLA 1VEMA 4PUWA 1A5CA 3B8WA 3I6EA 3W84A 1YLVA 3UG5A 4LOCA 3AU6A 4WSHA 4C6LA 2QCDB 1EC8A 3ZMRA 4EACA 2QW5A 3NPVA 1VPXA 4Z2KA 3G1VA 1J2WA 5FSEC 3EB3A 3KHDA 3DN5A 5LNRA 4OUIA 1MQPA 3KEHA 3GDLA 1E6NA 1W3JA 3I65A 2P53A 3FHQA 3GO2A 2NWSA 4WVXA 3Q58A 4KEZA 1OCNA 1LRQA 4O8AA 3CV1A 1LDCA 3ZWSA 1KTCA 5C9UA 2ZDRA 3ZZ1A 3MKVA 4JN7A 3B0PA 3HGSA 1FY6A 1A49A 2PD9A 1ADSA 3AIVA 3O1NA 3IUIA 4B9YA 2JQXA 3LPFA 1KM5A 3WNKA 2FKPA 1ITCA 3M0HA 3WH8A 4Z1YA 3H2EA 1AMYA 3QFWA 3VUSA 4S38A 2WZEA 4XZIA 5HJXA 4AYGA 4I7WA 4ECLA 2OELA 3U9IA 3TC7A 1EP2A 1P7TA 3ANVA 5HJYA 1RA0A 4JYDA 4JQ4A 2XPKA 4MFEA 3QVQA 1QNQA 3U7VA 4CD4A 3SURA 2OZ0A 2YKKA 4NI3A 1VCFA 4GXMA 3DIPA 1Q6RA 3UW6A 3SSJA 2Q6ZA 2O9PA 4FLSA 4F79A 1D7FA 2YX0A 1R2RA 4BF9A 1C91A 4WKFA 3FXYA 5BWFA 3OZPA 3TZFA 1V0NA 3K4AA 3OBEA 3V5CA 1YPFA 1FWJC 4HHMA 5C7HA 2J47A 3BH4A 1UG6A 1KKRA 4LV9A 2PU1A 4XD3A 3ARXA 1VP5A 2VR5A 3L4XA 3EWBX 3H21A 2YA2A 3QYSA 3LLFA 1OVDA 4G5DA 1JEZA 1SFTA 4IIGA 3R2GA 3I3DA 4YVPA 4LF1A 1TJ1A 3KVMA 3WF3A 4I9MA 1PXGA 1QNSA 1W1B1 1EPXA 1PHWA 2KX9A 1EWEA 3W81A 4O52A 4H9YA 1YXCA 3ABXA 5CZJA 3LYEA 2YIHA 4I9AA 4MDPA 2ESCA 3H2NA 4YNGA 3ZR4A 4ENLA 1TCMA 4BWLA 2PGWA 5HNTA 3CWNA 2QIIA 3D0CA 2FJUB 2F9RA 3W7RA 3A4XA 2V8ZA 3IJQA 4GVFA 4IIEA 4CCCA 4E2OA 4YCPA 3E2VA 1UH2A 3U4AA 3C2EA 1TSIA 3EOLA 2JFEX 3K46A 4MB3A 1S39A 2HJPA 3H2CA 2TMDA 3RR4A 4DF1A 4GIRA 4QCEA 4RE4A 1NF0A 1EA9C 3WLNA 4PH6A 1KFKA 3S46A 1EBGA 2PUZA 3APTA 3JR2A 3AHYA 1OF6A 5HJLA 2PF8A 3DH7A 1G69A 3VU2A 4C6JA 3AIRA 3ERPA 4C1NA 1B3XA 4KEMA 4FF5A 3LG3A 1EQCA 1RD5A 2Y6ZA 3AXKA 5I5RA 1EJSC 1YE6A 1EC7A 3WQ6A 4N4QA 5LKYA 4GPNA 1VC4A 2RJHA 1U30A 1UR8A 3EDFA 5C9XA 2ZZ1A 3TWAA 3O0KA 3VIFA 3AWNA 4W89A 3GH4A 2QJGA 5T9CE 2WJEA 3CS2A 1MRAA 4AEFA 1B54A 1J96A 2WNNA 1EP3A 3NM3A 4DBWA 4J28A 4IL2A 8TIMA 3BGGA 5E0CA 5F2LA 5I24A 4OOUA 3BPWA 4ZSTA 2R82A 4LRTA 2BASA 1GQLA 2Y89A 2J9XA 2PP3A 4KH2A 1JYWA 3LM7A 4W85A 2JF7A 3BG3A 2C71A 1XIEA 4NASA 2W63A 1R6WA 4CCDA 1Z42A 1OK6A 4AZ7A 3FS2A 2QUTA 3TJIA 2X09A 1HGWA 3LQLA 3MSRA 4TXEA 3SGUA 4Q8QA 4IG2B 1V4YA 4AAJA 1Y7VA 3A4AA 5I3IA 4ILSA 2NVDA 1QI2A 3GG1A 3RITA 4CCEA 4GZEA 1YW1A 3FYPA 3CHFA 3R7MA 2RHGA 3GBDA 4WLCA 3CUJA 5BW6A 1MXGA 4ADSA 2GLKA 4ZGYA 2ADAA 3FHAA 3UF9A 4QFUA 4P8VA 1W5PA 1TG7A 4ACZA 1MNZA 4M6VA 3T4CA 1XM3A 3RMEA 1J8VA 3W29A 5XINA 3W88A 2XWDA 2NSOA 4LQ1A 4D8LA 4K68A 1H1YA 3QKEA 2QUUA 5A1AA 4G1NA 3LTYA 2J8GA 3G77A 3CHDA 1R47A 1W9VA 3INPA 4P7LA 2Y7EA 1K4GA 3TTOA 2YYTA 2J6VA 3WK0A 4A3RA 3DFYA 5FJTA 2VCCA 3BL3A 4HOWA 2PU0A 3KL3A 2ONEA 4FP1A 4P8UA 4HPJA 3LGDA 1EZ2A 3CUHA 1HG3A 4RXFA 2ZTKA 2PGRA 3MUAA 1UB3A 3T0BA 4N0RA 1W17A 2QF8A 3VD7A 2HQAA 3NQMA 1WO2A 4YVVA 4GFSA 3HG3A 3R25A 5AHEA 1B30A 1G4SA 4O0ZA 2E67A 4XKYA 3SB0A 5G2IA 5LGXA 3MQTA 5C54A 2EPOA 3P5YA 1K9EA 3OLIA 3OZOA 4K6AA 2OLHA 3RYSA 5TF0A 3BOFA 3EX2A 2VRKA 1HNYA 4GG9A 1UD5A 1MDLA 1ZJAA 5F1UA 1UW9A 3CV6A 4AUBA 4O1BA 3M7WA 3ALGA 3G1AA 1PUDA 2VNCA 3IGHX 3K8KA 2ZUSA 3RRAA 1ZENA 1A5MC 3DENA 1V3KA 3S1UA 4B4HA 4GVHA 1WXJA 4J4KA 1A5NC 3GKAA 3AI0A 3GDRA 3VKDA 3PBWA 4AIOA 2Y7GA 3LERA 2BXYA 4JTRA 4XWUA 3USBA 2P1FA 4ZQMA 4NG3A 3N4FA 4Q8OA 3EPOA 1TIMA 3DKJA 3P67A 4I7UA 3ID7A 1C90A 3EZ4A 3B4UA 3QGAC 2J8TA 3SEPA 1L6WA 3O7UA 3B0YA 4GISA 4PUKA 3CQ0A 4ORIA 4CUCA 4A21A 3OYZA 1R9YA 4UXDA 4AEOA 1US2A 5E93A 3ORWA 3PF3A 3QGVA 2BVTA 4HA0A 3UWWA 3K30A 1DJNA 3UXIA 2XHYA 2XVLA 1EDTA 2ZWZA 1YNPA 1T6MA 4IMFA 5DCEA 2H3BA 4JY9A 3AYRA 3QZAA 1TPB1 4NYUA 5HANA 3D3AA 3IS4A 3OG3A 2XZ7A 4QJ1A 4HYWA 2V30A 2YL9A 2QR6A 2ZWYA 2XH0A 3LN3A 2DZAA 2RDXA 1LWJA 3ZO9A 1FVPA 3WF4A 3U48A 4H04A 1WA3A 1Q85A 8XIAA 2A21A 1CXKA 2YCIX 3GFYA 4TV5A 3OVRA 3JUGA 4B9ZA 4DNMA 1JFXA 1BYBA 1ZNNA 4DPPA 4JTFA 2D2GA 3SZ8A 3S5YA 4KT2A 1VRXA 4O16A 3USZA 4JGDA 4PMXA 1VFOA 1J18A 1U33A 4JN6A 3AISA 1XCFA 4J3ZA 4GHRA 3QW4B 2C18A 4UMBA 4LC6A 3V3WA 4MWAE 3W72A 3B0XA 1D8WA 5ENLA 2QPXA 2YXGA 1TMQA 1V6YA 1XC6A 2OYLA 3HGJA 1WAUA 2PWVA 2QNEA 4AZGA 3BJFA 3EBVA 2EHHA 1I0BA 3PZMA 3MANA 3O07A 3S42A 1WDSA 4BJHA 5FEXA 3ARZA 2YLLA 1S1PA 1D9EA 2F2HA 1QTWA 3WNPA 1XRVA 2EPMX 3BLLA 2OLAA 3Q37A 1IEWA 2F8QA 2WC4A 2VURA 3EOUA 3UR8A 4JHMA 1N7KA 2WVUA 3M0KA 1H5VA 1DL3A 5C9RA 3RLHA 4MB4A 3VFLA 4LVBA 2PURA 1HVQA 2YXOA 2KAUC 5AYYA 2ISDA 1BD0A 4RNJA 1J5TA 1I1WA 4D8AA 1AZ1A 4PMOA 1TWDA 3G6LA 3O3RA 4PMVA 4NZ4A 4M80A 1QOQA 4R9OA 2CZFA 3ZS4A 1W5OA 4CNOA 4GUJA 3RX4A 4FXFA 4S23A 5AZ0A 1UZ1A 1PWLA 3WDHA 3BMXA 4PBFA 3R8HA 1O95A 3VKCA 1FFQA 3N04A 1WQ5A 1OFBA 4XAYA 4E8DA 3BLPX 2G3IA 4GOAA 3L0KA 1GPFA 3UNTA 4DBEA 1HQTA 3N15A 1Q8JA 3KWXA 4PTXA 4RDVA 2O9TA 5LIXX 4DLFA 4XK2A 5F1VA 2ZUVA 5CBIA 3DFPA 1PYMA 4JN8A 4ZE5A 4J3XA 1QW8A 2Z6IA 4DXVA 3ZT5A 1DEDA 3ZT7A 1QT1A 3I6TA 3GSMA 3C5QA 1VYRA 3IJIA 3PZOA 1R9XA 2VEMA 3W26A 2PWDA 2PWEA 1AJ2A 1TELA 5DMNA 4JL2A 1F73A 3WLTA 3MSYA 4B5TA 3T40A 2VYOA 3NVDA 4RL3A 4DM1A 1KM6A 4ZVJA 2VZVA 2CWNA 4DUXA 3S5NA 1DJGA 4G9PA 2DVUA 1DJQA 1E9YB 1E5JA 3THUA 3QHMA 1NFGA 3NO1A 1MW0A 3GH7A 3WDQA 4RE2A 5FAGA 1VLWA 4LU0A 4KWSA 3R1ZA 3VVGA 4UIOA 1KM3A 2HVMA 1OYCA 3FEQA 2VOMA 2EPNA 3TCSA 1YTEA 5IM51 1DIDA 3GE7A 3DC0A 2EKCA 2AQVA 4D2JA 3EXSA 3M7SA 3XISA 2VC9A 3UJ2A 3T81A 1EX1A 2GL5A 2F7FA 2QZRA 1K9DA 4C5ZA 4MHBA 1GOMA 4B4FA 3A3WA 4MUPA 3PTDA 2PRMA 2P76A 3NURA 4Z42C 1H3GA 4MOZA 2GQ8A 4EKJA 3W75A 3W74A 1XGDA 2Y7FA 3HZ3A 2XM2A 1R3SA 1GQIA 2VEKA 1RALA 2D1ZA 3Q45A 2WVTA 4GZ7A 5DXXA 2E3ZA 5CGMA 3QMSA 1XC4A 4Z1CA 4LALA 1FA2A 2IXUA 3BDKA 4O53A 2YB4A 1ZP4A 2PFHA 4TQTA 1H7NA 1O60A 4AZCB 1HKMA 1DXIA 3V0TA 1AQFA 1XYFA 1QPOA 5FL1A 3D3FA 1IT7A 1N8WA 3HG5A 3W1PA 2E1WA 2Y7DA 4LBSA 1W1IE 1YDNA 1NVMA 1OX5A 1JCYA 3WQOA 2NXGA 1FP8A 4JIHA 2VKZG 1P43A 2MANA 4ZENA 3NUKA 2J27A 4KFOA 3U57A 5AC4A 2AAAA 4R33A 3TC3A 3B8UA 3DGBA 4BQ4A 3S9ZA 2WJFA 3UT0A 1YEYA 1P0NA 2DZVA 2I7GA 1HO1A 1MW1A 1WDPA 4V2XA 2C6QA 1YHTA 3RFAA 2E6YA 2EJ1A 4FB7A 1DTNA 1U2YA 1VFMA 1WBJA 5CZ0A 3UR7A 3VZYA 4E6MA 5JBFA 1GOOA 2CLPA 1H1NA 3WF2A 4RR4A 3P14A 1O94A 1BSLA 4J7RA 1UR2A 5I0DA 1W9PA 1KCXA 3VAVA 2GJPA 4LAMA 3QY8A 4FX8A 1QBAA 3C2FA 2YL5A 4X2RA 4HTBA 4YJ5A 4NAEA 3RMJA 4TV6A 3WQDA 4MWAA 2BVYA 1T8XA 3W1UA 3W86A 5B80A 4CN4A 1W3NA 1AH4A 1E0VA 3GIPA 3GW0A 4QGCA 5GVJA 2OOFA 2E6DA 3ARVA 1EP1A 2O0TA 1UWUA 4AY1A 2O4QA 3EOSA 4LCRA 2X2YA 4AF0B 4PCPA 4K37A 3KCJA 2ZFAA 3PUGA 3GHUA 5J8LA 3W23A 3AICA 4B3LA 4RV8A 3UA3A 4NYYA 3VDBA 1M1BA 3W2LA 1BQGA 2WSRA 3POCA 1QDSA 1MVYA 4Y2WA 2OZ3A 2VOTA 1PZ3A 1J01A 3EWWA 2BG5A 4D6IA 3GUGA 1C8QA 1WAWA 4RCXA 3ANUA 4L6OA 3CUFA 4QS6A 1CB7B 4XBSA 3T42A 1XG4A 5AY7A 2AAMA 3FA3A 3RX3A 4DQWA 2V3GA 1BKHA 1XYCA 2WJZA 2DDXA 3WK1A 3OOQA 3G1HA 1EBHA 1QHZA 2DSUA 3E5PA 5HMSA 5EBAA 3CT7A 2E0PA 4M0XA 5FOOA 4QDMA 3M07A 1G5AA 4I7VA 4RW3A 5D9NA 2UV8G 3E74A 5G1TA 1JZ5A 4S3FA 3AXHA 1UASA 3EPNA 4MAVA 2FGLA 5LZLA 3VOGA 2CXEA 4ZCWA 1ZCOA 2WC7A 3QLDA 4MDOA 3WMCA 1THFD 4DPQA 1JZ7A 2A7NA 4JKLA 1ZAJA 5G4WA 4A3QA 2OYKA 2QQ6A 3LGGA 1I2QA 5G1YA 4LXFA 4ICNA 3BAIA 1E3XA 2GK1A 1OZQA 4GUHA 5IDZA 4UQBA 3OG2A 4NAFB 1NEYA 1Y5XA 3LPGA 4MY1A 4O4WA 1OG0A 3STGA 4K8EA 2GJLA 2XYLA 3P8JA 1AA1B 3ZSTA 1E6RA 3R58A 2V5BA 3W53A 1DV7A 1DE5A 4KRZA 1FUYA 1JD7A 2IKGA 3PWAA 4MGGA 3UGRA 3MSDA 5XIAA 1UKTA 3WLHA 3RGTA 1T7LA 2PTZA 4HZMA 2HPIA 4CU8A 3C56A 1E6QM 2PCEA 3SIZA 3AXIA 1GTEA 2NQHA 3TNBA 3AO0A 4UZUA 3II1A 3KOFA 3LM3A 2WNWA 4LWWA 2XH2A 1H1ZA 1KM1A 3SJ3A 1WB0A 1CIUA 4JTTA 1FH7A 1XSIA 2W6RA 3RK8A 5K9XA 4WOQA 3WLOA 3NOEA 4Z1DA 1CGVA 6A3HA 4AX7A 3EXTA 3GHRA 3RJXA 4OJYA 1K3UA 1SFSA 3TN3A 2J7GA 1TV3A 1UD3A 3ISIX 2VFFA 2VFGA 5L6UA 2Z24A 3OW1A 4GY0A 1QVBA 3T2OA 4ERIA 1YIXA 4E4PA 1DWGM 2P8BA 1UZHA 3N18A 1MI3A 3L12A 3CBWA 3QV8A 4Y6GA 2Z1KA 4HOXA 1MEWA 3MA8A 3UR2A 4OWGA 4CEUC 4KF1A 1E40A 1EB3A 2XFYA 3W7DA 1NDWA 4GUIA 3L4ZA 1IIHA 1XLHA 1EJTC 3M5ZA 3N25A 2E9BA 5EMKA 4JPGA 4HU8A 1JAKA 5CPMA 3QTPA 4H8HA 1K8ZA 2VD9A 3P62A 4IIFA 2XSXA 3EA2A 5I3HA 4H3DA 3TKFA 4JR5A 3HV8A 1JG9A 3W2MA 4Y9NA 3SCUA 2OLSA 3G18A 2GDQA 1DWJM 2HBVA 2GUUA 2CCRA 2Z2AA 3LHYA 1H7WA 2VEPA 1P6CA 3RCNA 5J04A 4YHEA 3PHAA 5K9DA 1UHVA 3MJMA 3AMLA 1L8PA 4ZO9A 1I45A 4GJIA 5JXQA 1XD0A 1CGUA 1EUAA 2ZX7A 4FOJA 2NSXA 2Y61A 3CQIA 1E73M 2W66A 3P60A 1RV8A 2VT0A 3U2ZA 2OYMA 4QROA 3W87A 4LUJA 1BWLA 4JX4A 5M5DA 3NWRA 5FJRA 3T09A 3RNDA 3PN8A 2PDMA 1YADA 5EGRA 2J8FA 2QKFA 1B3YA 4B5VA 4GYFA 4WXYA 4RKAA 1RCQA 4EK7A 5AC8A 4L4MA 2G50A 3AWOA 1M7PA 4F0KA 3QJAA 1SJDA 1PHQA 4LUTB 3B8DA 4UTTA 1ZLPA 2H9AB 3NVTA 3LHWA 1V7YA 3LNMA 4IQLA 1SVDA 2G97A 3SQMA 4OHQA 4HPNA 3TYCA 2Z2BA 1XL9A 4PUNA 2J13A 2EAWA 1B57A 1QU4A 3WF0A 1JRCA 2EG8A 3U6WA 5A6KA 4F0LA 2VZUA 3R13A 3GAKA 4PFMA 1H11A 2EGZA 4LUYA 4INFA 3W38A 3LS9A 2GOKA 1PTDA 7REQB 2XIQA 3K2GA 1SSDA 5CJNA 1E0TA 5BXSA 3I68A 3F4CA 2DT0A 4HT3A 5I79A 3W2KA 3URBA 3G24A 4CN1A 2V5CA 4WQ6A 4UOZA 5I07A 4UZSA 5G4HC 3MVTA 4LY8A 3ABQA 3LI0A 5DLCA 2RDUA 2WVSA 2A2IA 1KCKA 2R8WA 4DJFA 1H62A 5EPDA 3EEGA 1TX2A 3O6CA 1C7TA 1LG2A 4UTLA 3TR2A 1R8LA 3BMWA 1YPXA 2GDVA 4AIUA 3FW6A 1JZ6A 2VQUA 3QEZA 5C70A 2INEA 1F74A 3W4RA 3P61A 3CMJA 2R1MA 1Q7ZA 3WQVA 3VCNA 4NT0A 4YN5A 1I6NA 1TRDA 3K13A 4Y7EA 2WJDA 3U0HA 1M01A 2VVNA 1AW1A 3HURA 2ABBA 3ZLHA 4IMAA 4CVUA 4UTWA 1A53A 1VFTA 2BY0A 2FB2A 1C3FA 1IXOA 2ATSA 4AG0A 2Y8UA 2DZWA 3WQWA 1DBTA 1OY0A 1AJZA 1GOXA 5G2HA 4PYSA 3OODA 4IJBA 2Z26A 4JY8A 1O12A 2VHLA 5I3GA 3C6CA 3VZZA 4IFKA 2E9LA 3RJYA 1V3HA 3MUIA 1DYSA 2HEJA 2X16A 2P3EA 2QCNA 4QSFA 4C60A 1JL8A 1RCOB 2AQWA 3GTNA 2O9OA 1PDYA 2AL2B 1XCXA 1LYXA 1BRLA 1SR0A 4AWEA 1MZHA 4HVXA 3E0VA 1OD0A 1C9WA 3FFSA 4IT1A 3RG6A 4NIRA 4KWOA 3RAOA 4ROQA 5D2WA 3U8GA 3SCPA 3MI3A 3FIGA 4FPSA 2GGEA 3VC5A 1J11A 1J6OA 1H7XA 4Q4KA 3AXXA 3TQPA 4BI5A 5A8QA 4HMCA 3A24A 1F07A 2J62A 3SUVA 1XWYA 4FOUA 3GKFA 1W3KA 3GC2A 5FJUA 3ZT6A 1I9CB 3MP5A 2FVKA 1IT0A 5IOBA 4ORMA 1QPRA 1S5WA 1FCUA 2A3BA 2A0NA 1ALDA 4XUGA 5KMYA 1CXIA 3TMQA 2B31A 1DE6A 3BOXA 3TXZA 4UUIA 3KBWA 1TWZA 2CHOA 1LUCB 6ALDA 1EGZA 4RDZA 1EYWA 2X1IA 4AWSA 1V3IA 2FZDA 3B4YA 1BXCA 3CTLA 1L2UA 1HXJA 4US5A 1HP4A 2D2JA 2EO7A 4J27A 4OV9A 2QHAA 2PDPA 3R79A 1XLEA 1ITUA 1LP6A 1JXJA 2I17A 1PO9A 3E49A 4GNJA 4KWVA 1WBHA 4AEEA 6REQA 4ZQCA 1PIFA 2WANA 3SRKA 1BG4A 4RZBA 1KXQA 2R1KA 5DMLA 4DO4A 3S2JA 1MEIA 3D6NA 3T44A 3GR7A 1TJPA 3HQPA 3J7HA 4MFDA 4FZIA 2ZX5A 3BCDA 5JMUA 1KWKA 4RE3A 3MP3A 5GPRA 4YXGA 3GNOA 4WY0B 1W8SA 3VMPA 1UKQA 2IKHA 1PJ9A 4B91A 1EJ7L 2OTDA 2J7CA 3LXAA 3AUJA 1B0IA 1OD8A 1KV5A 3KL0A 5FI8A 3OQ8A 2ZZ6A 1M68A 3FJ6A 2FGBA 1XKJA 3QPEA 3S1WA 4EX4A 2HE5A 3PZUA 4I9JA 2A4AA 2VGIA 3LNPA 3N11A 3AS2A 1VRDA 1M04A 4R7OA 2XSAA 1UYQA 5BRBA 1NTHA 4H00A 2A3LA 5DANA 2ZKMX 2UWFA 4GQBA 1HN1A 4REQB 3K1GA 5HULA 1XR2A 3UZWA 3W07A 3GUWA 2BHZA 2F61A 4QP0A 4MJZA 1IT8A 3WIJA 2QCDA 1JULA 1E0WA 3TA6A 3OJGA 4I5RA 1C9DA 1RQHA 2WV8A 2FDMA 5KETA 2X7VA 3KFTA 2GSHA 4W5ZA 2YGYA 2QMKA 1B31A 3E0IA 3VNIA 4JFTA 3CB3A 4A35A 2OZ8A 3DEQA 1VGAA 2DSWA 3L9CA 9XIAA 1DVJA 1XYMA 1FRBA 3VGBA 1DQWA 5HOSA 1ZAHA 2ACUA 1BPLB 3NG3A 4QCFA 3TN4A 4LB3A 2R14A 3P82A 3PM6A 1PPIA 3T6CA 5K4ZA 1QK0A 3LRKA 3FDKA 3GC4A 3LTPA 2TODA 3IGSA 5I09A 3EMCA 2XG9A 1G4PA 4U2YA 4XAGA 3V36A 5B7ZA 2ZXDA 4FMVA 2CBVA 2FPTA 4EXBA 3EOOA 4TVCA 3MHGA 1TPEA 4UFLA 3PPCA 1QPKA 4NP7A 3AS0A 3REQB 1NJJA 4O4VA 3WLRA 3GU9A 2PCQA 1UC4A 1JI1A 2DV0A 4ZQPA 1V6XA 3MBDA 2QV4A 1EJXC 3TW9A 4C7GA 3CH0A 4XBKA 2FFCA 3SCRA 2OQYA 1KR1A 3LENA 6TAAA 3BSGA 4QEEA 2Z29A 2DJXA 4X2PA 4GX8A 1KGXA 1EO7A 2WOQA 1M03A 2FHCA 3HPZA 3QBUA 3L2MA 3B05A 2BVWA 1ZTVA 5G2WA 2BGNE 2WPGA 3W1LA 3PAOA 3VUPA 4GIEA 3DDMA 3ICJA 2C19A 1B2YA 2VFHA 3D47A 3TW6A 4TMCA 1LCOA 3CUGA 1VFHA 3IARA 4JL1A 3A21A 4JAWA 4FIRA 5CJ5A 1ENUA 2I56A 4RPQA 3GR4A 4IF2A 4W93A 4MY8A 1OFOA 3AROA 3UJSA 4FEZA 4BF5A 2A6NA 4DBUA 4JX5A 4NZ3A 1TX0A 1JCNA 2X41A 5DF0A 5IHSA 3MUCA 1JQVA 1K7EA 4PMUA 3CPUA 3NO3A 3C0SA 3PUDA 3I10A 4XV0A 1HJSA 4JTHA 2HBXA 1Z8AA 2PWUA 1Y0EA 2G3FA 1Z6KA 2E5DA 5BU9A 4JD4A 3F2CA 2V67A 2E7FA 3AZTA 4NKCA 3JS3A 1FBAA 1H50A 5HMFA 2FIQA 1WOAA 4MVAA 3TW7A 4YS1A 3W7MA 5A2AA 4EXQA 1UH3A 2HS8A 2V68A 2J9YA 4IMDA 3SQLA 1UOZA 3OZMA 3ES7A 1LTDA 3ZFHA 4D6JA 1TMHA 5A6LA 1U5HA 4JS3A 3FAWA 4KKXA 1OEPA 1JYVA 1KXVA 2VVSA 3KP0A 3AZSA 3SBFA 4E0CA 3NL3A 4NRSA 4GGHA 4DJDC 3ES8A 2V2HA 3GX9A 3G5EA 5D9OA 3SY8A 2VZSA 3UJEA 3CAKA 2TPSA 3B8VA 2Z28A 4P8WA 1Q2SA 4AD0A 3WNMA 1MSSA 1UD4A 1EXPA 4LYKA 1SW0A 3F4WA 3KWSA 4DYEA 3UJFA 2O56A 1GEHA 1L6YA 1IEXA 2R24A 5MKGB 4EPDC 1PIGA 1W8GA 3A3XA 3JW7A 2WPBA 4W8LA 4B5UA 1UKPA 4BQ3A 2FZ9A 5A8GA 5DO8A 4OFCA 1UWRA 1F3XA 2D2OA 1A5LC 1SZFA 4PCFA 3FSTA 4CNPA 1V79A 2PDQA 5E9XA 1GPWA 3TROA 2YZRA 4HP5A 1R3RA 3H4XA 1QOXA 1BVWA 4G2DA 3BC9A 1BF2A 2ZA2A 1KRCC 3PZVA 1IEQA 3QR0A 4JQ3A 4IG2A 5FJPA 1UKOA 4A3YA 3NQVA 4UFHA 4G7EA 1NWTA 3DYOA 2WMIB 4ONVA 3UZXA 3R89A 4PB4A 3S2CA 4NHVA 4C6EA 3GVWA 1V3JA 2CERA 2VJXA 1EQPA 4XIAA 5A8NA 1KLYA 2GVEA 4WK9A 4G7FA 2JK2A 1U1HA 1S5TA 3BXWA 3SN1A 3UBPC 1VPQA 5EYWA 3QV9A 1UUOA 1TUFA 4X61A 2O4MA 3S1VA 4JBRA 3OVQA 3WDJA 2V82A 4MNJA 4AY8A 2ISSA 3F2DA 3VYLA 4NSBA 1GJWA 3MUY1 3I4EA 3LCWA 3LD5A 3VXGA 2AKMA 1DWIM 4EPEC 4X3ZA 3M9YA 3W85A 2I5GA 3RCMA 3T9PA 3WMLA 3QN3A 1CECA 1R7AA 4NZCA 1VENA 1EIXA 3NJ3A 2C8NA 3IANA 4S3BA 4S39A 3GNRA 1E4NA 4Y8EA 1IGSA 1RAKA 1SUXA 1RPKA 1EH9A 1O68A 3IUHA 2QJMA 1O5RA 4N42A 1JFHA 5FF2A 4J3WA 3H7RA 4CD6A 3LB0A 4D6GA 4A8IA 3MI6A 1RP9A 3M64A 4RV3A 2D69A 3HIJA 4IXXA 1IZCA 3PS7A 5E0KA 3N9SA 2OU4A 4HCLA 1P4CA 4FOKA 1LLWA 2PWGA 4BA0A 2WHJA 3LZ3A 1CI1A 2B7NA 2P0IA 4MADA 3TP4A 4WSKA 5A94A 2DGAA 5TNVA 2RDWA 3H2MA 5AOUA 3BLIA 2FTWA 4CQAA 5FAJA 2OT1A 4O54A 3E0FA 1FDJA 3NYZA 3KLKA 5I3FA 4YYCA 5M1TA 1WOBA 3F2BA 4UTMA 3JZUA 3WJYA 1GYLA 5JBEA 4Q6JA 2PGFA 3L0GA 1HJUA 3G1RA 3GXFA 1RH9A 4CGTA 3EGJA 1PWMA 4ZEPA 3TJLA 3L2IA 3WQFA 1XG3A 1M6JA 1W1YA 2INZA 2R91A 2J24A 1V03A 4EPBC 5D02A 3QXBA 1CB2A 1V6UA 4ML4A 3M6DA 1E71M 5E09A 1XIBA 2G0WA 3ZJ6A 3WEZA 4FLOA 1NAL1 2OQLA 2QV5A 4DWSC 2VTFA 1NOFA 4JQ1A 2DPEA 3VIPA 2XWEA 3S9YA 3N3TA 1S5VA 4D72A 1TTIA 4R34A 2SFPA 4QTGA 4XB3A 3RLUA 4FR6A 1U5JA 1W37A 1IE7C 3MPGA 4XISA 1RSCA 3PFMA 3TYUA 4MYAA 3F03K 4ZOEA 1SZGA 2VO5A 3DC8A 1YYAA 1ZFJA 5FA5A 3NGJA 1OQFA 1ME8A 2VP8A 2ZADA 3EXRA 3UNDA 1VIWA 4H7CA 4LAOA 1QASA 9RUBA 4QM1A 3V75A 1KFJA 2VDIA 4MTVA 4Z2HA 1J5SA 1A0CA 1TVPA 2CLOA 1XH0A 4F66A 1XYBA 4ATLA 4GRSA 3F5KA 3M4HA 5E5CA 4L6DA 3AIUA 2X0HA 3TONA 1Z89A 3NZRA 2WZHA 1JDDA 1GTHA 5DT5A 2B0MA 4LBUA 2NQ9A 1XV8A 1N55A 4JCLA 1XP3A 3N14A 3R0DA 3BUVA 4AVOA 2PS2A 3UWEA 3LTSA 4PUEA 4Q4QA 1KD0A 1GORA 4CD5A 4ML9A 1X6LA 3IK4A 1ZBCA 1DWFM 4RZ5A 1UWSA 2BY1A 5A2CA 1K7XA 2QCCA 2DVXA 1CXFA 1FH9A 3FEMA 2Z1WA 4Z2JA 3VCCA 4ZL1A 2J9ZA 3WK2A 4L1WA 3GDBA 1FWFC 2VEGA 5MHBA 1HIZA 1K03A 1WZKA 1E51A 5AC7A 1OGSA 3NL5A 4HZ7A 4ZO8A 3M5XA 3CHCA 3P93A 1GEQA 1NIUA 1JZ8A 4UFIA 3N73A 4M19A 5CQ1A 4O19A 2V81A 4M7SA 4D1JA 2VUYA 5CSYA 3WLIA 4DNHA 2EEXA 1KFCA 1I60A 4DB7A 1E4LA 1NQ6A 3L65A 2XGBA 2OX4A 1NSJA 2X7WA 1V3LA 4GYPC 1B3WA 4G56A 1A47A 4NJIA 5A5WA 5IRPA 5CSRA 5EMLA 2JKPA 1UH4A 1CXHA 4AC7C 2E9MA 3EMQA 3QR1A 5EL1A 4WJEA 3FY1A 4J5NA 3HQ1A 1JF6A 1KB3A 4IP4A 4R27A 3V1HA 4DEFA 4NJKA 3GXTA 3WMSA 1E72M 1PZ0A 1HX0A 5A2BA 4U10A 4LB4A 3PZGA 2Y2WA 3NDOA 3ATYA 2OO6A 1GVOA 2IPFA 5EB8A 5EY5A 1MUCA 3CV2A 5AVNA 4FALA 5CAKA 1QMLA 2J79A 1LL4A 1EDQA 2UY3A 1M9HA 1TV5A 1X1NA 5M17A 1R85A 3F5JA 1HW6A 3S1XA 3NDZA 1LT8A 2C1GA 2PTYA 4IHCA 7TIMA 5EMMA 3XINA 2FTPA 7ODCA 1HJXA 4H41A 3CIWA 1TUXA 5FIPA 1OX4B 4C1NB 1ZUAX 6ENLA 3NPWA 4K39A 2GUBA 3KZPA 1JYNA 2QF7A 1WZMA 2J7EA 2QCEA 2J74A 3WUEA 2Y0FA 3KBVA 1B5TA 1F8MA 4W7UA 4OKDA 4JYEA 1W1VA 3NR0A 4E3VA 5E1QA 5CPQA 4Q8MA 4TR9A 3LRMA 5AECA 3OGVA 2FZNA 1QAPA 2AQOA 3POHA 1TPUA 4IL0A 4XD6A 3TYBA 2J75A 1ICSA 3WFZA 3W7IA 4MLRA 2GPTA 3A5FA 3MB9A 3AHXA 3GW3A 2EG6A 1TYGA 4BF7A 4HQVA 1TE6A 2GOUA 3P74A 1KTBA 3EKZA 4HYVA 1R87A 1F3WA 1GT8A 2CIPA 4JHZA 3WBXA 3EPMA 3OYXA 3NOYA 3SCVA 3IGUA 1JIBA 2HWGA 1XUUA 1MXSA 4MM1A 2NQ5A 2WAGA 1JI2A 3WL1A 4H8UA 3Q65A 4JFSA 2WB5A 4FX6M 3V16A 4NL1A 3I3EA 1CXLA 1XQLA 2PI6A 4KCWA 1UWAA 3W7PA 4JX6A 3G6MA 1JPHA 3GXPA 3O2LA 3FDGA 1F05A 1W54A 3HPXA 4ACZB 3CUIA 2H6RA 3M0XA 1OBAA 1IF2A 5K9CA 4QAIA 4G8TA 3C0LA 1OIFA 5CGTA 1Q2RA 2HVNA 3BW2A 4GMEA 4JNZA 1BEUA 2CBUA 4WKHA 1FWCC 2XU2A 4A8RA 2OKOA 2H90A 1SFJA 4XUYA 1Q6EA 4BKNA 1Q3NA 5C2CA 2OX1A 4GZJA 3KOXA 1R2TA 5A95A 4UCGA 1Z9AA 3H2AA 4ZO6A 2HVOA 3ITXA 3KLLA 2VGBA 4GBDA 1SZEA 3WFLA 4MUZA 3T0TA 1VPYA 3VD4A 4WXZA 3GNNA 4O18A 3IIXA 3GXMA 3UJRA 4CQBA 2WCSA 3TTQA 4JFVA 2VR2A 4AC1X 1MQQA 5IBXA 1CLXA 1FX6A 3DFQA 4CLMA 3T0DA 2FPVA 2ZE0A 4I6KA 2ACQA 1V6TA 2YDQA 4OT7A 2C15A 2NLYA 1TJ2A 4K2SA 2YDSA 3BAWA 2J78A 3G22A 3TR9A 3N2MA 1UWIA 4DZAA 2F6UA 3SN4A 4XKYB 3UPMA 4X60A 4JNYA 4ZBCA 4Y9OA 1KM2A 3RPTA 3LK6A 1L9WA 3WD2A 1E3ZA 2WQPA 2IXVA 4NXSA 5T8GA 4CNSA 3W7HA 5T91A 1UMYA 1XHGA 8A3HA 4QBXA 3IPWA 1M53A 1TZ7A 2BMBA 1JGIA 1CT5A 1PTAA 1J0KA 4E2VA 2AKZA 2B7OA 4JTQA 2DUZA 3TU9A 3NSXA 1Q45A 4FSAA 4OV4A 1TVNA 5LIYX 2V3EA 2Y4SA 1GVSA 5FF3A 4LUSB 3B9EA 2FH8A 4L7ZA 1B3VA 4CNTA 5EBUA 4M6QA 3R12A 2HNEA 4GQGA 4F9DA 1ONWA 5DEZA 4E5TA 1PKMA 1UD8A 3VDCA 2W9MA 3PBUA 2Z0IA 1BYAA 3HB9A 3DHFA 3R6IA 2Y24A 3BLEA 4P5UA 2OQHA 5H2ZA 3UXKA 4JTAA 4M81A 4Q7BA 1E4IA 4KGJA 3SIMA 4OU1A 4O8RA 5A6BD 3AIEA 2CPUA 2GYIA 3WDPP 1VJZA 3KXQA 1GW1A 2ZVRA 2OWWA 1F3TA 3OLEA 4C6DA 1XYZA 5MF5A 3C61A 2OPJA 2GWNA 4PL2A 2YSWA 4OGZA 1QPNA 3PBVA 3TTEA 4K8HA 4CNUA 2W0UA 3CJPA 4GA8A 3W7OA 3CZGA 4UR8A 2CESA 3FNDA 1VH7A 3DI1A 4L65A 4DM2A 1ISVA 5LIWX 4IPLA 4H6KA 1HZYA 2WHMA 2PZ0A 3RO8A 4MY9A 2ZIDA 1QBBA 1W1PA 1XD1A 4MAZA 4YLWA 4P7NA 3KM8A 4V28A 1LRNA 3QLLA 2QJHA 4IOTA 2WNZA 2AOSA 3WNNA 1VBJA 4ZQOA 3HGOA 4H9XA 5A69A 2W91A 3F4VA 7CGTA 1Q4WA 3T8QA 4ERAA 3DU0A 3W7NA 1ZRQA 2YCLB 4XAZA 1TRIA 2UZ9A 4GINA 4XKMA 5H91A 1XBYA 3VNMA 3I7RA 3W7QA 2YZ5A 4MB1A 1E9ZB 4Z2IA 3BLOA 1V02E 1EOMA 3MSGA 1I2OA 5AZ1A 3RU8X 3SN0A 4WSJA 3FYOA 4GGBA 2MNRA 1F5ZA 3DG3A 5F4XA 1UOKA 3SFKA 2F2KA 3KS6A 5CCZA 2YBUA