3W1YA

Crystal structure of t brucei atg8.2 in complex with e coli s10
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
120
Chain Sequence
b'HYRYQYTRSFAERAKETESARLRYPKHIPILCEPTSVRLFSTRQQVQRELDCNKFLLPETATVMEFMMALRQRLLLEEGQAVFVFIGNELPPNSACLGDIYARAKDPDGFLYVSYGVENT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated protein 1A/1B, light chain 3
molecule tags Transport protein/ribosomal protein
source organism Trypanosoma brucei brucei
publication title Crystal structure of T brucei ATG8.2
rcsb
total genus 35
structure length 120
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3w1yA00
3IFWB 1OEYJ 3RYTA 3K9PB 4BKTA 3C0RB 2DYMA 2MP2B 3VQIA 4HCPB 3S2AA 2K39A 5G2NA 2QHOA 4DHZB 2CU1A 1Z2MA 1R4MI 4IG7B 5KHOA 2OJRA 2R2QA 4K7UA 2PEAA 3ZRFA 2BWFA 2AL6A 3X23A 2G3QB 1SIFA 2L7RA 2N4FA 3IBEA 4FN2A 3ALBA 5DPRA 4E71A 4B9KA 4IUMB 2GBNA 3WAPA 5KHQA 2CHWA 3KH0A 1WRDB 2O2VA 3PLUA 2L00B 1UD7A 3V61A 3PGEA 4HPMB 1J19A 1WX9A 1E5WA 4MSMB 1J8CA 3M63B 4TV3A 1WMHA 3DDCB 4KZCA 4A3OA 2MBBB 4TUUA 4GU2A 1WJUA 2IYDB 4KDLB 4WWOA 2EKEC 2FUHB 4I6NB 4JGHB 4X57B 3H1UA 1E7VA 3JW0X 1P98A 3RZFA 2N1WA 4MGIE 2FCNA 2ZCBA 2V3SA 2LVOA 4GDKA 2NBVB 3JVZX 3ZRCA 1P1AA 1UH6A 5AZGA 3TMPB 2LWPA 3L13A 3H9DA 3WANA 3UIPB 3KUCB 1OEYA 1P0RA 4W9KA 3W1YA 3VAWA 2KQ7A 3VUWA 3RUIB 3A1QB 1IPGA 3APFA 2KDIA 2KWVB 1SE9A 3CSTA 2I1KA 1WYWB 1E90A 2IZVB 1G6JA 3ML9A 2ASQA 4LCDE 3NZSA 4P7IA 4AP4C 1UZXB 3PS6A 4LJOB 1OGWA 1MG8A 4BOSC 1Y8RC 3UINB 3R7RA 5AZHA 2IO0B 4PYUA 4BFRA 3TIXA 1T0YA 3A33B 2JF5A 2O6VD 3QWZB 2M8SA 4K7SA 3KUZA 2BKFA 4GB9A 2ZJDA 1YQBA 3TBLD 4G3XB 2MRPA 4W9IA 1QZEA 4F1SA 2L8JA 3NOBA 4W9EA 1E8ZA 2EMSA 4KIKB 1WXMA 3U30A 2K8HA 2KXJA 2XK5A 3ZDTA 3LJ3A 3ZNGC 1JRUA 2DZMA 4LJPB 4HDQA 4G50A 2KLCA 3B1LX 4GDLA 3QIJA 4BKGA 3PT2B 2GOWA 3TCAA 1RLFA 1OTRB 5JZEB 2IO2B 4EUTA 4I6LB 2HE7A 2KWCA 3HM6X 1EO6A 3L0WB 2LJ5A 1LFDA 2MSED 1WM3A 5DPTA 4BKSA 3ZLZA 4DWFA 3DPDA 4HJKA 2N9EB 2DZIA 4M0WB 2WWZA 3JSVB 4FHJA 4JIOU 2FCSA 3NS8A 4GIVA 2NPTB 3ZNZB 2JPHA 2ZPNA 2DYOA 5E6NA 4II3B 3TJPA 3M3JA 3V60A 2KD0A 2CHZA 4XX5A 4ICUA 2LZ6A 3CMMB 2UYZB 3V6EB 1WGRA 4BKSD 4NJ7A 4AUQC 4F7ZA 5LXIB 5LXHA 4M8MA 1Q0WB 3VHTC 2J0KA 3DVNU 4ANVA 2C7NB 1E7UA 3I3TB 2N9PC 2V4LA 2NBUA 3WALA 2KFKB 3UQBA 2LD9A 1WJ6A 4K7WA 4WWNA 4EKUA 2G4DB 2L0TA 1TZ1A 1EF5A 2EMTA 4K81A 3H7PB 4XZ4A 4DXAB 4RM8A 3DVNV 2ZEQA 4LDTD 3X0WA 3KYDD 2J0JA 3DBSA 4B6WA 2RR9A 1WIAA 1V81A 1F9JA 4WAAA 3RCZA 3QAQA 3N32A 1GG3A 3RZWC 1L2NA 2WYQA 3QA8A 4HDOA 4JL9A 3OJ4B 2L05A 3VUXA 2BPSA 4YL8A 4F8CB 2D07B 2KWUB 1KOTA 2N7DA 3WA0A 2G4SA 2LRUA 2FIDA 3EFUA 3K9OB 2PE9A 4FBJB 1P9DU 5TR5A 2FAZA 2M0XA 2Z0EB 4W9HA 1R4NI 4II2B 2CR5A 1FXTB 3VH3B 3JYUA 2KK8A 2IO3B 1I35A 4NQLB 5D94A 1P3QU 2DZKA 2KDFB 5CHWA 1S1QB 1WMHB 2G45B 2K1FA 2KFKA 2KTRB 4MJSA 4W9JA 3RT3B 1ZGUB 1TGZB 5FR6A 1WGYA 4ANWA 5G55A 3IHPC 4TQ0A 4OVUA 1EF1A 1V5OA 2OOBB 4W9LA 3PSEB 5J18A 2WDTB 3QJZA 2ZVOA 2MBOA 4KSKC 4BVUC 2K6QA 1V9JA 2LI5A 1ZW7A 2LXAA 2R2OA 3R66C 4JLCA 5IAAC 2AEHA 4DHZE 4FA6A 2YLMA 2L76A 4BBNF 3QC8B 2RPQA 1WGHA 2MBQA 1LXDA 4IWQA 4KVGB 1ZKHA 2KJHB 3NHEB 4FJZA 4KDIC 2C5LC 2KJRA 4EOYA 5AEKB 3B0AA 3ZO5B 4MGKE 4GXBA 3NY5A 2KZRA 2JT4B 4HXDA 4OVVA 3AULA 3UQAA 2LGXA 3EHVA 2LGYA 2Z59B 3L54A 3GOEA 3T9LA 4A20A 4DBGA 2W9NA 3B08A 3U7DA 2ZPYA 1TBEA 3PHWB 1A5RA 1NBFC 2BYFA 4IWOA 3OLMD 1IP9A 3ZIMA 4HWIB 3PTFC 4WJPA 5J17A 4GDLB 3MTNB 4LDTB 2LUEA 1GNUA 2FNJB 4WQOB 4DHJD 1WGDA 1CMXB 1V49A 4MGZE 1M94A 5C23A 3NZUA 3HHMA 2XK5B 1KM7A 2ZVNA 3DVGY 3PPAA 4WJQA 3ZUNA 2KC1A 2I1JA 1V86A 5CHFA 4PS3A 5CX3A 3L10B 2NS5A 3SDLC 1SGHA 4WJNA 2JZ3B 2JRHA 3ML8A 2Y5BB 2B3AA 2NPTA 3DQVA 3W1SA 3JSVA 2AWTA 1S3SG 1E8WA 4MEMA 3ZNID 5HKHA 2IY0B 1YX5B 4NJ6A 4FULA 2JRIB 3PHXB 1Z5SB 2ZCCA 1C3TA 2GBKA 2NR2A 1WE7A 4I6PA 4IM3A 4NAWA 3HM3A 4J6IA 2MW5A 2MQJA 3A1QA 4TKNA 5CHVC 1WXVA 5JHBA 2DX5B 1XD3B 3DCGA 4PYZA 1E8YA 3U8ZA 5J2RA 2KX0A 2REXA 3RULA 1KLVA 2MBEA 3ZNHB 4ASWC 5C1ZA 3VH4B 2IY1B 1V6EA 4G11A 3ZTCA 3VXWA 2DHZA 2WX1A 3PRZA 3ZTDA 4KIKA 2J7QB 2DENB 5IA7A 3EC8A 3PREA 1WZ3A 4MSQB 3ZVVA 1L7YA 2MP2A 3QCAA 4NQKE 4W9CA 4HK2A 3PV1A 3ZW3A 4ZRJA 2D2QA 3IVFA 3OAWA 2D11A 5AZFA 3TL5A 4FJYA 3WIMA 1TTNA 2GBMA 3UIOB 1PQSA 4MM3A 3UF8A 3AXCA 1WR1A 2KTRA 2JUOA 2L3ZA 3VUYA 3CSFA 3ENEA 4EFOA 1J0GA 1C1YB 2LRWA 4RM9A 4AJYB 4EZJA 4ZYNA 2KVRA 5DCNA 1YX6B 2CHXA 4G0NB 4W9GA 2PJHA 2MX2A 3ZKJC 4EZKA 3APDA 3ECIA 1NI2A 3DBHI 2O2VB 4NPNA 2PPHA 4MH0E 2K25A 2KANA 3BY4B 1LM8B 5DPSA 3SU8X 4CO7A 4EEWA 3VVWB 1ISNA 4B95A 4NNJB 2RSUA 2DYBA 1WZ0A 5DPWA 3P2BA 3QQ8B 5EDSA 1KJTA 2MLBA 1H8CA 2N7EA 3AI5A 1I42A 2PE6B 2KJ6A 4KV2A 2N1VA 4GMVA 2UWQA 3A9JA 2KQSA 4ZDVA 2K8CA 3A9JB 4EZLA 4WJOA 4E3CA 2BYVE 2O6VB 1WM2A 2KDEB 2JXXA 1GC7A 2KMCA 3GZNI 5E6PA 4FADA 3R3MA 3QK0A 3LDZE 2XEWA 4W9FA 5D2MB 1WFYA 4KZ0A 1WH3A 4GSWA 3HIZA 3R7QA 1Q5WB 2LVQA 4ICVA 2DAJA 3M62B 3KVFB 5D6JB 4IW0A 2C7MB 1UBQA 2M1MA 1D3ZA 1WI0A 3AU4A 3BINA 4W9DA 4AWJA 4BOZB 3VTVA 4RMAA 2C9WB 1UBIA 1UELA 1GJZA 1RAXA 3PZDA 2BYEA 2FIFA 2M4NA 2K8BA 2LVPA 1WY8A 3IG3A 2MCNB 3HK0A 2J0MA 2HTHA 3O65B 3VTWA 2KFJA 4ZRIA 2KOXA 3DBLI 2NCNA 4ANUA 3WAOA 4N9F4 3L08A 3KUDB 3L16A 2HJ8A 2XBBC 1WX8A 2LXCA 4ANXA 4HVBA 4GOCA 4MDKE 3H6NA 3UGBB 2KNBA 4TQ1A 2A4ZA 1V80A 1X1MA 2BGFA 2BWES 3OJ3A 2KO3A 2BKRB 4FHKA 3PVLA 4GDKB 2RD0A 1IYFA 2GBJA 1WX7A 2CKHB 2LGDA 5LLIA 2Z0DB 2D3GA 2AYOB 2MWSB 3DOWA 1AARA 2KX3A 2L0FA 2NBWB 4FLHA 2JWZA 3VDZA 3SD5A 2C60A 2KN5A 3AU5A 1VD2A 3D32A 4A3PA 5L95C 3DBRI 4BBNC 4KSLC 5L83A 4MELA 4CHKA 4NAWB 3Q3FA 4NY0A 1Q1OA 2MA9B 1U4AA 1H4RA 3KW5B 1WXAA 4ZRKA 3V6CB 1YIWA 1HE8A 2DZJA 2C7HA 2JY6A 2ZNVC 3MJWA 4WWPA 1V2YA 3N3KB 2GBRA 2JVCA 4GN1A 4GGQA 5CTRC 4HPLB 2MBHA 4AOFA 3ONSA 2K6DB 4FJVB 3DVGX 5GMVA 4DDGD 3A4SC 4CYEA 2BF8B 4MGYE 1GUAB 3VTUA 2ZNVB 3QX1A 4IWPA 2HD5B 2RGFA 4XC2A 2KLGA 2D10A 5JHAA 1XQQA 4DK5A 4JQWC 3PRPB 3T8MA 2NVUI 2V1YA 1OQYA 2KC2A 4DDID 4E74A 4AJWA 3H7PA 2IBIB 3KYCD 2KMAA 3SHQA 3MHSD 3Q3JA 2CS4A 2WX0A 2KTFA 3A9KB 1BT0A 2AL3A 3N30A 1V5TA 1E8XA 1YD8U 2IO1B 1RFAA 1RRBA 2KKCA 1WJ4A 1WF9A 4IC7B 4PS7A 1EUVB 3H7SA 4HCNB 3WAMA 2DAFA 5BO4B 5JH5C 4DHJB 2N9XA 3QARA 2KHWB 3PRMB 2M17A 3CF6E 3RD2A 3VFKA 3ZDMC 4IM0A 4HLEA 1LQBA 3PLVA 1WXSA 1UGMA 3A4RA 1K8RB 1WGGA 2KDBA 4K1RB 2VRRB 4IM2A 4URKA 5E6OA 2A5UA 2FCMA 2ZZPB 2YVCA 1WE6A 3M95A 1WJNA 4M8NA 1XT9B 3V62A 1YJ1A 1WR6E 4PS8A 3W1SC 3L17A 2JZZA 2O6VA 2GMIC 4MJSB 5D7GA 3EECA 3A9KA 1VCBA 3QHTA 3APCA 1GC6A 1NDDA 2LASA 2FCQA
chains in the Genus database with same CATH superfamily
3R2TA 3K9PB 2MP2B 3KWVA 3S2AA 1I4PA 1VLBA 4DHZB 2CU1A 5KHOA 3IT4B 1TYGB 2OJRA 3ZRFA 3X23A 1SIFA 5DPRA 3ALBA 4B9KA 3KH0A 1WRDB 2M19A 4C7ZA 2L00B 3V61A 4HPMB 2BYTA 2D5GA 3TEXA 2SEBD 3M63B 4TV3A 3ABVB 2PIAA 1EU4A 1F77A 4KDLB 4FXCA 2EKEC 4I6NB 3NUHB 2WU2B 4ZRPA 1UH6A 5AZGA 3L13A 3H9DA 3ZJTA 1XLNA 3VAWA 3RUIB 3O13A 3DHIC 4HRSA 3Q8BA 1G6JA 3TEZA 2AQ2B 1VR9A 4LJOB 1TS3A 1JQ4A 1JW9D 2O6VD 3R8BA 2D3AA 3V3XA 4GB9A 3DHGC 1L0XB 1VDVA 2RDHA 3TBLD 1HA5A 4S0RA 1QZEA 4F1SA 1ZUD2 4L23A 4LK0M 1P7EA 4W9EA 2K8HA 3ZDTA 3Q6BA 2H89B 3SFEB 4BKGA 3PT2B 1OTRB 5JZEB 2HE7A 3HM6X 1I4GA 2MSED 5DPTA 1I4RA 3V05A 4M0WB 4YSXB 4FHJA 1YOVB 2FCSA 4JIOU 2JPHA 4ACFA 2DYOA 2JYTA 3V60A 4M01A 4XX5A 2LZ6A 3CMMB 1GAQB 5LXIB 2J0KA 4AQ7A 1J7BA 2N9PC 2WGSA 5FR3A 2NBUA 3WALA 2KFKB 1ZDVA 4YTMB 2LD9A 1DYQA 5HG2A 4AS1A 2J0JA 3DBSA 1WIAA 1V81A 4BZAA 3RNBC 4B0EA 2WLBA 3EFCA 1ZOYB 1RYJA 3OJ4B 2L05A 2BPSA 1JWAD 4F8CB 2N7DA 2FIDA 3ZYYX 3K9OB 2M0XA 2Z0EB 1FXTB 2KK8A 3ZJUA 2INCC 2CJNA 4RCOA 5D94A 1P3QU 3AMZA 2OHFA 2G45B 2K1FA 4TMAB 1V1PB 4NJCA 4W9JA 3RT3B 1WRIA 1MHXA 2ZW1A 3AE9B 5FR6A 2BS3B 4ANWA 5G55A 1RM6C 1C79A 4OVUA 3PSEB 4RGMA 4KSKC 4J3OD 4BVUC 1V9JA 2LI5A 3R66C 3EUB2 2AEHA 4FA6A 2BB6A 2V4IB 2YLMA 2L76A 4BBNF 1XLQA 1C4PA 1WGHA 4IWQA 3NHEB 4FJZA 2KJRA 4EOYA 1FRRA 1R4NB 4LLGM 4C7YA 4K3BA 3AEAB 2BQQA 3N1ZC 4A20A 2JWUA 2MJEA 3B08A 1IBXA 4MT5A 1TBEA 3ZGZA 2QC8A 3PTFC 4JPSA 4GDLB 1V1OA 2LUEA 1V49A 2I2YA 2J42A 1KM7A 2XK5B 2ZVNA 5CHFA 3I5JC 4WJNA 1NVID 3ML8A 2JZ3B 3AE6B 2GI9A 2KQ4X 4MEMA 5HKHA 3UI3A 1JWBD 4DQOC 1SJED 2ZCCA 1N6ZA 2GBKA 3E9SA 4WAFA 2CJOA 2NR2A 4I6PA 4IM3A 2MW5A 1K50A 1QOBA 4HPPA 4PYZA 5J2RA 1ENFA 4UDUC 2REXA 4P1BC 3ZNHB 4ASWC 3ZTCA 4RFBA 2DHZA 1JWSD 5IA7A 1TS5A 3VRAB 2INNE 2MP2A 2M0AA 3N20C 2HTME 2J53A 3Q8EA 5EE0A 1L6UA 1FD6A 5AZFA 3WIMA 3UIOB 4MM3A 4Q2JA 2L3ZA 3VUYA 3CSFA 3ENEA 2WDQB 2LEKA 4EZJA 3AE3B 2LJIA 1YX6B 3Q14C 1YNTE 3DBHI 2KANA 4JWSC 1LM8B 3VVWB 2JU6X 2IPKD 1C4CA 2DYBA 2RSUA 5DPWA 2Y5PA 3P2BA 1KJTA 3AI5A 2Y5CA 2UWQA 3A9JA 3BK1A 1GOZA 5IOIA 2K8CA 4M0WA 3A9JB 2BYVE 3AEEB 1FNUA 2JXXA 2WHIA 3C19A 2WXPA 1I4QA 1Y56A 1WFYA 4RF1A 4KZ0A 3NG0A 4PK1A 1Q5WB 1J7CA 2QCZA 2MHJA 1HEZE 4RGTA 1F52A 5I4DA 1GB1A 4OZAA 1ET6A 2JX5A 2RDBC 1FNVA 2BYEA 4N6EB 2M4NA 1YJJA 2K8BA 2LVPA 3BWUD 2WS3B 4JE3B 3IG3A 1AWDA 3HK0A 2J0MA 3O65B 2EKIA 1WYGA 3DBLI 1CJEA 1QLBB 3WAOA 3KUDB 3L16A 1N60A 4TQ1A 2BWES 1KLGD 3PVLA 1IYFA 1KLUD 1WX7A 3P1MA 2LGDA 2W82A 3DOWA 2L0FA 2JWZA 2C60A 1VD2A 1N63A 3RNCC 2MA9B 3KW5B 1U4AA 4AWJA 3V6CB 2ZNVC 3AB5A 2N9KA 3N3KB 4WIPA 4GGQA 4HPLB 1ZP0B 2K9XA 3RNEC 3ONSA 1AYFA 4MGYE 3VTUA 4IWPA 2KLGA 1JALA 1XLOA 1E9MA 3R2IA 2KVZA 4DDID 4AJWA 3H7PA 2KMAA 3A9KB 2INDC 4B0MA 1V5TA 2IO1B 4K3CA 1RRBA 1B1ZA 2KMMA 1PFDA 1E0ZA 5JH5C 4YTNB 2V0GA 3QARA 1MI0A 3A4RA 1WGGA 3FKYA 4IM2A 3NVYA 5E6OA 2ZZPB 1WE6A 3M95A 3W2DA 2AQ1B 3V62A 4LNIA 4IDIA 3W1SC 5IP4D 2JZZA 2NMQA 1GC6A 3RNGC 1SIJA 3URYA 1OEYJ 3RYTA 3C0RB 2K39A 5G2NA 2QHOA 1Z2MA 4P1CC 4WWMA 2R2QA 1TS4A 2XNAC 1KF6B 2PEAA 1QOFA 1QKZA 2N4FA 4E71A 1ZDXA 5KHQA 2CHWA 2O2VA 1UD7A 3PGEA 1WX9A 4MSMB 1I4HA 1WMHA 1WJUA 2XN9C 2VH1A 3T3OA 4MGIE 2FCNA 3LB8C 2V3SA 2LVOA 5H92C 2NBVB 1P1AA 3HUIA 1A70A 3TMPB 2LWPA 5LNK1 2WXIA 1C76A 2GB1A 3GP7A 3WANA 5AUIA 1P0RA 3W1YA 4USAA 1IPGA 2KWVB 1SE9A 2I1KA 1EWYC 2IZVB 3ML9A 2ASQA 3NZSA 3AV8A 1UZXB 1OGWA 4XYCA 2IO0B 1F1HA 3ZJVA 1YQBA 4G3XB 4W9IA 3NOBA 1E8ZA 5BMHA 1SSNA 2KXJA 2G1EA 3MC0B 4LJPB 3AM9A 2LHDA 1M4VA 3AE8B 4EUTA 3BVMA 3I9V1 3L0WB 1LFDA 2IGGA 3ZLZA 1PGXA 4DWFA 2DZIA 3JSVB 3NS8A 4GIVA 3ZNZB 2NPTB 3M3JA 1ZPSA 1UNSA 3U2SC 5JXVA 3V6EB 1DGJA 4R3DA 1Q0WB 3I57A 4ANVA 1L5PA 3I3TB 5BMIA 3AE1B 2L0TA 1V97A 2IGHA 1TY0A 4K81A 4DXAB 1SJHD 2WXFA 4LDTD 2ZEQA 1ZXHA 2V3PA 3FAHA 3PZ8A 3MC9A 3LXFA 1F9JA 2BB5A 4A6QA 3QAQA 2WYQA 3QA8A 4HDOA 3BVGA 2ICIA 3VUXA 4ZHPA 4YL8A 3EFUA 2V9HA 2PE9A 3TUOA 1R4NI 4II2B 1FRDA 5CHWA 2KFKA 4MJSA 4ITKA 3P63A 4C4VB 2BW2A 1TGZB 3IHPC 1C78A 1EF1A 2OOBB 5J18A 3VRBB 2K6QA 1ZW7A 1QOAA 4JLCA 5IAAC 4P6VF 5MPOA 3RFZB 3QC8B 1XCTL 2RPQA 1LXDA 4KVGB 1ZKHA 2KJHB 1AW7A 4A90A 3N9YC 3W5VB 3NY5A 4US8A 2JT4B 4HXDA 3AULA 3UQAA 2LGXA 2W54A 4DBGA 2Z59B 2ZW0A 4IWOA 1N61A 2GLSA 3FILB 2WXKA 5G5HA 4WQOB 4DHJD 1M94A 2DBYA 3PPAA 4WJQA 3ZUNA 1V86A 5CX3A 3L10B 3IAM1 3I63C 1QOGA 1KFYB 1IUEA 4L1BA 2JRHA 3DQVA 1E8WA 3DBRB 2IY0B 1UUPA 3FC4A 4C00A 1YX5B 4FULA 2JRIB 1Z5SB 1C3TA 1HZ6A 1WE7A 3HM3A 4TKNA 4WURA 3GE3C 1WXVA 3DCGA 3U8ZA 1E8YA 2KX0A 3RULA 1KLVA 2WQYB 3VH4B 3J9CA 2VZKD 1WZ3A 1KTKA 3ZVVA 1L7YA 4W9CA 1XEEA 1N5XA 2D2QA 4ZRJA 3OAWA 2D11A 3TL5A 1WXQA 1PQSA 2JUOA 2MJ3A 1C1YB 2LRWA 4RM9A 1NI3A 4AJYB 3AEFB 3B2FA 5DCNA 2OEDA 2PPHA 1J7AA 3BY4B 5DPSA 5EDSA 1BUIC 4EE2A 1LO5D 2KJ6A 2N1VA 2D3CA 2KQSA 1VZ6A 4EZLA 3RNFC 1WM2A 2KMCA 4ARIA 1GC7A 3GZNI 5H8YE 3QK0A 2KWDA 1TIFA 1WH3A 4GSWA 3HIZA 3AH7A 5T8IA 2C7MB 2Y3AA 1UBQA 4YWGG 1IGCA 2M1MA 1D3ZA 4BOZB 1NYQA 3VTVA 4RMAA 4OZCA 1UBIA 1UELA 1E6EB 1TY2A 2MCNB 2INPE 2BS4B 2KFJA 3LYYA 4A9AA 4ZRIA 2KOXA 2NCNA 2OJWA 3BZDB 2HJ8A 3E56A 4WH4A 2KNBA 1STEA 2A4ZA 1X1MA 2PLPA 1XCQL 2BKRB 4FHKA 2LMCA 2CKHB 2D3GA 1AARA 1TKYA 2ON8A 3VDZA 1EU3A 3AU5A 2X8XX 3DBRI 1TZOA 5L83A 4D2KA 1FFUA 4NY0A 1H4RA 4ZRKA 3MJWA 1HE8A 2C7HA 4GN1A 1JROA 1C4AA 3N1YC 1C9FA 1PYWD 3RPFC 1GUAB 2ZNVB 2RGFA 1XLPA 1XQQA 4ZRQA 3PRPB 1RWSA 3T8MA 2V1YA 2W3SA 2GRIA 4E74A 1YMHE 4YTPB 3SHQA 3KYCD 2KACA 2AQ3B 2WX0A 4HKQA 1WJ4A 2PKOA 4OVZA 4HKZE 3NVWA 5BO4B 2K0PA 2KHWB 3PRMB 3CF6E 1CQVA 1T0RC 1YN5A 1LQBA 4XDCA 2NTSA 1UGMA 1K8RB 3AEBB 4XGAB 2JSVX 1LGRA 2A5UA 2YVCA 1YJ1A 4PS8A 1L0YB 2GMIC 2TSSA 4MJSB 5GXGB 3QHTA 4MH8A 3AN1A 4ZHOA 3VQIA 3GE8C 2FE8A 1R4MI 4IG7B 2BWFA 2AL6A 2L7RA 5G5GA 1QT9A 4IUMB 3WAPA 1VJKA 3PLUA 2WXLA 3NJTA 1J8CA 4RF0A 2WXGA 2LUMA 4KKIA 4KZCA 4A3OA 2MBBB 2V3NA 2IYDB 5IO9A 1DOIA 2FUHB 4X57B 1E7VA 1ET9A 2CU3A 3P4RB 2IJ0A 3JVZX 1MHHE 3MFGA 1QQRA 2WP9B 1GB4A 5BYQA 3UIPB 3KUCB 1OEYA 1SE3A 4W9KA 3U52E 2KQ7A 3CSTA 1WYWB 1E90A 2X38A 4P7IA 2I38A 3PS6A 1Y8RC 2WXMA 3R7RA 2K22A 2DNFA 4PYUA 1FCLA 4L2YA 4LNOA 3TIXA 1T0YA 2ACZB 3QWZB 2M8SA 3KUZA 2BKFA 5BYSA 3SEBA 2L8JA 2L32A 2EMSA 4KIKB 1EM7A 1I4XA 3LJ3A 2DZMA 4HDQA 4G50A 1JCKB 2KDMA 4KGTA 1UF0A 3B1LX 3QIJA 2GOWA 3TCAA 1RLFA 5IKCM 1R4MB 2IO2B 4I6LB 2KWCA 2VH2A 4HJKA 4HJGE 2N9EB 3SDLC 2WWZA 1L0VB 4II3B 3TJPA 4ICUA 2J4XA 2UYZB 4RGNA 4M8MA 1SE4A 3VHTC 3DVNU 2C7NB 3Q69A 3NRZA 3UQBA 1WJ6A 4EKUA 4WWNA 2FBWB 2G4DB 1TZ1A 1EF5A 2EMTA 3AECB 3H7PB 4XZ4A 4C4VA 5HI1A 1T5XD 3X0WA 3KYDD 2M56B 4B6WA 2RR9A 1L6VA 3N32A 3AE7B 4JL9A 1SE2A 5EE1A 2D07B 2JXTA 2G4SA 2LRUA 4FBJB 1FFVA 5TR5A 2FAZA 4W9HA 1I35A 4NQLB 2K3UA 2DZKA 1S1QB 2KTRB 1ZGUB 1WGYA 3B2GA 1V5OA 4W9LA 2MBOA 4H2AA 2R2OA 3RN9C 1D4BA 4XE0A 4IKGA 1EWCA 1YN4A 3P42A 3ZO5B 4GXBA 3HVZA 4OVVA 1SBBB 2JYEA 3EHVA 3L54A 3GOEA 3T9LA 1E7PB 2ZPYA 1T0QC 2H88B 1A5RA 1NBFC 2BYFA 5AUKA 1YQ4B 3MTNB 4LDTB 1FXIA 4BAXA 1ACCA 2BTEA 1WGDA 1CMXB 4MGZE 1VZ7A 3NZUA 3DVGY 2KC1A 1TKEA 4PS3A 4KKJA 2NS5A 1T3QA 2B3AA 3AEDB 2AWTA 2PVOD 4XDDA 3PZ7A 3VR8B 1F2RC 2Z8LA 4J6IA 1IGDA 4LNFA 3A1QA 3U7ZA 5CHVC 5JHBA 2DX5B 2RMMA 1XD3B 1RFKA 3BYYB 4OHJA 1QILA 3VXWA 2WX1A 3PRZA 3ZTDA 1XF5L 4KIKA 1WSPA 2J7QB 2DENB 2ONQA 1T6BX 4NQKE 4DXGA 3NS1A 3IVFA 3PO0A 4FJYA 1TTNA 2GBMA 3UF8A 3AXCA 1ROEA 2KT7A 3EGRA 4ZYNA 2KVRA 1D5MC 3ZKJC 2MX2A 3APDA 3ECIA 1C77A 4YSZB 1YJIA 2O2VB 4MH0E 4CO7A 1ISNA 3L4PA 4JX1C 3EA6A 2MLBA 4S17A 3IT6B 4GMVA 4ARCA 4ZDVA 4WJOA 1MG4A 2O6VB 3MC8A 4FADA 2KYWA 5E6PA 3NVVA 3N1XC 2K5PA 3R7QA 3HVDA 1FXAA 2DAJA 3KVFB 5D6JB 4IW0A 1MFWA 1MJDA 1WI0A 1GJZA 2R61A 4P16A 1RAXA 3KQ4A 2HJ1A 4RH6A 1WY8A 4KX6B 1JRPA 3VTWA 2AX5A 4ANUA 3AEGB 1QF6A 4RGOS 4N9F4 3L08A 2XBBC 4HVBA 2LXCA 1YN3A 4MDKE 1PGBA 3UGBB 1HTOA 1V80A 2BGFA 3OJ3A 3Q2AC 1Q10A 2RD0A 3ZQ4A 4ZYSA 2GBJA 3T3NA 2B76B 2Z0DB 1PDXA 2WXRA 4O1NA 2MWSB 2KX3A 3SD5A 2KN5A 3D32A 4A3PA 5L95C 3AE5B 3DBHB 4BBNC 4CHKA 3Q3FA 1YQ3B 4C80A 1Q1OA 1WXAA 4DHZE 1YIWA 2PTLA 2WU5B 2GBRA 2LFIA 4A8XC 1SEBD 3Q3OC 4AOFA 5GMVA 2K6DB 2UU7A 2WXHA 3QX1A 3ZXRA 2W55A 4DK5A 4JQWC 3DHHC 2KC2A 4C56C 1K52A 2QSDA 2IBIB 3MHSD 3Q3JA 2CS4A 3P4PB 1FNWA 1VZ8A 2PW9A 2AL3A 3N30A 1L4ZB 2VZKB 4XWTA 4IC7B 4ZOHC 2KKCA 1WF9A 5C2TB 3GB1A 1EUVB 4HCNB 3WAMA 4REZA 2N9XA 1SB3C 3VFKA 1D5XC 3DWGC 4IM0A 3PLVA 5EE9A 1FPYA 5EE3A 2KDBA 2VRRB 3MJ5A 1WGKA 3SR6A 1FEHA 3W5UB 2O6VA 2DWQA 1N62A 5D7GA 3EECA 1VCBA 1TT5B 1NDDA 3IFWB 1K51A 1I7HA 4BKTA 2DYMA 4NZLB 4M02A 4HCPB 5FK9C 1HTQA 1JMLA 4K7UA 3Q3MC 2LGIA 2G3QB 3IBEA 4FN2A 1UWXA 2MJDA 4US9A 1FO4A 3Q8CA 5IN7A 2GBNA 1J19A 1D5ZC 1E5WA 2MH7A 1GPXA 3DDCB 3TEWA 4TUUA 4GU2A 1DOXA 4WWOA 1HXYD 4JGHB 3H1UA 3P4SB 3JW0X 1P98A 3RZFA 2N1WA 2BBCA 2ZCBA 4JWUC 3TEYA 3CWIA 4GDKA 3ZRCA 1N5WA 3VUWA 1D6EC 3A1QB 3APFA 2KDIA 1FM0D 1FIQA 3WCQA 2WXQA 1HQRD 4LCDE 2QILA 4AP4C 2RDGA 1MG8A 5BYRA 4BOSC 3UINB 5AZHA 4BFRA 3A33B 1DOYA 2JF5A 4K7SA 3RMKC 2BVCA 2ZJDA 2E3TA 2MRPA 3RI7C 1WXMA 3U30A 2XK5A 2PVGC 3ZNGC 1JRUA 2IGDA 2KLCA 4OW0A 4GDLA 2IDYA 4GLSC 3IAS1 3ETRA 1EO6A 2LJ5A 4BKSA 1WM3A 1E10A 3DPDA 4XWWA 4MACA 3C8YA 1JWMD 2G9HD 2ZPNA 3SFDB 5E6NA 1OQRA 2KD0A 2WNMA 2CHZA 3NVZA 2SAKA 1WGRA 4BKSD 4NJ7A 4AUQC 3AE4B 1NENB 4F7ZA 5LXHA 2RPVA 3FILA 3BK2A 1E7UA 2V4LA 1MPEA 4K7WA 2Q5WD 2WDVB 4RM8A 1V1PA 3DVNV 3P4QB 4PT5A 2MEKA 3IXSA 1WWTA 4WAAA 2YEPF 3RCZA 1GG3A 2LGSA 3RZWC 1L2NA 4DXFA 1OFFA 2BT6A 4M00A 1KOTA 2KWUB 3WA0A 5D3IB 1P9DU 3W9CB 2JQRB 2CR5A 3VH3B 3JYUA 2IO3B 2KDFB 1BMLC 2NTTA 1XO3A 1WMHB 1ZXIA 3KLSX 3BIID 3OG5A 4IOIE 5E6JA 4QAYA 3MP9A 4TQ0A 1CK1A 1PGAA 2WDTB 3QJZA 5HFYA 2ZVOA 2LXAA 3MHZA 2WXNA 3Q8AA 4A55A 2MBQA 4KDIC 2C5LC 5AEKB 3B0AA 4KGSA 4MGKE 1XXGA 2KZRA 3Q8FA 2LGYA 3RNAC 4HROA 2QEJC 2W9NA 3U7DA 2L83A 3PHWB 2WXJA 3OLMD 1IP9A 3ZIMA 3GZNB 4HWIB 4WJPA 5J17A 1GNUA 2FNJB 1L4DB 4YT0B 5C23A 3HHMA 2W3RA 2I1JA 1V8CA 1AN8A 1SGHA 2BS2B 2Y5BB 2NPTA 3W1SA 3JSVA 1S3SG 3ZNID 1TKGA 1VRAB 3ZXVA 4NJ6A 1KRHA 1CZPA 3PHXB 4NAWA 4YSYB 4WQMA 2MQJA 1IBXB 2MBEA 2N7JA 2LHEA 5C1ZA 4N58A 3OWEB 2IY1B 1V6EA 4G11A 5HHDG 2J52A 3GS2A 3EC8A 3PREA 4MSQB 1ZE3D 1MVKA 2QMTA 3QCAA 2QJLA 4HK2A 3PV1A 3ZW3A 2QDFA 3VR9B 3H8HA 1JWUD 1WR1A 5BMGA 1F0ZA 2KTRA 2L1AA 2WXOA 4EFOA 1J0GA 4LNNA 1T0SC 4RNAA 2CHXA 4G0NB 4W9GA 2PJHA 4EZKA 1NI2A 1F2RI 4NPNA 2K25A 3SU8X 4EEWA 3NZ3A 4B95A 4NNJB 1WZ0A 3QQ8B 1NEKB 1H8CA 2N7EA 1I42A 2PE6B 4KV2A 1FMAD 2E6XA 4E3CA 2KDEB 3R3MA 3LDZE 4N59A 2XEWA 4W9FA 5D2MB 5TSSA 2YEPB 3U4EG 3BYTB 2WDRB 1KH0A 2LVQA 3DWMA 4ICVA 3M62B 2N9LA 3BINA 3AU4A 4W9DA 2C9WB 1BXTA 2QIEB 3PZDA 2FIFA 4LNKA 1B9RA 2HTHA 1FCCC 2EELA 4TSSA 2DLBA 1WX8A 4ANXA 4GOCA 3H6NA 3TSSA 2KO3A 4GDKB 4HEA1 5LLIA 5C3JB 2AYOB 1UWMA 2KAJA 4YXDB 1SXTA 2N0SB 2NBWB 4FLHA 4KSLC 4MELA 4NAWB 4NAMA 1OQQA 4WWPA 2DZJA 2JY6A 3DBLB 2D3BA 1V2YA 3Q3NC 2JVCA 5CTRC 2MBHA 4FJVB 3DVGX 2FUG1 2KN4A 2L52A 3A4SC 4DDGD 4CQNA 3KWLA 2BF8B 4CYEA 3BVZA 3AE2B 2HD5B 3HRDD 4XC2A 2D10A 5JHAA 1PUTA 1SF0A 2NVUI 1OQYA 2JZPA 5FKAC 2PMVA 4LTUA 1TJEA 1UGJA 1ESFA 2KTFA 1BT0A 1E8XA 1YD8U 1NYRA 4PS7A 1RFAA 3H7SA 2DAFA 4DHJB 3CIRB 3RD2A 3ZDMC 2M17A 4HLEA 4OZBA 1WXSA 1HZ5A 4K1RB 1TS2A 1K53A 4KGRA 4URKA 2FCMA 4M8NA 1WJNA 1XT9B 1WR6E 3L17A 3B9JA 2HDEA 4MM3B 3A9KA 5D3DA 3APCA 2LASA 1R7SA 1P7FA 2FCQA
chains in the Genus database with same CATH topology
3IFWB 1OEYJ 3RYTA 3K9PB 4BKTA 3C0RB 2DYMA 2MP2B 3VQIA 4HCPB 3S2AA 2K39A 5G2NA 2QHOA 4DHZB 2CU1A 1Z2MA 1R4MI 4IG7B 5KHOA 2OJRA 2R2QA 4K7UA 2PEAA 3ZRFA 2BWFA 2AL6A 3X23A 2G3QB 1SIFA 2L7RA 2N4FA 3IBEA 4FN2A 3ALBA 5DPRA 4E71A 4B9KA 4IUMB 2GBNA 3WAPA 5KHQA 2CHWA 3KH0A 1WRDB 2O2VA 3PLUA 2L00B 1UD7A 3V61A 3PGEA 4HPMB 1J19A 1WX9A 1E5WA 4MSMB 1J8CA 3M63B 4TV3A 1WMHA 3DDCB 4KZCA 4A3OA 2MBBB 4TUUA 4GU2A 1WJUA 2IYDB 4KDLB 4WWOA 2EKEC 2FUHB 4I6NB 4JGHB 4X57B 3H1UA 1E7VA 3JW0X 1P98A 3RZFA 2N1WA 4MGIE 2FCNA 2ZCBA 2V3SA 2LVOA 4GDKA 2NBVB 3JVZX 3ZRCA 1P1AA 1UH6A 5AZGA 3TMPB 2LWPA 3L13A 3H9DA 3WANA 3UIPB 3KUCB 1OEYA 1P0RA 4W9KA 3W1YA 3VAWA 2KQ7A 3VUWA 3RUIB 3A1QB 1IPGA 3APFA 2KDIA 2KWVB 1SE9A 3CSTA 2I1KA 1WYWB 1E90A 2IZVB 1G6JA 3ML9A 2ASQA 4LCDE 3NZSA 4P7IA 4AP4C 1UZXB 3PS6A 4LJOB 1OGWA 1MG8A 4BOSC 1Y8RC 3UINB 3R7RA 5AZHA 2IO0B 4PYUA 4BFRA 3TIXA 1T0YA 3A33B 2JF5A 2O6VD 3QWZB 2M8SA 4K7SA 3KUZA 2BKFA 4GB9A 2ZJDA 1YQBA 3TBLD 4G3XB 2MRPA 4W9IA 1QZEA 4F1SA 2L8JA 3NOBA 4W9EA 1E8ZA 2EMSA 4KIKB 1WXMA 3U30A 2K8HA 2KXJA 2XK5A 3ZDTA 3LJ3A 3ZNGC 1JRUA 2DZMA 4LJPB 4HDQA 4G50A 2KLCA 3B1LX 4GDLA 3QIJA 4BKGA 3PT2B 2GOWA 3TCAA 1RLFA 1OTRB 5JZEB 2IO2B 4EUTA 4I6LB 2HE7A 2KWCA 3HM6X 1EO6A 3L0WB 2LJ5A 1LFDA 2MSED 1WM3A 5DPTA 4BKSA 3ZLZA 4DWFA 3DPDA 4HJKA 2N9EB 2DZIA 4M0WB 2WWZA 3JSVB 4FHJA 4JIOU 2FCSA 3NS8A 4GIVA 2NPTB 3ZNZB 2JPHA 2ZPNA 2DYOA 5E6NA 4II3B 3TJPA 3M3JA 3V60A 2KD0A 2CHZA 4XX5A 4ICUA 2LZ6A 3CMMB 2UYZB 3V6EB 1WGRA 4BKSD 4NJ7A 4AUQC 4F7ZA 5LXIB 5LXHA 4M8MA 1Q0WB 3VHTC 2J0KA 3DVNU 4ANVA 2C7NB 1E7UA 3I3TB 2N9PC 2V4LA 2NBUA 3WALA 2KFKB 3UQBA 2LD9A 1WJ6A 4K7WA 4WWNA 4EKUA 2G4DB 2L0TA 1TZ1A 1EF5A 2EMTA 4K81A 3H7PB 4XZ4A 4DXAB 4RM8A 3DVNV 2ZEQA 4LDTD 3X0WA 3KYDD 2J0JA 3DBSA 4B6WA 2RR9A 1WIAA 1V81A 1F9JA 4WAAA 3RCZA 3QAQA 3N32A 1GG3A 3RZWC 1L2NA 2WYQA 3QA8A 4HDOA 4JL9A 3OJ4B 2L05A 3VUXA 2BPSA 4YL8A 4F8CB 2D07B 2KWUB 1KOTA 2N7DA 3WA0A 2G4SA 2LRUA 2FIDA 3EFUA 3K9OB 2PE9A 4FBJB 1P9DU 5TR5A 2FAZA 2M0XA 2Z0EB 4W9HA 1R4NI 4II2B 2CR5A 1FXTB 3VH3B 3JYUA 2KK8A 2IO3B 1I35A 4NQLB 5D94A 1P3QU 2DZKA 2KDFB 5CHWA 1S1QB 1WMHB 2G45B 2K1FA 2KFKA 2KTRB 4MJSA 4W9JA 3RT3B 1ZGUB 1TGZB 5FR6A 1WGYA 4ANWA 5G55A 3IHPC 4TQ0A 4OVUA 1EF1A 1V5OA 2OOBB 4W9LA 3PSEB 5J18A 2WDTB 3QJZA 2ZVOA 2MBOA 4KSKC 4BVUC 2K6QA 1V9JA 2LI5A 1ZW7A 2LXAA 2R2OA 3R66C 4JLCA 5IAAC 2AEHA 4DHZE 4FA6A 2YLMA 2L76A 4BBNF 3QC8B 2RPQA 1WGHA 2MBQA 1LXDA 4IWQA 4KVGB 1ZKHA 2KJHB 3NHEB 4FJZA 4KDIC 2C5LC 2KJRA 4EOYA 5AEKB 3B0AA 3ZO5B 4MGKE 4GXBA 3NY5A 2KZRA 2JT4B 4HXDA 4OVVA 3AULA 3UQAA 2LGXA 3EHVA 2LGYA 2Z59B 3L54A 3GOEA 3T9LA 4A20A 4DBGA 2W9NA 3B08A 3U7DA 2ZPYA 1TBEA 3PHWB 1A5RA 1NBFC 2BYFA 4IWOA 3OLMD 1IP9A 3ZIMA 4HWIB 3PTFC 4WJPA 5J17A 4GDLB 3MTNB 4LDTB 2LUEA 1GNUA 2FNJB 4WQOB 4DHJD 1WGDA 1CMXB 1V49A 4MGZE 1M94A 5C23A 3NZUA 3HHMA 2XK5B 1KM7A 2ZVNA 3DVGY 3PPAA 4WJQA 3ZUNA 2KC1A 2I1JA 1V86A 5CHFA 4PS3A 5CX3A 3L10B 2NS5A 3SDLC 1SGHA 4WJNA 2JZ3B 2JRHA 3ML8A 2Y5BB 2B3AA 2NPTA 3DQVA 3W1SA 3JSVA 2AWTA 1S3SG 1E8WA 4MEMA 3ZNID 5HKHA 2IY0B 1YX5B 4NJ6A 4FULA 2JRIB 3PHXB 1Z5SB 2ZCCA 1C3TA 2GBKA 2NR2A 1WE7A 4I6PA 4IM3A 4NAWA 3HM3A 4J6IA 2MW5A 2MQJA 3A1QA 4TKNA 5CHVC 1WXVA 5JHBA 2DX5B 1XD3B 3DCGA 4PYZA 1E8YA 3U8ZA 5J2RA 2KX0A 2REXA 3RULA 1KLVA 2MBEA 3ZNHB 4ASWC 5C1ZA 3VH4B 2IY1B 1V6EA 4G11A 3ZTCA 3VXWA 2DHZA 2WX1A 3PRZA 3ZTDA 4KIKA 2J7QB 2DENB 5IA7A 3EC8A 3PREA 1WZ3A 4MSQB 3ZVVA 1L7YA 2MP2A 3QCAA 4NQKE 4W9CA 4HK2A 3PV1A 3ZW3A 4ZRJA 2D2QA 3IVFA 3OAWA 2D11A 5AZFA 3TL5A 4FJYA 3WIMA 1TTNA 2GBMA 3UIOB 1PQSA 4MM3A 3UF8A 3AXCA 1WR1A 2KTRA 2JUOA 2L3ZA 3VUYA 3CSFA 3ENEA 4EFOA 1J0GA 1C1YB 2LRWA 4RM9A 4AJYB 4EZJA 4ZYNA 2KVRA 5DCNA 1YX6B 2CHXA 4G0NB 4W9GA 2PJHA 2MX2A 3ZKJC 4EZKA 3APDA 3ECIA 1NI2A 3DBHI 2O2VB 4NPNA 2PPHA 4MH0E 2K25A 2KANA 3BY4B 1LM8B 5DPSA 3SU8X 4CO7A 4EEWA 3VVWB 1ISNA 4B95A 4NNJB 2RSUA 2DYBA 1WZ0A 5DPWA 3P2BA 3QQ8B 5EDSA 1KJTA 2MLBA 1H8CA 2N7EA 3AI5A 1I42A 2PE6B 2KJ6A 4KV2A 2N1VA 4GMVA 2UWQA 3A9JA 2KQSA 4ZDVA 2K8CA 3A9JB 4EZLA 4WJOA 4E3CA 2BYVE 2O6VB 1WM2A 2KDEB 2JXXA 1GC7A 2KMCA 3GZNI 5E6PA 4FADA 3R3MA 3QK0A 3LDZE 2XEWA 4W9FA 5D2MB 1WFYA 4KZ0A 1WH3A 4GSWA 3HIZA 3R7QA 1Q5WB 2LVQA 4ICVA 2DAJA 3M62B 3KVFB 5D6JB 4IW0A 2C7MB 1UBQA 2M1MA 1D3ZA 1WI0A 3AU4A 3BINA 4W9DA 4AWJA 4BOZB 3VTVA 4RMAA 2C9WB 1UBIA 1UELA 1GJZA 1RAXA 3PZDA 2BYEA 2FIFA 2M4NA 2K8BA 2LVPA 1WY8A 3IG3A 2MCNB 3HK0A 2J0MA 2HTHA 3O65B 3VTWA 2KFJA 4ZRIA 2KOXA 3DBLI 2NCNA 4ANUA 3WAOA 4N9F4 3L08A 3KUDB 3L16A 2HJ8A 2XBBC 1WX8A 2LXCA 4ANXA 4HVBA 4GOCA 4MDKE 3H6NA 3UGBB 2KNBA 4TQ1A 2A4ZA 1V80A 1X1MA 2BGFA 2BWES 3OJ3A 2KO3A 2BKRB 4FHKA 3PVLA 4GDKB 2RD0A 1IYFA 2GBJA 1WX7A 2CKHB 2LGDA 5LLIA 2Z0DB 2D3GA 2AYOB 2MWSB 3DOWA 1AARA 2KX3A 2L0FA 2NBWB 4FLHA 2JWZA 3VDZA 3SD5A 2C60A 2KN5A 3AU5A 1VD2A 3D32A 4A3PA 5L95C 3DBRI 4BBNC 4KSLC 5L83A 4MELA 4CHKA 4NAWB 3Q3FA 4NY0A 1Q1OA 2MA9B 1U4AA 1H4RA 3KW5B 1WXAA 4ZRKA 3V6CB 1YIWA 1HE8A 2DZJA 2C7HA 2JY6A 2ZNVC 3MJWA 4WWPA 1V2YA 3N3KB 2GBRA 2JVCA 4GN1A 4GGQA 5CTRC 4HPLB 2MBHA 4AOFA 3ONSA 2K6DB 4FJVB 3DVGX 5GMVA 4DDGD 3A4SC 4CYEA 2BF8B 4MGYE 1GUAB 3VTUA 2ZNVB 3QX1A 4IWPA 2HD5B 2RGFA 4XC2A 2KLGA 2D10A 5JHAA 1XQQA 4DK5A 4JQWC 3PRPB 3T8MA 2NVUI 2V1YA 1OQYA 2KC2A 4DDID 4E74A 4AJWA 3H7PA 2IBIB 3KYCD 2KMAA 3SHQA 3MHSD 3Q3JA 2CS4A 2WX0A 2KTFA 3A9KB 1BT0A 2AL3A 3N30A 1V5TA 1E8XA 1YD8U 2IO1B 1RFAA 1RRBA 2KKCA 1WJ4A 1WF9A 4IC7B 4PS7A 1EUVB 3H7SA 4HCNB 3WAMA 2DAFA 5BO4B 5JH5C 4DHJB 2N9XA 3QARA 2KHWB 3PRMB 2M17A 3CF6E 3RD2A 3VFKA 3ZDMC 4IM0A 4HLEA 1LQBA 3PLVA 1WXSA 1UGMA 3A4RA 1K8RB 1WGGA 2KDBA 4K1RB 2VRRB 4IM2A 4URKA 5E6OA 2A5UA 2FCMA 2ZZPB 2YVCA 1WE6A 3M95A 1WJNA 4M8NA 1XT9B 3V62A 1YJ1A 1WR6E 4PS8A 3W1SC 3L17A 2JZZA 2O6VA 2GMIC 4MJSB 5D7GA 3EECA 3A9KA 1VCBA 3QHTA 3APCA 1GC6A 1NDDA 2LASA 2FCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFW B;  1OEY J;  3RYT A;  3K9P B;  4BKT A;  3C0R B;  2DYM A;  2MP2 B;  3VQI A;  4HCP B;  3S2A A;  2K39 A;  5G2N A;  2QHO A;  4DHZ B;  2CU1 A;  1Z2M A;  1R4M I;  4IG7 B;  5KHO A;  2OJR A;  2R2Q A;  4K7U A;  2PEA A;  3ZRF A;  2BWF A;  2AL6 A;  3X23 A;  2G3Q B;  1SIF A;  2L7R A;  2N4F A;  3IBE A;  4FN2 A;  3ALB A;  5DPR A;  4E71 A;  4B9K A;  4IUM B;  2GBN A;  3WAP A;  5KHQ A;  2CHW A;  3KH0 A;  1WRD B;  2O2V A;  3PLU A;  2L00 B;  1UD7 A;  3V61 A;  3PGE A;  4HPM B;  1J19 A;  1WX9 A;  1E5W A;  4MSM B;  1J8C A;  3M63 B;  4TV3 A;  1WMH A;  3DDC B;  4KZC A;  4A3O A;  2MBB B;  4TUU A;  4GU2 A;  1WJU A;  2IYD B;  4KDL B;  4WWO A;  2EKE C;  2FUH B;  4I6N B;  4JGH B;  4X57 B;  3H1U A;  1E7V A;  3JW0 X;  1P98 A;  3RZF A;  2N1W A;  4MGI E;  2FCN A;  2ZCB A;  2V3S A;  2LVO A;  4GDK A;  2NBV B;  3JVZ X;  3ZRC A;  1P1A A;  1UH6 A;  5AZG A;  3TMP B;  2LWP A;  3L13 A;  3H9D A;  3WAN A;  3UIP B;  3KUC B;  1OEY A;  1P0R A;  4W9K A;  3W1Y A;  3VAW A;  2KQ7 A;  3VUW A;  3RUI B;  3A1Q B;  1IPG A;  3APF A;  2KDI A;  2KWV B;  1SE9 A;  3CST A;  2I1K A;  1WYW B;  1E90 A;  2IZV B;  1G6J A;  3ML9 A;  2ASQ A;  4LCD E;  3NZS A;  4P7I A;  4AP4 C;  1UZX B;  3PS6 A;  4LJO B;  1OGW A;  1MG8 A;  4BOS C;  1Y8R C;  3UIN B;  3R7R A;  5AZH A;  2IO0 B;  4PYU A;  4BFR A;  3TIX A;  1T0Y A;  3A33 B;  2JF5 A;  2O6V D;  3QWZ B;  2M8S A;  4K7S A;  3KUZ A;  2BKF A;  4GB9 A;  2ZJD A;  1YQB A;  3TBL D;  4G3X B;  2MRP A;  4W9I A;  1QZE A;  4F1S A;  2L8J A;  3NOB A;  4W9E A;  1E8Z A;  2EMS A;  4KIK B;  1WXM A;  3U30 A;  2K8H A;  2KXJ A;  2XK5 A;  3ZDT A;  3LJ3 A;  3ZNG C;  1JRU A;  2DZM A;  4LJP B;  4HDQ A;  4G50 A;  2KLC A;  3B1L X;  4GDL A;  3QIJ A;  4BKG A;  3PT2 B;  2GOW A;  3TCA A;  1RLF A;  1OTR B;  5JZE B;  2IO2 B;  4EUT A;  4I6L B;  2HE7 A;  2KWC A;  3HM6 X;  1EO6 A;  3L0W B;  2LJ5 A;  1LFD A;  2MSE D;  1WM3 A;  5DPT A;  4BKS A;  3ZLZ A;  4DWF A;  3DPD A;  4HJK A;  2N9E B;  2DZI A;  4M0W B;  2WWZ A;  3JSV B;  4FHJ A;  4JIO U;  2FCS A;  3NS8 A;  4GIV A;  2NPT B;  3ZNZ B;  2JPH A;  2ZPN A;  2DYO A;  5E6N A;  4II3 B;  3TJP A;  3M3J A;  3V60 A;  2KD0 A;  2CHZ A;  4XX5 A;  4ICU A;  2LZ6 A;  3CMM B;  2UYZ B;  3V6E B;  1WGR A;  4BKS D;  4NJ7 A;  4AUQ C;  4F7Z A;  5LXI B;  5LXH A;  4M8M A;  1Q0W B;  3VHT C;  2J0K A;  3DVN U;  4ANV A;  2C7N B;  1E7U A;  3I3T B;  2N9P C;  2V4L A;  2NBU A;  3WAL A;  2KFK B;  3UQB A;  2LD9 A;  1WJ6 A;  4K7W A;  4WWN A;  4EKU A;  2G4D B;  2L0T A;  1TZ1 A;  1EF5 A;  2EMT A;  4K81 A;  3H7P B;  4XZ4 A;  4DXA B;  4RM8 A;  3DVN V;  2ZEQ A;  4LDT D;  3X0W A;  3KYD D;  2J0J A;  3DBS A;  4B6W A;  2RR9 A;  1WIA A;  1V81 A;  1F9J A;  4WAA A;  3RCZ A;  3QAQ A;  3N32 A;  1GG3 A;  3RZW C;  1L2N A;  2WYQ A;  3QA8 A;  4HDO A;  4JL9 A;  3OJ4 B;  2L05 A;  3VUX A;  2BPS A;  4YL8 A;  4F8C B;  2D07 B;  2KWU B;  1KOT A;  2N7D A;  3WA0 A;  2G4S A;  2LRU A;  2FID A;  3EFU A;  3K9O B;  2PE9 A;  4FBJ B;  1P9D U;  5TR5 A;  2FAZ A;  2M0X A;  2Z0E B;  4W9H A;  1R4N I;  4II2 B;  2CR5 A;  1FXT B;  3VH3 B;  3JYU A;  2KK8 A;  2IO3 B;  1I35 A;  4NQL B;  5D94 A;  1P3Q U;  2DZK A;  2KDF B;  5CHW A;  1S1Q B;  1WMH B;  2G45 B;  2K1F A;  2KFK A;  2KTR B;  4MJS A;  4W9J A;  3RT3 B;  1ZGU B;  1TGZ B;  5FR6 A;  1WGY A;  4ANW A;  5G55 A;  3IHP C;  4TQ0 A;  4OVU A;  1EF1 A;  1V5O A;  2OOB B;  4W9L A;  3PSE B;  5J18 A;  2WDT B;  3QJZ A;  2ZVO A;  2MBO A;  4KSK C;  4BVU C;  2K6Q A;  1V9J A;  2LI5 A;  1ZW7 A;  2LXA A;  2R2O A;  3R66 C;  4JLC A;  5IAA C;  2AEH A;  4DHZ E;  4FA6 A;  2YLM A;  2L76 A;  4BBN F;  3QC8 B;  2RPQ A;  1WGH A;  2MBQ A;  1LXD A;  4IWQ A;  4KVG B;  1ZKH A;  2KJH B;  3NHE B;  4FJZ A;  4KDI C;  2C5L C;  2KJR A;  4EOY A;  5AEK B;  3B0A A;  3ZO5 B;  4MGK E;  4GXB A;  3NY5 A;  2KZR A;  2JT4 B;  4HXD A;  4OVV A;  3AUL A;  3UQA A;  2LGX A;  3EHV A;  2LGY A;  2Z59 B;  3L54 A;  3GOE A;  3T9L A;  4A20 A;  4DBG A;  2W9N A;  3B08 A;  3U7D A;  2ZPY A;  1TBE A;  3PHW B;  1A5R A;  1NBF C;  2BYF A;  4IWO A;  3OLM D;  1IP9 A;  3ZIM A;  4HWI B;  3PTF C;  4WJP A;  5J17 A;  4GDL B;  3MTN B;  4LDT B;  2LUE A;  1GNU A;  2FNJ B;  4WQO B;  4DHJ D;  1WGD A;  1CMX B;  1V49 A;  4MGZ E;  1M94 A;  5C23 A;  3NZU A;  3HHM A;  2XK5 B;  1KM7 A;  2ZVN A;  3DVG Y;  3PPA A;  4WJQ A;  3ZUN A;  2KC1 A;  2I1J A;  1V86 A;  5CHF A;  4PS3 A;  5CX3 A;  3L10 B;  2NS5 A;  3SDL C;  1SGH A;  4WJN A;  2JZ3 B;  2JRH A;  3ML8 A;  2Y5B B;  2B3A A;  2NPT A;  3DQV A;  3W1S A;  3JSV A;  2AWT A;  1S3S G;  1E8W A;  4MEM A;  3ZNI D;  5HKH A;  2IY0 B;  1YX5 B;  4NJ6 A;  4FUL A;  2JRI B;  3PHX B;  1Z5S B;  2ZCC A;  1C3T A;  2GBK A;  2NR2 A;  1WE7 A;  4I6P A;  4IM3 A;  4NAW A;  3HM3 A;  4J6I A;  2MW5 A;  2MQJ A;  3A1Q A;  4TKN A;  5CHV C;  1WXV A;  5JHB A;  2DX5 B;  1XD3 B;  3DCG A;  4PYZ A;  1E8Y A;  3U8Z A;  5J2R A;  2KX0 A;  2REX A;  3RUL A;  1KLV A;  2MBE A;  3ZNH B;  4ASW C;  5C1Z A;  3VH4 B;  2IY1 B;  1V6E A;  4G11 A;  3ZTC A;  3VXW A;  2DHZ A;  2WX1 A;  3PRZ A;  3ZTD A;  4KIK A;  2J7Q B;  2DEN B;  5IA7 A;  3EC8 A;  3PRE A;  1WZ3 A;  4MSQ B;  3ZVV A;  1L7Y A;  2MP2 A;  3QCA A;  4NQK E;  4W9C A;  4HK2 A;  3PV1 A;  3ZW3 A;  4ZRJ A;  2D2Q A;  3IVF A;  3OAW A;  2D11 A;  5AZF A;  3TL5 A;  4FJY A;  3WIM A;  1TTN A;  2GBM A;  3UIO B;  1PQS A;  4MM3 A;  3UF8 A;  3AXC A;  1WR1 A;  2KTR A;  2JUO A;  2L3Z A;  3VUY A;  3CSF A;  3ENE A;  4EFO A;  1J0G A;  1C1Y B;  2LRW A;  4RM9 A;  4AJY B;  4EZJ A;  4ZYN A;  2KVR A;  5DCN A;  1YX6 B;  2CHX A;  4G0N B;  4W9G A;  2PJH A;  2MX2 A;  3ZKJ C;  4EZK A;  3APD A;  3ECI A;  1NI2 A;  3DBH I;  2O2V B;  4NPN A;  2PPH A;  4MH0 E;  2K25 A;  2KAN A;  3BY4 B;  1LM8 B;  5DPS A;  3SU8 X;  4CO7 A;  4EEW A;  3VVW B;  1ISN A;  4B95 A;  4NNJ B;  2RSU A;  2DYB A;  1WZ0 A;  5DPW A;  3P2B A;  3QQ8 B;  5EDS A;  1KJT A;  2MLB A;  1H8C A;  2N7E A;  3AI5 A;  1I42 A;  2PE6 B;  2KJ6 A;  4KV2 A;  2N1V A;  4GMV A;  2UWQ A;  3A9J A;  2KQS A;  4ZDV A;  2K8C A;  3A9J B;  4EZL A;  4WJO A;  4E3C A;  2BYV E;  2O6V B;  1WM2 A;  2KDE B;  2JXX A;  1GC7 A;  2KMC A;  3GZN I;  5E6P A;  4FAD A;  3R3M A;  3QK0 A;  3LDZ E;  2XEW A;  4W9F A;  5D2M B;  1WFY A;  4KZ0 A;  1WH3 A;  4GSW A;  3HIZ A;  3R7Q A;  1Q5W B;  2LVQ A;  4ICV A;  2DAJ A;  3M62 B;  3KVF B;  5D6J B;  4IW0 A;  2C7M B;  1UBQ A;  2M1M A;  1D3Z A;  1WI0 A;  3AU4 A;  3BIN A;  4W9D A;  4AWJ A;  4BOZ B;  3VTV A;  4RMA A;  2C9W B;  1UBI A;  1UEL A;  1GJZ A;  1RAX A;  3PZD A;  2BYE A;  2FIF A;  2M4N A;  2K8B A;  2LVP A;  1WY8 A;  3IG3 A;  2MCN B;  3HK0 A;  2J0M A;  2HTH A;  3O65 B;  3VTW A;  2KFJ A;  4ZRI A;  2KOX A;  3DBL I;  2NCN A;  4ANU A;  3WAO A;  4N9F 4;  3L08 A;  3KUD B;  3L16 A;  2HJ8 A;  2XBB C;  1WX8 A;  2LXC A;  4ANX A;  4HVB A;  4GOC A;  4MDK E;  3H6N A;  3UGB B;  2KNB A;  4TQ1 A;  2A4Z A;  1V80 A;  1X1M A;  2BGF A;  2BWE S;  3OJ3 A;  2KO3 A;  2BKR B;  4FHK A;  3PVL A;  4GDK B;  2RD0 A;  1IYF A;  2GBJ A;  1WX7 A;  2CKH B;  2LGD A;  5LLI A;  2Z0D B;  2D3G A;  2AYO B;  2MWS B;  3DOW A;  1AAR A;  2KX3 A;  2L0F A;  2NBW B;  4FLH A;  2JWZ A;  3VDZ A;  3SD5 A;  2C60 A;  2KN5 A;  3AU5 A;  1VD2 A;  3D32 A;  4A3P A;  5L95 C;  3DBR I;  4BBN C;  4KSL C;  5L83 A;  4MEL A;  4CHK A;  4NAW B;  3Q3F A;  4NY0 A;  1Q1O A;  2MA9 B;  1U4A A;  1H4R A;  3KW5 B;  1WXA A;  4ZRK A;  3V6C B;  1YIW A;  1HE8 A;  2DZJ A;  2C7H A;  2JY6 A;  2ZNV C;  3MJW A;  4WWP A;  1V2Y A;  3N3K B;  2GBR A;  2JVC A;  4GN1 A;  4GGQ A;  5CTR C;  4HPL B;  2MBH A;  4AOF A;  3ONS A;  2K6D B;  4FJV B;  3DVG X;  5GMV A;  4DDG D;  3A4S C;  4CYE A;  2BF8 B;  4MGY E;  1GUA B;  3VTU A;  2ZNV B;  3QX1 A;  4IWP A;  2HD5 B;  2RGF A;  4XC2 A;  2KLG A;  2D10 A;  5JHA A;  1XQQ A;  4DK5 A;  4JQW C;  3PRP B;  3T8M A;  2NVU I;  2V1Y A;  1OQY A;  2KC2 A;  4DDI D;  4E74 A;  4AJW A;  3H7P A;  2IBI B;  3KYC D;  2KMA A;  3SHQ A;  3MHS D;  3Q3J A;  2CS4 A;  2WX0 A;  2KTF A;  3A9K B;  1BT0 A;  2AL3 A;  3N30 A;  1V5T A;  1E8X A;  1YD8 U;  2IO1 B;  1RFA A;  1RRB A;  2KKC A;  1WJ4 A;  1WF9 A;  4IC7 B;  4PS7 A;  1EUV B;  3H7S A;  4HCN B;  3WAM A;  2DAF A;  5BO4 B;  5JH5 C;  4DHJ B;  2N9X A;  3QAR A;  2KHW B;  3PRM B;  2M17 A;  3CF6 E;  3RD2 A;  3VFK A;  3ZDM C;  4IM0 A;  4HLE A;  1LQB A;  3PLV A;  1WXS A;  1UGM A;  3A4R A;  1K8R B;  1WGG A;  2KDB A;  4K1R B;  2VRR B;  4IM2 A;  4URK A;  5E6O A;  2A5U A;  2FCM A;  2ZZP B;  2YVC A;  1WE6 A;  3M95 A;  1WJN A;  4M8N A;  1XT9 B;  3V62 A;  1YJ1 A;  1WR6 E;  4PS8 A;  3W1S C;  3L17 A;  2JZZ A;  2O6V A;  2GMI C;  4MJS B;  5D7G A;  3EEC A;  3A9K A;  1VCB A;  3QHT A;  3APC A;  1GC6 A;  1NDD A;  2LAS A;  2FCQ A; 
#chains in the Genus database with same CATH topology
 3R2T A;  3K9P B;  2MP2 B;  3KWV A;  3S2A A;  1I4P A;  1VLB A;  4DHZ B;  2CU1 A;  5KHO A;  3IT4 B;  1TYG B;  2OJR A;  3ZRF A;  3X23 A;  1SIF A;  5DPR A;  3ALB A;  4B9K A;  3KH0 A;  1WRD B;  2M19 A;  4C7Z A;  2L00 B;  3V61 A;  4HPM B;  2BYT A;  2D5G A;  3TEX A;  2SEB D;  3M63 B;  4TV3 A;  3ABV B;  2PIA A;  1EU4 A;  1F77 A;  4KDL B;  4FXC A;  2EKE C;  4I6N B;  3NUH B;  2WU2 B;  4ZRP A;  1UH6 A;  5AZG A;  3L13 A;  3H9D A;  3ZJT A;  1XLN A;  3VAW A;  3RUI B;  3O13 A;  3DHI C;  4HRS A;  3Q8B A;  1G6J A;  3TEZ A;  2AQ2 B;  1VR9 A;  4LJO B;  1TS3 A;  1JQ4 A;  1JW9 D;  2O6V D;  3R8B A;  2D3A A;  3V3X A;  4GB9 A;  3DHG C;  1L0X B;  1VDV A;  2RDH A;  3TBL D;  1HA5 A;  4S0R A;  1QZE A;  4F1S A;  1ZUD 2;  4L23 A;  4LK0 M;  1P7E A;  4W9E A;  2K8H A;  3ZDT A;  3Q6B A;  2H89 B;  3SFE B;  4BKG A;  3PT2 B;  1OTR B;  5JZE B;  2HE7 A;  3HM6 X;  1I4G A;  2MSE D;  5DPT A;  1I4R A;  3V05 A;  4M0W B;  4YSX B;  4FHJ A;  1YOV B;  2FCS A;  4JIO U;  2JPH A;  4ACF A;  2DYO A;  2JYT A;  3V60 A;  4M01 A;  4XX5 A;  2LZ6 A;  3CMM B;  1GAQ B;  5LXI B;  2J0K A;  4AQ7 A;  1J7B A;  2N9P C;  2WGS A;  5FR3 A;  2NBU A;  3WAL A;  2KFK B;  1ZDV A;  4YTM B;  2LD9 A;  1DYQ A;  5HG2 A;  4AS1 A;  2J0J A;  3DBS A;  1WIA A;  1V81 A;  4BZA A;  3RNB C;  4B0E A;  2WLB A;  3EFC A;  1ZOY B;  1RYJ A;  3OJ4 B;  2L05 A;  2BPS A;  1JWA D;  4F8C B;  2N7D A;  2FID A;  3ZYY X;  3K9O B;  2M0X A;  2Z0E B;  1FXT B;  2KK8 A;  3ZJU A;  2INC C;  2CJN A;  4RCO A;  5D94 A;  1P3Q U;  3AMZ A;  2OHF A;  2G45 B;  2K1F A;  4TMA B;  1V1P B;  4NJC A;  4W9J A;  3RT3 B;  1WRI A;  1MHX A;  2ZW1 A;  3AE9 B;  5FR6 A;  2BS3 B;  4ANW A;  5G55 A;  1RM6 C;  1C79 A;  4OVU A;  3PSE B;  4RGM A;  4KSK C;  4J3O D;  4BVU C;  1V9J A;  2LI5 A;  3R66 C;  3EUB 2;  2AEH A;  4FA6 A;  2BB6 A;  2V4I B;  2YLM A;  2L76 A;  4BBN F;  1XLQ A;  1C4P A;  1WGH A;  4IWQ A;  3NHE B;  4FJZ A;  2KJR A;  4EOY A;  1FRR A;  1R4N B;  4LLG M;  4C7Y A;  4K3B A;  3AEA B;  2BQQ A;  3N1Z C;  4A20 A;  2JWU A;  2MJE A;  3B08 A;  1IBX A;  4MT5 A;  1TBE A;  3ZGZ A;  2QC8 A;  3PTF C;  4JPS A;  4GDL B;  1V1O A;  2LUE A;  1V49 A;  2I2Y A;  2J42 A;  1KM7 A;  2XK5 B;  2ZVN A;  5CHF A;  3I5J C;  4WJN A;  1NVI D;  3ML8 A;  2JZ3 B;  3AE6 B;  2GI9 A;  2KQ4 X;  4MEM A;  5HKH A;  3UI3 A;  1JWB D;  4DQO C;  1SJE D;  2ZCC A;  1N6Z A;  2GBK A;  3E9S A;  4WAF A;  2CJO A;  2NR2 A;  4I6P A;  4IM3 A;  2MW5 A;  1K50 A;  1QOB A;  4HPP A;  4PYZ A;  5J2R A;  1ENF A;  4UDU C;  2REX A;  4P1B C;  3ZNH B;  4ASW C;  3ZTC A;  4RFB A;  2DHZ A;  1JWS D;  5IA7 A;  1TS5 A;  3VRA B;  2INN E;  2MP2 A;  2M0A A;  3N20 C;  2HTM E;  2J53 A;  3Q8E A;  5EE0 A;  1L6U A;  1FD6 A;  5AZF A;  3WIM A;  3UIO B;  4MM3 A;  4Q2J A;  2L3Z A;  3VUY A;  3CSF A;  3ENE A;  2WDQ B;  2LEK A;  4EZJ A;  3AE3 B;  2LJI A;  1YX6 B;  3Q14 C;  1YNT E;  3DBH I;  2KAN A;  4JWS C;  1LM8 B;  3VVW B;  2JU6 X;  2IPK D;  1C4C A;  2DYB A;  2RSU A;  5DPW A;  2Y5P A;  3P2B A;  1KJT A;  3AI5 A;  2Y5C A;  2UWQ A;  3A9J A;  3BK1 A;  1GOZ A;  5IOI A;  2K8C A;  4M0W A;  3A9J B;  2BYV E;  3AEE B;  1FNU A;  2JXX A;  2WHI A;  3C19 A;  2WXP A;  1I4Q A;  1Y56 A;  1WFY A;  4RF1 A;  4KZ0 A;  3NG0 A;  4PK1 A;  1Q5W B;  1J7C A;  2QCZ A;  2MHJ A;  1HEZ E;  4RGT A;  1F52 A;  5I4D A;  1GB1 A;  4OZA A;  1ET6 A;  2JX5 A;  2RDB C;  1FNV A;  2BYE A;  4N6E B;  2M4N A;  1YJJ A;  2K8B A;  2LVP A;  3BWU D;  2WS3 B;  4JE3 B;  3IG3 A;  1AWD A;  3HK0 A;  2J0M A;  3O65 B;  2EKI A;  1WYG A;  3DBL I;  1CJE A;  1QLB B;  3WAO A;  3KUD B;  3L16 A;  1N60 A;  4TQ1 A;  2BWE S;  1KLG D;  3PVL A;  1IYF A;  1KLU D;  1WX7 A;  3P1M A;  2LGD A;  2W82 A;  3DOW A;  2L0F A;  2JWZ A;  2C60 A;  1VD2 A;  1N63 A;  3RNC C;  2MA9 B;  3KW5 B;  1U4A A;  4AWJ A;  3V6C B;  2ZNV C;  3AB5 A;  2N9K A;  3N3K B;  4WIP A;  4GGQ A;  4HPL B;  1ZP0 B;  2K9X A;  3RNE C;  3ONS A;  1AYF A;  4MGY E;  3VTU A;  4IWP A;  2KLG A;  1JAL A;  1XLO A;  1E9M A;  3R2I A;  2KVZ A;  4DDI D;  4AJW A;  3H7P A;  2KMA A;  3A9K B;  2IND C;  4B0M A;  1V5T A;  2IO1 B;  4K3C A;  1RRB A;  1B1Z A;  2KMM A;  1PFD A;  1E0Z A;  5JH5 C;  4YTN B;  2V0G A;  3QAR A;  1MI0 A;  3A4R A;  1WGG A;  3FKY A;  4IM2 A;  3NVY A;  5E6O A;  2ZZP B;  1WE6 A;  3M95 A;  3W2D A;  2AQ1 B;  3V62 A;  4LNI A;  4IDI A;  3W1S C;  5IP4 D;  2JZZ A;  2NMQ A;  1GC6 A;  3RNG C;  1SIJ A;  3URY A;  1OEY J;  3RYT A;  3C0R B;  2K39 A;  5G2N A;  2QHO A;  1Z2M A;  4P1C C;  4WWM A;  2R2Q A;  1TS4 A;  2XNA C;  1KF6 B;  2PEA A;  1QOF A;  1QKZ A;  2N4F A;  4E71 A;  1ZDX A;  5KHQ A;  2CHW A;  2O2V A;  1UD7 A;  3PGE A;  1WX9 A;  4MSM B;  1I4H A;  1WMH A;  1WJU A;  2XN9 C;  2VH1 A;  3T3O A;  4MGI E;  2FCN A;  3LB8 C;  2V3S A;  2LVO A;  5H92 C;  2NBV B;  1P1A A;  3HUI A;  1A70 A;  3TMP B;  2LWP A;  5LNK 1;  2WXI A;  1C76 A;  2GB1 A;  3GP7 A;  3WAN A;  5AUI A;  1P0R A;  3W1Y A;  4USA A;  1IPG A;  2KWV B;  1SE9 A;  2I1K A;  1EWY C;  2IZV B;  3ML9 A;  2ASQ A;  3NZS A;  3AV8 A;  1UZX B;  1OGW A;  4XYC A;  2IO0 B;  1F1H A;  3ZJV A;  1YQB A;  4G3X B;  4W9I A;  3NOB A;  1E8Z A;  5BMH A;  1SSN A;  2KXJ A;  2G1E A;  3MC0 B;  4LJP B;  3AM9 A;  2LHD A;  1M4V A;  3AE8 B;  4EUT A;  3BVM A;  3I9V 1;  3L0W B;  1LFD A;  2IGG A;  3ZLZ A;  1PGX A;  4DWF A;  2DZI A;  3JSV B;  3NS8 A;  4GIV A;  3ZNZ B;  2NPT B;  3M3J A;  1ZPS A;  1UNS A;  3U2S C;  5JXV A;  3V6E B;  1DGJ A;  4R3D A;  1Q0W B;  3I57 A;  4ANV A;  1L5P A;  3I3T B;  5BMI A;  3AE1 B;  2L0T A;  1V97 A;  2IGH A;  1TY0 A;  4K81 A;  4DXA B;  1SJH D;  2WXF A;  4LDT D;  2ZEQ A;  1ZXH A;  2V3P A;  3FAH A;  3PZ8 A;  3MC9 A;  3LXF A;  1F9J A;  2BB5 A;  4A6Q A;  3QAQ A;  2WYQ A;  3QA8 A;  4HDO A;  3BVG A;  2ICI A;  3VUX A;  4ZHP A;  4YL8 A;  3EFU A;  2V9H A;  2PE9 A;  3TUO A;  1R4N I;  4II2 B;  1FRD A;  5CHW A;  2KFK A;  4MJS A;  4ITK A;  3P63 A;  4C4V B;  2BW2 A;  1TGZ B;  3IHP C;  1C78 A;  1EF1 A;  2OOB B;  5J18 A;  3VRB B;  2K6Q A;  1ZW7 A;  1QOA A;  4JLC A;  5IAA C;  4P6V F;  5MPO A;  3RFZ B;  3QC8 B;  1XCT L;  2RPQ A;  1LXD A;  4KVG B;  1ZKH A;  2KJH B;  1AW7 A;  4A90 A;  3N9Y C;  3W5V B;  3NY5 A;  4US8 A;  2JT4 B;  4HXD A;  3AUL A;  3UQA A;  2LGX A;  2W54 A;  4DBG A;  2Z59 B;  2ZW0 A;  4IWO A;  1N61 A;  2GLS A;  3FIL B;  2WXK A;  5G5H A;  4WQO B;  4DHJ D;  1M94 A;  2DBY A;  3PPA A;  4WJQ A;  3ZUN A;  1V86 A;  5CX3 A;  3L10 B;  3IAM 1;  3I63 C;  1QOG A;  1KFY B;  1IUE A;  4L1B A;  2JRH A;  3DQV A;  1E8W A;  3DBR B;  2IY0 B;  1UUP A;  3FC4 A;  4C00 A;  1YX5 B;  4FUL A;  2JRI B;  1Z5S B;  1C3T A;  1HZ6 A;  1WE7 A;  3HM3 A;  4TKN A;  4WUR A;  3GE3 C;  1WXV A;  3DCG A;  3U8Z A;  1E8Y A;  2KX0 A;  3RUL A;  1KLV A;  2WQY B;  3VH4 B;  3J9C A;  2VZK D;  1WZ3 A;  1KTK A;  3ZVV A;  1L7Y A;  4W9C A;  1XEE A;  1N5X A;  2D2Q A;  4ZRJ A;  3OAW A;  2D11 A;  3TL5 A;  1WXQ A;  1PQS A;  2JUO A;  2MJ3 A;  1C1Y B;  2LRW A;  4RM9 A;  1NI3 A;  4AJY B;  3AEF B;  3B2F A;  5DCN A;  2OED A;  2PPH A;  1J7A A;  3BY4 B;  5DPS A;  5EDS A;  1BUI C;  4EE2 A;  1LO5 D;  2KJ6 A;  2N1V A;  2D3C A;  2KQS A;  1VZ6 A;  4EZL A;  3RNF C;  1WM2 A;  2KMC A;  4ARI A;  1GC7 A;  3GZN I;  5H8Y E;  3QK0 A;  2KWD A;  1TIF A;  1WH3 A;  4GSW A;  3HIZ A;  3AH7 A;  5T8I A;  2C7M B;  2Y3A A;  1UBQ A;  4YWG G;  1IGC A;  2M1M A;  1D3Z A;  4BOZ B;  1NYQ A;  3VTV A;  4RMA A;  4OZC A;  1UBI A;  1UEL A;  1E6E B;  1TY2 A;  2MCN B;  2INP E;  2BS4 B;  2KFJ A;  3LYY A;  4A9A A;  4ZRI A;  2KOX A;  2NCN A;  2OJW A;  3BZD B;  2HJ8 A;  3E56 A;  4WH4 A;  2KNB A;  1STE A;  2A4Z A;  1X1M A;  2PLP A;  1XCQ L;  2BKR B;  4FHK A;  2LMC A;  2CKH B;  2D3G A;  1AAR A;  1TKY A;  2ON8 A;  3VDZ A;  1EU3 A;  3AU5 A;  2X8X X;  3DBR I;  1TZO A;  5L83 A;  4D2K A;  1FFU A;  4NY0 A;  1H4R A;  4ZRK A;  3MJW A;  1HE8 A;  2C7H A;  4GN1 A;  1JRO A;  1C4A A;  3N1Y C;  1C9F A;  1PYW D;  3RPF C;  1GUA B;  2ZNV B;  2RGF A;  1XLP A;  1XQQ A;  4ZRQ A;  3PRP B;  1RWS A;  3T8M A;  2V1Y A;  2W3S A;  2GRI A;  4E74 A;  1YMH E;  4YTP B;  3SHQ A;  3KYC D;  2KAC A;  2AQ3 B;  2WX0 A;  4HKQ A;  1WJ4 A;  2PKO A;  4OVZ A;  4HKZ E;  3NVW A;  5BO4 B;  2K0P A;  2KHW B;  3PRM B;  3CF6 E;  1CQV A;  1T0R C;  1YN5 A;  1LQB A;  4XDC A;  2NTS A;  1UGM A;  1K8R B;  3AEB B;  4XGA B;  2JSV X;  1LGR A;  2A5U A;  2YVC A;  1YJ1 A;  4PS8 A;  1L0Y B;  2GMI C;  2TSS A;  4MJS B;  5GXG B;  3QHT A;  4MH8 A;  3AN1 A;  4ZHO A;  3VQI A;  3GE8 C;  2FE8 A;  1R4M I;  4IG7 B;  2BWF A;  2AL6 A;  2L7R A;  5G5G A;  1QT9 A;  4IUM B;  3WAP A;  1VJK A;  3PLU A;  2WXL A;  3NJT A;  1J8C A;  4RF0 A;  2WXG A;  2LUM A;  4KKI A;  4KZC A;  4A3O A;  2MBB B;  2V3N A;  2IYD B;  5IO9 A;  1DOI A;  2FUH B;  4X57 B;  1E7V A;  1ET9 A;  2CU3 A;  3P4R B;  2IJ0 A;  3JVZ X;  1MHH E;  3MFG A;  1QQR A;  2WP9 B;  1GB4 A;  5BYQ A;  3UIP B;  3KUC B;  1OEY A;  1SE3 A;  4W9K A;  3U52 E;  2KQ7 A;  3CST A;  1WYW B;  1E90 A;  2X38 A;  4P7I A;  2I38 A;  3PS6 A;  1Y8R C;  2WXM A;  3R7R A;  2K22 A;  2DNF A;  4PYU A;  1FCL A;  4L2Y A;  4LNO A;  3TIX A;  1T0Y A;  2ACZ B;  3QWZ B;  2M8S A;  3KUZ A;  2BKF A;  5BYS A;  3SEB A;  2L8J A;  2L32 A;  2EMS A;  4KIK B;  1EM7 A;  1I4X A;  3LJ3 A;  2DZM A;  4HDQ A;  4G50 A;  1JCK B;  2KDM A;  4KGT A;  1UF0 A;  3B1L X;  3QIJ A;  2GOW A;  3TCA A;  1RLF A;  5IKC M;  1R4M B;  2IO2 B;  4I6L B;  2KWC A;  2VH2 A;  4HJK A;  4HJG E;  2N9E B;  3SDL C;  2WWZ A;  1L0V B;  4II3 B;  3TJP A;  4ICU A;  2J4X A;  2UYZ B;  4RGN A;  4M8M A;  1SE4 A;  3VHT C;  3DVN U;  2C7N B;  3Q69 A;  3NRZ A;  3UQB A;  1WJ6 A;  4EKU A;  4WWN A;  2FBW B;  2G4D B;  1TZ1 A;  1EF5 A;  2EMT A;  3AEC B;  3H7P B;  4XZ4 A;  4C4V A;  5HI1 A;  1T5X D;  3X0W A;  3KYD D;  2M56 B;  4B6W A;  2RR9 A;  1L6V A;  3N32 A;  3AE7 B;  4JL9 A;  1SE2 A;  5EE1 A;  2D07 B;  2JXT A;  2G4S A;  2LRU A;  4FBJ B;  1FFV A;  5TR5 A;  2FAZ A;  4W9H A;  1I35 A;  4NQL B;  2K3U A;  2DZK A;  1S1Q B;  2KTR B;  1ZGU B;  1WGY A;  3B2G A;  1V5O A;  4W9L A;  2MBO A;  4H2A A;  2R2O A;  3RN9 C;  1D4B A;  4XE0 A;  4IKG A;  1EWC A;  1YN4 A;  3P42 A;  3ZO5 B;  4GXB A;  3HVZ A;  4OVV A;  1SBB B;  2JYE A;  3EHV A;  3L54 A;  3GOE A;  3T9L A;  1E7P B;  2ZPY A;  1T0Q C;  2H88 B;  1A5R A;  1NBF C;  2BYF A;  5AUK A;  1YQ4 B;  3MTN B;  4LDT B;  1FXI A;  4BAX A;  1ACC A;  2BTE A;  1WGD A;  1CMX B;  4MGZ E;  1VZ7 A;  3NZU A;  3DVG Y;  2KC1 A;  1TKE A;  4PS3 A;  4KKJ A;  2NS5 A;  1T3Q A;  2B3A A;  3AED B;  2AWT A;  2PVO D;  4XDD A;  3PZ7 A;  3VR8 B;  1F2R C;  2Z8L A;  4J6I A;  1IGD A;  4LNF A;  3A1Q A;  3U7Z A;  5CHV C;  5JHB A;  2DX5 B;  2RMM A;  1XD3 B;  1RFK A;  3BYY B;  4OHJ A;  1QIL A;  3VXW A;  2WX1 A;  3PRZ A;  3ZTD A;  1XF5 L;  4KIK A;  1WSP A;  2J7Q B;  2DEN B;  2ONQ A;  1T6B X;  4NQK E;  4DXG A;  3NS1 A;  3IVF A;  3PO0 A;  4FJY A;  1TTN A;  2GBM A;  3UF8 A;  3AXC A;  1ROE A;  2KT7 A;  3EGR A;  4ZYN A;  2KVR A;  1D5M C;  3ZKJ C;  2MX2 A;  3APD A;  3ECI A;  1C77 A;  4YSZ B;  1YJI A;  2O2V B;  4MH0 E;  4CO7 A;  1ISN A;  3L4P A;  4JX1 C;  3EA6 A;  2MLB A;  4S17 A;  3IT6 B;  4GMV A;  4ARC A;  4ZDV A;  4WJO A;  1MG4 A;  2O6V B;  3MC8 A;  4FAD A;  2KYW A;  5E6P A;  3NVV A;  3N1X C;  2K5P A;  3R7Q A;  3HVD A;  1FXA A;  2DAJ A;  3KVF B;  5D6J B;  4IW0 A;  1MFW A;  1MJD A;  1WI0 A;  1GJZ A;  2R61 A;  4P16 A;  1RAX A;  3KQ4 A;  2HJ1 A;  4RH6 A;  1WY8 A;  4KX6 B;  1JRP A;  3VTW A;  2AX5 A;  4ANU A;  3AEG B;  1QF6 A;  4RGO S;  4N9F 4;  3L08 A;  2XBB C;  4HVB A;  2LXC A;  1YN3 A;  4MDK E;  1PGB A;  3UGB B;  1HTO A;  1V80 A;  2BGF A;  3OJ3 A;  3Q2A C;  1Q10 A;  2RD0 A;  3ZQ4 A;  4ZYS A;  2GBJ A;  3T3N A;  2B76 B;  2Z0D B;  1PDX A;  2WXR A;  4O1N A;  2MWS B;  2KX3 A;  3SD5 A;  2KN5 A;  3D32 A;  4A3P A;  5L95 C;  3AE5 B;  3DBH B;  4BBN C;  4CHK A;  3Q3F A;  1YQ3 B;  4C80 A;  1Q1O A;  1WXA A;  4DHZ E;  1YIW A;  2PTL A;  2WU5 B;  2GBR A;  2LFI A;  4A8X C;  1SEB D;  3Q3O C;  4AOF A;  5GMV A;  2K6D B;  2UU7 A;  2WXH A;  3QX1 A;  3ZXR A;  2W55 A;  4DK5 A;  4JQW C;  3DHH C;  2KC2 A;  4C56 C;  1K52 A;  2QSD A;  2IBI B;  3MHS D;  3Q3J A;  2CS4 A;  3P4P B;  1FNW A;  1VZ8 A;  2PW9 A;  2AL3 A;  3N30 A;  1L4Z B;  2VZK B;  4XWT A;  4IC7 B;  4ZOH C;  2KKC A;  1WF9 A;  5C2T B;  3GB1 A;  1EUV B;  4HCN B;  3WAM A;  4REZ A;  2N9X A;  1SB3 C;  3VFK A;  1D5X C;  3DWG C;  4IM0 A;  3PLV A;  5EE9 A;  1FPY A;  5EE3 A;  2KDB A;  2VRR B;  3MJ5 A;  1WGK A;  3SR6 A;  1FEH A;  3W5U B;  2O6V A;  2DWQ A;  1N62 A;  5D7G A;  3EEC A;  1VCB A;  1TT5 B;  1NDD A;  3IFW B;  1K51 A;  1I7H A;  4BKT A;  2DYM A;  4NZL B;  4M02 A;  4HCP B;  5FK9 C;  1HTQ A;  1JML A;  4K7U A;  3Q3M C;  2LGI A;  2G3Q B;  3IBE A;  4FN2 A;  1UWX A;  2MJD A;  4US9 A;  1FO4 A;  3Q8C A;  5IN7 A;  2GBN A;  1J19 A;  1D5Z C;  1E5W A;  2MH7 A;  1GPX A;  3DDC B;  3TEW A;  4TUU A;  4GU2 A;  1DOX A;  4WWO A;  1HXY D;  4JGH B;  3H1U A;  3P4S B;  3JW0 X;  1P98 A;  3RZF A;  2N1W A;  2BBC A;  2ZCB A;  4JWU C;  3TEY A;  3CWI A;  4GDK A;  3ZRC A;  1N5W A;  3VUW A;  1D6E C;  3A1Q B;  3APF A;  2KDI A;  1FM0 D;  1FIQ A;  3WCQ A;  2WXQ A;  1HQR D;  4LCD E;  2QIL A;  4AP4 C;  2RDG A;  1MG8 A;  5BYR A;  4BOS C;  3UIN B;  5AZH A;  4BFR A;  3A33 B;  1DOY A;  2JF5 A;  4K7S A;  3RMK C;  2BVC A;  2ZJD A;  2E3T A;  2MRP A;  3RI7 C;  1WXM A;  3U30 A;  2XK5 A;  2PVG C;  3ZNG C;  1JRU A;  2IGD A;  2KLC A;  4OW0 A;  4GDL A;  2IDY A;  4GLS C;  3IAS 1;  3ETR A;  1EO6 A;  2LJ5 A;  4BKS A;  1WM3 A;  1E10 A;  3DPD A;  4XWW A;  4MAC A;  3C8Y A;  1JWM D;  2G9H D;  2ZPN A;  3SFD B;  5E6N A;  1OQR A;  2KD0 A;  2WNM A;  2CHZ A;  3NVZ A;  2SAK A;  1WGR A;  4BKS D;  4NJ7 A;  4AUQ C;  3AE4 B;  1NEN B;  4F7Z A;  5LXH A;  2RPV A;  3FIL A;  3BK2 A;  1E7U A;  2V4L A;  1MPE A;  4K7W A;  2Q5W D;  2WDV B;  4RM8 A;  1V1P A;  3DVN V;  3P4Q B;  4PT5 A;  2MEK A;  3IXS A;  1WWT A;  4WAA A;  2YEP F;  3RCZ A;  1GG3 A;  2LGS A;  3RZW C;  1L2N A;  4DXF A;  1OFF A;  2BT6 A;  4M00 A;  1KOT A;  2KWU B;  3WA0 A;  5D3I B;  1P9D U;  3W9C B;  2JQR B;  2CR5 A;  3VH3 B;  3JYU A;  2IO3 B;  2KDF B;  1BML C;  2NTT A;  1XO3 A;  1WMH B;  1ZXI A;  3KLS X;  3BII D;  3OG5 A;  4IOI E;  5E6J A;  4QAY A;  3MP9 A;  4TQ0 A;  1CK1 A;  1PGA A;  2WDT B;  3QJZ A;  5HFY A;  2ZVO A;  2LXA A;  3MHZ A;  2WXN A;  3Q8A A;  4A55 A;  2MBQ A;  4KDI C;  2C5L C;  5AEK B;  3B0A A;  4KGS A;  4MGK E;  1XXG A;  2KZR A;  3Q8F A;  2LGY A;  3RNA C;  4HRO A;  2QEJ C;  2W9N A;  3U7D A;  2L83 A;  3PHW B;  2WXJ A;  3OLM D;  1IP9 A;  3ZIM A;  3GZN B;  4HWI B;  4WJP A;  5J17 A;  1GNU A;  2FNJ B;  1L4D B;  4YT0 B;  5C23 A;  3HHM A;  2W3R A;  2I1J A;  1V8C A;  1AN8 A;  1SGH A;  2BS2 B;  2Y5B B;  2NPT A;  3W1S A;  3JSV A;  1S3S G;  3ZNI D;  1TKG A;  1VRA B;  3ZXV A;  4NJ6 A;  1KRH A;  1CZP A;  3PHX B;  4NAW A;  4YSY B;  4WQM A;  2MQJ A;  1IBX B;  2MBE A;  2N7J A;  2LHE A;  5C1Z A;  4N58 A;  3OWE B;  2IY1 B;  1V6E A;  4G11 A;  5HHD G;  2J52 A;  3GS2 A;  3EC8 A;  3PRE A;  4MSQ B;  1ZE3 D;  1MVK A;  2QMT A;  3QCA A;  2QJL A;  4HK2 A;  3PV1 A;  3ZW3 A;  2QDF A;  3VR9 B;  3H8H A;  1JWU D;  1WR1 A;  5BMG A;  1F0Z A;  2KTR A;  2L1A A;  2WXO A;  4EFO A;  1J0G A;  4LNN A;  1T0S C;  4RNA A;  2CHX A;  4G0N B;  4W9G A;  2PJH A;  4EZK A;  1NI2 A;  1F2R I;  4NPN A;  2K25 A;  3SU8 X;  4EEW A;  3NZ3 A;  4B95 A;  4NNJ B;  1WZ0 A;  3QQ8 B;  1NEK B;  1H8C A;  2N7E A;  1I42 A;  2PE6 B;  4KV2 A;  1FMA D;  2E6X A;  4E3C A;  2KDE B;  3R3M A;  3LDZ E;  4N59 A;  2XEW A;  4W9F A;  5D2M B;  5TSS A;  2YEP B;  3U4E G;  3BYT B;  2WDR B;  1KH0 A;  2LVQ A;  3DWM A;  4ICV A;  3M62 B;  2N9L A;  3BIN A;  3AU4 A;  4W9D A;  2C9W B;  1BXT A;  2QIE B;  3PZD A;  2FIF A;  4LNK A;  1B9R A;  2HTH A;  1FCC C;  2EEL A;  4TSS A;  2DLB A;  1WX8 A;  4ANX A;  4GOC A;  3H6N A;  3TSS A;  2KO3 A;  4GDK B;  4HEA 1;  5LLI A;  5C3J B;  2AYO B;  1UWM A;  2KAJ A;  4YXD B;  1SXT A;  2N0S B;  2NBW B;  4FLH A;  4KSL C;  4MEL A;  4NAW B;  4NAM A;  1OQQ A;  4WWP A;  2DZJ A;  2JY6 A;  3DBL B;  2D3B A;  1V2Y A;  3Q3N C;  2JVC A;  5CTR C;  2MBH A;  4FJV B;  3DVG X;  2FUG 1;  2KN4 A;  2L52 A;  3A4S C;  4DDG D;  4CQN A;  3KWL A;  2BF8 B;  4CYE A;  3BVZ A;  3AE2 B;  2HD5 B;  3HRD D;  4XC2 A;  2D10 A;  5JHA A;  1PUT A;  1SF0 A;  2NVU I;  1OQY A;  2JZP A;  5FKA C;  2PMV A;  4LTU A;  1TJE A;  1UGJ A;  1ESF A;  2KTF A;  1BT0 A;  1E8X A;  1YD8 U;  1NYR A;  4PS7 A;  1RFA A;  3H7S A;  2DAF A;  4DHJ B;  3CIR B;  3RD2 A;  3ZDM C;  2M17 A;  4HLE A;  4OZB A;  1WXS A;  1HZ5 A;  4K1R B;  1TS2 A;  1K53 A;  4KGR A;  4URK A;  2FCM A;  4M8N A;  1WJN A;  1XT9 B;  1WR6 E;  3L17 A;  3B9J A;  2HDE A;  4MM3 B;  3A9K A;  5D3D A;  3APC A;  2LAS A;  1R7S A;  1P7F A;  2FCQ A; 
#chains in the Genus database with same CATH homology
 3IFW B;  1OEY J;  3RYT A;  3K9P B;  4BKT A;  3C0R B;  2DYM A;  2MP2 B;  3VQI A;  4HCP B;  3S2A A;  2K39 A;  5G2N A;  2QHO A;  4DHZ B;  2CU1 A;  1Z2M A;  1R4M I;  4IG7 B;  5KHO A;  2OJR A;  2R2Q A;  4K7U A;  2PEA A;  3ZRF A;  2BWF A;  2AL6 A;  3X23 A;  2G3Q B;  1SIF A;  2L7R A;  2N4F A;  3IBE A;  4FN2 A;  3ALB A;  5DPR A;  4E71 A;  4B9K A;  4IUM B;  2GBN A;  3WAP A;  5KHQ A;  2CHW A;  3KH0 A;  1WRD B;  2O2V A;  3PLU A;  2L00 B;  1UD7 A;  3V61 A;  3PGE A;  4HPM B;  1J19 A;  1WX9 A;  1E5W A;  4MSM B;  1J8C A;  3M63 B;  4TV3 A;  1WMH A;  3DDC B;  4KZC A;  4A3O A;  2MBB B;  4TUU A;  4GU2 A;  1WJU A;  2IYD B;  4KDL B;  4WWO A;  2EKE C;  2FUH B;  4I6N B;  4JGH B;  4X57 B;  3H1U A;  1E7V A;  3JW0 X;  1P98 A;  3RZF A;  2N1W A;  4MGI E;  2FCN A;  2ZCB A;  2V3S A;  2LVO A;  4GDK A;  2NBV B;  3JVZ X;  3ZRC A;  1P1A A;  1UH6 A;  5AZG A;  3TMP B;  2LWP A;  3L13 A;  3H9D A;  3WAN A;  3UIP B;  3KUC B;  1OEY A;  1P0R A;  4W9K A;  3W1Y A;  3VAW A;  2KQ7 A;  3VUW A;  3RUI B;  3A1Q B;  1IPG A;  3APF A;  2KDI A;  2KWV B;  1SE9 A;  3CST A;  2I1K A;  1WYW B;  1E90 A;  2IZV B;  1G6J A;  3ML9 A;  2ASQ A;  4LCD E;  3NZS A;  4P7I A;  4AP4 C;  1UZX B;  3PS6 A;  4LJO B;  1OGW A;  1MG8 A;  4BOS C;  1Y8R C;  3UIN B;  3R7R A;  5AZH A;  2IO0 B;  4PYU A;  4BFR A;  3TIX A;  1T0Y A;  3A33 B;  2JF5 A;  2O6V D;  3QWZ B;  2M8S A;  4K7S A;  3KUZ A;  2BKF A;  4GB9 A;  2ZJD A;  1YQB A;  3TBL D;  4G3X B;  2MRP A;  4W9I A;  1QZE A;  4F1S A;  2L8J A;  3NOB A;  4W9E A;  1E8Z A;  2EMS A;  4KIK B;  1WXM A;  3U30 A;  2K8H A;  2KXJ A;  2XK5 A;  3ZDT A;  3LJ3 A;  3ZNG C;  1JRU A;  2DZM A;  4LJP B;  4HDQ A;  4G50 A;  2KLC A;  3B1L X;  4GDL A;  3QIJ A;  4BKG A;  3PT2 B;  2GOW A;  3TCA A;  1RLF A;  1OTR B;  5JZE B;  2IO2 B;  4EUT A;  4I6L B;  2HE7 A;  2KWC A;  3HM6 X;  1EO6 A;  3L0W B;  2LJ5 A;  1LFD A;  2MSE D;  1WM3 A;  5DPT A;  4BKS A;  3ZLZ A;  4DWF A;  3DPD A;  4HJK A;  2N9E B;  2DZI A;  4M0W B;  2WWZ A;  3JSV B;  4FHJ A;  4JIO U;  2FCS A;  3NS8 A;  4GIV A;  2NPT B;  3ZNZ B;  2JPH A;  2ZPN A;  2DYO A;  5E6N A;  4II3 B;  3TJP A;  3M3J A;  3V60 A;  2KD0 A;  2CHZ A;  4XX5 A;  4ICU A;  2LZ6 A;  3CMM B;  2UYZ B;  3V6E B;  1WGR A;  4BKS D;  4NJ7 A;  4AUQ C;  4F7Z A;  5LXI B;  5LXH A;  4M8M A;  1Q0W B;  3VHT C;  2J0K A;  3DVN U;  4ANV A;  2C7N B;  1E7U A;  3I3T B;  2N9P C;  2V4L A;  2NBU A;  3WAL A;  2KFK B;  3UQB A;  2LD9 A;  1WJ6 A;  4K7W A;  4WWN A;  4EKU A;  2G4D B;  2L0T A;  1TZ1 A;  1EF5 A;  2EMT A;  4K81 A;  3H7P B;  4XZ4 A;  4DXA B;  4RM8 A;  3DVN V;  2ZEQ A;  4LDT D;  3X0W A;  3KYD D;  2J0J A;  3DBS A;  4B6W A;  2RR9 A;  1WIA A;  1V81 A;  1F9J A;  4WAA A;  3RCZ A;  3QAQ A;  3N32 A;  1GG3 A;  3RZW C;  1L2N A;  2WYQ A;  3QA8 A;  4HDO A;  4JL9 A;  3OJ4 B;  2L05 A;  3VUX A;  2BPS A;  4YL8 A;  4F8C B;  2D07 B;  2KWU B;  1KOT A;  2N7D A;  3WA0 A;  2G4S A;  2LRU A;  2FID A;  3EFU A;  3K9O B;  2PE9 A;  4FBJ B;  1P9D U;  5TR5 A;  2FAZ A;  2M0X A;  2Z0E B;  4W9H A;  1R4N I;  4II2 B;  2CR5 A;  1FXT B;  3VH3 B;  3JYU A;  2KK8 A;  2IO3 B;  1I35 A;  4NQL B;  5D94 A;  1P3Q U;  2DZK A;  2KDF B;  5CHW A;  1S1Q B;  1WMH B;  2G45 B;  2K1F A;  2KFK A;  2KTR B;  4MJS A;  4W9J A;  3RT3 B;  1ZGU B;  1TGZ B;  5FR6 A;  1WGY A;  4ANW A;  5G55 A;  3IHP C;  4TQ0 A;  4OVU A;  1EF1 A;  1V5O A;  2OOB B;  4W9L A;  3PSE B;  5J18 A;  2WDT B;  3QJZ A;  2ZVO A;  2MBO A;  4KSK C;  4BVU C;  2K6Q A;  1V9J A;  2LI5 A;  1ZW7 A;  2LXA A;  2R2O A;  3R66 C;  4JLC A;  5IAA C;  2AEH A;  4DHZ E;  4FA6 A;  2YLM A;  2L76 A;  4BBN F;  3QC8 B;  2RPQ A;  1WGH A;  2MBQ A;  1LXD A;  4IWQ A;  4KVG B;  1ZKH A;  2KJH B;  3NHE B;  4FJZ A;  4KDI C;  2C5L C;  2KJR A;  4EOY A;  5AEK B;  3B0A A;  3ZO5 B;  4MGK E;  4GXB A;  3NY5 A;  2KZR A;  2JT4 B;  4HXD A;  4OVV A;  3AUL A;  3UQA A;  2LGX A;  3EHV A;  2LGY A;  2Z59 B;  3L54 A;  3GOE A;  3T9L A;  4A20 A;  4DBG A;  2W9N A;  3B08 A;  3U7D A;  2ZPY A;  1TBE A;  3PHW B;  1A5R A;  1NBF C;  2BYF A;  4IWO A;  3OLM D;  1IP9 A;  3ZIM A;  4HWI B;  3PTF C;  4WJP A;  5J17 A;  4GDL B;  3MTN B;  4LDT B;  2LUE A;  1GNU A;  2FNJ B;  4WQO B;  4DHJ D;  1WGD A;  1CMX B;  1V49 A;  4MGZ E;  1M94 A;  5C23 A;  3NZU A;  3HHM A;  2XK5 B;  1KM7 A;  2ZVN A;  3DVG Y;  3PPA A;  4WJQ A;  3ZUN A;  2KC1 A;  2I1J A;  1V86 A;  5CHF A;  4PS3 A;  5CX3 A;  3L10 B;  2NS5 A;  3SDL C;  1SGH A;  4WJN A;  2JZ3 B;  2JRH A;  3ML8 A;  2Y5B B;  2B3A A;  2NPT A;  3DQV A;  3W1S A;  3JSV A;  2AWT A;  1S3S G;  1E8W A;  4MEM A;  3ZNI D;  5HKH A;  2IY0 B;  1YX5 B;  4NJ6 A;  4FUL A;  2JRI B;  3PHX B;  1Z5S B;  2ZCC A;  1C3T A;  2GBK A;  2NR2 A;  1WE7 A;  4I6P A;  4IM3 A;  4NAW A;  3HM3 A;  4J6I A;  2MW5 A;  2MQJ A;  3A1Q A;  4TKN A;  5CHV C;  1WXV A;  5JHB A;  2DX5 B;  1XD3 B;  3DCG A;  4PYZ A;  1E8Y A;  3U8Z A;  5J2R A;  2KX0 A;  2REX A;  3RUL A;  1KLV A;  2MBE A;  3ZNH B;  4ASW C;  5C1Z A;  3VH4 B;  2IY1 B;  1V6E A;  4G11 A;  3ZTC A;  3VXW A;  2DHZ A;  2WX1 A;  3PRZ A;  3ZTD A;  4KIK A;  2J7Q B;  2DEN B;  5IA7 A;  3EC8 A;  3PRE A;  1WZ3 A;  4MSQ B;  3ZVV A;  1L7Y A;  2MP2 A;  3QCA A;  4NQK E;  4W9C A;  4HK2 A;  3PV1 A;  3ZW3 A;  4ZRJ A;  2D2Q A;  3IVF A;  3OAW A;  2D11 A;  5AZF A;  3TL5 A;  4FJY A;  3WIM A;  1TTN A;  2GBM A;  3UIO B;  1PQS A;  4MM3 A;  3UF8 A;  3AXC A;  1WR1 A;  2KTR A;  2JUO A;  2L3Z A;  3VUY A;  3CSF A;  3ENE A;  4EFO A;  1J0G A;  1C1Y B;  2LRW A;  4RM9 A;  4AJY B;  4EZJ A;  4ZYN A;  2KVR A;  5DCN A;  1YX6 B;  2CHX A;  4G0N B;  4W9G A;  2PJH A;  2MX2 A;  3ZKJ C;  4EZK A;  3APD A;  3ECI A;  1NI2 A;  3DBH I;  2O2V B;  4NPN A;  2PPH A;  4MH0 E;  2K25 A;  2KAN A;  3BY4 B;  1LM8 B;  5DPS A;  3SU8 X;  4CO7 A;  4EEW A;  3VVW B;  1ISN A;  4B95 A;  4NNJ B;  2RSU A;  2DYB A;  1WZ0 A;  5DPW A;  3P2B A;  3QQ8 B;  5EDS A;  1KJT A;  2MLB A;  1H8C A;  2N7E A;  3AI5 A;  1I42 A;  2PE6 B;  2KJ6 A;  4KV2 A;  2N1V A;  4GMV A;  2UWQ A;  3A9J A;  2KQS A;  4ZDV A;  2K8C A;  3A9J B;  4EZL A;  4WJO A;  4E3C A;  2BYV E;  2O6V B;  1WM2 A;  2KDE B;  2JXX A;  1GC7 A;  2KMC A;  3GZN I;  5E6P A;  4FAD A;  3R3M A;  3QK0 A;  3LDZ E;  2XEW A;  4W9F A;  5D2M B;  1WFY A;  4KZ0 A;  1WH3 A;  4GSW A;  3HIZ A;  3R7Q A;  1Q5W B;  2LVQ A;  4ICV A;  2DAJ A;  3M62 B;  3KVF B;  5D6J B;  4IW0 A;  2C7M B;  1UBQ A;  2M1M A;  1D3Z A;  1WI0 A;  3AU4 A;  3BIN A;  4W9D A;  4AWJ A;  4BOZ B;  3VTV A;  4RMA A;  2C9W B;  1UBI A;  1UEL A;  1GJZ A;  1RAX A;  3PZD A;  2BYE A;  2FIF A;  2M4N A;  2K8B A;  2LVP A;  1WY8 A;  3IG3 A;  2MCN B;  3HK0 A;  2J0M A;  2HTH A;  3O65 B;  3VTW A;  2KFJ A;  4ZRI A;  2KOX A;  3DBL I;  2NCN A;  4ANU A;  3WAO A;  4N9F 4;  3L08 A;  3KUD B;  3L16 A;  2HJ8 A;  2XBB C;  1WX8 A;  2LXC A;  4ANX A;  4HVB A;  4GOC A;  4MDK E;  3H6N A;  3UGB B;  2KNB A;  4TQ1 A;  2A4Z A;  1V80 A;  1X1M A;  2BGF A;  2BWE S;  3OJ3 A;  2KO3 A;  2BKR B;  4FHK A;  3PVL A;  4GDK B;  2RD0 A;  1IYF A;  2GBJ A;  1WX7 A;  2CKH B;  2LGD A;  5LLI A;  2Z0D B;  2D3G A;  2AYO B;  2MWS B;  3DOW A;  1AAR A;  2KX3 A;  2L0F A;  2NBW B;  4FLH A;  2JWZ A;  3VDZ A;  3SD5 A;  2C60 A;  2KN5 A;  3AU5 A;  1VD2 A;  3D32 A;  4A3P A;  5L95 C;  3DBR I;  4BBN C;  4KSL C;  5L83 A;  4MEL A;  4CHK A;  4NAW B;  3Q3F A;  4NY0 A;  1Q1O A;  2MA9 B;  1U4A A;  1H4R A;  3KW5 B;  1WXA A;  4ZRK A;  3V6C B;  1YIW A;  1HE8 A;  2DZJ A;  2C7H A;  2JY6 A;  2ZNV C;  3MJW A;  4WWP A;  1V2Y A;  3N3K B;  2GBR A;  2JVC A;  4GN1 A;  4GGQ A;  5CTR C;  4HPL B;  2MBH A;  4AOF A;  3ONS A;  2K6D B;  4FJV B;  3DVG X;  5GMV A;  4DDG D;  3A4S C;  4CYE A;  2BF8 B;  4MGY E;  1GUA B;  3VTU A;  2ZNV B;  3QX1 A;  4IWP A;  2HD5 B;  2RGF A;  4XC2 A;  2KLG A;  2D10 A;  5JHA A;  1XQQ A;  4DK5 A;  4JQW C;  3PRP B;  3T8M A;  2NVU I;  2V1Y A;  1OQY A;  2KC2 A;  4DDI D;  4E74 A;  4AJW A;  3H7P A;  2IBI B;  3KYC D;  2KMA A;  3SHQ A;  3MHS D;  3Q3J A;  2CS4 A;  2WX0 A;  2KTF A;  3A9K B;  1BT0 A;  2AL3 A;  3N30 A;  1V5T A;  1E8X A;  1YD8 U;  2IO1 B;  1RFA A;  1RRB A;  2KKC A;  1WJ4 A;  1WF9 A;  4IC7 B;  4PS7 A;  1EUV B;  3H7S A;  4HCN B;  3WAM A;  2DAF A;  5BO4 B;  5JH5 C;  4DHJ B;  2N9X A;  3QAR A;  2KHW B;  3PRM B;  2M17 A;  3CF6 E;  3RD2 A;  3VFK A;  3ZDM C;  4IM0 A;  4HLE A;  1LQB A;  3PLV A;  1WXS A;  1UGM A;  3A4R A;  1K8R B;  1WGG A;  2KDB A;  4K1R B;  2VRR B;  4IM2 A;  4URK A;  5E6O A;  2A5U A;  2FCM A;  2ZZP B;  2YVC A;  1WE6 A;  3M95 A;  1WJN A;  4M8N A;  1XT9 B;  3V62 A;  1YJ1 A;  1WR6 E;  4PS8 A;  3W1S C;  3L17 A;  2JZZ A;  2O6V A;  2GMI C;  4MJS B;  5D7G A;  3EEC A;  3A9K A;  1VCB A;  3QHT A;  3APC A;  1GC6 A;  1NDD A;  2LAS A;  2FCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...