3W1YA

Crystal structure of t brucei atg8.2 in complex with e coli s10
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
120
Chain Sequence
HYRYQYTRSFAERAKETESARLRYPKHIPILCEPTSVRLFSTRQQVQRELDCNKFLLPETATVMEFMMALRQRLLLEEGQAVFVFIGNELPPNSACLGDIYARAKDPDGFLYVSYGVENT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated protein 1A/1B, light chain 3
publication title Crystal structure of T brucei ATG8.2
rcsb
source organism Trypanosoma brucei brucei
molecule tags Transport protein/ribosomal protein
total genus 35
structure length 120
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3w1yA00
4MGKE 4M0WB 1XT9B 4MELA 2EMSA 2DYOA 2NBWB 2KDFB 4A3OA 2GOWA 2KNBA 2N4FA 1IPGA 1RFAA 3UINB 2R2QA 5JHBA 4ZYNA 2MRPA 2D10A 3ALBA 3HK0A 3VTWA 3W1SC 3A9JB 4PYZA 4FJVB 5D94A 1LFDA 4MGIE 3PRZA 2OOBB 3JVZX 4M8NA 1WGDA 2HD5B 3UQAA 4FHJA 1BT0A 2EMTA 2JXXA 2MP2B 1RAXA 4KSLC 2MP2A 3VQIA 3WIMA 2D3GA 1Z5SB 2KKCA 4BOZB 2JZ3B 4ZDVA 3PREA 3PGEA 4PS7A 1LXDA 2BKFA 1E8ZA 5D6JB 1L7YA 1WMHB 2KDBA 2DHZA 3VHTC 2LASA 3PLUA 5CX3A 3KYDD 3IBEA 1P3QU 3BY4B 1RRBA 2K1FA 3S2AA 4BKSD 1WY8A 2C7HA 3AULA 3L0WB 1UH6A 2ZZPB 3QIJA 4IWQA 1H8CA 2FIFA 1V5TA 4JGHB 5JHAA 1XD3B 4IM2A 1AARA 2G4DB 2K25A 2NVUI 3NZUA 5FR6A 4CO7A 3APDA 3ZVVA 5HKHA 1UBQA 3ZNGC 4M8MA 3DVGX 3U8ZA 1MG8A 1OGWA 1E90A 3V60A 2BYEA 2QHOA 3DPDA 2FIDA 3EFUA 3PT2B 4RMAA 1IYFA 4IWPA 4EUTA 3W1YA 1WJ4A 1WXSA 2IO1B 2LXCA 2LGXA 4HDOA 2FCSA 1P0RA 2IY0B 4KZCA 3B0AA 3RT3B 1UBIA 3VDZA 2MBHA 2W9NA 5D2MB 3PV1A 4MSMB 3Q3FA 4G11A 3ZTDA 4EFOA 2DZMA 4B95A 2J0KA 3APCA 3SHQA 4DDGD 2GBRA 4JQWC 4ICUA 4FULA 2KQSA 4X57B 3N3KB 1NI2A 3X23A 2L7RA 1XQQA 2NBUA 2NPTA 4JLCA 3ZIMA 1G6JA 2G3QB 4JIOU 3PZDA 3TCAA 2MQJA 5J2RA 1LQBA 2HTHA 2LGDA 2KQ7A 3VUWA 3TL5A 3MJWA 2V1YA 1V6EA 1HE8A 2GBMA 3AI5A 4G3XB 4TV3A 4G0NB 3TMPB 2N9EB 5G55A 3QAQA 3PPAA 4NAWB 3TBLD 2IY1B 3M63B 2O2VB 4HVBA 4NAWA 3WAMA 3PHXB 4KDIC 2AYOB 4FADA 2BWFA 4GN1A 3VH3B 1GJZA 1CMXB 2I1KA 4LDTD 1V9JA 2N1WA 4WJOA 5DPRA 2BF8B 2ZPNA 5DPWA 2BWES 3QCAA 4NQLB 2KC1A 3C0RB 1WXAA 2CHWA 4WWOA 2PE9A 2LD9A 3GZNI 4TUUA 1V81A 4IM0A 4RM9A 4FLHA 4FBJB 1T0YA 3ZO5B 4I6LB 3RYTA 5EDSA 2B3AA 2KXJA 2BYFA 1Y8RC 3DOWA 3NY5A 1EF1A 3A9KB 2MX2A 1WGHA 3D32A 4GDKB 4LJPB 4BBNC 2DZKA 2IO2B 3AU5A 2N9PC 3UF8A 1WXMA 4BKGA 2KHWB 3PSEB 3MHSD 2KO3A 2D11A 2C5LC 1R4MI 4ZRIA 3ML9A 4WAAA 3AXCA 2DENB 2N1VA 2JRIB 3T9LA 4PS8A 2LWPA 3ZNHB 2RGFA 1D3ZA 1NBFC 2Z0EB 4HK2A 5JH5C 1F9JA 2KJHB 1WRDB 3TJPA 1YX6B 1WGRA 5G2NA 2KLGA 2MBEA 1V49A 2UYZB 2MA9B 2XK5B 1WE6A 3V61A 2XK5A 5CHVC 4HCPB 3U30A 3PTFC 4LDTB 4LCDE 1U4AA 4J6IA 4HLEA 3KYCD 3P2BA 4KV2A 3H6NA 4IG7B 4EOYA 2LJ5A 3VVWB 4HDQA 1QZEA 4BVUC 2KMCA 2NS5A 2RPQA 4ZRJA 2BKRB 4MGYE 4EEWA 5BO4B 3A1QB 3A1QA 2M0XA 1TGZB 2MBBB 2N7DA 2NR2A 1I42A 2PJHA 3DQVA 4N9F4 3DBLI 3V62A 4ANXA 3RZFA 5J17A 2V4LA 1WGYA 5AZGA 1J8CA 2MSED 3DBSA 4F7ZA 1X1MA 3KUDB 2JZZA 2PEAA 2VRRB 3QJZA 4DXAB 1IP9A 3EECA 2GBKA 3NS8A 2KLCA 4MJSB 4G50A 4MJSA 2JPHA 2K8BA 1J0GA 2FCMA 2C60A 2PE6B 1WJNA 3LJ3A 2EKEC 2XEWA 3HM3A 4HWIB 2YLMA 3RUIB 2KMAA 2AWTA 1SE9A 4GSWA 3ZRFA 2RR9A 4MSQB 4ANVA 3QK0A 3ZDTA 3DBHI 4P7IA 4WQOB 3SD5A 2G4SA 4WJNA 2K8CA 4FJYA 3H9DA 1WFYA 2OJRA 2KTFA 1P9DU 5AZFA 3UIPB 4PS3A 3L17A 3JSVA 3OJ4B 2Y5BB 2ZVNA 1ZW7A 1S3SG 3B1LX 3LDZE 4W9LA 2KFKB 2J0JA 2LZ6A 3Q3JA 3ZDMC 2R2OA 2KFKA 4BFRA 4ASWC 2V3SA 1YQBA 3QA8A 5GMVA 3DDCB 3KUZA 3RULA 3MTNB 3OAWA 3HHMA 1K8RB 1EUVB 3ZTCA 2KN5A 2LXAA 3L10B 4HPMB 4E71A 4I6NB 3A33B 2AL6A 2WDTB 4AUQC 1P1AA 4A20A 4W9KA 1A5RA 2JUOA 1E5WA 1Q5WB 1WH3A 1WGGA 1EO6A 2NPTB 5LXIB 4KIKB 4W9CA 2WYQA 4IWOA 4KIKA 1WX8A 4W9JA 1UD7A 2ZCBA 4A3PA 2RD0A 3CSFA 3N32A 3QX1A 1H4RA 4W9GA 1GNUA 3L54A 3ZUNA 4AWJA 1LM8B 2I1JA 2J7QB 3VUXA 1KOTA 2K6DB 3ZW3A 4ANUA 4TQ1A 3V6CB 5JZEB 4KVGB 3QHTA 3L08A 4F8CB 5IAAC 5KHOA 4DHJD 1FXTB 2KX3A 2DZIA 2G45B 4HPLB 2RSUA 2C9WB 5DPTA 1WZ3A 3H7PA 2ZJDA 4KDLB 1J19A 2L0FA 3A4RA 5CTRC 4B9KA 5L95C 3APFA 5E6PA 2LUEA 4GMVA 1YIWA 3IHPC 1WR6E 2KTRB 1GC7A 4TKNA 4FA6A 2KTRA 3PHWB 3H1UA 3ECIA 4K1RB 3CMMB 3EC8A 2LGYA 4AJYB 3EHVA 4ANWA 2PPHA 3OLMD 2MCNB 4IM3A 2ZVOA 2FNJB 3M3JA 4XC2A 3K9PB 2YVCA 1YD8U 1KJTA 2KFJA 1WM2A 2LVOA 2N9XA 4K81A 4W9EA 2J0MA 4LJOB 4WWPA 4NY0A 3R66C 2KDIA 4BKTA 5TR5A 2MBOA 3DVNU 4TQ0A 2L8JA 4FN2A 4OVUA 5J18A 2JY6A 3A4SC 3NZSA 3SU8X 1C1YB 3JW0X 1OEYA 4KZ0A 2ZCCA 4MGZE 2GMIC 2WX1A 2KANA 2HE7A 3WALA 5L83A 4W9HA 4NPNA 3PLVA 2FCQA 2FCNA 3QWZB 3CSTA 1OTRB 3PS6A 3M95A 4MEMA 4W9FA 4CHKA 2CR5A 1ISNA 3NOBA 4GDLB 4IUMB 1TZ1A 4GDLA 4GB9A 3VXWA 2DYMA 2LRUA 4NNJB 2C7NB 1E8YA 2ZPYA 4DHZB 2A5UA 3WAOA 2KOXA 2REXA 1E7UA 3IFWB 2JF5A 2DZJA 5AZHA 3DBRI 2CHXA 4B6WA 1YX5B 4IC7B 1TTNA 4GU2A 1OQYA 2KJ6A 1PQSA 2IYDB 2N7EA 4XZ4A 3UIOB 2KJRA 4K7UA 4CYEA 1JRUA 4W9DA 5DCNA 2ASQA 4RM8A 2NBVB 2BYVE 2ZNVC 1UGMA 3HIZA 3RCZA 5C23A 1UELA 2O6VD 1S1QB 2HJ8A 4JL9A 1P98A 4K7WA 4KSKC 1WZ0A 2JWZA 3R3MA 3ZKJC 3A9JA 1WM3A 1GC6A 2AL3A 2M17A 1I35A 2KX0A 3JSVB 3HM6X 4AJWA 2KC2A 3R7QA 5E6OA 2M8SA 4HXDA 2KWUB 3K9OB 4FHKA 3QQ8B 1VCBA 3RZWC 3O65B 2IBIB 2ZNVB 1ZGUB 2MW5A 1V86A 2L00B 3DVGY 2WX0A 1M94A 5E6NA 1WMHA 2GBJA 1WI0A 3ENEA 4EZJA 1KM7A 2FUHB 3VTUA 3VAWA 4HCNB 3UGBB 1L2NA 1R4NI 3W1SA 2CS4A 4EZLA 4F1SA 1GG3A 2L76A 3ONSA 2KK8A 2JVCA 2ZEQA 4FJZA 2L0TA 4NQKE 3KUCB 4WJPA 4MM3A 2MWSB 3ML8A 5LLIA 3IG3A 2FAZA 2IZVB 3JYUA 3PVLA 4WJQA 2K6QA 5CHFA 2O6VB 1WX7A 1WF9A 1WJUA 2JT4B 2O6VA 3DCGA 3TIXA 4MDKE 1SGHA 3ZNID 1SIFA 2MLBA 3KVFB 2KD0A 4NJ6A 4IW0A 4ICVA 3WANA 5C1ZA 5LXHA 3M62B 1OEYJ 1EF5A 4MH0E 4E74A 3SDLC 4GGQA 1KLVA 1E8XA 2KVRA 3GOEA 3I3TB 1C3TA 3H7PB 2DX5B 4DBGA 4ZRKA 3VH4B 2D2QA 2K8HA 4WWNA 2M1MA 3RD2A 4EKUA 2LVQA 2LI5A 4W9IA 3V6EB 1V5OA 2AEHA 3L13A 4BKSA 2Z0DB 4HJKA 3VFKA 3WA0A 1E8WA 4K7SA 2KDEB 4BBNF 4PYUA 3H7SA 4GXBA 4DHZE 4GOCA 2Z59B 2C7MB 3VTVA 4I6PA 5AEKB 3VUYA 2M4NA 2O2VA 4AOFA 1WJ6A 1V2YA 3ZNZB 5IA7A 3X0WA 1WXVA 4DWFA 5CHWA 2DYBA 2CKHB 1TBEA 1WX9A 4II3B 4BOSC 3KH0A 4OVVA 2LRWA 3L16A 3WAPA 3BINA 1WE7A 2GBNA 3KW5B 2XBBC 4URKA 2UWQA 3CF6E 3NHEB 1V80A 4DHJB 4GIVA 1YJ1A 2CU1A 3ZRCA 5KHQA 3AU4A 1WIAA 3PRPB 2IO0B 1Q0WB 2BGFA 3R7RA 2KWCA 3A9KA 2L3ZA 3IVFA 4DDID 4E3CA 1RLFA 5DPSA 4GDKA 4XX5A 3DVNV 1UZXB 1Q1OA 2K39A 1Z2MA 3U7DA 3QARA 2MBQA 3B08A 2CHZA 3QC8B 2NCNA 5D7GA 4II2B 1E7VA 2WWZA 3ZLZA 4DK5A 3N30A 2BPSA 3UQBA 2LVPA 2DAJA 1ZKHA 2L05A 2D07B 4AP4C 4YL8A 3OJ3A 3PRMB 1NDDA 1WR1A 2JRHA 2KWVB 1VD2A 2KZRA 4EZKA 2IO3B 4NJ7A 2A4ZA 1WYWB 3T8MA 2DAFA 1GUAB
chains in the Genus database with same CATH superfamily
4MGKE 1JW9D 2W82A 1XLPA 2DYOA 2KDFB 2N4FA 1QQRA 2R2QA 3W1SC 1QOGA 5D94A 4WIPA 1WRIA 1KH0A 2MP2A 2D3GA 1F77A 2QC8A 4PS7A 1E8ZA 3P1MA 2KDBA 2MH7A 2LASA 3IBEA 3FKYA 1RRBA 1VRAB 3L0WB 1TKYA 2FIFA 1V5TA 4CO7A 2K25A 4RH6A 1STEA 5HKHA 1MG8A 1ROEA 5AUIA 1PDXA 1OGWA 3V60A 1XEEA 4EUTA 2KAJA 3ZJUA 1D5XC 3P42A 1ZP0B 3NJTA 4KZCA 1Q10A 1FD6A 3RT3B 5HFYA 4BZAA 3PV1A 3Q3FA 4EFOA 1T6BX 2DZMA 1YOVB 3APCA 4ICUA 4YSXB 4FULA 3U7ZA 1NI2A 3IXSA 2X8XX 4JIOU 3PZDA 1E9MA 2MQJA 2L83A 4ZYSA 3U4EG 3T3OA 2V1YA 3AI5A 2EELA 1JALA 3PPAA 2O2VB 1IGDA 2WXRA 1TKGA 3PHXB 2BW2A 2BWFA 4GN1A 3SFDB 2I1KA 4LDTD 1V9JA 1PFDA 4NQLB 2KC1A 3C0RB 3W2DA 2LD9A 3GZNI 4IM0A 4FBJB 3RYTA 1C9FA 5EDSA 2KXJA 1Y8RC 1EF1A 1JWMD 3A9KB 2MHJA 2MX2A 4LJPB 2N9PC 1WXMA 3MHSD 2KO3A 3AEAB 1R4MI 4XDDA 2BB5A 2H88B 3KLSX 2LWPA 1WGRA 1F0ZA 2UYZB 1R7SA 2XK5A 2RPVA 5CHVC 3U30A 3RNGC 3PZ8A 4HLEA 4KV2A 3H6NA 3ZXRA 1DYQA 3BZDB 2KMCA 3B9JA 4MGYE 4EEWA 5BO4B 1N62A 1FXIA 1TGZB 3MHZA 2PJHA 3DQVA 4N9F4 2WXMA 3ZJTA 2CU3A 5J17A 2V4LA 2WHIA 3DBSA 4ITKA 3N9YC 3GZNB 3KUDB 2PEAA 1K52A 3NS1A 4MJSB 1FO4A 2IDYA 2K8BA 1XLQA 1ESFA 2D3BA 2YLMA 1N6ZA 2AWTA 4GSWA 2RR9A 3QK0A 1R4MB 4WQOB 4P7IA 4WJNA 1L0XB 4RFBA 1EU3A 4P1BC 2KTFA 5AZFA 1ZOYB 3L17A 3OJ4B 1V1PA 2ZVNA 1ZW7A 3B1LX 2KFKB 2LZ6A 2JZPA 1CZPA 1J7CA 1FIQA 2V3SA 3MTNB 1EWCA 2NTSA 3OAWA 2VH2A 1K8RB 1QT9A 2KN5A 1ZXHA 3L10B 4HPMB 3A33B 2WDTB 4W9KA 2BB6A 4LLGM 2PKOA 4KIKB 2L52A 1I4HA 2D5GA 3N32A 3QX1A 2LEKA 4W9GA 4AWJA 1LM8B 2D3AA 2K6DB 4TQ1A 3V6CB 1AN8A 1RFKA 5IAAC 4OHJA 4MH8A 2DZIA 3BVGA 2RSUA 2C9WB 3H7PA 2L0FA 1L6VA 3AEEB 1AWDA 1SIJA 1J7AA 3PHWB 1V8CA 3ECIA 3CMMB 2LGYA 3AE3B 3C8YA 5G5HA 4IM3A 3NG0A 4XC2A 2INPE 3K9PB 1XCQL 3MP9A 1YD8U 1WM2A 1VLBA 2LVOA 2Z8LA 2XN9C 4LJOB 4NY0A 3R66C 2JX5A 4TQ0A 2KDMA 2LGSA 1L6UA 4OVUA 4A8XC 2WXLA 1UNSA 1E6EB 3AE6B 4XE0A 2GB1A 2ZCCA 1P7EA 5L83A 1KLUD 4NPNA 1PGXA 2FCQA 3CSTA 1OTRB 3M95A 4GDLB 4GB9A 1QF6A 2LRUA 2ZPYA 4DHZB 4DXGA 1QILA 1VJKA 4S17A 4WH4A 2YEPF 3UIOB 4K7UA 1JRUA 4HROA 2WXOA 3TEYA 3RCZA 1UELA 3Q2AC 2K3UA 1S1QB 1FRDA 1P98A 3A9JA 1GC6A 2AL3A 2M17A 2V3NA 1JWUD 5BYQA 2ACZB 3R7QA 2WNMA 1VCBA 3RZWC 3GE3C 2L00B 1XXGA 1JWSD 4ZHOA 1TS3A 1L2NA 1SE4A 1R4NI 4F1SA 2L76A 3O13A 3CWIA 2KK8A 2ZEQA 4FJZA 4MM3B 3ML8A 5LLIA 4DXFA 4WJQA 1NVID 1WX7A 2O6VA 3DCGA 1F2RC 1SIFA 2MLBA 4NJ6A 4IW0A 1UGJA 1OEYJ 1E10A 4E74A 2PIAA 2KVRA 3GOEA 1C3TA 3H7PB 2K8HA 2M1MA 3RD2A 5BMHA 2LI5A 1V5OA 2PTLA 3VFKA 4K7SA 4BBNF 3EGRA 1HZ5A 2M4NA 3W9CB 1SSNA 1R4NB 1ET6A 1BMLC 4BOSC 1WXQA 3PZ7A 1V80A 1XCTL 1YQ3B 2CU1A 5KHQA 3AU4A 3R7RA 2KWCA 1XLOA 4XX5A 1Q1OA 1Z2MA 4DK5A 2BPSA 3UQBA 1ZDXA 1ZKHA 2D07B 2OEDA 4AP4C 4YL8A 3N1XC 3AE5B 1SE2A 2KZRA 4ZOHC 1N63A 3IAS1 3RI7C 4G11A 3Q8AA 1GUAB 4MELA 4AS1A 1TS5A 4ZRQA 1DGJA 1DOYA 2N9KA 2GOWA 1VR9A 2MRPA 3A9JB 1I4XA 4FJVB 1LO5D 3PRZA 2OOBB 3JVZX 4M8NA 1WGDA 2M56B 2QIEB 4RGTA 2JXXA 4KSLC 1RAXA 5EE3A 4ZRPA 3N20C 5CX3A 3BY4B 3S2AA 4BKSD 3AULA 2J53A 2ZZPB 5C2TB 1YN5A 3HUIA 5FR6A 4KGSA 3ZVVA 4IKGA 3U8ZA 2L1AA 4RMAA 1AW7A 2QHOA 3DPDA 1IYFA 2QJLA 3W1YA 1WXSA 3DBRB 2LXCA 2LGXA 4B0EA 4RF0A 1P7FA 1UBIA 3TEXA 1EWYC 5D2MB 4B95A 2J0KA 4B0MA 2GBRA 2RDGA 4DDGD 4JQWC 2KQSA 5JXVA 4X57B 4JLCA 2NPTA 1G6JA 2KYWA 3DHHC 3DHGC 5J2RA 1LQBA 2LGDA 1UF0A 3R2TA 2KQ7A 3VUWA 3TL5A 3BVZA 1HE8A 3RFZB 1V97A 3WCQA 2ZW0A 4NAWB 3M63B 3I9V1 5H8YE 4WJOA 2W54A 1FPYA 2BWES 4WWOA 4TUUA 4M00A 4RM9A 4FLHA 1MHHE 4I6LB 2IGDA 2JXTA 3NY5A 3EA6A 4BBNC 4BKGA 2D11A 3W5UB 2DENB 3ZNHB 4YTNB 1NBFC 2KJHB 1WRDB 1YX6B 3Q6BA 2MA9B 4C00A 1WE6A 1NEKB 3PTFC 4LDTB 3UI3A 1U4AA 2J42A 4J6IA 3KYCD 4BVUC 3AE2B 3PO0A 5IOIA 2N7DA 2NR2A 3V62A 3ZQ4A 4XYCA 1C4AA 4J3OD 2AX5A 1I4RA 2WXIA 2VRRB 1JWBD 3E9SA 3IAM1 3QJZA 2KLCA 4MJSA 1OQRA 4A6QA 2PE6B 3LJ3A 1WJNA 3RUIB 2XEWA 3URYA 4MSQB 1VZ7A 2K8CA 1SEBD 2BVCA 1WFYA 2BBCA 3VRAB 2JQRB 3JSVA 5G5GA 1S3SG 3LDZE 4S0RA 1OFFA 4BFRA 2KFKA 3U2SC 3QA8A 3KUZA 1F1HA 1L4DB 3HHMA 4CQNA 3ABVB 3KWLA 3RNAC 3ZTCA 4XGAB 3NVVA 5BYRA 4XWTA 1QOAA 4A20A 1WGGA 1WH3A 5HHDG 2G1EA 2NPTB 2WYQA 4IWOA 4KIKA 1WX8A 1UD7A 2RD0A 3HRDD 2I1JA 2J7QB 3ZW3A 4ANUA 2BS3B 4KVGB 3QHTA 1FM0D 3RMKC 1YN4A 1YQ4B 4DHJD 3NUHB 3TUOA 1FXTB 2QEJC 3MFGA 2G45B 3GS2A 4HPLB 2J52A 5DPTA 5IO9A 1XLNA 3LB8C 5HI1A 3A4RA 4ACFA 3SR6A 5L95C 5GXGB 3Q8CA 1YIWA 1IGCA 1WR6E 2KTRB 1KF6B 1MG4A 4K1RB 3VR9B 1GPXA 1TT5B 1ZPSA 2V3PA 2VZKD 2ZVOA 2RDHA 2KFJA 5IN7A 4ARCA 1SB3C 3P4RB 2KDIA 2WQYB 2E3TA 2JY6A 2W3RA 3SU8X 3FC4A 1OEYA 1QOFA 5EE1A 2WX1A 3ZJVA 2FCNA 4MEMA 4CHKA 4LNFA 2CR5A 1OQQA 3EFCA 4O1NA 2WXQA 4GDLA 3TSSA 2DYMA 4NNJB 1FXAA 1E7UA 3IFWB 4L1BA 2CHXA 4IC7B 4GU2A 1OQYA 1T5XD 3Q8BA 2MJDA 1PQSA 4W9DA 5DCNA 2ASQA 4C7YA 3HIZA 3AECB 5C23A 4OZBA 4KSKC 4JL9A 1B1ZA 3ZKJC 1C4PA 3RN9C 1I35A 3JSVB 4RGNA 2ZNVB 2MW5A 1V86A 1WMHA 2FUHB 2RMMA 2KACA 1TKEA 2WDVB 5EE0A 4EZLA 1NENB 1E7PB 3ONSA 3RNCC 4NQKE 2WU5B 4WJPA 4MM3A 3JYUA 1L5PA 3PVLA 2K6QA 3C19A 3TIXA 3ZNID 3WANA 1L4ZB 4C56C 3R2IA 2QMTA 2SEBD 3SDLC 3I3TB 4M02A 3AMZA 2D2QA 1A70A 4EKUA 2LVQA 4W9IA 3V6EB 3AE7B 3L13A 1HA5A 4BKSA 3EUB2 1E8WA 2KDEB 4PYUA 4DHZE 3AE4B 5AEKB 1D5ZC 4AOFA 3ZNZB 5IA7A 1TY2A 4DWFA 1K53A 1TBEA 3NVYA 2KVZA 2K9XA 1YJIA 2GBNA 3KW5B 2I2YA 2UWQA 4BAXA 2WXJA 1YJ1A 1C79A 1E0ZA 1WIAA 4C7ZA 1EU4A 2BGFA 4DDID 5DPSA 4GDKA 4LNNA 1L0YB 2INDC 1WSPA 3H8HA 2LMCA 4N59A 2K39A 3U7DA 2MBQA 1TIFA 1GOZA 2WWZA 2DAJA 3OWEB 5T8IA 4P6VF 1VDVA 2JU6X 3OJ3A 4RGMA 1WR1A 1WYWB 3T8MA 3MC8A 4M0WB 2QCZA 3AN1A 2G9HD 2WLBA 1I4GA 4WQMA 2KNBA 3J9CA 1IPGA 3UINB 4N58A 3HK0A 3VTWA 1EM7A 1UWXA 2QILA 1LFDA 3DWMA 4RNAA 3UQAA 2VH1A 2EMTA 3WIMA 1SJHD 3ETRA 2TSSA 1D5MC 3PREA 3PGEA 2JSVX 5D6JB 1WMHB 3VHTC 3KYDD 1P3QU 2K1FA 1QKZA 1T0RC 1WY8A 1UH6A 4PT5A 1B9RA 4IM2A 2G4DB 2DLBA 2V9HA 3APDA 4M8MA 3DVGX 1YMHE 1E90A 2BS4B 2BYEA 3PT2B 2FIDA 1I7HA 1WJ4A 5BYSA 1ZDVA 4YWGG 2FCSA 2IY0B 1YJJA 2LUMA 2W9NA 2EKIA 2PLPA 3SHQA 1V1OA 3N3KB 2L7RA 2WDRB 1XF5L 4M01A 3TCAA 4P1CC 4HPPA 1N5XA 3MJWA 1V6EA 2GBMA 3TMPB 3QAQA 3TBLD 3BVMA 4NAWA 2AYOB 4FADA 1GJZA 1CMXB 3U52E 2SAKA 5DPRA 2BF8B 3HVZA 1WYGA 3QCAA 2L32A 2OJWA 1V81A 2BS2B 1C78A 3ZO5B 2B3AA 2JYTA 1SE3A 1WGHA 4GDKB 2DZKA 3PSEB 5BMGA 2NTTA 1K50A 1N61A 3ML9A 4ZRIA 1NI3A 2N1VA 3HVDA 4JPSA 2RGFA 2Z0EB 4HK2A 1F9JA 1JRPA 3TJPA 4TSSA 5G2NA 2MBEA 4JE3B 3AE1B 3V61A 2WDQB 2DNFA 4LCDE 2ONQA 3P2BA 4XDCA 1RYJA 4HDQA 1RWSA 3VVWB 3R8BA 4ZRJA 2BKRB 3A1QB 4N6EB 2MBBB 1I42A 3AV8A 3RNBC 4ANXA 1J8CA 2MSED 4RF1A 4F7ZA 1ENFA 2JZZA 1IP9A 3NS8A 2GBKA 4YSYB 4G50A 5E6JA 3P4PB 2H89B 1J0GA 2FCMA 4KKIA 1LGRA 3SFEB 2M19A 1C4CA 3GB1A 1Y56A 4HWIB 3ZRFA 1FNVA 3ZDTA 2G4SA 1CK1A 2KQ4X 4HKZE 3BWUD 3UIPB 1F2RI 2WGSA 2INNE 2Y5PA 2WXPA 4W9LA 1PYWD 2J0JA 3Q3JA 1DOXA 1HZ6A 4ASWC 5H92C 2W55A 3DDCB 3RULA 1ET9A 3RNFC 1GB4A 4E71A 4I6NB 4AUQC 1DOIA 1P1AA 1A5RA 2MJEA 2JUOA 5LXIB 5IKCM 3NRZA 4C80A 2ZCBA 2HTME 1GNUA 3FILB 3L54A 3VUXA 1KOTA 5JZEB 4F8CB 1KRHA 5KHOA 1UUPA 2N7JA 1WZ3A 2ZJDA 1J19A 1TY0A 2LHDA 5E6PA 2LUEA 4GMVA 4TKNA 2KTRA 3EC8A 2PPHA 3KWVA 3OLMD 1PGAA 1KJTA 1GB1A 2N9XA 4K81A 4BKTA 5TR5A 2MBOA 3BK1A 3DVNU 4YXDB 3IT6B 3A4SC 3NZSA 3E56A 1C1YB 3JW0X 4MGZE 2GMIC 4P16A 2HE7A 2FBWB 3LXFA 1D6EC 3PLVA 3QWZB 2N0SB 1ISNA 4K3CA 2WP9B 3VXWA 4REZA 2C7NB 2KOXA 2DZJA 2VZKB 4LNOA 1C77A 2KT7A 1TTNA 2KJ6A 2IYDB 2N7EA 4XZ4A 4CYEA 4LNKA 2GLSA 1JQ4A 4RM8A 2NBVB 2ZNVC 3AEDB 2O6VD 2IPKD 2JWZA 2MJ3A 1WM3A 4OVZA 1ZUD2 5BMIA 3I63C 5E6OA 2M8SA 4HXDA 2OHFA 2KWUB 3K9OB 3QQ8B 2CJOA 3O65B 2IBIB 3AEGB 1ZGUB 3DVGY 2WX0A 1M94A 4GLSC 4USAA 5E6NA 2GBJA 1WI0A 3ENEA 4EZJA 1KM7A 3LYYA 1UWMA 3VAWA 3UGBB 3W1SA 4A90A 2IGGA 1FNWA 2CS4A 1AYFA 3GE8C 2KWDA 2JVCA 1JWAD 2Q5WD 4MACA 2MWSB 3IG3A 2FAZA 3W5VB 2YEPB 1TYGB 4R3DA 1WF9A 2JT4B 4MDKE 1SGHA 2KD0A 2MEKA 1MI0A 5C1ZA 2W3SA 4KKJA 3OG5A 4OZCA 1M4VA 1KLVA 1E8XA 2QSDA 2DX5B 4DBGA 1HQRD 4WWNA 5FR3A 2E6XA 2AEHA 4WAFA 3Q8FA 2Z0DB 3SEBA 3CIRB 3WA0A 1T0SC 4YSZB 1SF0A 4GXBA 4IOIE 2Z59B 2WXKA 3VTVA 4I6PA 1WJ6A 3X0WA 1WXVA 5CHWA 2PVGC 4II3B 4ARIA 4OVVA 3WAPA 4NZLB 3BK2A 4GIVA 3ZRCA 5EE9A 3DWGC 1Q0WB 2L3ZA 3IVFA 2BT6A 4E3CA 3AEFB 5LNK1 1PGBA 1UZXB 5AUKA 2K0PA 3QARA 2LGIA 2NCNA 2XNAC 4II2B 1E7VA 5D7GA 1YN3A 3N30A 2LVPA 2WS3B 2WU2B 2B76B 3PRMB 1FEHA 1NDDA 2KWVB 4EZKA 2IO3B 3RNEC 2DAFA 1XT9B 4M0WA 2EMSA 2GI9A 1PUTA 2NBWB 4LK0M 4A3OA 5HG2A 2HJ1A 1RFAA 4HJGE 5JHBA 4ZYNA 2D10A 3ALBA 5TSSA 4PYZA 4MGIE 4US9A 2HD5B 4FHJA 1BT0A 1SBBB 2MP2B 1FFVA 2I38A 3VQIA 4BOZB 1Z5SB 2KKCA 1MPEA 2JZ3B 4Q2JA 4ZDVA 1KLGD 1LXDA 2BKFA 1L7YA 2DHZA 3PLUA 1MJDA 1NYQA 4PK1A 2C7HA 2AQ3B 4IWQA 3QIJA 1H8CA 4JGHB 5JHAA 1XD3B 3NVZA 1AARA 1L0VB 2NVUI 3NZUA 3Q8EA 1UBQA 3ZNGC 1QOBA 4EE2A 4HRSA 4YTMB 3EFUA 1KFYB 1YNTE 4IWPA 2IO1B 3P63A 4HDOA 2AQ2B 1P0RA 1HTOA 1MVKA 3B0AA 4QAYA 4YTPB 3VDZA 2MBHA 4MSMB 3ZTDA 1J7BA 3AEBB 1I4QA 1ZE3D 3X23A 3ZIMA 1XQQA 2NBUA 4NAMA 3BIID 5D3IB 2G3QB 2DBYA 2HTHA 3Q69A 3GP7A 3VRBB 4KX6B 4G3XB 4TV3A 1FFUA 4G0NB 4RCOA 1TS4A 2N9EB 5G55A 2IY1B 4HVBA 3MJ5A 3WAMA 4KDIC 1JMLA 3VH3B 3T3NA 2N1WA 2ZPNA 3V3XA 5DPWA 2V4IB 1WXAA 2CHWA 1TZOA 2PE9A 2PVOD 1XO3A 1T0YA 4L2YA 2ON8A 2WXFA 3MC0B 2BYFA 3DOWA 3D32A 2IO2B 3AU5A 3UF8A 2KHWB 1IBXA 2C5LC 4WAAA 3AXCA 4RGOS 2JRIB 3T9LA 4PS8A 2INCC 1D3ZA 5JH5C 4LNIA 1RM6C 2KLGA 1V49A 2XK5B 3P4QB 4HCPB 2BTEA 4IG7B 2WXNA 4EOYA 2LJ5A 2N9LA 3V05A 1QZEA 3MC9A 2J4XA 2NS5A 2RPQA 2WXHA 2DWQA 3A1QA 2M0XA 2NMQA 3DBLI 3I5JC 3RZFA 1WGYA 1QLBB 1X1MA 2IJ0A 4OW0A 2PMVA 4DXAB 3EECA 2Y3AA 2JPHA 3L4PA 2C60A 3BYTB 2EKEC 3HM3A 2KMAA 1SE9A 4JWUC 2HDEA 1CJEA 4ANVA 2M0AA 1D4BA 3DBHI 3SD5A 3TEWA 4FJYA 3H9DA 2OJRA 2FUG1 1P9DU 4PS3A 2R61A 1V1PB 2X38A 2Y5BB 4D2KA 1JROA 3ZDMC 2R2OA 1TJEA 1YQBA 5GMVA 3N1YC 3I57A 2ZW1A 4ZHPA 1EUVB 2V0GA 1N5WA 2LXAA 3Q3MC 2AL6A 2CJNA 1BUIC 3BYYB 3AE9B 2IGHA 3DBLB 5FK9C 1E5WA 1Q5WB 1EO6A 2KN4A 1IUEA 4W9CA 4W9JA 4A3PA 3CSFA 1H4RA 3ZUNA 3FILA 3B2FA 3L08A 1N60A 2KX3A 3AM9A 3DBHB 3NZ3A 4H2AA 1MHXA 4KDLB 5CTRC 4B9KA 5IP4D 4TMAB 2AQ1B 3APFA 3IHPC 5FKAC 1GC7A 4KGRA 4FA6A 1WGKA 3H1UA 4XWWA 4UDUC 4AJYB 4FXCA 3EHVA 4ANWA 2MCNB 3Q3NC 2FNJB 3M3JA 3N1ZC 1IBXB 2YVCA 4MT5A 2D3CA 4YT0B 4W9EA 2J0MA 4WWPA 3TEZA 2K22A 2L8JA 1I4PA 4FN2A 5MPOA 5J18A 3RPFC 2Y5CA 4KZ0A 4IDIA 1HXYD 3WALA 2KANA 4W9HA 1CQVA 4C4VA 3PS6A 4W9FA 3NOBA 4IUMB 1TZ1A 2RDBC 1E8YA 2BYTA 4A9AA 2A5UA 4DQOC 3WAOA 2REXA 1K51A 3P4SB 2JF5A 4JWSC 5AZHA 3DBRI 3VR8B 4B6WA 1YX5B 4OZAA 2KJRA 2JYEA 2BYVE 2FE8A 1UGMA 3ZGZA 2HJ8A 4K7WA 1WZ0A 3AH7A 3R3MA 2KX0A 3HM6X 4AJWA 2KC2A 2JWUA 3B2GA 2UU7A 4FHKA 1WWTA 1NYRA 3Q14C 3AE8B 3VTUA 4HCNB 1MFWA 1GG3A 2PW9A 1VZ8A 1FCLA 2LJIA 2L0TA 3KUCB 3DHIC 1BXTA 1JCKB 2KMMA 2IZVB 5CHFA 3NVWA 2K5PA 2O6VB 1WJUA 3ZXVA 1FMAD 3KVFB 2LHEA 5C3JB 2GRIA 4WURA 4ICVA 5LXHA 1FCCC 4HEA1 3M62B 4HKQA 1EF5A 4MH0E 1HTQA 4GGQA 4NJCA 4ZRKA 3VH4B 4A55A 3IT4B 1KTKA 2BQQA 4KGTA 4HJKA 3Q3OC 2ICIA 3H7SA 4GOCA 3ZYYX 2C7MB 3VUYA 2O2VA 1V2YA 1FRRA 2WXGA 2DYBA 2CKHB 1WX9A 4US8A 3KH0A 2LRWA 3L16A 4AQ7A 3BINA 3FAHA 1WE7A 2XBBC 4URKA 3CF6E 3NHEB 4L23A 4JX1C 1SJED 4DHJB 1VZ6A 1SXTA 2LFIA 3PRPB 2IO0B 1FNUA 3A9KA 1HEZE 1RLFA 3KQ4A 3DVNV 1ACCA 4K3BA 2QDFA 4C4VB 1T0QC 3AB5A 3B08A 2CHZA 3QC8B 3ZLZA 5D3DA 4WWMA 2L05A 1F52A 5I4DA 1C76A 1T3QA 4LTUA 2JRHA 1VD2A 1ZXIA 4NJ7A 1GAQB 2A4ZA 5AZGA 1TS2A
chains in the Genus database with same CATH topology
4MGKE 4M0WB 1XT9B 4MELA 2EMSA 2DYOA 2NBWB 2KDFB 4A3OA 2GOWA 2KNBA 2N4FA 1IPGA 1RFAA 3UINB 2R2QA 5JHBA 4ZYNA 2MRPA 2D10A 3ALBA 3HK0A 3VTWA 3W1SC 3A9JB 4PYZA 4FJVB 5D94A 1LFDA 4MGIE 3PRZA 2OOBB 3JVZX 4M8NA 1WGDA 2HD5B 3UQAA 4FHJA 1BT0A 2EMTA 2JXXA 2MP2B 1RAXA 4KSLC 2MP2A 3VQIA 3WIMA 2D3GA 1Z5SB 2KKCA 4BOZB 2JZ3B 4ZDVA 3PREA 3PGEA 4PS7A 1LXDA 2BKFA 1E8ZA 5D6JB 1L7YA 1WMHB 2KDBA 2DHZA 3VHTC 2LASA 3PLUA 5CX3A 3KYDD 3IBEA 1P3QU 3BY4B 1RRBA 2K1FA 3S2AA 4BKSD 1WY8A 2C7HA 3AULA 3L0WB 1UH6A 2ZZPB 3QIJA 4IWQA 1H8CA 2FIFA 1V5TA 4JGHB 5JHAA 1XD3B 4IM2A 1AARA 2G4DB 2K25A 2NVUI 3NZUA 5FR6A 4CO7A 3APDA 3ZVVA 5HKHA 1UBQA 3ZNGC 4M8MA 3DVGX 3U8ZA 1MG8A 1OGWA 1E90A 3V60A 2BYEA 2QHOA 3DPDA 2FIDA 3EFUA 3PT2B 4RMAA 1IYFA 4IWPA 4EUTA 3W1YA 1WJ4A 1WXSA 2IO1B 2LXCA 2LGXA 4HDOA 2FCSA 1P0RA 2IY0B 4KZCA 3B0AA 3RT3B 1UBIA 3VDZA 2MBHA 2W9NA 5D2MB 3PV1A 4MSMB 3Q3FA 4G11A 3ZTDA 4EFOA 2DZMA 4B95A 2J0KA 3APCA 3SHQA 4DDGD 2GBRA 4JQWC 4ICUA 4FULA 2KQSA 4X57B 3N3KB 1NI2A 3X23A 2L7RA 1XQQA 2NBUA 2NPTA 4JLCA 3ZIMA 1G6JA 2G3QB 4JIOU 3PZDA 3TCAA 2MQJA 5J2RA 1LQBA 2HTHA 2LGDA 2KQ7A 3VUWA 3TL5A 3MJWA 2V1YA 1V6EA 1HE8A 2GBMA 3AI5A 4G3XB 4TV3A 4G0NB 3TMPB 2N9EB 5G55A 3QAQA 3PPAA 4NAWB 3TBLD 2IY1B 3M63B 2O2VB 4HVBA 4NAWA 3WAMA 3PHXB 4KDIC 2AYOB 4FADA 2BWFA 4GN1A 3VH3B 1GJZA 1CMXB 2I1KA 4LDTD 1V9JA 2N1WA 4WJOA 5DPRA 2BF8B 2ZPNA 5DPWA 2BWES 3QCAA 4NQLB 2KC1A 3C0RB 1WXAA 2CHWA 4WWOA 2PE9A 2LD9A 3GZNI 4TUUA 1V81A 4IM0A 4RM9A 4FLHA 4FBJB 1T0YA 3ZO5B 4I6LB 3RYTA 5EDSA 2B3AA 2KXJA 2BYFA 1Y8RC 3DOWA 3NY5A 1EF1A 3A9KB 2MX2A 1WGHA 3D32A 4GDKB 4LJPB 4BBNC 2DZKA 2IO2B 3AU5A 2N9PC 3UF8A 1WXMA 4BKGA 2KHWB 3PSEB 3MHSD 2KO3A 2D11A 2C5LC 1R4MI 4ZRIA 3ML9A 4WAAA 3AXCA 2DENB 2N1VA 2JRIB 3T9LA 4PS8A 2LWPA 3ZNHB 2RGFA 1D3ZA 1NBFC 2Z0EB 4HK2A 5JH5C 1F9JA 2KJHB 1WRDB 3TJPA 1YX6B 1WGRA 5G2NA 2KLGA 2MBEA 1V49A 2UYZB 2MA9B 2XK5B 1WE6A 3V61A 2XK5A 5CHVC 4HCPB 3U30A 3PTFC 4LDTB 4LCDE 1U4AA 4J6IA 4HLEA 3KYCD 3P2BA 4KV2A 3H6NA 4IG7B 4EOYA 2LJ5A 3VVWB 4HDQA 1QZEA 4BVUC 2KMCA 2NS5A 2RPQA 4ZRJA 2BKRB 4MGYE 4EEWA 5BO4B 3A1QB 3A1QA 2M0XA 1TGZB 2MBBB 2N7DA 2NR2A 1I42A 2PJHA 3DQVA 4N9F4 3DBLI 3V62A 4ANXA 3RZFA 5J17A 2V4LA 1WGYA 5AZGA 1J8CA 2MSED 3DBSA 4F7ZA 1X1MA 3KUDB 2JZZA 2PEAA 2VRRB 3QJZA 4DXAB 1IP9A 3EECA 2GBKA 3NS8A 2KLCA 4MJSB 4G50A 4MJSA 2JPHA 2K8BA 1J0GA 2FCMA 2C60A 2PE6B 1WJNA 3LJ3A 2EKEC 2XEWA 3HM3A 4HWIB 2YLMA 3RUIB 2KMAA 2AWTA 1SE9A 4GSWA 3ZRFA 2RR9A 4MSQB 4ANVA 3QK0A 3ZDTA 3DBHI 4P7IA 4WQOB 3SD5A 2G4SA 4WJNA 2K8CA 4FJYA 3H9DA 1WFYA 2OJRA 2KTFA 1P9DU 5AZFA 3UIPB 4PS3A 3L17A 3JSVA 3OJ4B 2Y5BB 2ZVNA 1ZW7A 1S3SG 3B1LX 3LDZE 4W9LA 2KFKB 2J0JA 2LZ6A 3Q3JA 3ZDMC 2R2OA 2KFKA 4BFRA 4ASWC 2V3SA 1YQBA 3QA8A 5GMVA 3DDCB 3KUZA 3RULA 3MTNB 3OAWA 3HHMA 1K8RB 1EUVB 3ZTCA 2KN5A 2LXAA 3L10B 4HPMB 4E71A 4I6NB 3A33B 2AL6A 2WDTB 4AUQC 1P1AA 4A20A 4W9KA 1A5RA 2JUOA 1E5WA 1Q5WB 1WH3A 1WGGA 1EO6A 2NPTB 5LXIB 4KIKB 4W9CA 2WYQA 4IWOA 4KIKA 1WX8A 4W9JA 1UD7A 2ZCBA 4A3PA 2RD0A 3CSFA 3N32A 3QX1A 1H4RA 4W9GA 1GNUA 3L54A 3ZUNA 4AWJA 1LM8B 2I1JA 2J7QB 3VUXA 1KOTA 2K6DB 3ZW3A 4ANUA 4TQ1A 3V6CB 5JZEB 4KVGB 3QHTA 3L08A 4F8CB 5IAAC 5KHOA 4DHJD 1FXTB 2KX3A 2DZIA 2G45B 4HPLB 2RSUA 2C9WB 5DPTA 1WZ3A 3H7PA 2ZJDA 4KDLB 1J19A 2L0FA 3A4RA 5CTRC 4B9KA 5L95C 3APFA 5E6PA 2LUEA 4GMVA 1YIWA 3IHPC 1WR6E 2KTRB 1GC7A 4TKNA 4FA6A 2KTRA 3PHWB 3H1UA 3ECIA 4K1RB 3CMMB 3EC8A 2LGYA 4AJYB 3EHVA 4ANWA 2PPHA 3OLMD 2MCNB 4IM3A 2ZVOA 2FNJB 3M3JA 4XC2A 3K9PB 2YVCA 1YD8U 1KJTA 2KFJA 1WM2A 2LVOA 2N9XA 4K81A 4W9EA 2J0MA 4LJOB 4WWPA 4NY0A 3R66C 2KDIA 4BKTA 5TR5A 2MBOA 3DVNU 4TQ0A 2L8JA 4FN2A 4OVUA 5J18A 2JY6A 3A4SC 3NZSA 3SU8X 1C1YB 3JW0X 1OEYA 4KZ0A 2ZCCA 4MGZE 2GMIC 2WX1A 2KANA 2HE7A 3WALA 5L83A 4W9HA 4NPNA 3PLVA 2FCQA 2FCNA 3QWZB 3CSTA 1OTRB 3PS6A 3M95A 4MEMA 4W9FA 4CHKA 2CR5A 1ISNA 3NOBA 4GDLB 4IUMB 1TZ1A 4GDLA 4GB9A 3VXWA 2DYMA 2LRUA 4NNJB 2C7NB 1E8YA 2ZPYA 4DHZB 2A5UA 3WAOA 2KOXA 2REXA 1E7UA 3IFWB 2JF5A 2DZJA 5AZHA 3DBRI 2CHXA 4B6WA 1YX5B 4IC7B 1TTNA 4GU2A 1OQYA 2KJ6A 1PQSA 2IYDB 2N7EA 4XZ4A 3UIOB 2KJRA 4K7UA 4CYEA 1JRUA 4W9DA 5DCNA 2ASQA 4RM8A 2NBVB 2BYVE 2ZNVC 1UGMA 3HIZA 3RCZA 5C23A 1UELA 2O6VD 1S1QB 2HJ8A 4JL9A 1P98A 4K7WA 4KSKC 1WZ0A 2JWZA 3R3MA 3ZKJC 3A9JA 1WM3A 1GC6A 2AL3A 2M17A 1I35A 2KX0A 3JSVB 3HM6X 4AJWA 2KC2A 3R7QA 5E6OA 2M8SA 4HXDA 2KWUB 3K9OB 4FHKA 3QQ8B 1VCBA 3RZWC 3O65B 2IBIB 2ZNVB 1ZGUB 2MW5A 1V86A 2L00B 3DVGY 2WX0A 1M94A 5E6NA 1WMHA 2GBJA 1WI0A 3ENEA 4EZJA 1KM7A 2FUHB 3VTUA 3VAWA 4HCNB 3UGBB 1L2NA 1R4NI 3W1SA 2CS4A 4EZLA 4F1SA 1GG3A 2L76A 3ONSA 2KK8A 2JVCA 2ZEQA 4FJZA 2L0TA 4NQKE 3KUCB 4WJPA 4MM3A 2MWSB 3ML8A 5LLIA 3IG3A 2FAZA 2IZVB 3JYUA 3PVLA 4WJQA 2K6QA 5CHFA 2O6VB 1WX7A 1WF9A 1WJUA 2JT4B 2O6VA 3DCGA 3TIXA 4MDKE 1SGHA 3ZNID 1SIFA 2MLBA 3KVFB 2KD0A 4NJ6A 4IW0A 4ICVA 3WANA 5C1ZA 5LXHA 3M62B 1OEYJ 1EF5A 4MH0E 4E74A 3SDLC 4GGQA 1KLVA 1E8XA 2KVRA 3GOEA 3I3TB 1C3TA 3H7PB 2DX5B 4DBGA 4ZRKA 3VH4B 2D2QA 2K8HA 4WWNA 2M1MA 3RD2A 4EKUA 2LVQA 2LI5A 4W9IA 3V6EB 1V5OA 2AEHA 3L13A 4BKSA 2Z0DB 4HJKA 3VFKA 3WA0A 1E8WA 4K7SA 2KDEB 4BBNF 4PYUA 3H7SA 4GXBA 4DHZE 4GOCA 2Z59B 2C7MB 3VTVA 4I6PA 5AEKB 3VUYA 2M4NA 2O2VA 4AOFA 1WJ6A 1V2YA 3ZNZB 5IA7A 3X0WA 1WXVA 4DWFA 5CHWA 2DYBA 2CKHB 1TBEA 1WX9A 4II3B 4BOSC 3KH0A 4OVVA 2LRWA 3L16A 3WAPA 3BINA 1WE7A 2GBNA 3KW5B 2XBBC 4URKA 2UWQA 3CF6E 3NHEB 1V80A 4DHJB 4GIVA 1YJ1A 2CU1A 3ZRCA 5KHQA 3AU4A 1WIAA 3PRPB 2IO0B 1Q0WB 2BGFA 3R7RA 2KWCA 3A9KA 2L3ZA 3IVFA 4DDID 4E3CA 1RLFA 5DPSA 4GDKA 4XX5A 3DVNV 1UZXB 1Q1OA 2K39A 1Z2MA 3U7DA 3QARA 2MBQA 3B08A 2CHZA 3QC8B 2NCNA 5D7GA 4II2B 1E7VA 2WWZA 3ZLZA 4DK5A 3N30A 2BPSA 3UQBA 2LVPA 2DAJA 1ZKHA 2L05A 2D07B 4AP4C 4YL8A 3OJ3A 3PRMB 1NDDA 1WR1A 2JRHA 2KWVB 1VD2A 2KZRA 4EZKA 2IO3B 4NJ7A 2A4ZA 1WYWB 3T8MA 2DAFA 1GUAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MGK E;  4M0W B;  1XT9 B;  4MEL A;  2EMS A;  2DYO A;  2NBW B;  2KDF B;  4A3O A;  2GOW A;  2KNB A;  2N4F A;  1IPG A;  1RFA A;  3UIN B;  2R2Q A;  5JHB A;  4ZYN A;  2MRP A;  2D10 A;  3ALB A;  3HK0 A;  3VTW A;  3W1S C;  3A9J B;  4PYZ A;  4FJV B;  5D94 A;  1LFD A;  4MGI E;  3PRZ A;  2OOB B;  3JVZ X;  4M8N A;  1WGD A;  2HD5 B;  3UQA A;  4FHJ A;  1BT0 A;  2EMT A;  2JXX A;  2MP2 B;  1RAX A;  4KSL C;  2MP2 A;  3VQI A;  3WIM A;  2D3G A;  1Z5S B;  2KKC A;  4BOZ B;  2JZ3 B;  4ZDV A;  3PRE A;  3PGE A;  4PS7 A;  1LXD A;  2BKF A;  1E8Z A;  5D6J B;  1L7Y A;  1WMH B;  2KDB A;  2DHZ A;  3VHT C;  2LAS A;  3PLU A;  5CX3 A;  3KYD D;  3IBE A;  1P3Q U;  3BY4 B;  1RRB A;  2K1F A;  3S2A A;  4BKS D;  1WY8 A;  2C7H A;  3AUL A;  3L0W B;  1UH6 A;  2ZZP B;  3QIJ A;  4IWQ A;  1H8C A;  2FIF A;  1V5T A;  4JGH B;  5JHA A;  1XD3 B;  4IM2 A;  1AAR A;  2G4D B;  2K25 A;  2NVU I;  3NZU A;  5FR6 A;  4CO7 A;  3APD A;  3ZVV A;  5HKH A;  1UBQ A;  3ZNG C;  4M8M A;  3DVG X;  3U8Z A;  1MG8 A;  1OGW A;  1E90 A;  3V60 A;  2BYE A;  2QHO A;  3DPD A;  2FID A;  3EFU A;  3PT2 B;  4RMA A;  1IYF A;  4IWP A;  4EUT A;  3W1Y A;  1WJ4 A;  1WXS A;  2IO1 B;  2LXC A;  2LGX A;  4HDO A;  2FCS A;  1P0R A;  2IY0 B;  4KZC A;  3B0A A;  3RT3 B;  1UBI A;  3VDZ A;  2MBH A;  2W9N A;  5D2M B;  3PV1 A;  4MSM B;  3Q3F A;  4G11 A;  3ZTD A;  4EFO A;  2DZM A;  4B95 A;  2J0K A;  3APC A;  3SHQ A;  4DDG D;  2GBR A;  4JQW C;  4ICU A;  4FUL A;  2KQS A;  4X57 B;  3N3K B;  1NI2 A;  3X23 A;  2L7R A;  1XQQ A;  2NBU A;  2NPT A;  4JLC A;  3ZIM A;  1G6J A;  2G3Q B;  4JIO U;  3PZD A;  3TCA A;  2MQJ A;  5J2R A;  1LQB A;  2HTH A;  2LGD A;  2KQ7 A;  3VUW A;  3TL5 A;  3MJW A;  2V1Y A;  1V6E A;  1HE8 A;  2GBM A;  3AI5 A;  4G3X B;  4TV3 A;  4G0N B;  3TMP B;  2N9E B;  5G55 A;  3QAQ A;  3PPA A;  4NAW B;  3TBL D;  2IY1 B;  3M63 B;  2O2V B;  4HVB A;  4NAW A;  3WAM A;  3PHX B;  4KDI C;  2AYO B;  4FAD A;  2BWF A;  4GN1 A;  3VH3 B;  1GJZ A;  1CMX B;  2I1K A;  4LDT D;  1V9J A;  2N1W A;  4WJO A;  5DPR A;  2BF8 B;  2ZPN A;  5DPW A;  2BWE S;  3QCA A;  4NQL B;  2KC1 A;  3C0R B;  1WXA A;  2CHW A;  4WWO A;  2PE9 A;  2LD9 A;  3GZN I;  4TUU A;  1V81 A;  4IM0 A;  4RM9 A;  4FLH A;  4FBJ B;  1T0Y A;  3ZO5 B;  4I6L B;  3RYT A;  5EDS A;  2B3A A;  2KXJ A;  2BYF A;  1Y8R C;  3DOW A;  3NY5 A;  1EF1 A;  3A9K B;  2MX2 A;  1WGH A;  3D32 A;  4GDK B;  4LJP B;  4BBN C;  2DZK A;  2IO2 B;  3AU5 A;  2N9P C;  3UF8 A;  1WXM A;  4BKG A;  2KHW B;  3PSE B;  3MHS D;  2KO3 A;  2D11 A;  2C5L C;  1R4M I;  4ZRI A;  3ML9 A;  4WAA A;  3AXC A;  2DEN B;  2N1V A;  2JRI B;  3T9L A;  4PS8 A;  2LWP A;  3ZNH B;  2RGF A;  1D3Z A;  1NBF C;  2Z0E B;  4HK2 A;  5JH5 C;  1F9J A;  2KJH B;  1WRD B;  3TJP A;  1YX6 B;  1WGR A;  5G2N A;  2KLG A;  2MBE A;  1V49 A;  2UYZ B;  2MA9 B;  2XK5 B;  1WE6 A;  3V61 A;  2XK5 A;  5CHV C;  4HCP B;  3U30 A;  3PTF C;  4LDT B;  4LCD E;  1U4A A;  4J6I A;  4HLE A;  3KYC D;  3P2B A;  4KV2 A;  3H6N A;  4IG7 B;  4EOY A;  2LJ5 A;  3VVW B;  4HDQ A;  1QZE A;  4BVU C;  2KMC A;  2NS5 A;  2RPQ A;  4ZRJ A;  2BKR B;  4MGY E;  4EEW A;  5BO4 B;  3A1Q B;  3A1Q A;  2M0X A;  1TGZ B;  2MBB B;  2N7D A;  2NR2 A;  1I42 A;  2PJH A;  3DQV A;  4N9F 4;  3DBL I;  3V62 A;  4ANX A;  3RZF A;  5J17 A;  2V4L A;  1WGY A;  5AZG A;  1J8C A;  2MSE D;  3DBS A;  4F7Z A;  1X1M A;  3KUD B;  2JZZ A;  2PEA A;  2VRR B;  3QJZ A;  4DXA B;  1IP9 A;  3EEC A;  2GBK A;  3NS8 A;  2KLC A;  4MJS B;  4G50 A;  4MJS A;  2JPH A;  2K8B A;  1J0G A;  2FCM A;  2C60 A;  2PE6 B;  1WJN A;  3LJ3 A;  2EKE C;  2XEW A;  3HM3 A;  4HWI B;  2YLM A;  3RUI B;  2KMA A;  2AWT A;  1SE9 A;  4GSW A;  3ZRF A;  2RR9 A;  4MSQ B;  4ANV A;  3QK0 A;  3ZDT A;  3DBH I;  4P7I A;  4WQO B;  3SD5 A;  2G4S A;  4WJN A;  2K8C A;  4FJY A;  3H9D A;  1WFY A;  2OJR A;  2KTF A;  1P9D U;  5AZF A;  3UIP B;  4PS3 A;  3L17 A;  3JSV A;  3OJ4 B;  2Y5B B;  2ZVN A;  1ZW7 A;  1S3S G;  3B1L X;  3LDZ E;  4W9L A;  2KFK B;  2J0J A;  2LZ6 A;  3Q3J A;  3ZDM C;  2R2O A;  2KFK A;  4BFR A;  4ASW C;  2V3S A;  1YQB A;  3QA8 A;  5GMV A;  3DDC B;  3KUZ A;  3RUL A;  3MTN B;  3OAW A;  3HHM A;  1K8R B;  1EUV B;  3ZTC A;  2KN5 A;  2LXA A;  3L10 B;  4HPM B;  4E71 A;  4I6N B;  3A33 B;  2AL6 A;  2WDT B;  4AUQ C;  1P1A A;  4A20 A;  4W9K A;  1A5R A;  2JUO A;  1E5W A;  1Q5W B;  1WH3 A;  1WGG A;  1EO6 A;  2NPT B;  5LXI B;  4KIK B;  4W9C A;  2WYQ A;  4IWO A;  4KIK A;  1WX8 A;  4W9J A;  1UD7 A;  2ZCB A;  4A3P A;  2RD0 A;  3CSF A;  3N32 A;  3QX1 A;  1H4R A;  4W9G A;  1GNU A;  3L54 A;  3ZUN A;  4AWJ A;  1LM8 B;  2I1J A;  2J7Q B;  3VUX A;  1KOT A;  2K6D B;  3ZW3 A;  4ANU A;  4TQ1 A;  3V6C B;  5JZE B;  4KVG B;  3QHT A;  3L08 A;  4F8C B;  5IAA C;  5KHO A;  4DHJ D;  1FXT B;  2KX3 A;  2DZI A;  2G45 B;  4HPL B;  2RSU A;  2C9W B;  5DPT A;  1WZ3 A;  3H7P A;  2ZJD A;  4KDL B;  1J19 A;  2L0F A;  3A4R A;  5CTR C;  4B9K A;  5L95 C;  3APF A;  5E6P A;  2LUE A;  4GMV A;  1YIW A;  3IHP C;  1WR6 E;  2KTR B;  1GC7 A;  4TKN A;  4FA6 A;  2KTR A;  3PHW B;  3H1U A;  3ECI A;  4K1R B;  3CMM B;  3EC8 A;  2LGY A;  4AJY B;  3EHV A;  4ANW A;  2PPH A;  3OLM D;  2MCN B;  4IM3 A;  2ZVO A;  2FNJ B;  3M3J A;  4XC2 A;  3K9P B;  2YVC A;  1YD8 U;  1KJT A;  2KFJ A;  1WM2 A;  2LVO A;  2N9X A;  4K81 A;  4W9E A;  2J0M A;  4LJO B;  4WWP A;  4NY0 A;  3R66 C;  2KDI A;  4BKT A;  5TR5 A;  2MBO A;  3DVN U;  4TQ0 A;  2L8J A;  4FN2 A;  4OVU A;  5J18 A;  2JY6 A;  3A4S C;  3NZS A;  3SU8 X;  1C1Y B;  3JW0 X;  1OEY A;  4KZ0 A;  2ZCC A;  4MGZ E;  2GMI C;  2WX1 A;  2KAN A;  2HE7 A;  3WAL A;  5L83 A;  4W9H A;  4NPN A;  3PLV A;  2FCQ A;  2FCN A;  3QWZ B;  3CST A;  1OTR B;  3PS6 A;  3M95 A;  4MEM A;  4W9F A;  4CHK A;  2CR5 A;  1ISN A;  3NOB A;  4GDL B;  4IUM B;  1TZ1 A;  4GDL A;  4GB9 A;  3VXW A;  2DYM A;  2LRU A;  4NNJ B;  2C7N B;  1E8Y A;  2ZPY A;  4DHZ B;  2A5U A;  3WAO A;  2KOX A;  2REX A;  1E7U A;  3IFW B;  2JF5 A;  2DZJ A;  5AZH A;  3DBR I;  2CHX A;  4B6W A;  1YX5 B;  4IC7 B;  1TTN A;  4GU2 A;  1OQY A;  2KJ6 A;  1PQS A;  2IYD B;  2N7E A;  4XZ4 A;  3UIO B;  2KJR A;  4K7U A;  4CYE A;  1JRU A;  4W9D A;  5DCN A;  2ASQ A;  4RM8 A;  2NBV B;  2BYV E;  2ZNV C;  1UGM A;  3HIZ A;  3RCZ A;  5C23 A;  1UEL A;  2O6V D;  1S1Q B;  2HJ8 A;  4JL9 A;  1P98 A;  4K7W A;  4KSK C;  1WZ0 A;  2JWZ A;  3R3M A;  3ZKJ C;  3A9J A;  1WM3 A;  1GC6 A;  2AL3 A;  2M17 A;  1I35 A;  2KX0 A;  3JSV B;  3HM6 X;  4AJW A;  2KC2 A;  3R7Q A;  5E6O A;  2M8S A;  4HXD A;  2KWU B;  3K9O B;  4FHK A;  3QQ8 B;  1VCB A;  3RZW C;  3O65 B;  2IBI B;  2ZNV B;  1ZGU B;  2MW5 A;  1V86 A;  2L00 B;  3DVG Y;  2WX0 A;  1M94 A;  5E6N A;  1WMH A;  2GBJ A;  1WI0 A;  3ENE A;  4EZJ A;  1KM7 A;  2FUH B;  3VTU A;  3VAW A;  4HCN B;  3UGB B;  1L2N A;  1R4N I;  3W1S A;  2CS4 A;  4EZL A;  4F1S A;  1GG3 A;  2L76 A;  3ONS A;  2KK8 A;  2JVC A;  2ZEQ A;  4FJZ A;  2L0T A;  4NQK E;  3KUC B;  4WJP A;  4MM3 A;  2MWS B;  3ML8 A;  5LLI A;  3IG3 A;  2FAZ A;  2IZV B;  3JYU A;  3PVL A;  4WJQ A;  2K6Q A;  5CHF A;  2O6V B;  1WX7 A;  1WF9 A;  1WJU A;  2JT4 B;  2O6V A;  3DCG A;  3TIX A;  4MDK E;  1SGH A;  3ZNI D;  1SIF A;  2MLB A;  3KVF B;  2KD0 A;  4NJ6 A;  4IW0 A;  4ICV A;  3WAN A;  5C1Z A;  5LXH A;  3M62 B;  1OEY J;  1EF5 A;  4MH0 E;  4E74 A;  3SDL C;  4GGQ A;  1KLV A;  1E8X A;  2KVR A;  3GOE A;  3I3T B;  1C3T A;  3H7P B;  2DX5 B;  4DBG A;  4ZRK A;  3VH4 B;  2D2Q A;  2K8H A;  4WWN A;  2M1M A;  3RD2 A;  4EKU A;  2LVQ A;  2LI5 A;  4W9I A;  3V6E B;  1V5O A;  2AEH A;  3L13 A;  4BKS A;  2Z0D B;  4HJK A;  3VFK A;  3WA0 A;  1E8W A;  4K7S A;  2KDE B;  4BBN F;  4PYU A;  3H7S A;  4GXB A;  4DHZ E;  4GOC A;  2Z59 B;  2C7M B;  3VTV A;  4I6P A;  5AEK B;  3VUY A;  2M4N A;  2O2V A;  4AOF A;  1WJ6 A;  1V2Y A;  3ZNZ B;  5IA7 A;  3X0W A;  1WXV A;  4DWF A;  5CHW A;  2DYB A;  2CKH B;  1TBE A;  1WX9 A;  4II3 B;  4BOS C;  3KH0 A;  4OVV A;  2LRW A;  3L16 A;  3WAP A;  3BIN A;  1WE7 A;  2GBN A;  3KW5 B;  2XBB C;  4URK A;  2UWQ A;  3CF6 E;  3NHE B;  1V80 A;  4DHJ B;  4GIV A;  1YJ1 A;  2CU1 A;  3ZRC A;  5KHQ A;  3AU4 A;  1WIA A;  3PRP B;  2IO0 B;  1Q0W B;  2BGF A;  3R7R A;  2KWC A;  3A9K A;  2L3Z A;  3IVF A;  4DDI D;  4E3C A;  1RLF A;  5DPS A;  4GDK A;  4XX5 A;  3DVN V;  1UZX B;  1Q1O A;  2K39 A;  1Z2M A;  3U7D A;  3QAR A;  2MBQ A;  3B08 A;  2CHZ A;  3QC8 B;  2NCN A;  5D7G A;  4II2 B;  1E7V A;  2WWZ A;  3ZLZ A;  4DK5 A;  3N30 A;  2BPS A;  3UQB A;  2LVP A;  2DAJ A;  1ZKH A;  2L05 A;  2D07 B;  4AP4 C;  4YL8 A;  3OJ3 A;  3PRM B;  1NDD A;  1WR1 A;  2JRH A;  2KWV B;  1VD2 A;  2KZR A;  4EZK A;  2IO3 B;  4NJ7 A;  2A4Z A;  1WYW B;  3T8M A;  2DAF A;  1GUA B; 
#chains in the Genus database with same CATH topology
 4MGK E;  1JW9 D;  2W82 A;  1XLP A;  2DYO A;  2KDF B;  2N4F A;  1QQR A;  2R2Q A;  3W1S C;  1QOG A;  5D94 A;  4WIP A;  1WRI A;  1KH0 A;  2MP2 A;  2D3G A;  1F77 A;  2QC8 A;  4PS7 A;  1E8Z A;  3P1M A;  2KDB A;  2MH7 A;  2LAS A;  3IBE A;  3FKY A;  1RRB A;  1VRA B;  3L0W B;  1TKY A;  2FIF A;  1V5T A;  4CO7 A;  2K25 A;  4RH6 A;  1STE A;  5HKH A;  1MG8 A;  1ROE A;  5AUI A;  1PDX A;  1OGW A;  3V60 A;  1XEE A;  4EUT A;  2KAJ A;  3ZJU A;  1D5X C;  3P42 A;  1ZP0 B;  3NJT A;  4KZC A;  1Q10 A;  1FD6 A;  3RT3 B;  5HFY A;  4BZA A;  3PV1 A;  3Q3F A;  4EFO A;  1T6B X;  2DZM A;  1YOV B;  3APC A;  4ICU A;  4YSX B;  4FUL A;  3U7Z A;  1NI2 A;  3IXS A;  2X8X X;  4JIO U;  3PZD A;  1E9M A;  2MQJ A;  2L83 A;  4ZYS A;  3U4E G;  3T3O A;  2V1Y A;  3AI5 A;  2EEL A;  1JAL A;  3PPA A;  2O2V B;  1IGD A;  2WXR A;  1TKG A;  3PHX B;  2BW2 A;  2BWF A;  4GN1 A;  3SFD B;  2I1K A;  4LDT D;  1V9J A;  1PFD A;  4NQL B;  2KC1 A;  3C0R B;  3W2D A;  2LD9 A;  3GZN I;  4IM0 A;  4FBJ B;  3RYT A;  1C9F A;  5EDS A;  2KXJ A;  1Y8R C;  1EF1 A;  1JWM D;  3A9K B;  2MHJ A;  2MX2 A;  4LJP B;  2N9P C;  1WXM A;  3MHS D;  2KO3 A;  3AEA B;  1R4M I;  4XDD A;  2BB5 A;  2H88 B;  3KLS X;  2LWP A;  1WGR A;  1F0Z A;  2UYZ B;  1R7S A;  2XK5 A;  2RPV A;  5CHV C;  3U30 A;  3RNG C;  3PZ8 A;  4HLE A;  4KV2 A;  3H6N A;  3ZXR A;  1DYQ A;  3BZD B;  2KMC A;  3B9J A;  4MGY E;  4EEW A;  5BO4 B;  1N62 A;  1FXI A;  1TGZ B;  3MHZ A;  2PJH A;  3DQV A;  4N9F 4;  2WXM A;  3ZJT A;  2CU3 A;  5J17 A;  2V4L A;  2WHI A;  3DBS A;  4ITK A;  3N9Y C;  3GZN B;  3KUD B;  2PEA A;  1K52 A;  3NS1 A;  4MJS B;  1FO4 A;  2IDY A;  2K8B A;  1XLQ A;  1ESF A;  2D3B A;  2YLM A;  1N6Z A;  2AWT A;  4GSW A;  2RR9 A;  3QK0 A;  1R4M B;  4WQO B;  4P7I A;  4WJN A;  1L0X B;  4RFB A;  1EU3 A;  4P1B C;  2KTF A;  5AZF A;  1ZOY B;  3L17 A;  3OJ4 B;  1V1P A;  2ZVN A;  1ZW7 A;  3B1L X;  2KFK B;  2LZ6 A;  2JZP A;  1CZP A;  1J7C A;  1FIQ A;  2V3S A;  3MTN B;  1EWC A;  2NTS A;  3OAW A;  2VH2 A;  1K8R B;  1QT9 A;  2KN5 A;  1ZXH A;  3L10 B;  4HPM B;  3A33 B;  2WDT B;  4W9K A;  2BB6 A;  4LLG M;  2PKO A;  4KIK B;  2L52 A;  1I4H A;  2D5G A;  3N32 A;  3QX1 A;  2LEK A;  4W9G A;  4AWJ A;  1LM8 B;  2D3A A;  2K6D B;  4TQ1 A;  3V6C B;  1AN8 A;  1RFK A;  5IAA C;  4OHJ A;  4MH8 A;  2DZI A;  3BVG A;  2RSU A;  2C9W B;  3H7P A;  2L0F A;  1L6V A;  3AEE B;  1AWD A;  1SIJ A;  1J7A A;  3PHW B;  1V8C A;  3ECI A;  3CMM B;  2LGY A;  3AE3 B;  3C8Y A;  5G5H A;  4IM3 A;  3NG0 A;  4XC2 A;  2INP E;  3K9P B;  1XCQ L;  3MP9 A;  1YD8 U;  1WM2 A;  1VLB A;  2LVO A;  2Z8L A;  2XN9 C;  4LJO B;  4NY0 A;  3R66 C;  2JX5 A;  4TQ0 A;  2KDM A;  2LGS A;  1L6U A;  4OVU A;  4A8X C;  2WXL A;  1UNS A;  1E6E B;  3AE6 B;  4XE0 A;  2GB1 A;  2ZCC A;  1P7E A;  5L83 A;  1KLU D;  4NPN A;  1PGX A;  2FCQ A;  3CST A;  1OTR B;  3M95 A;  4GDL B;  4GB9 A;  1QF6 A;  2LRU A;  2ZPY A;  4DHZ B;  4DXG A;  1QIL A;  1VJK A;  4S17 A;  4WH4 A;  2YEP F;  3UIO B;  4K7U A;  1JRU A;  4HRO A;  2WXO A;  3TEY A;  3RCZ A;  1UEL A;  3Q2A C;  2K3U A;  1S1Q B;  1FRD A;  1P98 A;  3A9J A;  1GC6 A;  2AL3 A;  2M17 A;  2V3N A;  1JWU D;  5BYQ A;  2ACZ B;  3R7Q A;  2WNM A;  1VCB A;  3RZW C;  3GE3 C;  2L00 B;  1XXG A;  1JWS D;  4ZHO A;  1TS3 A;  1L2N A;  1SE4 A;  1R4N I;  4F1S A;  2L76 A;  3O13 A;  3CWI A;  2KK8 A;  2ZEQ A;  4FJZ A;  4MM3 B;  3ML8 A;  5LLI A;  4DXF A;  4WJQ A;  1NVI D;  1WX7 A;  2O6V A;  3DCG A;  1F2R C;  1SIF A;  2MLB A;  4NJ6 A;  4IW0 A;  1UGJ A;  1OEY J;  1E10 A;  4E74 A;  2PIA A;  2KVR A;  3GOE A;  1C3T A;  3H7P B;  2K8H A;  2M1M A;  3RD2 A;  5BMH A;  2LI5 A;  1V5O A;  2PTL A;  3VFK A;  4K7S A;  4BBN F;  3EGR A;  1HZ5 A;  2M4N A;  3W9C B;  1SSN A;  1R4N B;  1ET6 A;  1BML C;  4BOS C;  1WXQ A;  3PZ7 A;  1V80 A;  1XCT L;  1YQ3 B;  2CU1 A;  5KHQ A;  3AU4 A;  3R7R A;  2KWC A;  1XLO A;  4XX5 A;  1Q1O A;  1Z2M A;  4DK5 A;  2BPS A;  3UQB A;  1ZDX A;  1ZKH A;  2D07 B;  2OED A;  4AP4 C;  4YL8 A;  3N1X C;  3AE5 B;  1SE2 A;  2KZR A;  4ZOH C;  1N63 A;  3IAS 1;  3RI7 C;  4G11 A;  3Q8A A;  1GUA B;  4MEL A;  4AS1 A;  1TS5 A;  4ZRQ A;  1DGJ A;  1DOY A;  2N9K A;  2GOW A;  1VR9 A;  2MRP A;  3A9J B;  1I4X A;  4FJV B;  1LO5 D;  3PRZ A;  2OOB B;  3JVZ X;  4M8N A;  1WGD A;  2M56 B;  2QIE B;  4RGT A;  2JXX A;  4KSL C;  1RAX A;  5EE3 A;  4ZRP A;  3N20 C;  5CX3 A;  3BY4 B;  3S2A A;  4BKS D;  3AUL A;  2J53 A;  2ZZP B;  5C2T B;  1YN5 A;  3HUI A;  5FR6 A;  4KGS A;  3ZVV A;  4IKG A;  3U8Z A;  2L1A A;  4RMA A;  1AW7 A;  2QHO A;  3DPD A;  1IYF A;  2QJL A;  3W1Y A;  1WXS A;  3DBR B;  2LXC A;  2LGX A;  4B0E A;  4RF0 A;  1P7F A;  1UBI A;  3TEX A;  1EWY C;  5D2M B;  4B95 A;  2J0K A;  4B0M A;  2GBR A;  2RDG A;  4DDG D;  4JQW C;  2KQS A;  5JXV A;  4X57 B;  4JLC A;  2NPT A;  1G6J A;  2KYW A;  3DHH C;  3DHG C;  5J2R A;  1LQB A;  2LGD A;  1UF0 A;  3R2T A;  2KQ7 A;  3VUW A;  3TL5 A;  3BVZ A;  1HE8 A;  3RFZ B;  1V97 A;  3WCQ A;  2ZW0 A;  4NAW B;  3M63 B;  3I9V 1;  5H8Y E;  4WJO A;  2W54 A;  1FPY A;  2BWE S;  4WWO A;  4TUU A;  4M00 A;  4RM9 A;  4FLH A;  1MHH E;  4I6L B;  2IGD A;  2JXT A;  3NY5 A;  3EA6 A;  4BBN C;  4BKG A;  2D11 A;  3W5U B;  2DEN B;  3ZNH B;  4YTN B;  1NBF C;  2KJH B;  1WRD B;  1YX6 B;  3Q6B A;  2MA9 B;  4C00 A;  1WE6 A;  1NEK B;  3PTF C;  4LDT B;  3UI3 A;  1U4A A;  2J42 A;  4J6I A;  3KYC D;  4BVU C;  3AE2 B;  3PO0 A;  5IOI A;  2N7D A;  2NR2 A;  3V62 A;  3ZQ4 A;  4XYC A;  1C4A A;  4J3O D;  2AX5 A;  1I4R A;  2WXI A;  2VRR B;  1JWB D;  3E9S A;  3IAM 1;  3QJZ A;  2KLC A;  4MJS A;  1OQR A;  4A6Q A;  2PE6 B;  3LJ3 A;  1WJN A;  3RUI B;  2XEW A;  3URY A;  4MSQ B;  1VZ7 A;  2K8C A;  1SEB D;  2BVC A;  1WFY A;  2BBC A;  3VRA B;  2JQR B;  3JSV A;  5G5G A;  1S3S G;  3LDZ E;  4S0R A;  1OFF A;  4BFR A;  2KFK A;  3U2S C;  3QA8 A;  3KUZ A;  1F1H A;  1L4D B;  3HHM A;  4CQN A;  3ABV B;  3KWL A;  3RNA C;  3ZTC A;  4XGA B;  3NVV A;  5BYR A;  4XWT A;  1QOA A;  4A20 A;  1WGG A;  1WH3 A;  5HHD G;  2G1E A;  2NPT B;  2WYQ A;  4IWO A;  4KIK A;  1WX8 A;  1UD7 A;  2RD0 A;  3HRD D;  2I1J A;  2J7Q B;  3ZW3 A;  4ANU A;  2BS3 B;  4KVG B;  3QHT A;  1FM0 D;  3RMK C;  1YN4 A;  1YQ4 B;  4DHJ D;  3NUH B;  3TUO A;  1FXT B;  2QEJ C;  3MFG A;  2G45 B;  3GS2 A;  4HPL B;  2J52 A;  5DPT A;  5IO9 A;  1XLN A;  3LB8 C;  5HI1 A;  3A4R A;  4ACF A;  3SR6 A;  5L95 C;  5GXG B;  3Q8C A;  1YIW A;  1IGC A;  1WR6 E;  2KTR B;  1KF6 B;  1MG4 A;  4K1R B;  3VR9 B;  1GPX A;  1TT5 B;  1ZPS A;  2V3P A;  2VZK D;  2ZVO A;  2RDH A;  2KFJ A;  5IN7 A;  4ARC A;  1SB3 C;  3P4R B;  2KDI A;  2WQY B;  2E3T A;  2JY6 A;  2W3R A;  3SU8 X;  3FC4 A;  1OEY A;  1QOF A;  5EE1 A;  2WX1 A;  3ZJV A;  2FCN A;  4MEM A;  4CHK A;  4LNF A;  2CR5 A;  1OQQ A;  3EFC A;  4O1N A;  2WXQ A;  4GDL A;  3TSS A;  2DYM A;  4NNJ B;  1FXA A;  1E7U A;  3IFW B;  4L1B A;  2CHX A;  4IC7 B;  4GU2 A;  1OQY A;  1T5X D;  3Q8B A;  2MJD A;  1PQS A;  4W9D A;  5DCN A;  2ASQ A;  4C7Y A;  3HIZ A;  3AEC B;  5C23 A;  4OZB A;  4KSK C;  4JL9 A;  1B1Z A;  3ZKJ C;  1C4P A;  3RN9 C;  1I35 A;  3JSV B;  4RGN A;  2ZNV B;  2MW5 A;  1V86 A;  1WMH A;  2FUH B;  2RMM A;  2KAC A;  1TKE A;  2WDV B;  5EE0 A;  4EZL A;  1NEN B;  1E7P B;  3ONS A;  3RNC C;  4NQK E;  2WU5 B;  4WJP A;  4MM3 A;  3JYU A;  1L5P A;  3PVL A;  2K6Q A;  3C19 A;  3TIX A;  3ZNI D;  3WAN A;  1L4Z B;  4C56 C;  3R2I A;  2QMT A;  2SEB D;  3SDL C;  3I3T B;  4M02 A;  3AMZ A;  2D2Q A;  1A70 A;  4EKU A;  2LVQ A;  4W9I A;  3V6E B;  3AE7 B;  3L13 A;  1HA5 A;  4BKS A;  3EUB 2;  1E8W A;  2KDE B;  4PYU A;  4DHZ E;  3AE4 B;  5AEK B;  1D5Z C;  4AOF A;  3ZNZ B;  5IA7 A;  1TY2 A;  4DWF A;  1K53 A;  1TBE A;  3NVY A;  2KVZ A;  2K9X A;  1YJI A;  2GBN A;  3KW5 B;  2I2Y A;  2UWQ A;  4BAX A;  2WXJ A;  1YJ1 A;  1C79 A;  1E0Z A;  1WIA A;  4C7Z A;  1EU4 A;  2BGF A;  4DDI D;  5DPS A;  4GDK A;  4LNN A;  1L0Y B;  2IND C;  1WSP A;  3H8H A;  2LMC A;  4N59 A;  2K39 A;  3U7D A;  2MBQ A;  1TIF A;  1GOZ A;  2WWZ A;  2DAJ A;  3OWE B;  5T8I A;  4P6V F;  1VDV A;  2JU6 X;  3OJ3 A;  4RGM A;  1WR1 A;  1WYW B;  3T8M A;  3MC8 A;  4M0W B;  2QCZ A;  3AN1 A;  2G9H D;  2WLB A;  1I4G A;  4WQM A;  2KNB A;  3J9C A;  1IPG A;  3UIN B;  4N58 A;  3HK0 A;  3VTW A;  1EM7 A;  1UWX A;  2QIL A;  1LFD A;  3DWM A;  4RNA A;  3UQA A;  2VH1 A;  2EMT A;  3WIM A;  1SJH D;  3ETR A;  2TSS A;  1D5M C;  3PRE A;  3PGE A;  2JSV X;  5D6J B;  1WMH B;  3VHT C;  3KYD D;  1P3Q U;  2K1F A;  1QKZ A;  1T0R C;  1WY8 A;  1UH6 A;  4PT5 A;  1B9R A;  4IM2 A;  2G4D B;  2DLB A;  2V9H A;  3APD A;  4M8M A;  3DVG X;  1YMH E;  1E90 A;  2BS4 B;  2BYE A;  3PT2 B;  2FID A;  1I7H A;  1WJ4 A;  5BYS A;  1ZDV A;  4YWG G;  2FCS A;  2IY0 B;  1YJJ A;  2LUM A;  2W9N A;  2EKI A;  2PLP A;  3SHQ A;  1V1O A;  3N3K B;  2L7R A;  2WDR B;  1XF5 L;  4M01 A;  3TCA A;  4P1C C;  4HPP A;  1N5X A;  3MJW A;  1V6E A;  2GBM A;  3TMP B;  3QAQ A;  3TBL D;  3BVM A;  4NAW A;  2AYO B;  4FAD A;  1GJZ A;  1CMX B;  3U52 E;  2SAK A;  5DPR A;  2BF8 B;  3HVZ A;  1WYG A;  3QCA A;  2L32 A;  2OJW A;  1V81 A;  2BS2 B;  1C78 A;  3ZO5 B;  2B3A A;  2JYT A;  1SE3 A;  1WGH A;  4GDK B;  2DZK A;  3PSE B;  5BMG A;  2NTT A;  1K50 A;  1N61 A;  3ML9 A;  4ZRI A;  1NI3 A;  2N1V A;  3HVD A;  4JPS A;  2RGF A;  2Z0E B;  4HK2 A;  1F9J A;  1JRP A;  3TJP A;  4TSS A;  5G2N A;  2MBE A;  4JE3 B;  3AE1 B;  3V61 A;  2WDQ B;  2DNF A;  4LCD E;  2ONQ A;  3P2B A;  4XDC A;  1RYJ A;  4HDQ A;  1RWS A;  3VVW B;  3R8B A;  4ZRJ A;  2BKR B;  3A1Q B;  4N6E B;  2MBB B;  1I42 A;  3AV8 A;  3RNB C;  4ANX A;  1J8C A;  2MSE D;  4RF1 A;  4F7Z A;  1ENF A;  2JZZ A;  1IP9 A;  3NS8 A;  2GBK A;  4YSY B;  4G50 A;  5E6J A;  3P4P B;  2H89 B;  1J0G A;  2FCM A;  4KKI A;  1LGR A;  3SFE B;  2M19 A;  1C4C A;  3GB1 A;  1Y56 A;  4HWI B;  3ZRF A;  1FNV A;  3ZDT A;  2G4S A;  1CK1 A;  2KQ4 X;  4HKZ E;  3BWU D;  3UIP B;  1F2R I;  2WGS A;  2INN E;  2Y5P A;  2WXP A;  4W9L A;  1PYW D;  2J0J A;  3Q3J A;  1DOX A;  1HZ6 A;  4ASW C;  5H92 C;  2W55 A;  3DDC B;  3RUL A;  1ET9 A;  3RNF C;  1GB4 A;  4E71 A;  4I6N B;  4AUQ C;  1DOI A;  1P1A A;  1A5R A;  2MJE A;  2JUO A;  5LXI B;  5IKC M;  3NRZ A;  4C80 A;  2ZCB A;  2HTM E;  1GNU A;  3FIL B;  3L54 A;  3VUX A;  1KOT A;  5JZE B;  4F8C B;  1KRH A;  5KHO A;  1UUP A;  2N7J A;  1WZ3 A;  2ZJD A;  1J19 A;  1TY0 A;  2LHD A;  5E6P A;  2LUE A;  4GMV A;  4TKN A;  2KTR A;  3EC8 A;  2PPH A;  3KWV A;  3OLM D;  1PGA A;  1KJT A;  1GB1 A;  2N9X A;  4K81 A;  4BKT A;  5TR5 A;  2MBO A;  3BK1 A;  3DVN U;  4YXD B;  3IT6 B;  3A4S C;  3NZS A;  3E56 A;  1C1Y B;  3JW0 X;  4MGZ E;  2GMI C;  4P16 A;  2HE7 A;  2FBW B;  3LXF A;  1D6E C;  3PLV A;  3QWZ B;  2N0S B;  1ISN A;  4K3C A;  2WP9 B;  3VXW A;  4REZ A;  2C7N B;  2KOX A;  2DZJ A;  2VZK B;  4LNO A;  1C77 A;  2KT7 A;  1TTN A;  2KJ6 A;  2IYD B;  2N7E A;  4XZ4 A;  4CYE A;  4LNK A;  2GLS A;  1JQ4 A;  4RM8 A;  2NBV B;  2ZNV C;  3AED B;  2O6V D;  2IPK D;  2JWZ A;  2MJ3 A;  1WM3 A;  4OVZ A;  1ZUD 2;  5BMI A;  3I63 C;  5E6O A;  2M8S A;  4HXD A;  2OHF A;  2KWU B;  3K9O B;  3QQ8 B;  2CJO A;  3O65 B;  2IBI B;  3AEG B;  1ZGU B;  3DVG Y;  2WX0 A;  1M94 A;  4GLS C;  4USA A;  5E6N A;  2GBJ A;  1WI0 A;  3ENE A;  4EZJ A;  1KM7 A;  3LYY A;  1UWM A;  3VAW A;  3UGB B;  3W1S A;  4A90 A;  2IGG A;  1FNW A;  2CS4 A;  1AYF A;  3GE8 C;  2KWD A;  2JVC A;  1JWA D;  2Q5W D;  4MAC A;  2MWS B;  3IG3 A;  2FAZ A;  3W5V B;  2YEP B;  1TYG B;  4R3D A;  1WF9 A;  2JT4 B;  4MDK E;  1SGH A;  2KD0 A;  2MEK A;  1MI0 A;  5C1Z A;  2W3S A;  4KKJ A;  3OG5 A;  4OZC A;  1M4V A;  1KLV A;  1E8X A;  2QSD A;  2DX5 B;  4DBG A;  1HQR D;  4WWN A;  5FR3 A;  2E6X A;  2AEH A;  4WAF A;  3Q8F A;  2Z0D B;  3SEB A;  3CIR B;  3WA0 A;  1T0S C;  4YSZ B;  1SF0 A;  4GXB A;  4IOI E;  2Z59 B;  2WXK A;  3VTV A;  4I6P A;  1WJ6 A;  3X0W A;  1WXV A;  5CHW A;  2PVG C;  4II3 B;  4ARI A;  4OVV A;  3WAP A;  4NZL B;  3BK2 A;  4GIV A;  3ZRC A;  5EE9 A;  3DWG C;  1Q0W B;  2L3Z A;  3IVF A;  2BT6 A;  4E3C A;  3AEF B;  5LNK 1;  1PGB A;  1UZX B;  5AUK A;  2K0P A;  3QAR A;  2LGI A;  2NCN A;  2XNA C;  4II2 B;  1E7V A;  5D7G A;  1YN3 A;  3N30 A;  2LVP A;  2WS3 B;  2WU2 B;  2B76 B;  3PRM B;  1FEH A;  1NDD A;  2KWV B;  4EZK A;  2IO3 B;  3RNE C;  2DAF A;  1XT9 B;  4M0W A;  2EMS A;  2GI9 A;  1PUT A;  2NBW B;  4LK0 M;  4A3O A;  5HG2 A;  2HJ1 A;  1RFA A;  4HJG E;  5JHB A;  4ZYN A;  2D10 A;  3ALB A;  5TSS A;  4PYZ A;  4MGI E;  4US9 A;  2HD5 B;  4FHJ A;  1BT0 A;  1SBB B;  2MP2 B;  1FFV A;  2I38 A;  3VQI A;  4BOZ B;  1Z5S B;  2KKC A;  1MPE A;  2JZ3 B;  4Q2J A;  4ZDV A;  1KLG D;  1LXD A;  2BKF A;  1L7Y A;  2DHZ A;  3PLU A;  1MJD A;  1NYQ A;  4PK1 A;  2C7H A;  2AQ3 B;  4IWQ A;  3QIJ A;  1H8C A;  4JGH B;  5JHA A;  1XD3 B;  3NVZ A;  1AAR A;  1L0V B;  2NVU I;  3NZU A;  3Q8E A;  1UBQ A;  3ZNG C;  1QOB A;  4EE2 A;  4HRS A;  4YTM B;  3EFU A;  1KFY B;  1YNT E;  4IWP A;  2IO1 B;  3P63 A;  4HDO A;  2AQ2 B;  1P0R A;  1HTO A;  1MVK A;  3B0A A;  4QAY A;  4YTP B;  3VDZ A;  2MBH A;  4MSM B;  3ZTD A;  1J7B A;  3AEB B;  1I4Q A;  1ZE3 D;  3X23 A;  3ZIM A;  1XQQ A;  2NBU A;  4NAM A;  3BII D;  5D3I B;  2G3Q B;  2DBY A;  2HTH A;  3Q69 A;  3GP7 A;  3VRB B;  4KX6 B;  4G3X B;  4TV3 A;  1FFU A;  4G0N B;  4RCO A;  1TS4 A;  2N9E B;  5G55 A;  2IY1 B;  4HVB A;  3MJ5 A;  3WAM A;  4KDI C;  1JML A;  3VH3 B;  3T3N A;  2N1W A;  2ZPN A;  3V3X A;  5DPW A;  2V4I B;  1WXA A;  2CHW A;  1TZO A;  2PE9 A;  2PVO D;  1XO3 A;  1T0Y A;  4L2Y A;  2ON8 A;  2WXF A;  3MC0 B;  2BYF A;  3DOW A;  3D32 A;  2IO2 B;  3AU5 A;  3UF8 A;  2KHW B;  1IBX A;  2C5L C;  4WAA A;  3AXC A;  4RGO S;  2JRI B;  3T9L A;  4PS8 A;  2INC C;  1D3Z A;  5JH5 C;  4LNI A;  1RM6 C;  2KLG A;  1V49 A;  2XK5 B;  3P4Q B;  4HCP B;  2BTE A;  4IG7 B;  2WXN A;  4EOY A;  2LJ5 A;  2N9L A;  3V05 A;  1QZE A;  3MC9 A;  2J4X A;  2NS5 A;  2RPQ A;  2WXH A;  2DWQ A;  3A1Q A;  2M0X A;  2NMQ A;  3DBL I;  3I5J C;  3RZF A;  1WGY A;  1QLB B;  1X1M A;  2IJ0 A;  4OW0 A;  2PMV A;  4DXA B;  3EEC A;  2Y3A A;  2JPH A;  3L4P A;  2C60 A;  3BYT B;  2EKE C;  3HM3 A;  2KMA A;  1SE9 A;  4JWU C;  2HDE A;  1CJE A;  4ANV A;  2M0A A;  1D4B A;  3DBH I;  3SD5 A;  3TEW A;  4FJY A;  3H9D A;  2OJR A;  2FUG 1;  1P9D U;  4PS3 A;  2R61 A;  1V1P B;  2X38 A;  2Y5B B;  4D2K A;  1JRO A;  3ZDM C;  2R2O A;  1TJE A;  1YQB A;  5GMV A;  3N1Y C;  3I57 A;  2ZW1 A;  4ZHP A;  1EUV B;  2V0G A;  1N5W A;  2LXA A;  3Q3M C;  2AL6 A;  2CJN A;  1BUI C;  3BYY B;  3AE9 B;  2IGH A;  3DBL B;  5FK9 C;  1E5W A;  1Q5W B;  1EO6 A;  2KN4 A;  1IUE A;  4W9C A;  4W9J A;  4A3P A;  3CSF A;  1H4R A;  3ZUN A;  3FIL A;  3B2F A;  3L08 A;  1N60 A;  2KX3 A;  3AM9 A;  3DBH B;  3NZ3 A;  4H2A A;  1MHX A;  4KDL B;  5CTR C;  4B9K A;  5IP4 D;  4TMA B;  2AQ1 B;  3APF A;  3IHP C;  5FKA C;  1GC7 A;  4KGR A;  4FA6 A;  1WGK A;  3H1U A;  4XWW A;  4UDU C;  4AJY B;  4FXC A;  3EHV A;  4ANW A;  2MCN B;  3Q3N C;  2FNJ B;  3M3J A;  3N1Z C;  1IBX B;  2YVC A;  4MT5 A;  2D3C A;  4YT0 B;  4W9E A;  2J0M A;  4WWP A;  3TEZ A;  2K22 A;  2L8J A;  1I4P A;  4FN2 A;  5MPO A;  5J18 A;  3RPF C;  2Y5C A;  4KZ0 A;  4IDI A;  1HXY D;  3WAL A;  2KAN A;  4W9H A;  1CQV A;  4C4V A;  3PS6 A;  4W9F A;  3NOB A;  4IUM B;  1TZ1 A;  2RDB C;  1E8Y A;  2BYT A;  4A9A A;  2A5U A;  4DQO C;  3WAO A;  2REX A;  1K51 A;  3P4S B;  2JF5 A;  4JWS C;  5AZH A;  3DBR I;  3VR8 B;  4B6W A;  1YX5 B;  4OZA A;  2KJR A;  2JYE A;  2BYV E;  2FE8 A;  1UGM A;  3ZGZ A;  2HJ8 A;  4K7W A;  1WZ0 A;  3AH7 A;  3R3M A;  2KX0 A;  3HM6 X;  4AJW A;  2KC2 A;  2JWU A;  3B2G A;  2UU7 A;  4FHK A;  1WWT A;  1NYR A;  3Q14 C;  3AE8 B;  3VTU A;  4HCN B;  1MFW A;  1GG3 A;  2PW9 A;  1VZ8 A;  1FCL A;  2LJI A;  2L0T A;  3KUC B;  3DHI C;  1BXT A;  1JCK B;  2KMM A;  2IZV B;  5CHF A;  3NVW A;  2K5P A;  2O6V B;  1WJU A;  3ZXV A;  1FMA D;  3KVF B;  2LHE A;  5C3J B;  2GRI A;  4WUR A;  4ICV A;  5LXH A;  1FCC C;  4HEA 1;  3M62 B;  4HKQ A;  1EF5 A;  4MH0 E;  1HTQ A;  4GGQ A;  4NJC A;  4ZRK A;  3VH4 B;  4A55 A;  3IT4 B;  1KTK A;  2BQQ A;  4KGT A;  4HJK A;  3Q3O C;  2ICI A;  3H7S A;  4GOC A;  3ZYY X;  2C7M B;  3VUY A;  2O2V A;  1V2Y A;  1FRR A;  2WXG A;  2DYB A;  2CKH B;  1WX9 A;  4US8 A;  3KH0 A;  2LRW A;  3L16 A;  4AQ7 A;  3BIN A;  3FAH A;  1WE7 A;  2XBB C;  4URK A;  3CF6 E;  3NHE B;  4L23 A;  4JX1 C;  1SJE D;  4DHJ B;  1VZ6 A;  1SXT A;  2LFI A;  3PRP B;  2IO0 B;  1FNU A;  3A9K A;  1HEZ E;  1RLF A;  3KQ4 A;  3DVN V;  1ACC A;  4K3B A;  2QDF A;  4C4V B;  1T0Q C;  3AB5 A;  3B08 A;  2CHZ A;  3QC8 B;  3ZLZ A;  5D3D A;  4WWM A;  2L05 A;  1F52 A;  5I4D A;  1C76 A;  1T3Q A;  4LTU A;  2JRH A;  1VD2 A;  1ZXI A;  4NJ7 A;  1GAQ B;  2A4Z A;  5AZG A;  1TS2 A; 
#chains in the Genus database with same CATH homology
 4MGK E;  4M0W B;  1XT9 B;  4MEL A;  2EMS A;  2DYO A;  2NBW B;  2KDF B;  4A3O A;  2GOW A;  2KNB A;  2N4F A;  1IPG A;  1RFA A;  3UIN B;  2R2Q A;  5JHB A;  4ZYN A;  2MRP A;  2D10 A;  3ALB A;  3HK0 A;  3VTW A;  3W1S C;  3A9J B;  4PYZ A;  4FJV B;  5D94 A;  1LFD A;  4MGI E;  3PRZ A;  2OOB B;  3JVZ X;  4M8N A;  1WGD A;  2HD5 B;  3UQA A;  4FHJ A;  1BT0 A;  2EMT A;  2JXX A;  2MP2 B;  1RAX A;  4KSL C;  2MP2 A;  3VQI A;  3WIM A;  2D3G A;  1Z5S B;  2KKC A;  4BOZ B;  2JZ3 B;  4ZDV A;  3PRE A;  3PGE A;  4PS7 A;  1LXD A;  2BKF A;  1E8Z A;  5D6J B;  1L7Y A;  1WMH B;  2KDB A;  2DHZ A;  3VHT C;  2LAS A;  3PLU A;  5CX3 A;  3KYD D;  3IBE A;  1P3Q U;  3BY4 B;  1RRB A;  2K1F A;  3S2A A;  4BKS D;  1WY8 A;  2C7H A;  3AUL A;  3L0W B;  1UH6 A;  2ZZP B;  3QIJ A;  4IWQ A;  1H8C A;  2FIF A;  1V5T A;  4JGH B;  5JHA A;  1XD3 B;  4IM2 A;  1AAR A;  2G4D B;  2K25 A;  2NVU I;  3NZU A;  5FR6 A;  4CO7 A;  3APD A;  3ZVV A;  5HKH A;  1UBQ A;  3ZNG C;  4M8M A;  3DVG X;  3U8Z A;  1MG8 A;  1OGW A;  1E90 A;  3V60 A;  2BYE A;  2QHO A;  3DPD A;  2FID A;  3EFU A;  3PT2 B;  4RMA A;  1IYF A;  4IWP A;  4EUT A;  3W1Y A;  1WJ4 A;  1WXS A;  2IO1 B;  2LXC A;  2LGX A;  4HDO A;  2FCS A;  1P0R A;  2IY0 B;  4KZC A;  3B0A A;  3RT3 B;  1UBI A;  3VDZ A;  2MBH A;  2W9N A;  5D2M B;  3PV1 A;  4MSM B;  3Q3F A;  4G11 A;  3ZTD A;  4EFO A;  2DZM A;  4B95 A;  2J0K A;  3APC A;  3SHQ A;  4DDG D;  2GBR A;  4JQW C;  4ICU A;  4FUL A;  2KQS A;  4X57 B;  3N3K B;  1NI2 A;  3X23 A;  2L7R A;  1XQQ A;  2NBU A;  2NPT A;  4JLC A;  3ZIM A;  1G6J A;  2G3Q B;  4JIO U;  3PZD A;  3TCA A;  2MQJ A;  5J2R A;  1LQB A;  2HTH A;  2LGD A;  2KQ7 A;  3VUW A;  3TL5 A;  3MJW A;  2V1Y A;  1V6E A;  1HE8 A;  2GBM A;  3AI5 A;  4G3X B;  4TV3 A;  4G0N B;  3TMP B;  2N9E B;  5G55 A;  3QAQ A;  3PPA A;  4NAW B;  3TBL D;  2IY1 B;  3M63 B;  2O2V B;  4HVB A;  4NAW A;  3WAM A;  3PHX B;  4KDI C;  2AYO B;  4FAD A;  2BWF A;  4GN1 A;  3VH3 B;  1GJZ A;  1CMX B;  2I1K A;  4LDT D;  1V9J A;  2N1W A;  4WJO A;  5DPR A;  2BF8 B;  2ZPN A;  5DPW A;  2BWE S;  3QCA A;  4NQL B;  2KC1 A;  3C0R B;  1WXA A;  2CHW A;  4WWO A;  2PE9 A;  2LD9 A;  3GZN I;  4TUU A;  1V81 A;  4IM0 A;  4RM9 A;  4FLH A;  4FBJ B;  1T0Y A;  3ZO5 B;  4I6L B;  3RYT A;  5EDS A;  2B3A A;  2KXJ A;  2BYF A;  1Y8R C;  3DOW A;  3NY5 A;  1EF1 A;  3A9K B;  2MX2 A;  1WGH A;  3D32 A;  4GDK B;  4LJP B;  4BBN C;  2DZK A;  2IO2 B;  3AU5 A;  2N9P C;  3UF8 A;  1WXM A;  4BKG A;  2KHW B;  3PSE B;  3MHS D;  2KO3 A;  2D11 A;  2C5L C;  1R4M I;  4ZRI A;  3ML9 A;  4WAA A;  3AXC A;  2DEN B;  2N1V A;  2JRI B;  3T9L A;  4PS8 A;  2LWP A;  3ZNH B;  2RGF A;  1D3Z A;  1NBF C;  2Z0E B;  4HK2 A;  5JH5 C;  1F9J A;  2KJH B;  1WRD B;  3TJP A;  1YX6 B;  1WGR A;  5G2N A;  2KLG A;  2MBE A;  1V49 A;  2UYZ B;  2MA9 B;  2XK5 B;  1WE6 A;  3V61 A;  2XK5 A;  5CHV C;  4HCP B;  3U30 A;  3PTF C;  4LDT B;  4LCD E;  1U4A A;  4J6I A;  4HLE A;  3KYC D;  3P2B A;  4KV2 A;  3H6N A;  4IG7 B;  4EOY A;  2LJ5 A;  3VVW B;  4HDQ A;  1QZE A;  4BVU C;  2KMC A;  2NS5 A;  2RPQ A;  4ZRJ A;  2BKR B;  4MGY E;  4EEW A;  5BO4 B;  3A1Q B;  3A1Q A;  2M0X A;  1TGZ B;  2MBB B;  2N7D A;  2NR2 A;  1I42 A;  2PJH A;  3DQV A;  4N9F 4;  3DBL I;  3V62 A;  4ANX A;  3RZF A;  5J17 A;  2V4L A;  1WGY A;  5AZG A;  1J8C A;  2MSE D;  3DBS A;  4F7Z A;  1X1M A;  3KUD B;  2JZZ A;  2PEA A;  2VRR B;  3QJZ A;  4DXA B;  1IP9 A;  3EEC A;  2GBK A;  3NS8 A;  2KLC A;  4MJS B;  4G50 A;  4MJS A;  2JPH A;  2K8B A;  1J0G A;  2FCM A;  2C60 A;  2PE6 B;  1WJN A;  3LJ3 A;  2EKE C;  2XEW A;  3HM3 A;  4HWI B;  2YLM A;  3RUI B;  2KMA A;  2AWT A;  1SE9 A;  4GSW A;  3ZRF A;  2RR9 A;  4MSQ B;  4ANV A;  3QK0 A;  3ZDT A;  3DBH I;  4P7I A;  4WQO B;  3SD5 A;  2G4S A;  4WJN A;  2K8C A;  4FJY A;  3H9D A;  1WFY A;  2OJR A;  2KTF A;  1P9D U;  5AZF A;  3UIP B;  4PS3 A;  3L17 A;  3JSV A;  3OJ4 B;  2Y5B B;  2ZVN A;  1ZW7 A;  1S3S G;  3B1L X;  3LDZ E;  4W9L A;  2KFK B;  2J0J A;  2LZ6 A;  3Q3J A;  3ZDM C;  2R2O A;  2KFK A;  4BFR A;  4ASW C;  2V3S A;  1YQB A;  3QA8 A;  5GMV A;  3DDC B;  3KUZ A;  3RUL A;  3MTN B;  3OAW A;  3HHM A;  1K8R B;  1EUV B;  3ZTC A;  2KN5 A;  2LXA A;  3L10 B;  4HPM B;  4E71 A;  4I6N B;  3A33 B;  2AL6 A;  2WDT B;  4AUQ C;  1P1A A;  4A20 A;  4W9K A;  1A5R A;  2JUO A;  1E5W A;  1Q5W B;  1WH3 A;  1WGG A;  1EO6 A;  2NPT B;  5LXI B;  4KIK B;  4W9C A;  2WYQ A;  4IWO A;  4KIK A;  1WX8 A;  4W9J A;  1UD7 A;  2ZCB A;  4A3P A;  2RD0 A;  3CSF A;  3N32 A;  3QX1 A;  1H4R A;  4W9G A;  1GNU A;  3L54 A;  3ZUN A;  4AWJ A;  1LM8 B;  2I1J A;  2J7Q B;  3VUX A;  1KOT A;  2K6D B;  3ZW3 A;  4ANU A;  4TQ1 A;  3V6C B;  5JZE B;  4KVG B;  3QHT A;  3L08 A;  4F8C B;  5IAA C;  5KHO A;  4DHJ D;  1FXT B;  2KX3 A;  2DZI A;  2G45 B;  4HPL B;  2RSU A;  2C9W B;  5DPT A;  1WZ3 A;  3H7P A;  2ZJD A;  4KDL B;  1J19 A;  2L0F A;  3A4R A;  5CTR C;  4B9K A;  5L95 C;  3APF A;  5E6P A;  2LUE A;  4GMV A;  1YIW A;  3IHP C;  1WR6 E;  2KTR B;  1GC7 A;  4TKN A;  4FA6 A;  2KTR A;  3PHW B;  3H1U A;  3ECI A;  4K1R B;  3CMM B;  3EC8 A;  2LGY A;  4AJY B;  3EHV A;  4ANW A;  2PPH A;  3OLM D;  2MCN B;  4IM3 A;  2ZVO A;  2FNJ B;  3M3J A;  4XC2 A;  3K9P B;  2YVC A;  1YD8 U;  1KJT A;  2KFJ A;  1WM2 A;  2LVO A;  2N9X A;  4K81 A;  4W9E A;  2J0M A;  4LJO B;  4WWP A;  4NY0 A;  3R66 C;  2KDI A;  4BKT A;  5TR5 A;  2MBO A;  3DVN U;  4TQ0 A;  2L8J A;  4FN2 A;  4OVU A;  5J18 A;  2JY6 A;  3A4S C;  3NZS A;  3SU8 X;  1C1Y B;  3JW0 X;  1OEY A;  4KZ0 A;  2ZCC A;  4MGZ E;  2GMI C;  2WX1 A;  2KAN A;  2HE7 A;  3WAL A;  5L83 A;  4W9H A;  4NPN A;  3PLV A;  2FCQ A;  2FCN A;  3QWZ B;  3CST A;  1OTR B;  3PS6 A;  3M95 A;  4MEM A;  4W9F A;  4CHK A;  2CR5 A;  1ISN A;  3NOB A;  4GDL B;  4IUM B;  1TZ1 A;  4GDL A;  4GB9 A;  3VXW A;  2DYM A;  2LRU A;  4NNJ B;  2C7N B;  1E8Y A;  2ZPY A;  4DHZ B;  2A5U A;  3WAO A;  2KOX A;  2REX A;  1E7U A;  3IFW B;  2JF5 A;  2DZJ A;  5AZH A;  3DBR I;  2CHX A;  4B6W A;  1YX5 B;  4IC7 B;  1TTN A;  4GU2 A;  1OQY A;  2KJ6 A;  1PQS A;  2IYD B;  2N7E A;  4XZ4 A;  3UIO B;  2KJR A;  4K7U A;  4CYE A;  1JRU A;  4W9D A;  5DCN A;  2ASQ A;  4RM8 A;  2NBV B;  2BYV E;  2ZNV C;  1UGM A;  3HIZ A;  3RCZ A;  5C23 A;  1UEL A;  2O6V D;  1S1Q B;  2HJ8 A;  4JL9 A;  1P98 A;  4K7W A;  4KSK C;  1WZ0 A;  2JWZ A;  3R3M A;  3ZKJ C;  3A9J A;  1WM3 A;  1GC6 A;  2AL3 A;  2M17 A;  1I35 A;  2KX0 A;  3JSV B;  3HM6 X;  4AJW A;  2KC2 A;  3R7Q A;  5E6O A;  2M8S A;  4HXD A;  2KWU B;  3K9O B;  4FHK A;  3QQ8 B;  1VCB A;  3RZW C;  3O65 B;  2IBI B;  2ZNV B;  1ZGU B;  2MW5 A;  1V86 A;  2L00 B;  3DVG Y;  2WX0 A;  1M94 A;  5E6N A;  1WMH A;  2GBJ A;  1WI0 A;  3ENE A;  4EZJ A;  1KM7 A;  2FUH B;  3VTU A;  3VAW A;  4HCN B;  3UGB B;  1L2N A;  1R4N I;  3W1S A;  2CS4 A;  4EZL A;  4F1S A;  1GG3 A;  2L76 A;  3ONS A;  2KK8 A;  2JVC A;  2ZEQ A;  4FJZ A;  2L0T A;  4NQK E;  3KUC B;  4WJP A;  4MM3 A;  2MWS B;  3ML8 A;  5LLI A;  3IG3 A;  2FAZ A;  2IZV B;  3JYU A;  3PVL A;  4WJQ A;  2K6Q A;  5CHF A;  2O6V B;  1WX7 A;  1WF9 A;  1WJU A;  2JT4 B;  2O6V A;  3DCG A;  3TIX A;  4MDK E;  1SGH A;  3ZNI D;  1SIF A;  2MLB A;  3KVF B;  2KD0 A;  4NJ6 A;  4IW0 A;  4ICV A;  3WAN A;  5C1Z A;  5LXH A;  3M62 B;  1OEY J;  1EF5 A;  4MH0 E;  4E74 A;  3SDL C;  4GGQ A;  1KLV A;  1E8X A;  2KVR A;  3GOE A;  3I3T B;  1C3T A;  3H7P B;  2DX5 B;  4DBG A;  4ZRK A;  3VH4 B;  2D2Q A;  2K8H A;  4WWN A;  2M1M A;  3RD2 A;  4EKU A;  2LVQ A;  2LI5 A;  4W9I A;  3V6E B;  1V5O A;  2AEH A;  3L13 A;  4BKS A;  2Z0D B;  4HJK A;  3VFK A;  3WA0 A;  1E8W A;  4K7S A;  2KDE B;  4BBN F;  4PYU A;  3H7S A;  4GXB A;  4DHZ E;  4GOC A;  2Z59 B;  2C7M B;  3VTV A;  4I6P A;  5AEK B;  3VUY A;  2M4N A;  2O2V A;  4AOF A;  1WJ6 A;  1V2Y A;  3ZNZ B;  5IA7 A;  3X0W A;  1WXV A;  4DWF A;  5CHW A;  2DYB A;  2CKH B;  1TBE A;  1WX9 A;  4II3 B;  4BOS C;  3KH0 A;  4OVV A;  2LRW A;  3L16 A;  3WAP A;  3BIN A;  1WE7 A;  2GBN A;  3KW5 B;  2XBB C;  4URK A;  2UWQ A;  3CF6 E;  3NHE B;  1V80 A;  4DHJ B;  4GIV A;  1YJ1 A;  2CU1 A;  3ZRC A;  5KHQ A;  3AU4 A;  1WIA A;  3PRP B;  2IO0 B;  1Q0W B;  2BGF A;  3R7R A;  2KWC A;  3A9K A;  2L3Z A;  3IVF A;  4DDI D;  4E3C A;  1RLF A;  5DPS A;  4GDK A;  4XX5 A;  3DVN V;  1UZX B;  1Q1O A;  2K39 A;  1Z2M A;  3U7D A;  3QAR A;  2MBQ A;  3B08 A;  2CHZ A;  3QC8 B;  2NCN A;  5D7G A;  4II2 B;  1E7V A;  2WWZ A;  3ZLZ A;  4DK5 A;  3N30 A;  2BPS A;  3UQB A;  2LVP A;  2DAJ A;  1ZKH A;  2L05 A;  2D07 B;  4AP4 C;  4YL8 A;  3OJ3 A;  3PRM B;  1NDD A;  1WR1 A;  2JRH A;  2KWV B;  1VD2 A;  2KZR A;  4EZK A;  2IO3 B;  4NJ7 A;  2A4Z A;  1WYW B;  3T8M A;  2DAF A;  1GUA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...