3W1YA

Crystal structure of t brucei atg8.2 in complex with e coli s10
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
120
Chain Sequence
b'HYRYQYTRSFAERAKETESARLRYPKHIPILCEPTSVRLFSTRQQVQRELDCNKFLLPETATVMEFMMALRQRLLLEEGQAVFVFIGNELPPNSACLGDIYARAKDPDGFLYVSYGVENT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated protein 1A/1B, light chain 3
publication title Crystal structure of T brucei ATG8.2
rcsb
source organism Trypanosoma brucei brucei
molecule tags Transport protein/ribosomal protein
total genus 35
structure length 120
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3w1yA00
3NHEB 4NQLB 4EKUA 4NAWA 4NJ6A 3VTVA 2JRHA 2K25A 3AI5A 3JSVA 3MTNB 1WGGA 3W1SA 2KFJA 2BWFA 1EO6A 3PRMB 1WJ4A 1WM3A 1WXAA 4NNJB 2BYFA 1OGWA 2G3QB 2DAFA 2LI5A 5JHAA 5D2MB 4BOZB 3N30A 1E8ZA 4GDKB 3JVZX 3ZTDA 3MHSD 4K7SA 2ZJDA 2ZVNA 3M95A 3VTWA 1P0RA 3ZNGC 1V9JA 3QJZA 1SE9A 2PE9A 1P9DU 2NCNA 2DZIA 1L7YA 4W9FA 4PS7A 1L2NA 2GBRA 3VUXA 1E8YA 5HKHA 4GGQA 4JIOU 2DZMA 4G3XB 4GSWA 2ZPNA 2FCNA 2MLBA 1EF5A 3OJ3A 4FULA 3IHPC 5AZGA 4FADA 2K39A 2KQSA 1G6JA 2FUHB 4ZYNA 3VHTC 1I42A 2O6VB 1KOTA 2CHXA 2G4DB 2LGDA 3EC8A 3DBSA 1Q0WB 1KLVA 2ZVOA 1WJNA 4J6IA 3K9OB 2N4FA 2GOWA 3L16A 3DVNU 4IWPA 3U8ZA 2ZEQA 1J8CA 2IYDB 1J0GA 4MSQB 4MELA 1CMXB 2KMAA 3PGEA 3L13A 4PYZA 3VAWA 4EUTA 1HE8A 4HLEA 1Q1OA 3HHMA 4LDTB 1WFYA 3QWZB 5J17A 2GBNA 4BKSD 2DAJA 2NBWB 1WXVA 2N9EB 2A4ZA 3A1QA 1RAXA 3WAOA 3IBEA 2DYBA 2AYOB 3APFA 2ZCCA 2KWVB 1TBEA 2V1YA 2ZNVC 2L8JA 3UGBB 2O2VA 3A33B 2D2QA 4MSMB 3VTUA 4TQ1A 3KYDD 2M1MA 2FNJB 3UIOB 3ZDTA 2KN5A 3A9JA 1Z2MA 3QA8A 2KKCA 3OLMD 2KTFA 4HPLB 4KVGB 5D6JB 5D94A 2L0FA 2KLCA 1P3QU 1WZ3A 2IO1B 1E8WA 3JW0X 3L17A 5G2NA 2DZKA 4A3OA 1IYFA 5CHVC 3DBHI 4MJSA 4MGKE 4BKSA 3ZKJC 2WWZA 2KJHB 1KJTA 3IVFA 4EZLA 2KHWB 5TR5A 1OQYA 4HDOA 4LCDE 1D3ZA 2LRWA 1X1MA 2LZ6A 3X0WA 3NZUA 4KSLC 2FAZA 4HVBA 5KHOA 5DPSA 4OVUA 2LXAA 5DPTA 3AULA 2CR5A 3VUWA 5LXHA 4WJQA 4HCPB 4ZDVA 3DCGA 2L05A 3PSEB 1Y8RC 2KXJA 3NOBA 3PTFC 3L0WB 2RGFA 4W9IA 2LGYA 2IZVB 2O6VA 1A5RA 2LUEA 2MRPA 3H6NA 1WRDB 2HD5B 4CYEA 1E90A 2K8HA 1WIAA 2KNBA 1WF9A 2AWTA 1LQBA 2MQJA 1WI0A 3L54A 2JPHA 4B95A 2C9WB 2KD0A 2Z0EB 3C0RB 3R7RA 2R2QA 4KV2A 4GDLB 2RR9A 4JL9A 4DWFA 2MP2A 1WMHB 3L10B 5AZHA 3I3TB 2W9NA 3H9DA 2LJ5A 3WA0A 2XK5B 3AXCA 3RUIB 2KTRB 2VRRB 3N3KB 1F9JA 2YLMA 4TQ0A 5C1ZA 1R4NI 4LJPB 4FJVB 4WWPA 2PE6B 4EZJA 2V3SA 3PRZA 4PYUA 5CX3A 2G45B 4RMAA 2KLGA 4WQOB 4K7WA 2KWCA 2D07B 2PEAA 3ZDMC 1V80A 2PPHA 2WDTB 2QHOA 1NDDA 3ECIA 4WJNA 5J2RA 4A20A 3KW5B 5GMVA 2BKFA 3APCA 2KOXA 5JH5C 2LXCA 4ASWC 1MG8A 3VVWB 4ANUA 2IO0B 2JF5A 1LXDA 2LASA 1H4RA 4EOYA 1RRBA 3PLVA 2BGFA 2CHZA 2IBIB 3ZIMA 3LJ3A 1GUAB 1WGHA 1M94A 5LLIA 3PVLA 2Z0DB 2N7DA 1AARA 4IG7B 2LRUA 2HE7A 3PHXB 3DVGX 4M8MA 2UWQA 3UQAA 1WX8A 1SIFA 1OEYA 3EHVA 3ZRCA 2DZJA 3N32A 4WWOA 4IWQA 4JLCA 2KFKA 4MM3A 5C23A 4BBNF 2NS5A 1E8XA 2N1VA 1JRUA 2HJ8A 4AWJA 2L00B 4PS3A 4MH0E 5DPRA 4HCNB 3TL5A 4B9KA 5L83A 1P98A 2LD9A 1WE6A 2FCSA 3DQVA 1WM2A 2GBJA 2KZRA 5DCNA 2KX3A 2DX5B 3BY4B 3H1UA 1C3TA 1E7VA 4WJPA 4K7UA 3DOWA 3QHTA 1EF1A 4MGYE 3T8MA 1H8CA 3KVFB 2BPSA 3DDCB 4DHZB 1WY8A 3H7PB 3RD2A 3RULA 2OJRA 4W9CA 4ANVA 2JZZA 1WR1A 1LM8B 3QX1A 1S1QB 3L08A 2GBMA 1WE7A 4GXBA 4FN2A 2DHZA 1UELA 1V2YA 1K8RB 1ZW7A 4GDLA 4TKNA 4URKA 2CU1A 2C7NB 2JT4B 1GG3A 3AU5A 3KUDB 2KDEB 3EECA 4W9KA 4W9HA 3A9KA 3TBLD 4BKGA 4A3PA 3HK0A 4KIKB 2XK5A 3Q3FA 5DPWA 3WAMA 1WGRA 2KTRA 3PS6A 4ICVA 4G11A 3GOEA 3D32A 1FXTB 4AJWA 3R7QA 2ZCBA 2L7RA 4BOSC 1V86A 4MGZE 1WXSA 2KC1A 2NBVB 3M3JA 3T9LA 4HJKA 1E7UA 2D3GA 1ZGUB 2M17A 3SDLC 2MBHA 5IA7A 1IP9A 5CTRC 2O6VD 2C60A 3NY5A 3TJPA 4KDIC 2BWES 2HTHA 4TUUA 4F7ZA 2K8BA 1S3SG 3DVGY 2R2OA 3JSVB 3ZTCA 3VXWA 4DHJD 2UYZB 2CS4A 3WALA 2FCQA 2MA9B 4WJOA 4GDKA 2KK8A 3TIXA 2LVPA 1GNUA 2K1FA 3PREA 4LDTD 2K6DB 2IO2B 1ISNA 4PS8A 4W9JA 3ML8A 5E6PA 1YX5B 1R4MI 2G4SA 2C7HA 4II3B 2KVRA 3PT2B 2XBBC 1QZEA 4DDID 2I1JA 2J0MA 1V49A 3A4SC 2MBEA 3JYUA 4KDLB 4MDKE 4ZRKA 3WAPA 2D11A 1C1YB 1YD8U 4RM9A 4CHKA 4G50A 4AUQC 1WX9A 2OOBB 5FR6A 3U7DA 4IM3A 2MCNB 2C7MB 2D10A 3V60A 1Q5WB 4G0NB 1XT9B 4LJOB 4XC2A 3VH4B 1WH3A 2J0JA 2WYQA 1TZ1A 3ONSA 4NJ7A 2J0KA 1GC7A 1LFDA 3OJ4B 5IAAC 4W9GA 1V5TA 3HIZA 3BINA 4DXAB 5J18A 4ICUA 4W9DA 2NR2A 5JZEB 4NY0A 2KDBA 5E6NA 3DBRI 2DYOA 3RCZA 5L95C 2DYMA 3TMPB 4E71A 2AEHA 3R66C 2MBQA 4FJZA 4I6PA 2PJHA 4W9LA 2M8SA 2BYEA 2LVOA 3KYCD 4I6NB 3RZWC 4GMVA 2FIDA 3ZUNA 1YQBA 2KX0A 1WGDA 1OTRB 4KIKA 4FA6A 2KMCA 1UD7A 2O2VB 1NBFC 4BBNC 4M0WB 5JHBA 1IPGA 4FLHA 3M62B 4CO7A 1PQSA 2JZ3B 3GZNI 1YIWA 2N1WA 1WZ0A 2EMTA 3A9JB 5E6OA 3RZFA 4E3CA 1TTNA 3QK0A 2YVCA 3SHQA 1XD3B 3LDZE 3ALBA 4IW0A 2CHWA 2NBUA 1KM7A 1WXMA 3R3MA 3QIJA 5KHQA 4BFRA 1YX6B 1VCBA 4GIVA 4M8NA 4MJSB 4WWNA 4XX5A 3APDA 2JWZA 4KZ0A 5AZFA 4WAAA 1RLFA 2ZZPB 3DPDA 3SD5A 2MW5A 3ML9A 2K8CA 3KUZA 2CKHB 3PPAA 3DVNV 5G55A 3ZNID 2L76A 3W1SC 3CF6E 4GOCA 1BT0A 4EFOA 2RSUA 2JRIB 3UINB 4K81A 3QAQA 4FHJA 4NPNA 4TV3A 4BVUC 2BYVE 3PHWB 3QCAA 2N7EA 3WIMA 3H7SA 4DK5A 1RFAA 4IC7B 4FJYA 4JQWC 4OVVA 1UBIA 2IY1B 1VD2A 4ANWA 3K9PB 2MX2A 2N9XA 2KWUB 2REXA 5D7GA 1WMHA 4HPMB 2A5UA 2BF8B 4DHJB 2EKEC 4N9F4 1YJ1A 3NS8A 2AL6A 3QQ8B 4X57B 4K1RB 1SGHA 1GC6A 2LWPA 2MP2B 3CSFA 2JXXA 3ZNZB 4AJYB 3V6EB 3O65B 4NQKE 2NPTB 5BO4B 4EEWA 2C5LC 3VUYA 3RT3B 3WANA 5AEKB 3U30A 3CSTA 2MBOA 2KANA 1GJZA 3V61A 3VFKA 1V81A 3EFUA 4KZCA 2NVUI 3B1LX 4NAWB 4GB9A 2XEWA 3V6CB 4B6WA 4AP4C 2FIFA 2N9PC 2V4LA 4IUMB 4ZRIA 3ZLZA 1UBQA 1UZXB 4ZRJA 4EZKA 3MJWA 4F8CB 3RYTA 3ZNHB 2MBBB 3ZRFA 3P2BA 1UH6A 3UF8A 3NZSA 4JGHB 2IO3B 2Y5BB 3DBLI 1E5WA 3UQBA 2IY0B 2KO3A 2KJRA 2RD0A 4RM8A 4DDGD 4E74A 4ANXA 1V5OA 1P1AA 4IM0A 4HK2A 4DHZE 4II2B 1J19A 3UIPB 2I1KA 5EDSA 3SU8X 3A4RA 2KQ7A 2KDFB 2MSED 3PRPB 3HM6X 2KDIA 3B0AA 1NI2A 2KFKB 3M63B 3KH0A 5CHWA 1T0YA 1WJUA 4FHKA 3ENEA 2WX0A 2DENB 2J7QB 1U4AA 2EMSA 3QARA 1TGZB 4BKTA 4F1SA 2LGXA 4W9EA 1UGMA 3H7PA 3QC8B 4HWIB 4IM2A 3X23A 2KJ6A 2ZPYA 4HXDA 1XQQA 2ASQA 2JUOA 1I35A 1OEYJ 2LVQA 3AU4A 3VH3B 2ZNVB 2BKRB 4AOFA 3IFWB 4XZ4A 1WR6E 3CMMB 2AL3A 3IG3A 3KUCB 4GN1A 4HDQA 2Z59B 4IWOA 3B08A 2WX1A 5CHFA 3VQIA 4FBJB 2KC2A 3A1QB 1WX7A 1EUVB 5LXIB 4YL8A 4GU2A 2JY6A 2M4NA 2JVCA 3Q3JA 4KSKC 4DBGA 2B3AA 3VDZA 3ZO5B 1ZKHA 2L3ZA 3PZDA 3V62A 2MWSB 2NPTA 1WGYA 2RPQA 3A9KB 2FCMA 3PV1A 3W1YA 2K6QA 4P7IA 3ZVVA 2L0TA 3PLUA 2GMIC 3ZW3A 2GBKA 3OAWA 1V6EA 1Z5SB 4I6LB 1WYWB 4MEMA 1WJ6A 4MGIE 2M0XA 3TCAA 3HM3A 3S2AA
chains in the Genus database with same CATH superfamily
2HJ1A 4NQLB 3VTVA 2J52A 2JRHA 3JSVA 2RDGA 3SFDB 1WGGA 2KFJA 2BWFA 1EO6A 4R3DA 1FNWA 3PRMB 1WM3A 3AEFB 1P7EA 2VH2A 1XCTL 4NNJB 2LI5A 5JHAA 1E8ZA 3ZTDA 1VLBA 3M95A 1L7YA 4HKQA 4PS7A 2PVGC 4MACA 4G3XB 4GSWA 4FULA 1EF5A 3AEGB 4NZLB 2NTTA 2FUHB 1FRDA 3VHTC 2O6VB 2LGDA 3EC8A 2PKOA 5D3DA 4IOIE 2ZVOA 3P4QB 4J6IA 3K9OB 2GOWA 4IWPA 3NG0A 4XDCA 1AWDA 4EUTA 1Q1OA 2OEDA 3QWZB 1QLBB 3AMZA 5J17A 4RCOA 4HKZE 3A1QA 1T0SC 1OQQA 3APFA 1F1HA 1XLPA 2KWVB 1YJJA 2ZCCA 5C2TB 3TSSA 2ZNVC 4RGNA 2FNJB 3WCQA 3OLMD 2L0FA 2KQ4X 1WGKA 3AEDB 3JW0X 2INNE 4A3OA 1ZXHA 3DBHI 2SEBD 5TR5A 3IAM1 5HHDG 3X0WA 3Q8AA 3DWGC 1QOGA 4HVBA 2BB6A 3Q8FA 4OVUA 2LXAA 1TS2A 3VUWA 2V3NA 4HCPB 3DCGA 1AN8A 2G9HD 2LGYA 2W3RA 2O6VA 2LUEA 2MRPA 1WRDB 2KNBA 1WF9A 2AWTA 1LQBA 1WI0A 2JPHA 1J7BA 3R7RA 1UNSA 2AQ1B 5AZHA 1F2RI 3AXCA 3PO0A 2VRRB 1L0VB 2Z8LA 3SFEB 1F9JA 4TQ0A 1E9MA 4EZJA 2V3SA 4PYUA 3BYTB 2KWCA 2CJOA 2PPHA 4WJNA 5GMVA 2BKFA 1IGCA 1FEHA 2LXCA 5BYSA 4ASWC 4ANUA 2IO0B 2JF5A 1D6EC 1I7HA 2LFIA 1C78A 2BGFA 3P1MA 3SEBA 5FK9C 5LLIA 2N7DA 2MHJA 4IG7B 2HE7A 2LMCA 2DZJA 5EE9A 3N32A 4IWQA 2DNFA 4AWJA 4PS3A 3TL5A 4B9KA 3DQVA 1WM2A 2GBJA 2DX5B 3BY4B 2J53A 1E7VA 3DOWA 4MGYE 2DLBA 1H8CA 2VZKB 3KVFB 4DHZB 3U2SC 2JZZA 3T3OA 3R2IA 1R4NB 2GBMA 4A8XC 4L23A 2WU2B 1N5WA 3EECA 4W9HA 4A3PA 1OFFA 3Q3FA 5DPWA 2M56B 3PS6A 2MJ3A 2BT6A 3GOEA 2PTLA 1NYQA 2L7RA 4BOSC 2KC1A 4HJKA 1HQRD 1ET9A 1E7UA 2D3GA 2AQ2B 2MBHA 2C60A 1PFDA 4F7ZA 2K8BA 3Q14C 1MHXA 1S3SG 3DVGY 3ZTCA 1R7SA 2CS4A 2MA9B 4GDKA 3KWVA 1XO3A 1IBXB 1GNUA 2K1FA 4LDTD 4PS8A 2JSVX 1TIFA 2KDMA 1JMLA 3AE6B 1TKEA 3A4SC 2WXHA 4ZRKA 3WAPA 3AE4B 1D5ZC 4CHKA 2B76B 3R2TA 1TS4A 2L52A 4LJOB 1WH3A 3FILB 2J0JA 2NMQA 3AN1A 1LFDA 4W9GA 3HIZA 1XLOA 4RFBA 2JYTA 2KDBA 2YEPB 5E6NA 1K53A 2AEHA 2PJHA 1HZ5A 2WXLA 3NUHB 1GB4A 4I6NB 4GMVA 1SF0A 2O2VB 4YWGG 1ENFA 4US9A 2OJWA 2JZ3B 3GZNI 3RZFA 1WZ0A 1I4QA 1R4MB 2YVCA 5EE3A 3B2FA 2CHWA 2QIEB 3BVZA 1M4VA 1KM7A 5FKAC 2WXQA 4BFRA 3MP9A 2W55A 1MVKA 4YTPB 2PVOD 1IBXA 2ZZPB 3SD5A 1FCCC 2RDBC 3KUZA 2CKHB 1FNVA 2QC8A 3ZQ4A 4NPNA 4DXFA 2N7EA 3RMKC 3DBRB 4IC7B 4OVVA 3IXSA 3ZXRA 3UI3A 1WMHA 4HPMB 1BUIC 2LGSA 1D5XC 4DHJB 3KWLA 2JXTA 4N9F4 1YJ1A 2J42A 4WAFA 4X57B 1SGHA 4JPSA 1D5MC 2LWPA 2MP2B 3CSFA 4AJYB 2AQ3B 3V6EB 1T6BX 2NPTB 3VUYA 2MBOA 1GJZA 3HVZA 4NAWB 4KZCA 2NVUI 2WGSA 3P42A 3BZDB 4AP4C 4ZRIA 4EZKA 4ZRJA 4PT5A 5BMGA 2KT7A 4RGMA 3UQBA 4HJGE 1P1AA 2KVZA 4DHZE 4IKGA 4WIPA 2W54A 3B0AA 2KFKB 3M63B 1WJUA 4FHKA 3ENEA 1RFKA 4UDUC 2INDC 4YSXB 2WXRA 3H7PA 3QC8B 3LYYA 4IM2A 2KJ6A 2ZPYA 1I35A 3VH3B 2BTEA 4WQMA 4AOFA 3IFWB 1WR6E 2CU3A 2GB1A 3CMMB 3IG3A 4IWOA 5CHFA 4XYCA 2WX1A 3EUB2 1WX7A 1E0ZA 4YL8A 1BXTA 2JY6A 2M4NA 3Q3OC 2JX5A 3VDZA 3MC8A 3ZO5B 2NPTA 4KGTA 3A9KB 2FCMA 3PV1A 4P7IA 3RNAC 3PLUA 3W5VB 2V9HA 2X38A 3IT6B 2ACZB 3TCAA 3B2GA 1HEZE 4NAWA 4NJ6A 4EKUA 3AE7B 2K25A 3AI5A 4C7ZA 1GB1A 2WXIA 2D5GA 1PYWD 1WXAA 1OGWA 3FC4A 2DAFA 3N30A 1SBBB 3MHSD 2ZJDA 1P0RA 1T5XD 1V9JA 1SE9A 2DZIA 1L2NA 4AQ7A 3VUXA 3TEWA 1E8YA 2I38A 4GGQA 2FCNA 3OJ3A 3IHPC 5AZGA 2BS2B 3KLSX 4FADA 2RDHA 4ZYNA 2G4DB 4WWMA 2UU7A 1Q0WB 1WSPA 2MEKA 1WJNA 2N4FA 2BVCA 3U8ZA 2ZEQA 1TS3A 1CMXB 1UUPA 1PUTA 2KMAA 3L13A 3VAWA 2LGIA 4N59A 4LDTB 1WFYA 1YJIA 1ROEA 4BKSD 4IDIA 5FR3A 1KH0A 3IBEA 3VTUA 4YT0B 3HVDA 3KYDD 4L2YA 3ZDTA 3B9JA 3A9JA 4HPLB 5D94A 2V3PA 4AS1A 1WZ3A 2IO1B 1E8WA 5G2NA 2DZKA 2WXGA 4MJSA 2KJHB 3IVFA 4EZLA 4RGTA 4HDOA 1D3ZA 1FRRA 3V05A 2K9XA 2FAZA 1MJDA 1PDXA 3AULA 2CR5A 1C79A 3RFZB 1WXQA 4ZDVA 1KTKA 1I4RA 1Y8RC 2KXJA 3NOBA 1UWXA 3PTFC 3L0WB 4W9IA 3EA6A 1A5RA 2HD5B 4M02A 2K8HA 1CZPA 3L54A 2D3CA 2C9WB 4KV2A 2KACA 2K22A 3L4PA 2SAKA 1HTQA 3H9DA 2ZW1A 3WA0A 4P6VF 4LLGM 1WWTA 3R8BA 3EGRA 1B9RA 3DBHB 1V80A 2WDTB 2QHOA 2BS3B 3APCA 2KOXA 1LXDA 1EU4A 1RRBA 2IBIB 3ZIMA 1LGRA 4ARCA 1WGHA 4D2KA 2Z0DB 3TEZA 3DVGX 2QMTA 4OW0A 2BS4B 3Q8CA 4JLCA 1NYRA 2NS5A 2N1VA 2W3SA 1JRUA 2HJ8A 2L00B 1P98A 1WE6A 5DCNA 3GB1A 3GP7A 4WJPA 1QF6A 4J3OD 1EF1A 1V1OA 5AUKA 3SR6A 1WY8A 4ANVA 4YTNB 1WR1A 1S1QB 3L08A 4FN2A 2DHZA 4P1CC 1ZW7A 2C7NB 1YN5A 3AE1B 2KDEB 4GLSC 1L4DB 3HK0A 4KIKB 3MFGA 1WGRA 4N58A 4G11A 3E56A 2ZCBA 4YTMB 1V86A 4MGZE 1WYGA 3T9LA 1ZGUB 3SDLC 1YN4A 4PK1A 5IA7A 5CTRC 2WXMA 5IP4D 3TJPA 4LTUA 1HTOA 2WXNA 2WXPA 3VXWA 4DHJD 1JWSD 4K3CA 2KK8A 3N1ZC 2IO2B 4QAYA 1YX5B 2QCZA 3URYA 4II3B 4NAMA 4DDID 2J0MA 2BW2A 1GOZA 4RM9A 1I4XA 4ZOHC 3P4RB 1FO4A 2MH7A 4B0EA 3U7DA 4IM3A 2MCNB 3V60A 2WP9B 4MT5A 4XC2A 2GLSA 3VH4B 4NJ7A 2PLPA 2J0KA 1GC7A 5IAAC 4DXAB 4ICUA 1TY2A 5JZEB 4NY0A 2Y5PA 2DYOA 5L95C 4E71A 3R66C 4I6PA 3BYYB 4W9LA 2M8SA 2BYEA 3RZWC 3VR9B 4ARIA 1YQBA 1WGDA 4KIKA 1Y56A 1NEKB 2N0SB 1PGBA 1UD7A 4BBNC 4M0WB 5JHBA 1I4HA 4FLHA 1N6ZA 3M62B 4CO7A 5E6OA 1TTNA 3PZ8A 2WXJA 1XD3B 3ALBA 5TSSA 3R3MA 1WXMA 3QIJA 1E7PB 3ZJUA 2E3TA 4GIVA 4XX5A 2JWZA 5AZFA 1RLFA 2INPE 2JWUA 2K8CA 2H88B 1K51A 3NJTA 4LNFA 2JRIB 3QAQA 1C9FA 3AECB 2FE8A 3H7SA 1DYQA 4DQOC 1DOYA 1QT9A 1RFAA 4FJYA 2IY1B 2PIAA 1VD2A 2WXFA 4ANWA 3NVYA 2MX2A 3BVGA 4JX1C 3BVMA 4A90A 5G5HA 1FD6A 3QQ8B 1GC6A 2LUMA 1TYGB 1QILA 2C5LC 3C19A 3RT3B 4XGAB 1V81A 3B1LX 2XEWA 4B6WA 4M0WA 2NTSA 3ZLZA 3RYTA 1VZ7A 2MBBB 3IT4B 1SSNA 4JGHB 3I63C 3DBLI 1E5WA 2YEPF 2KO3A 4RM8A 4DDGD 1CJEA 1SEBD 5LNK1 2GI9A 3UIPB 2ON8A 1VRAB 1FMAD 2BB5A 3SU8X 4S0RA 3PRPB 3HM6X 2GRIA 3C8YA 2R61A 4OHJA 1YQ4B 3Q3MC 2EMSA 1TGZB 2LGXA 1UGMA 3X23A 1XQQA 1NI3A 1OEYJ 3AU4A 2ZNVB 3KUCB 4FBJB 1N5XA 1EUVB 2XN9C 4KKJA 3LB8C 3P63A 4KSKC 2B3AA 1SJED 3PZDA 2RPQA 1L5PA 3W1YA 3OAWA 4TMAB 4MGIE 2M0XA 1C3TA 3S2AA 3NHEB 1SB3C 4ACFA 4C00A 3IAS1 1WJ4A 1FNUA 2BYFA 2G3QB 2D3AA 1KLGD 1QOAA 5D2MB 1CK1A 3V3XA 1T0QC 3JVZX 1FM0D 4K7SA 2ZVNA 3AE5B 3N20C 3VTWA 1B1ZA 2GBRA 5H8YE 1OQRA 2RMMA 3Q6BA 1FPYA 2ZPNA 5IO9A 3RNCC 3AH7A 4XWWA 2KQSA 1G6JA 4KKIA 3FILA 3FKYA 3DBSA 4A6QA 3AV8A 3VR8B 2X8XX 3L16A 1YN3A 2JU6X 3DVNU 2IYDB 1J0GA 3NZ3A 4MSQB 4MELA 4PYZA 2PW9A 3HHMA 1KLUD 2MJEA 2L83A 2DAJA 2NBWB 1WXVA 1RM6C 4C4VB 3WAOA 3GE8C 1ZUD2 2QSDA 2IPKD 2V1YA 1TBEA 2L8JA 3UGBB 2O2VA 3A33B 4MH8A 3MHZA 4OZCA 2M1MA 4TQ1A 4A9AA 3UIOB 3ZGZA 2KYWA 2WLBA 4Q2JA 1Z2MA 5BMIA 3QA8A 2KKCA 2KLCA 1XLNA 1JCKB 1FIQA 1C4CA 2J4XA 4MGKE 2FBWB 3ZKJC 1KJTA 3P4PB 2KHWB 4A55A 4ITKA 1OQYA 2LRWA 2LZ6A 4KSLC 5KHOA 2XNAC 4US8A 1SIJA 1TKGA 1L6UA 1J7AA 1EM7A 2L05A 3PSEB 2RGFA 2KMMA 2IZVB 4KGRA 1NENB 4CYEA 1E90A 1L0YB 1JQ4A 2VH1A 2L1AA 4JWSC 4B95A 2Z0EB 4GDLB 2RR9A 4JL9A 4DWFA 2MP2A 3L10B 5IN7A 3MC9A 2DWQA 2KTRB 3N3KB 4C4VA 5C1ZA 4FJVB 4WWPA 1TY0A 3PRZA 5CX3A 2G45B 2KLGA 4WQOB 2D07B 2PEAA 5J2RA 4A20A 3VVWB 1JWUD 1SE3A 4EOYA 2JQRB 1J7CA 2WQYB 1QQRA 1GUAB 3Q3NC 1KF6B 1M94A 1AARA 2LRUA 5T8IA 3PHXB 2UWQA 3UQAA 1SIFA 1FXAA 3EHVA 2K3UA 2KFKA 5C23A 1E8XA 5G5GA 2LD9A 1VZ8A 2KZRA 1ZPSA 2KX3A 1VR9A 2G1EA 3H1UA 4ZHPA 1N61A 3T8MA 2BPSA 3RD2A 3RULA 4W9CA 1QOFA 3FAHA 5H92C 1L6VA 1LM8B 3QX1A 1L4ZB 2IGHA 4GXBA 2RPVA 1LO5D 1N63A 3U4EG 1K8RB 3AB5A 4GDLA 4TKNA 4TSSA 1EWYC 2ONQA 1GG3A 1JALA 3AU5A 3KUDB 4W9KA 4BKGA 3A9KA 3TBLD 1XXGA 3VRBB 2KTRA 3WAMA 4ICVA 1C77A 3D32A 4ZHOA 2NBVB 1FXIA 1IP9A 2QEJC 2HTHA 3JSVB 2FCQA 4WJOA 1YMHE 2BBCA 3TIXA 3T3NA 4W9JA 2K6DB 1ISNA 3NRZA 3ML8A 2G4SA 5GXGB 2KVRA 2XBBC 1HXYD 1QZEA 1GPXA 4KDLB 4MDKE 1C1YB 1ZDVA 4G50A 2N9LA 4AUQC 1WX9A 2OOBB 2QJLA 1RYJA 1Q5WB 4G0NB 1XT9B 3J9CA 4C7YA 4P1BC 4HPPA 3ONSA 1TZ1A 3OJ4B 2NR2A 2DYMA 4BZAA 2LHEA 2MBQA 3ABVB 2LVOA 4KGSA 4RGOS 2FIDA 2KX0A 2WNMA 4FA6A 2KMCA 1NBFC 2Y5CA 1PQSA 1YIWA 2N1WA 2EMTA 1DOXA 5HG2A 3QK0A 3SHQA 3OG5A 1K52A 5BYRA 3LDZE 2HDEA 4IW0A 2FUG1 4M8NA 4WWNA 3APDA 4WAAA 2WU5B 2EKIA 1YNTE 1C4PA 4C56C 3PPAA 3DVNV 3CWIA 3ZNID 4GOCA 1BT0A 2QDFA 4EFOA 3MJ5A 4K81A 4FHJA 3TEYA 1VDVA 3QCAA 4LNOA 4JQWC 1UBIA 5D7GA 2Y3AA 1XLQA 5HI1A 2EKEC 1EWCA 1N62A 3TEXA 3BIID 2H89B 5BO4B 1ZE3D 3ZYYX 5AEKB 5HFYA 4HEA1 3V61A 3VFKA 3EFUA 4GB9A 3V6CB 4HRSA 5MPOA 2N9PC 4IUMB 1UBQA 1UZXB 3NVWA 2IGDA 4REZA 4F8CB 2K0PA 3ZRFA 4M01A 3P2BA 3GS2A 5I4DA 1D4BA 3UF8A 3NZSA 2Y5BB 2IY0B 2RD0A 1TS5A 4ANXA 4RNAA 1V5OA 3HRDD 3U7ZA 4II2B 2IDYA 2JZPA 2KQ7A 2KDFB 1E10A 3KH0A 1T0RC 1STEA 1NVID 2DENB 3N9YC 2J7QB 1U4AA 4S17A 4W9EA 1JROA 3W2DA 2ASQA 2JUOA 4OVZA 1SXTA 1YQ3B 1V8CA 4RH6A 4XZ4A 1F77A 4HDQA 4GN1A 3RNGC 2Z59B 1I4GA 4USAA 1SE2A 4GU2A 3Q3JA 1XCQL 1I4PA 1WGYA 3ZVVA 1UF0A 4C80A 3ZW3A 2L0TA 1ZP0B 1V6EA 1VJKA 3H8HA 4RMAA 3HM3A 3DBLB 1BMLC 1CQVA 1VZ6A 1TJEA 2KAJA 3MTNB 3HUIA 4YSYB 3W1SA 3AE3B 2EELA 3I57A 4BOZB 1FFVA 2BYTA 3AE8B 4GDKB 2V0GA 1JRPA 3ZNGC 3QJZA 1V97A 2PE9A 1P9DU 2NCNA 3KQ4A 4W9FA 1FCLA 5HKHA 4JIOU 2DZMA 2MLBA 3CIRB 2K39A 1QOBA 1I42A 5AUIA 1KOTA 1ACCA 1DGJA 2CHXA 5BMHA 1KLVA 4EE2A 1UGJA 3AE2B 1J8CA 1QKZA 3PGEA 3Q8EA 1GAQB 1HE8A 4HLEA 1K50A 3GZNB 2GBNA 2QILA 1AYFA 2N9EB 2A4ZA 3OWEB 1RAXA 2WS3B 2DYBA 2AYOB 4YSZB 5BYQA 2D2QA 4MSMB 5JXVA 3MC0B 2KN5A 2KTFA 4KVGB 5D6JB 1P3QU 2WDVB 1JWAD 3L17A 1IYFA 5CHVC 4BKSA 2WWZA 4LCDE 1X1MA 1F52A 3NZUA 4MM3B 5DPSA 5DPTA 5LXHA 4WJQA 4LNKA 1WRIA 4L1BA 2D3BA 3N1XC 3H6NA 1IUEA 1WIAA 2INCC 2IJ0A 4H2AA 3AEBB 2MQJA 2KD0A 3C0RB 2R2QA 1MG4A 4B0MA 1EU3A 1WMHB 3I3TB 4NJCA 2W9NA 2I2YA 2LJ5A 2XK5B 3RUIB 4FXCA 4XDDA 1TZOA 2YLMA 1R4NI 4LJPB 2PE6B 1XEEA 4WURA 1UWMA 4K7WA 3ZDMC 1JWBD 2CJNA 1NDDA 3ECIA 3KW5B 5JH5C 1MG8A 1C4AA 4LNIA 2LASA 1H4RA 3PLVA 2CHZA 4ZYSA 3LJ3A 3PVLA 4WH4A 1Q10A 5EE0A 3U52E 4M8MA 1WX8A 3W5UB 1OEYA 3ZRCA 4WWOA 4MM3A 4BBNF 1SE4A 1T3QA 5L83A 4MH0E 5DPRA 4HCNB 5E6JA 2E6XA 2FCSA 5EE1A 4K7UA 3BK1A 3QHTA 4N6EB 3DDCB 3H7PB 2OJRA 3DWMA 4XWTA 1WE7A 1C76A 1UELA 4BAXA 1V2YA 2PMVA 4URKA 2CU1A 2JT4B 3W9CB 1KRHA 2XK5A 1FXTB 4AJWA 1YOVB 3R7QA 1WXSA 3M3JA 1TT5B 2M17A 2O6VD 3NY5A 4KDIC 2BWES 4TUUA 5IOIA 2R2OA 2MJDA 2WHIA 2UYZB 3WALA 1P7FA 3Q8BA 4RF0A 2HTME 4XE0A 2LVPA 1MPEA 3PREA 4KX6B 4JE3B 2KN4A 5E6PA 1R4MI 1JWMD 2C7HA 3PT2B 2I1JA 1HA5A 1V49A 2N9KA 2MBEA 3E9SA 3JYUA 3RN9C 3RNEC 2D11A 1YD8U 4ZRPA 3PZ7A 4JWUC 5FR6A 2C7MB 2D10A 1ESFA 2ICIA 1PGAA 2WYQA 3NVZA 1V5TA 3BINA 5J18A 2AX5A 4W9DA 2L32A 1MFWA 2TSSA 3DBRI 3RCZA 3ZJVA 3TMPB 3NS1A 3ZJTA 4FJZA 1F2RC 2WXOA 3NVVA 3KYCD 3AEAB 3Q2AC 3ZUNA 2JYEA 1OTRB 3DHGC 3ZXVA 3EFCA 3RNBC 2M0AA 1IPGA 1F0ZA 1PGXA 1ZOYB 3A9JB 4E3CA 2LHDA 1SJHD 4K3BA 3AE9B 2NBUA 4OZAA 5KHQA 2WXKA 1IGDA 1YX6B 1VCBA 4MJSB 2OHFA 4KZ0A 2WDRB 1MHHE 4M00A 3DPDA 3I5JC 2MW5A 3ML9A 1HZ6A 1AW7A 5G55A 3TUOA 5D3IB 2L76A 3W1SC 3CF6E 1ET6A 2RSUA 4RF1A 2LJIA 1V1PB 3UINB 4TV3A 4BVUC 4YXDB 2BYVE 3PHWB 3WIMA 4DK5A 4OZBA 3K9PB 2M19A 2N7JA 2N9XA 2KWUB 2REXA 2A5UA 2BF8B 2KWDA 3NS8A 2AL6A 4K1RB 2DBYA 2JXXA 3ZNZB 1RWSA 3O65B 4NQKE 4EEWA 3WANA 3BWUD 3CSTA 3U30A 4LK0M 5C3JB 3AM9A 2KANA 4CQNA 3GE3C 1MI0A 3I9V1 4P16A 1TKYA 2FIFA 2V4LA 2IGGA 3DHIC 3MJWA 2V4IB 3ZNHB 1E6EB 3VRAB 3O13A 1UH6A 2LEKA 2VZKD 3LXFA 1DOIA 2IO3B 5IKCM 2KJRA 4E74A 1XF5L 3RPFC 4IM0A 4HK2A 2W82A 1J19A 3BK2A 1JW9D 2I1KA 3Q69A 5EDSA 3A4RA 1ZXIA 2ZW0A 4O1NA 2MSED 3DHHC 2KDIA 1NI2A 4HROA 5CHWA 1T0YA 3RNFC 2WX0A 2WDQB 1V1PA 3QARA 4BKTA 4ZRQA 4F1SA 1KFYB 4HWIB 1A70A 4HXDA 4DXGA 1ZDXA 2LVQA 2BKRB 2K5PA 3ETRA 2AL3A 3VQIA 3B08A 2KC2A 3A1QB 1FFUA 5LXIB 2JVCA 4LNNA 4DBGA 1N60A 3RI7C 3AEEB 1ZKHA 2L3ZA 3P4SB 3V62A 2MWSB 2K6QA 2GMIC 2GBKA 1Z5SB 4I6LB 1L0XB 2Q5WD 1WYWB 4MEMA 1WJ6A 2BQQA 3N1YC
chains in the Genus database with same CATH topology
3NHEB 4NQLB 4EKUA 4NAWA 4NJ6A 3VTVA 2JRHA 2K25A 3AI5A 3JSVA 3MTNB 1WGGA 3W1SA 2KFJA 2BWFA 1EO6A 3PRMB 1WJ4A 1WM3A 1WXAA 4NNJB 2BYFA 1OGWA 2G3QB 2DAFA 2LI5A 5JHAA 5D2MB 4BOZB 3N30A 1E8ZA 4GDKB 3JVZX 3ZTDA 3MHSD 4K7SA 2ZJDA 2ZVNA 3M95A 3VTWA 1P0RA 3ZNGC 1V9JA 3QJZA 1SE9A 2PE9A 1P9DU 2NCNA 2DZIA 1L7YA 4W9FA 4PS7A 1L2NA 2GBRA 3VUXA 1E8YA 5HKHA 4GGQA 4JIOU 2DZMA 4G3XB 4GSWA 2ZPNA 2FCNA 2MLBA 1EF5A 3OJ3A 4FULA 3IHPC 5AZGA 4FADA 2K39A 2KQSA 1G6JA 2FUHB 4ZYNA 3VHTC 1I42A 2O6VB 1KOTA 2CHXA 2G4DB 2LGDA 3EC8A 3DBSA 1Q0WB 1KLVA 2ZVOA 1WJNA 4J6IA 3K9OB 2N4FA 2GOWA 3L16A 3DVNU 4IWPA 3U8ZA 2ZEQA 1J8CA 2IYDB 1J0GA 4MSQB 4MELA 1CMXB 2KMAA 3PGEA 3L13A 4PYZA 3VAWA 4EUTA 1HE8A 4HLEA 1Q1OA 3HHMA 4LDTB 1WFYA 3QWZB 5J17A 2GBNA 4BKSD 2DAJA 2NBWB 1WXVA 2N9EB 2A4ZA 3A1QA 1RAXA 3WAOA 3IBEA 2DYBA 2AYOB 3APFA 2ZCCA 2KWVB 1TBEA 2V1YA 2ZNVC 2L8JA 3UGBB 2O2VA 3A33B 2D2QA 4MSMB 3VTUA 4TQ1A 3KYDD 2M1MA 2FNJB 3UIOB 3ZDTA 2KN5A 3A9JA 1Z2MA 3QA8A 2KKCA 3OLMD 2KTFA 4HPLB 4KVGB 5D6JB 5D94A 2L0FA 2KLCA 1P3QU 1WZ3A 2IO1B 1E8WA 3JW0X 3L17A 5G2NA 2DZKA 4A3OA 1IYFA 5CHVC 3DBHI 4MJSA 4MGKE 4BKSA 3ZKJC 2WWZA 2KJHB 1KJTA 3IVFA 4EZLA 2KHWB 5TR5A 1OQYA 4HDOA 4LCDE 1D3ZA 2LRWA 1X1MA 2LZ6A 3X0WA 3NZUA 4KSLC 2FAZA 4HVBA 5KHOA 5DPSA 4OVUA 2LXAA 5DPTA 3AULA 2CR5A 3VUWA 5LXHA 4WJQA 4HCPB 4ZDVA 3DCGA 2L05A 3PSEB 1Y8RC 2KXJA 3NOBA 3PTFC 3L0WB 2RGFA 4W9IA 2LGYA 2IZVB 2O6VA 1A5RA 2LUEA 2MRPA 3H6NA 1WRDB 2HD5B 4CYEA 1E90A 2K8HA 1WIAA 2KNBA 1WF9A 2AWTA 1LQBA 2MQJA 1WI0A 3L54A 2JPHA 4B95A 2C9WB 2KD0A 2Z0EB 3C0RB 3R7RA 2R2QA 4KV2A 4GDLB 2RR9A 4JL9A 4DWFA 2MP2A 1WMHB 3L10B 5AZHA 3I3TB 2W9NA 3H9DA 2LJ5A 3WA0A 2XK5B 3AXCA 3RUIB 2KTRB 2VRRB 3N3KB 1F9JA 2YLMA 4TQ0A 5C1ZA 1R4NI 4LJPB 4FJVB 4WWPA 2PE6B 4EZJA 2V3SA 3PRZA 4PYUA 5CX3A 2G45B 4RMAA 2KLGA 4WQOB 4K7WA 2KWCA 2D07B 2PEAA 3ZDMC 1V80A 2PPHA 2WDTB 2QHOA 1NDDA 3ECIA 4WJNA 5J2RA 4A20A 3KW5B 5GMVA 2BKFA 3APCA 2KOXA 5JH5C 2LXCA 4ASWC 1MG8A 3VVWB 4ANUA 2IO0B 2JF5A 1LXDA 2LASA 1H4RA 4EOYA 1RRBA 3PLVA 2BGFA 2CHZA 2IBIB 3ZIMA 3LJ3A 1GUAB 1WGHA 1M94A 5LLIA 3PVLA 2Z0DB 2N7DA 1AARA 4IG7B 2LRUA 2HE7A 3PHXB 3DVGX 4M8MA 2UWQA 3UQAA 1WX8A 1SIFA 1OEYA 3EHVA 3ZRCA 2DZJA 3N32A 4WWOA 4IWQA 4JLCA 2KFKA 4MM3A 5C23A 4BBNF 2NS5A 1E8XA 2N1VA 1JRUA 2HJ8A 4AWJA 2L00B 4PS3A 4MH0E 5DPRA 4HCNB 3TL5A 4B9KA 5L83A 1P98A 2LD9A 1WE6A 2FCSA 3DQVA 1WM2A 2GBJA 2KZRA 5DCNA 2KX3A 2DX5B 3BY4B 3H1UA 1C3TA 1E7VA 4WJPA 4K7UA 3DOWA 3QHTA 1EF1A 4MGYE 3T8MA 1H8CA 3KVFB 2BPSA 3DDCB 4DHZB 1WY8A 3H7PB 3RD2A 3RULA 2OJRA 4W9CA 4ANVA 2JZZA 1WR1A 1LM8B 3QX1A 1S1QB 3L08A 2GBMA 1WE7A 4GXBA 4FN2A 2DHZA 1UELA 1V2YA 1K8RB 1ZW7A 4GDLA 4TKNA 4URKA 2CU1A 2C7NB 2JT4B 1GG3A 3AU5A 3KUDB 2KDEB 3EECA 4W9KA 4W9HA 3A9KA 3TBLD 4BKGA 4A3PA 3HK0A 4KIKB 2XK5A 3Q3FA 5DPWA 3WAMA 1WGRA 2KTRA 3PS6A 4ICVA 4G11A 3GOEA 3D32A 1FXTB 4AJWA 3R7QA 2ZCBA 2L7RA 4BOSC 1V86A 4MGZE 1WXSA 2KC1A 2NBVB 3M3JA 3T9LA 4HJKA 1E7UA 2D3GA 1ZGUB 2M17A 3SDLC 2MBHA 5IA7A 1IP9A 5CTRC 2O6VD 2C60A 3NY5A 3TJPA 4KDIC 2BWES 2HTHA 4TUUA 4F7ZA 2K8BA 1S3SG 3DVGY 2R2OA 3JSVB 3ZTCA 3VXWA 4DHJD 2UYZB 2CS4A 3WALA 2FCQA 2MA9B 4WJOA 4GDKA 2KK8A 3TIXA 2LVPA 1GNUA 2K1FA 3PREA 4LDTD 2K6DB 2IO2B 1ISNA 4PS8A 4W9JA 3ML8A 5E6PA 1YX5B 1R4MI 2G4SA 2C7HA 4II3B 2KVRA 3PT2B 2XBBC 1QZEA 4DDID 2I1JA 2J0MA 1V49A 3A4SC 2MBEA 3JYUA 4KDLB 4MDKE 4ZRKA 3WAPA 2D11A 1C1YB 1YD8U 4RM9A 4CHKA 4G50A 4AUQC 1WX9A 2OOBB 5FR6A 3U7DA 4IM3A 2MCNB 2C7MB 2D10A 3V60A 1Q5WB 4G0NB 1XT9B 4LJOB 4XC2A 3VH4B 1WH3A 2J0JA 2WYQA 1TZ1A 3ONSA 4NJ7A 2J0KA 1GC7A 1LFDA 3OJ4B 5IAAC 4W9GA 1V5TA 3HIZA 3BINA 4DXAB 5J18A 4ICUA 4W9DA 2NR2A 5JZEB 4NY0A 2KDBA 5E6NA 3DBRI 2DYOA 3RCZA 5L95C 2DYMA 3TMPB 4E71A 2AEHA 3R66C 2MBQA 4FJZA 4I6PA 2PJHA 4W9LA 2M8SA 2BYEA 2LVOA 3KYCD 4I6NB 3RZWC 4GMVA 2FIDA 3ZUNA 1YQBA 2KX0A 1WGDA 1OTRB 4KIKA 4FA6A 2KMCA 1UD7A 2O2VB 1NBFC 4BBNC 4M0WB 5JHBA 1IPGA 4FLHA 3M62B 4CO7A 1PQSA 2JZ3B 3GZNI 1YIWA 2N1WA 1WZ0A 2EMTA 3A9JB 5E6OA 3RZFA 4E3CA 1TTNA 3QK0A 2YVCA 3SHQA 1XD3B 3LDZE 3ALBA 4IW0A 2CHWA 2NBUA 1KM7A 1WXMA 3R3MA 3QIJA 5KHQA 4BFRA 1YX6B 1VCBA 4GIVA 4M8NA 4MJSB 4WWNA 4XX5A 3APDA 2JWZA 4KZ0A 5AZFA 4WAAA 1RLFA 2ZZPB 3DPDA 3SD5A 2MW5A 3ML9A 2K8CA 3KUZA 2CKHB 3PPAA 3DVNV 5G55A 3ZNID 2L76A 3W1SC 3CF6E 4GOCA 1BT0A 4EFOA 2RSUA 2JRIB 3UINB 4K81A 3QAQA 4FHJA 4NPNA 4TV3A 4BVUC 2BYVE 3PHWB 3QCAA 2N7EA 3WIMA 3H7SA 4DK5A 1RFAA 4IC7B 4FJYA 4JQWC 4OVVA 1UBIA 2IY1B 1VD2A 4ANWA 3K9PB 2MX2A 2N9XA 2KWUB 2REXA 5D7GA 1WMHA 4HPMB 2A5UA 2BF8B 4DHJB 2EKEC 4N9F4 1YJ1A 3NS8A 2AL6A 3QQ8B 4X57B 4K1RB 1SGHA 1GC6A 2LWPA 2MP2B 3CSFA 2JXXA 3ZNZB 4AJYB 3V6EB 3O65B 4NQKE 2NPTB 5BO4B 4EEWA 2C5LC 3VUYA 3RT3B 3WANA 5AEKB 3U30A 3CSTA 2MBOA 2KANA 1GJZA 3V61A 3VFKA 1V81A 3EFUA 4KZCA 2NVUI 3B1LX 4NAWB 4GB9A 2XEWA 3V6CB 4B6WA 4AP4C 2FIFA 2N9PC 2V4LA 4IUMB 4ZRIA 3ZLZA 1UBQA 1UZXB 4ZRJA 4EZKA 3MJWA 4F8CB 3RYTA 3ZNHB 2MBBB 3ZRFA 3P2BA 1UH6A 3UF8A 3NZSA 4JGHB 2IO3B 2Y5BB 3DBLI 1E5WA 3UQBA 2IY0B 2KO3A 2KJRA 2RD0A 4RM8A 4DDGD 4E74A 4ANXA 1V5OA 1P1AA 4IM0A 4HK2A 4DHZE 4II2B 1J19A 3UIPB 2I1KA 5EDSA 3SU8X 3A4RA 2KQ7A 2KDFB 2MSED 3PRPB 3HM6X 2KDIA 3B0AA 1NI2A 2KFKB 3M63B 3KH0A 5CHWA 1T0YA 1WJUA 4FHKA 3ENEA 2WX0A 2DENB 2J7QB 1U4AA 2EMSA 3QARA 1TGZB 4BKTA 4F1SA 2LGXA 4W9EA 1UGMA 3H7PA 3QC8B 4HWIB 4IM2A 3X23A 2KJ6A 2ZPYA 4HXDA 1XQQA 2ASQA 2JUOA 1I35A 1OEYJ 2LVQA 3AU4A 3VH3B 2ZNVB 2BKRB 4AOFA 3IFWB 4XZ4A 1WR6E 3CMMB 2AL3A 3IG3A 3KUCB 4GN1A 4HDQA 2Z59B 4IWOA 3B08A 2WX1A 5CHFA 3VQIA 4FBJB 2KC2A 3A1QB 1WX7A 1EUVB 5LXIB 4YL8A 4GU2A 2JY6A 2M4NA 2JVCA 3Q3JA 4KSKC 4DBGA 2B3AA 3VDZA 3ZO5B 1ZKHA 2L3ZA 3PZDA 3V62A 2MWSB 2NPTA 1WGYA 2RPQA 3A9KB 2FCMA 3PV1A 3W1YA 2K6QA 4P7IA 3ZVVA 2L0TA 3PLUA 2GMIC 3ZW3A 2GBKA 3OAWA 1V6EA 1Z5SB 4I6LB 1WYWB 4MEMA 1WJ6A 4MGIE 2M0XA 3TCAA 3HM3A 3S2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHE B;  4NQL B;  4EKU A;  4NAW A;  4NJ6 A;  3VTV A;  2JRH A;  2K25 A;  3AI5 A;  3JSV A;  3MTN B;  1WGG A;  3W1S A;  2KFJ A;  2BWF A;  1EO6 A;  3PRM B;  1WJ4 A;  1WM3 A;  1WXA A;  4NNJ B;  2BYF A;  1OGW A;  2G3Q B;  2DAF A;  2LI5 A;  5JHA A;  5D2M B;  4BOZ B;  3N30 A;  1E8Z A;  4GDK B;  3JVZ X;  3ZTD A;  3MHS D;  4K7S A;  2ZJD A;  2ZVN A;  3M95 A;  3VTW A;  1P0R A;  3ZNG C;  1V9J A;  3QJZ A;  1SE9 A;  2PE9 A;  1P9D U;  2NCN A;  2DZI A;  1L7Y A;  4W9F A;  4PS7 A;  1L2N A;  2GBR A;  3VUX A;  1E8Y A;  5HKH A;  4GGQ A;  4JIO U;  2DZM A;  4G3X B;  4GSW A;  2ZPN A;  2FCN A;  2MLB A;  1EF5 A;  3OJ3 A;  4FUL A;  3IHP C;  5AZG A;  4FAD A;  2K39 A;  2KQS A;  1G6J A;  2FUH B;  4ZYN A;  3VHT C;  1I42 A;  2O6V B;  1KOT A;  2CHX A;  2G4D B;  2LGD A;  3EC8 A;  3DBS A;  1Q0W B;  1KLV A;  2ZVO A;  1WJN A;  4J6I A;  3K9O B;  2N4F A;  2GOW A;  3L16 A;  3DVN U;  4IWP A;  3U8Z A;  2ZEQ A;  1J8C A;  2IYD B;  1J0G A;  4MSQ B;  4MEL A;  1CMX B;  2KMA A;  3PGE A;  3L13 A;  4PYZ A;  3VAW A;  4EUT A;  1HE8 A;  4HLE A;  1Q1O A;  3HHM A;  4LDT B;  1WFY A;  3QWZ B;  5J17 A;  2GBN A;  4BKS D;  2DAJ A;  2NBW B;  1WXV A;  2N9E B;  2A4Z A;  3A1Q A;  1RAX A;  3WAO A;  3IBE A;  2DYB A;  2AYO B;  3APF A;  2ZCC A;  2KWV B;  1TBE A;  2V1Y A;  2ZNV C;  2L8J A;  3UGB B;  2O2V A;  3A33 B;  2D2Q A;  4MSM B;  3VTU A;  4TQ1 A;  3KYD D;  2M1M A;  2FNJ B;  3UIO B;  3ZDT A;  2KN5 A;  3A9J A;  1Z2M A;  3QA8 A;  2KKC A;  3OLM D;  2KTF A;  4HPL B;  4KVG B;  5D6J B;  5D94 A;  2L0F A;  2KLC A;  1P3Q U;  1WZ3 A;  2IO1 B;  1E8W A;  3JW0 X;  3L17 A;  5G2N A;  2DZK A;  4A3O A;  1IYF A;  5CHV C;  3DBH I;  4MJS A;  4MGK E;  4BKS A;  3ZKJ C;  2WWZ A;  2KJH B;  1KJT A;  3IVF A;  4EZL A;  2KHW B;  5TR5 A;  1OQY A;  4HDO A;  4LCD E;  1D3Z A;  2LRW A;  1X1M A;  2LZ6 A;  3X0W A;  3NZU A;  4KSL C;  2FAZ A;  4HVB A;  5KHO A;  5DPS A;  4OVU A;  2LXA A;  5DPT A;  3AUL A;  2CR5 A;  3VUW A;  5LXH A;  4WJQ A;  4HCP B;  4ZDV A;  3DCG A;  2L05 A;  3PSE B;  1Y8R C;  2KXJ A;  3NOB A;  3PTF C;  3L0W B;  2RGF A;  4W9I A;  2LGY A;  2IZV B;  2O6V A;  1A5R A;  2LUE A;  2MRP A;  3H6N A;  1WRD B;  2HD5 B;  4CYE A;  1E90 A;  2K8H A;  1WIA A;  2KNB A;  1WF9 A;  2AWT A;  1LQB A;  2MQJ A;  1WI0 A;  3L54 A;  2JPH A;  4B95 A;  2C9W B;  2KD0 A;  2Z0E B;  3C0R B;  3R7R A;  2R2Q A;  4KV2 A;  4GDL B;  2RR9 A;  4JL9 A;  4DWF A;  2MP2 A;  1WMH B;  3L10 B;  5AZH A;  3I3T B;  2W9N A;  3H9D A;  2LJ5 A;  3WA0 A;  2XK5 B;  3AXC A;  3RUI B;  2KTR B;  2VRR B;  3N3K B;  1F9J A;  2YLM A;  4TQ0 A;  5C1Z A;  1R4N I;  4LJP B;  4FJV B;  4WWP A;  2PE6 B;  4EZJ A;  2V3S A;  3PRZ A;  4PYU A;  5CX3 A;  2G45 B;  4RMA A;  2KLG A;  4WQO B;  4K7W A;  2KWC A;  2D07 B;  2PEA A;  3ZDM C;  1V80 A;  2PPH A;  2WDT B;  2QHO A;  1NDD A;  3ECI A;  4WJN A;  5J2R A;  4A20 A;  3KW5 B;  5GMV A;  2BKF A;  3APC A;  2KOX A;  5JH5 C;  2LXC A;  4ASW C;  1MG8 A;  3VVW B;  4ANU A;  2IO0 B;  2JF5 A;  1LXD A;  2LAS A;  1H4R A;  4EOY A;  1RRB A;  3PLV A;  2BGF A;  2CHZ A;  2IBI B;  3ZIM A;  3LJ3 A;  1GUA B;  1WGH A;  1M94 A;  5LLI A;  3PVL A;  2Z0D B;  2N7D A;  1AAR A;  4IG7 B;  2LRU A;  2HE7 A;  3PHX B;  3DVG X;  4M8M A;  2UWQ A;  3UQA A;  1WX8 A;  1SIF A;  1OEY A;  3EHV A;  3ZRC A;  2DZJ A;  3N32 A;  4WWO A;  4IWQ A;  4JLC A;  2KFK A;  4MM3 A;  5C23 A;  4BBN F;  2NS5 A;  1E8X A;  2N1V A;  1JRU A;  2HJ8 A;  4AWJ A;  2L00 B;  4PS3 A;  4MH0 E;  5DPR A;  4HCN B;  3TL5 A;  4B9K A;  5L83 A;  1P98 A;  2LD9 A;  1WE6 A;  2FCS A;  3DQV A;  1WM2 A;  2GBJ A;  2KZR A;  5DCN A;  2KX3 A;  2DX5 B;  3BY4 B;  3H1U A;  1C3T A;  1E7V A;  4WJP A;  4K7U A;  3DOW A;  3QHT A;  1EF1 A;  4MGY E;  3T8M A;  1H8C A;  3KVF B;  2BPS A;  3DDC B;  4DHZ B;  1WY8 A;  3H7P B;  3RD2 A;  3RUL A;  2OJR A;  4W9C A;  4ANV A;  2JZZ A;  1WR1 A;  1LM8 B;  3QX1 A;  1S1Q B;  3L08 A;  2GBM A;  1WE7 A;  4GXB A;  4FN2 A;  2DHZ A;  1UEL A;  1V2Y A;  1K8R B;  1ZW7 A;  4GDL A;  4TKN A;  4URK A;  2CU1 A;  2C7N B;  2JT4 B;  1GG3 A;  3AU5 A;  3KUD B;  2KDE B;  3EEC A;  4W9K A;  4W9H A;  3A9K A;  3TBL D;  4BKG A;  4A3P A;  3HK0 A;  4KIK B;  2XK5 A;  3Q3F A;  5DPW A;  3WAM A;  1WGR A;  2KTR A;  3PS6 A;  4ICV A;  4G11 A;  3GOE A;  3D32 A;  1FXT B;  4AJW A;  3R7Q A;  2ZCB A;  2L7R A;  4BOS C;  1V86 A;  4MGZ E;  1WXS A;  2KC1 A;  2NBV B;  3M3J A;  3T9L A;  4HJK A;  1E7U A;  2D3G A;  1ZGU B;  2M17 A;  3SDL C;  2MBH A;  5IA7 A;  1IP9 A;  5CTR C;  2O6V D;  2C60 A;  3NY5 A;  3TJP A;  4KDI C;  2BWE S;  2HTH A;  4TUU A;  4F7Z A;  2K8B A;  1S3S G;  3DVG Y;  2R2O A;  3JSV B;  3ZTC A;  3VXW A;  4DHJ D;  2UYZ B;  2CS4 A;  3WAL A;  2FCQ A;  2MA9 B;  4WJO A;  4GDK A;  2KK8 A;  3TIX A;  2LVP A;  1GNU A;  2K1F A;  3PRE A;  4LDT D;  2K6D B;  2IO2 B;  1ISN A;  4PS8 A;  4W9J A;  3ML8 A;  5E6P A;  1YX5 B;  1R4M I;  2G4S A;  2C7H A;  4II3 B;  2KVR A;  3PT2 B;  2XBB C;  1QZE A;  4DDI D;  2I1J A;  2J0M A;  1V49 A;  3A4S C;  2MBE A;  3JYU A;  4KDL B;  4MDK E;  4ZRK A;  3WAP A;  2D11 A;  1C1Y B;  1YD8 U;  4RM9 A;  4CHK A;  4G50 A;  4AUQ C;  1WX9 A;  2OOB B;  5FR6 A;  3U7D A;  4IM3 A;  2MCN B;  2C7M B;  2D10 A;  3V60 A;  1Q5W B;  4G0N B;  1XT9 B;  4LJO B;  4XC2 A;  3VH4 B;  1WH3 A;  2J0J A;  2WYQ A;  1TZ1 A;  3ONS A;  4NJ7 A;  2J0K A;  1GC7 A;  1LFD A;  3OJ4 B;  5IAA C;  4W9G A;  1V5T A;  3HIZ A;  3BIN A;  4DXA B;  5J18 A;  4ICU A;  4W9D A;  2NR2 A;  5JZE B;  4NY0 A;  2KDB A;  5E6N A;  3DBR I;  2DYO A;  3RCZ A;  5L95 C;  2DYM A;  3TMP B;  4E71 A;  2AEH A;  3R66 C;  2MBQ A;  4FJZ A;  4I6P A;  2PJH A;  4W9L A;  2M8S A;  2BYE A;  2LVO A;  3KYC D;  4I6N B;  3RZW C;  4GMV A;  2FID A;  3ZUN A;  1YQB A;  2KX0 A;  1WGD A;  1OTR B;  4KIK A;  4FA6 A;  2KMC A;  1UD7 A;  2O2V B;  1NBF C;  4BBN C;  4M0W B;  5JHB A;  1IPG A;  4FLH A;  3M62 B;  4CO7 A;  1PQS A;  2JZ3 B;  3GZN I;  1YIW A;  2N1W A;  1WZ0 A;  2EMT A;  3A9J B;  5E6O A;  3RZF A;  4E3C A;  1TTN A;  3QK0 A;  2YVC A;  3SHQ A;  1XD3 B;  3LDZ E;  3ALB A;  4IW0 A;  2CHW A;  2NBU A;  1KM7 A;  1WXM A;  3R3M A;  3QIJ A;  5KHQ A;  4BFR A;  1YX6 B;  1VCB A;  4GIV A;  4M8N A;  4MJS B;  4WWN A;  4XX5 A;  3APD A;  2JWZ A;  4KZ0 A;  5AZF A;  4WAA A;  1RLF A;  2ZZP B;  3DPD A;  3SD5 A;  2MW5 A;  3ML9 A;  2K8C A;  3KUZ A;  2CKH B;  3PPA A;  3DVN V;  5G55 A;  3ZNI D;  2L76 A;  3W1S C;  3CF6 E;  4GOC A;  1BT0 A;  4EFO A;  2RSU A;  2JRI B;  3UIN B;  4K81 A;  3QAQ A;  4FHJ A;  4NPN A;  4TV3 A;  4BVU C;  2BYV E;  3PHW B;  3QCA A;  2N7E A;  3WIM A;  3H7S A;  4DK5 A;  1RFA A;  4IC7 B;  4FJY A;  4JQW C;  4OVV A;  1UBI A;  2IY1 B;  1VD2 A;  4ANW A;  3K9P B;  2MX2 A;  2N9X A;  2KWU B;  2REX A;  5D7G A;  1WMH A;  4HPM B;  2A5U A;  2BF8 B;  4DHJ B;  2EKE C;  4N9F 4;  1YJ1 A;  3NS8 A;  2AL6 A;  3QQ8 B;  4X57 B;  4K1R B;  1SGH A;  1GC6 A;  2LWP A;  2MP2 B;  3CSF A;  2JXX A;  3ZNZ B;  4AJY B;  3V6E B;  3O65 B;  4NQK E;  2NPT B;  5BO4 B;  4EEW A;  2C5L C;  3VUY A;  3RT3 B;  3WAN A;  5AEK B;  3U30 A;  3CST A;  2MBO A;  2KAN A;  1GJZ A;  3V61 A;  3VFK A;  1V81 A;  3EFU A;  4KZC A;  2NVU I;  3B1L X;  4NAW B;  4GB9 A;  2XEW A;  3V6C B;  4B6W A;  4AP4 C;  2FIF A;  2N9P C;  2V4L A;  4IUM B;  4ZRI A;  3ZLZ A;  1UBQ A;  1UZX B;  4ZRJ A;  4EZK A;  3MJW A;  4F8C B;  3RYT A;  3ZNH B;  2MBB B;  3ZRF A;  3P2B A;  1UH6 A;  3UF8 A;  3NZS A;  4JGH B;  2IO3 B;  2Y5B B;  3DBL I;  1E5W A;  3UQB A;  2IY0 B;  2KO3 A;  2KJR A;  2RD0 A;  4RM8 A;  4DDG D;  4E74 A;  4ANX A;  1V5O A;  1P1A A;  4IM0 A;  4HK2 A;  4DHZ E;  4II2 B;  1J19 A;  3UIP B;  2I1K A;  5EDS A;  3SU8 X;  3A4R A;  2KQ7 A;  2KDF B;  2MSE D;  3PRP B;  3HM6 X;  2KDI A;  3B0A A;  1NI2 A;  2KFK B;  3M63 B;  3KH0 A;  5CHW A;  1T0Y A;  1WJU A;  4FHK A;  3ENE A;  2WX0 A;  2DEN B;  2J7Q B;  1U4A A;  2EMS A;  3QAR A;  1TGZ B;  4BKT A;  4F1S A;  2LGX A;  4W9E A;  1UGM A;  3H7P A;  3QC8 B;  4HWI B;  4IM2 A;  3X23 A;  2KJ6 A;  2ZPY A;  4HXD A;  1XQQ A;  2ASQ A;  2JUO A;  1I35 A;  1OEY J;  2LVQ A;  3AU4 A;  3VH3 B;  2ZNV B;  2BKR B;  4AOF A;  3IFW B;  4XZ4 A;  1WR6 E;  3CMM B;  2AL3 A;  3IG3 A;  3KUC B;  4GN1 A;  4HDQ A;  2Z59 B;  4IWO A;  3B08 A;  2WX1 A;  5CHF A;  3VQI A;  4FBJ B;  2KC2 A;  3A1Q B;  1WX7 A;  1EUV B;  5LXI B;  4YL8 A;  4GU2 A;  2JY6 A;  2M4N A;  2JVC A;  3Q3J A;  4KSK C;  4DBG A;  2B3A A;  3VDZ A;  3ZO5 B;  1ZKH A;  2L3Z A;  3PZD A;  3V62 A;  2MWS B;  2NPT A;  1WGY A;  2RPQ A;  3A9K B;  2FCM A;  3PV1 A;  3W1Y A;  2K6Q A;  4P7I A;  3ZVV A;  2L0T A;  3PLU A;  2GMI C;  3ZW3 A;  2GBK A;  3OAW A;  1V6E A;  1Z5S B;  4I6L B;  1WYW B;  4MEM A;  1WJ6 A;  4MGI E;  2M0X A;  3TCA A;  3HM3 A;  3S2A A; 
#chains in the Genus database with same CATH topology
 2HJ1 A;  4NQL B;  3VTV A;  2J52 A;  2JRH A;  3JSV A;  2RDG A;  3SFD B;  1WGG A;  2KFJ A;  2BWF A;  1EO6 A;  4R3D A;  1FNW A;  3PRM B;  1WM3 A;  3AEF B;  1P7E A;  2VH2 A;  1XCT L;  4NNJ B;  2LI5 A;  5JHA A;  1E8Z A;  3ZTD A;  1VLB A;  3M95 A;  1L7Y A;  4HKQ A;  4PS7 A;  2PVG C;  4MAC A;  4G3X B;  4GSW A;  4FUL A;  1EF5 A;  3AEG B;  4NZL B;  2NTT A;  2FUH B;  1FRD A;  3VHT C;  2O6V B;  2LGD A;  3EC8 A;  2PKO A;  5D3D A;  4IOI E;  2ZVO A;  3P4Q B;  4J6I A;  3K9O B;  2GOW A;  4IWP A;  3NG0 A;  4XDC A;  1AWD A;  4EUT A;  1Q1O A;  2OED A;  3QWZ B;  1QLB B;  3AMZ A;  5J17 A;  4RCO A;  4HKZ E;  3A1Q A;  1T0S C;  1OQQ A;  3APF A;  1F1H A;  1XLP A;  2KWV B;  1YJJ A;  2ZCC A;  5C2T B;  3TSS A;  2ZNV C;  4RGN A;  2FNJ B;  3WCQ A;  3OLM D;  2L0F A;  2KQ4 X;  1WGK A;  3AED B;  3JW0 X;  2INN E;  4A3O A;  1ZXH A;  3DBH I;  2SEB D;  5TR5 A;  3IAM 1;  5HHD G;  3X0W A;  3Q8A A;  3DWG C;  1QOG A;  4HVB A;  2BB6 A;  3Q8F A;  4OVU A;  2LXA A;  1TS2 A;  3VUW A;  2V3N A;  4HCP B;  3DCG A;  1AN8 A;  2G9H D;  2LGY A;  2W3R A;  2O6V A;  2LUE A;  2MRP A;  1WRD B;  2KNB A;  1WF9 A;  2AWT A;  1LQB A;  1WI0 A;  2JPH A;  1J7B A;  3R7R A;  1UNS A;  2AQ1 B;  5AZH A;  1F2R I;  3AXC A;  3PO0 A;  2VRR B;  1L0V B;  2Z8L A;  3SFE B;  1F9J A;  4TQ0 A;  1E9M A;  4EZJ A;  2V3S A;  4PYU A;  3BYT B;  2KWC A;  2CJO A;  2PPH A;  4WJN A;  5GMV A;  2BKF A;  1IGC A;  1FEH A;  2LXC A;  5BYS A;  4ASW C;  4ANU A;  2IO0 B;  2JF5 A;  1D6E C;  1I7H A;  2LFI A;  1C78 A;  2BGF A;  3P1M A;  3SEB A;  5FK9 C;  5LLI A;  2N7D A;  2MHJ A;  4IG7 B;  2HE7 A;  2LMC A;  2DZJ A;  5EE9 A;  3N32 A;  4IWQ A;  2DNF A;  4AWJ A;  4PS3 A;  3TL5 A;  4B9K A;  3DQV A;  1WM2 A;  2GBJ A;  2DX5 B;  3BY4 B;  2J53 A;  1E7V A;  3DOW A;  4MGY E;  2DLB A;  1H8C A;  2VZK B;  3KVF B;  4DHZ B;  3U2S C;  2JZZ A;  3T3O A;  3R2I A;  1R4N B;  2GBM A;  4A8X C;  4L23 A;  2WU2 B;  1N5W A;  3EEC A;  4W9H A;  4A3P A;  1OFF A;  3Q3F A;  5DPW A;  2M56 B;  3PS6 A;  2MJ3 A;  2BT6 A;  3GOE A;  2PTL A;  1NYQ A;  2L7R A;  4BOS C;  2KC1 A;  4HJK A;  1HQR D;  1ET9 A;  1E7U A;  2D3G A;  2AQ2 B;  2MBH A;  2C60 A;  1PFD A;  4F7Z A;  2K8B A;  3Q14 C;  1MHX A;  1S3S G;  3DVG Y;  3ZTC A;  1R7S A;  2CS4 A;  2MA9 B;  4GDK A;  3KWV A;  1XO3 A;  1IBX B;  1GNU A;  2K1F A;  4LDT D;  4PS8 A;  2JSV X;  1TIF A;  2KDM A;  1JML A;  3AE6 B;  1TKE A;  3A4S C;  2WXH A;  4ZRK A;  3WAP A;  3AE4 B;  1D5Z C;  4CHK A;  2B76 B;  3R2T A;  1TS4 A;  2L52 A;  4LJO B;  1WH3 A;  3FIL B;  2J0J A;  2NMQ A;  3AN1 A;  1LFD A;  4W9G A;  3HIZ A;  1XLO A;  4RFB A;  2JYT A;  2KDB A;  2YEP B;  5E6N A;  1K53 A;  2AEH A;  2PJH A;  1HZ5 A;  2WXL A;  3NUH B;  1GB4 A;  4I6N B;  4GMV A;  1SF0 A;  2O2V B;  4YWG G;  1ENF A;  4US9 A;  2OJW A;  2JZ3 B;  3GZN I;  3RZF A;  1WZ0 A;  1I4Q A;  1R4M B;  2YVC A;  5EE3 A;  3B2F A;  2CHW A;  2QIE B;  3BVZ A;  1M4V A;  1KM7 A;  5FKA C;  2WXQ A;  4BFR A;  3MP9 A;  2W55 A;  1MVK A;  4YTP B;  2PVO D;  1IBX A;  2ZZP B;  3SD5 A;  1FCC C;  2RDB C;  3KUZ A;  2CKH B;  1FNV A;  2QC8 A;  3ZQ4 A;  4NPN A;  4DXF A;  2N7E A;  3RMK C;  3DBR B;  4IC7 B;  4OVV A;  3IXS A;  3ZXR A;  3UI3 A;  1WMH A;  4HPM B;  1BUI C;  2LGS A;  1D5X C;  4DHJ B;  3KWL A;  2JXT A;  4N9F 4;  1YJ1 A;  2J42 A;  4WAF A;  4X57 B;  1SGH A;  4JPS A;  1D5M C;  2LWP A;  2MP2 B;  3CSF A;  4AJY B;  2AQ3 B;  3V6E B;  1T6B X;  2NPT B;  3VUY A;  2MBO A;  1GJZ A;  3HVZ A;  4NAW B;  4KZC A;  2NVU I;  2WGS A;  3P42 A;  3BZD B;  4AP4 C;  4ZRI A;  4EZK A;  4ZRJ A;  4PT5 A;  5BMG A;  2KT7 A;  4RGM A;  3UQB A;  4HJG E;  1P1A A;  2KVZ A;  4DHZ E;  4IKG A;  4WIP A;  2W54 A;  3B0A A;  2KFK B;  3M63 B;  1WJU A;  4FHK A;  3ENE A;  1RFK A;  4UDU C;  2IND C;  4YSX B;  2WXR A;  3H7P A;  3QC8 B;  3LYY A;  4IM2 A;  2KJ6 A;  2ZPY A;  1I35 A;  3VH3 B;  2BTE A;  4WQM A;  4AOF A;  3IFW B;  1WR6 E;  2CU3 A;  2GB1 A;  3CMM B;  3IG3 A;  4IWO A;  5CHF A;  4XYC A;  2WX1 A;  3EUB 2;  1WX7 A;  1E0Z A;  4YL8 A;  1BXT A;  2JY6 A;  2M4N A;  3Q3O C;  2JX5 A;  3VDZ A;  3MC8 A;  3ZO5 B;  2NPT A;  4KGT A;  3A9K B;  2FCM A;  3PV1 A;  4P7I A;  3RNA C;  3PLU A;  3W5V B;  2V9H A;  2X38 A;  3IT6 B;  2ACZ B;  3TCA A;  3B2G A;  1HEZ E;  4NAW A;  4NJ6 A;  4EKU A;  3AE7 B;  2K25 A;  3AI5 A;  4C7Z A;  1GB1 A;  2WXI A;  2D5G A;  1PYW D;  1WXA A;  1OGW A;  3FC4 A;  2DAF A;  3N30 A;  1SBB B;  3MHS D;  2ZJD A;  1P0R A;  1T5X D;  1V9J A;  1SE9 A;  2DZI A;  1L2N A;  4AQ7 A;  3VUX A;  3TEW A;  1E8Y A;  2I38 A;  4GGQ A;  2FCN A;  3OJ3 A;  3IHP C;  5AZG A;  2BS2 B;  3KLS X;  4FAD A;  2RDH A;  4ZYN A;  2G4D B;  4WWM A;  2UU7 A;  1Q0W B;  1WSP A;  2MEK A;  1WJN A;  2N4F A;  2BVC A;  3U8Z A;  2ZEQ A;  1TS3 A;  1CMX B;  1UUP A;  1PUT A;  2KMA A;  3L13 A;  3VAW A;  2LGI A;  4N59 A;  4LDT B;  1WFY A;  1YJI A;  1ROE A;  4BKS D;  4IDI A;  5FR3 A;  1KH0 A;  3IBE A;  3VTU A;  4YT0 B;  3HVD A;  3KYD D;  4L2Y A;  3ZDT A;  3B9J A;  3A9J A;  4HPL B;  5D94 A;  2V3P A;  4AS1 A;  1WZ3 A;  2IO1 B;  1E8W A;  5G2N A;  2DZK A;  2WXG A;  4MJS A;  2KJH B;  3IVF A;  4EZL A;  4RGT A;  4HDO A;  1D3Z A;  1FRR A;  3V05 A;  2K9X A;  2FAZ A;  1MJD A;  1PDX A;  3AUL A;  2CR5 A;  1C79 A;  3RFZ B;  1WXQ A;  4ZDV A;  1KTK A;  1I4R A;  1Y8R C;  2KXJ A;  3NOB A;  1UWX A;  3PTF C;  3L0W B;  4W9I A;  3EA6 A;  1A5R A;  2HD5 B;  4M02 A;  2K8H A;  1CZP A;  3L54 A;  2D3C A;  2C9W B;  4KV2 A;  2KAC A;  2K22 A;  3L4P A;  2SAK A;  1HTQ A;  3H9D A;  2ZW1 A;  3WA0 A;  4P6V F;  4LLG M;  1WWT A;  3R8B A;  3EGR A;  1B9R A;  3DBH B;  1V80 A;  2WDT B;  2QHO A;  2BS3 B;  3APC A;  2KOX A;  1LXD A;  1EU4 A;  1RRB A;  2IBI B;  3ZIM A;  1LGR A;  4ARC A;  1WGH A;  4D2K A;  2Z0D B;  3TEZ A;  3DVG X;  2QMT A;  4OW0 A;  2BS4 B;  3Q8C A;  4JLC A;  1NYR A;  2NS5 A;  2N1V A;  2W3S A;  1JRU A;  2HJ8 A;  2L00 B;  1P98 A;  1WE6 A;  5DCN A;  3GB1 A;  3GP7 A;  4WJP A;  1QF6 A;  4J3O D;  1EF1 A;  1V1O A;  5AUK A;  3SR6 A;  1WY8 A;  4ANV A;  4YTN B;  1WR1 A;  1S1Q B;  3L08 A;  4FN2 A;  2DHZ A;  4P1C C;  1ZW7 A;  2C7N B;  1YN5 A;  3AE1 B;  2KDE B;  4GLS C;  1L4D B;  3HK0 A;  4KIK B;  3MFG A;  1WGR A;  4N58 A;  4G11 A;  3E56 A;  2ZCB A;  4YTM B;  1V86 A;  4MGZ E;  1WYG A;  3T9L A;  1ZGU B;  3SDL C;  1YN4 A;  4PK1 A;  5IA7 A;  5CTR C;  2WXM A;  5IP4 D;  3TJP A;  4LTU A;  1HTO A;  2WXN A;  2WXP A;  3VXW A;  4DHJ D;  1JWS D;  4K3C A;  2KK8 A;  3N1Z C;  2IO2 B;  4QAY A;  1YX5 B;  2QCZ A;  3URY A;  4II3 B;  4NAM A;  4DDI D;  2J0M A;  2BW2 A;  1GOZ A;  4RM9 A;  1I4X A;  4ZOH C;  3P4R B;  1FO4 A;  2MH7 A;  4B0E A;  3U7D A;  4IM3 A;  2MCN B;  3V60 A;  2WP9 B;  4MT5 A;  4XC2 A;  2GLS A;  3VH4 B;  4NJ7 A;  2PLP A;  2J0K A;  1GC7 A;  5IAA C;  4DXA B;  4ICU A;  1TY2 A;  5JZE B;  4NY0 A;  2Y5P A;  2DYO A;  5L95 C;  4E71 A;  3R66 C;  4I6P A;  3BYY B;  4W9L A;  2M8S A;  2BYE A;  3RZW C;  3VR9 B;  4ARI A;  1YQB A;  1WGD A;  4KIK A;  1Y56 A;  1NEK B;  2N0S B;  1PGB A;  1UD7 A;  4BBN C;  4M0W B;  5JHB A;  1I4H A;  4FLH A;  1N6Z A;  3M62 B;  4CO7 A;  5E6O A;  1TTN A;  3PZ8 A;  2WXJ A;  1XD3 B;  3ALB A;  5TSS A;  3R3M A;  1WXM A;  3QIJ A;  1E7P B;  3ZJU A;  2E3T A;  4GIV A;  4XX5 A;  2JWZ A;  5AZF A;  1RLF A;  2INP E;  2JWU A;  2K8C A;  2H88 B;  1K51 A;  3NJT A;  4LNF A;  2JRI B;  3QAQ A;  1C9F A;  3AEC B;  2FE8 A;  3H7S A;  1DYQ A;  4DQO C;  1DOY A;  1QT9 A;  1RFA A;  4FJY A;  2IY1 B;  2PIA A;  1VD2 A;  2WXF A;  4ANW A;  3NVY A;  2MX2 A;  3BVG A;  4JX1 C;  3BVM A;  4A90 A;  5G5H A;  1FD6 A;  3QQ8 B;  1GC6 A;  2LUM A;  1TYG B;  1QIL A;  2C5L C;  3C19 A;  3RT3 B;  4XGA B;  1V81 A;  3B1L X;  2XEW A;  4B6W A;  4M0W A;  2NTS A;  3ZLZ A;  3RYT A;  1VZ7 A;  2MBB B;  3IT4 B;  1SSN A;  4JGH B;  3I63 C;  3DBL I;  1E5W A;  2YEP F;  2KO3 A;  4RM8 A;  4DDG D;  1CJE A;  1SEB D;  5LNK 1;  2GI9 A;  3UIP B;  2ON8 A;  1VRA B;  1FMA D;  2BB5 A;  3SU8 X;  4S0R A;  3PRP B;  3HM6 X;  2GRI A;  3C8Y A;  2R61 A;  4OHJ A;  1YQ4 B;  3Q3M C;  2EMS A;  1TGZ B;  2LGX A;  1UGM A;  3X23 A;  1XQQ A;  1NI3 A;  1OEY J;  3AU4 A;  2ZNV B;  3KUC B;  4FBJ B;  1N5X A;  1EUV B;  2XN9 C;  4KKJ A;  3LB8 C;  3P63 A;  4KSK C;  2B3A A;  1SJE D;  3PZD A;  2RPQ A;  1L5P A;  3W1Y A;  3OAW A;  4TMA B;  4MGI E;  2M0X A;  1C3T A;  3S2A A;  3NHE B;  1SB3 C;  4ACF A;  4C00 A;  3IAS 1;  1WJ4 A;  1FNU A;  2BYF A;  2G3Q B;  2D3A A;  1KLG D;  1QOA A;  5D2M B;  1CK1 A;  3V3X A;  1T0Q C;  3JVZ X;  1FM0 D;  4K7S A;  2ZVN A;  3AE5 B;  3N20 C;  3VTW A;  1B1Z A;  2GBR A;  5H8Y E;  1OQR A;  2RMM A;  3Q6B A;  1FPY A;  2ZPN A;  5IO9 A;  3RNC C;  3AH7 A;  4XWW A;  2KQS A;  1G6J A;  4KKI A;  3FIL A;  3FKY A;  3DBS A;  4A6Q A;  3AV8 A;  3VR8 B;  2X8X X;  3L16 A;  1YN3 A;  2JU6 X;  3DVN U;  2IYD B;  1J0G A;  3NZ3 A;  4MSQ B;  4MEL A;  4PYZ A;  2PW9 A;  3HHM A;  1KLU D;  2MJE A;  2L83 A;  2DAJ A;  2NBW B;  1WXV A;  1RM6 C;  4C4V B;  3WAO A;  3GE8 C;  1ZUD 2;  2QSD A;  2IPK D;  2V1Y A;  1TBE A;  2L8J A;  3UGB B;  2O2V A;  3A33 B;  4MH8 A;  3MHZ A;  4OZC A;  2M1M A;  4TQ1 A;  4A9A A;  3UIO B;  3ZGZ A;  2KYW A;  2WLB A;  4Q2J A;  1Z2M A;  5BMI A;  3QA8 A;  2KKC A;  2KLC A;  1XLN A;  1JCK B;  1FIQ A;  1C4C A;  2J4X A;  4MGK E;  2FBW B;  3ZKJ C;  1KJT A;  3P4P B;  2KHW B;  4A55 A;  4ITK A;  1OQY A;  2LRW A;  2LZ6 A;  4KSL C;  5KHO A;  2XNA C;  4US8 A;  1SIJ A;  1TKG A;  1L6U A;  1J7A A;  1EM7 A;  2L05 A;  3PSE B;  2RGF A;  2KMM A;  2IZV B;  4KGR A;  1NEN B;  4CYE A;  1E90 A;  1L0Y B;  1JQ4 A;  2VH1 A;  2L1A A;  4JWS C;  4B95 A;  2Z0E B;  4GDL B;  2RR9 A;  4JL9 A;  4DWF A;  2MP2 A;  3L10 B;  5IN7 A;  3MC9 A;  2DWQ A;  2KTR B;  3N3K B;  4C4V A;  5C1Z A;  4FJV B;  4WWP A;  1TY0 A;  3PRZ A;  5CX3 A;  2G45 B;  2KLG A;  4WQO B;  2D07 B;  2PEA A;  5J2R A;  4A20 A;  3VVW B;  1JWU D;  1SE3 A;  4EOY A;  2JQR B;  1J7C A;  2WQY B;  1QQR A;  1GUA B;  3Q3N C;  1KF6 B;  1M94 A;  1AAR A;  2LRU A;  5T8I A;  3PHX B;  2UWQ A;  3UQA A;  1SIF A;  1FXA A;  3EHV A;  2K3U A;  2KFK A;  5C23 A;  1E8X A;  5G5G A;  2LD9 A;  1VZ8 A;  2KZR A;  1ZPS A;  2KX3 A;  1VR9 A;  2G1E A;  3H1U A;  4ZHP A;  1N61 A;  3T8M A;  2BPS A;  3RD2 A;  3RUL A;  4W9C A;  1QOF A;  3FAH A;  5H92 C;  1L6V A;  1LM8 B;  3QX1 A;  1L4Z B;  2IGH A;  4GXB A;  2RPV A;  1LO5 D;  1N63 A;  3U4E G;  1K8R B;  3AB5 A;  4GDL A;  4TKN A;  4TSS A;  1EWY C;  2ONQ A;  1GG3 A;  1JAL A;  3AU5 A;  3KUD B;  4W9K A;  4BKG A;  3A9K A;  3TBL D;  1XXG A;  3VRB B;  2KTR A;  3WAM A;  4ICV A;  1C77 A;  3D32 A;  4ZHO A;  2NBV B;  1FXI A;  1IP9 A;  2QEJ C;  2HTH A;  3JSV B;  2FCQ A;  4WJO A;  1YMH E;  2BBC A;  3TIX A;  3T3N A;  4W9J A;  2K6D B;  1ISN A;  3NRZ A;  3ML8 A;  2G4S A;  5GXG B;  2KVR A;  2XBB C;  1HXY D;  1QZE A;  1GPX A;  4KDL B;  4MDK E;  1C1Y B;  1ZDV A;  4G50 A;  2N9L A;  4AUQ C;  1WX9 A;  2OOB B;  2QJL A;  1RYJ A;  1Q5W B;  4G0N B;  1XT9 B;  3J9C A;  4C7Y A;  4P1B C;  4HPP A;  3ONS A;  1TZ1 A;  3OJ4 B;  2NR2 A;  2DYM A;  4BZA A;  2LHE A;  2MBQ A;  3ABV B;  2LVO A;  4KGS A;  4RGO S;  2FID A;  2KX0 A;  2WNM A;  4FA6 A;  2KMC A;  1NBF C;  2Y5C A;  1PQS A;  1YIW A;  2N1W A;  2EMT A;  1DOX A;  5HG2 A;  3QK0 A;  3SHQ A;  3OG5 A;  1K52 A;  5BYR A;  3LDZ E;  2HDE A;  4IW0 A;  2FUG 1;  4M8N A;  4WWN A;  3APD A;  4WAA A;  2WU5 B;  2EKI A;  1YNT E;  1C4P A;  4C56 C;  3PPA A;  3DVN V;  3CWI A;  3ZNI D;  4GOC A;  1BT0 A;  2QDF A;  4EFO A;  3MJ5 A;  4K81 A;  4FHJ A;  3TEY A;  1VDV A;  3QCA A;  4LNO A;  4JQW C;  1UBI A;  5D7G A;  2Y3A A;  1XLQ A;  5HI1 A;  2EKE C;  1EWC A;  1N62 A;  3TEX A;  3BII D;  2H89 B;  5BO4 B;  1ZE3 D;  3ZYY X;  5AEK B;  5HFY A;  4HEA 1;  3V61 A;  3VFK A;  3EFU A;  4GB9 A;  3V6C B;  4HRS A;  5MPO A;  2N9P C;  4IUM B;  1UBQ A;  1UZX B;  3NVW A;  2IGD A;  4REZ A;  4F8C B;  2K0P A;  3ZRF A;  4M01 A;  3P2B A;  3GS2 A;  5I4D A;  1D4B A;  3UF8 A;  3NZS A;  2Y5B B;  2IY0 B;  2RD0 A;  1TS5 A;  4ANX A;  4RNA A;  1V5O A;  3HRD D;  3U7Z A;  4II2 B;  2IDY A;  2JZP A;  2KQ7 A;  2KDF B;  1E10 A;  3KH0 A;  1T0R C;  1STE A;  1NVI D;  2DEN B;  3N9Y C;  2J7Q B;  1U4A A;  4S17 A;  4W9E A;  1JRO A;  3W2D A;  2ASQ A;  2JUO A;  4OVZ A;  1SXT A;  1YQ3 B;  1V8C A;  4RH6 A;  4XZ4 A;  1F77 A;  4HDQ A;  4GN1 A;  3RNG C;  2Z59 B;  1I4G A;  4USA A;  1SE2 A;  4GU2 A;  3Q3J A;  1XCQ L;  1I4P A;  1WGY A;  3ZVV A;  1UF0 A;  4C80 A;  3ZW3 A;  2L0T A;  1ZP0 B;  1V6E A;  1VJK A;  3H8H A;  4RMA A;  3HM3 A;  3DBL B;  1BML C;  1CQV A;  1VZ6 A;  1TJE A;  2KAJ A;  3MTN B;  3HUI A;  4YSY B;  3W1S A;  3AE3 B;  2EEL A;  3I57 A;  4BOZ B;  1FFV A;  2BYT A;  3AE8 B;  4GDK B;  2V0G A;  1JRP A;  3ZNG C;  3QJZ A;  1V97 A;  2PE9 A;  1P9D U;  2NCN A;  3KQ4 A;  4W9F A;  1FCL A;  5HKH A;  4JIO U;  2DZM A;  2MLB A;  3CIR B;  2K39 A;  1QOB A;  1I42 A;  5AUI A;  1KOT A;  1ACC A;  1DGJ A;  2CHX A;  5BMH A;  1KLV A;  4EE2 A;  1UGJ A;  3AE2 B;  1J8C A;  1QKZ A;  3PGE A;  3Q8E A;  1GAQ B;  1HE8 A;  4HLE A;  1K50 A;  3GZN B;  2GBN A;  2QIL A;  1AYF A;  2N9E B;  2A4Z A;  3OWE B;  1RAX A;  2WS3 B;  2DYB A;  2AYO B;  4YSZ B;  5BYQ A;  2D2Q A;  4MSM B;  5JXV A;  3MC0 B;  2KN5 A;  2KTF A;  4KVG B;  5D6J B;  1P3Q U;  2WDV B;  1JWA D;  3L17 A;  1IYF A;  5CHV C;  4BKS A;  2WWZ A;  4LCD E;  1X1M A;  1F52 A;  3NZU A;  4MM3 B;  5DPS A;  5DPT A;  5LXH A;  4WJQ A;  4LNK A;  1WRI A;  4L1B A;  2D3B A;  3N1X C;  3H6N A;  1IUE A;  1WIA A;  2INC C;  2IJ0 A;  4H2A A;  3AEB B;  2MQJ A;  2KD0 A;  3C0R B;  2R2Q A;  1MG4 A;  4B0M A;  1EU3 A;  1WMH B;  3I3T B;  4NJC A;  2W9N A;  2I2Y A;  2LJ5 A;  2XK5 B;  3RUI B;  4FXC A;  4XDD A;  1TZO A;  2YLM A;  1R4N I;  4LJP B;  2PE6 B;  1XEE A;  4WUR A;  1UWM A;  4K7W A;  3ZDM C;  1JWB D;  2CJN A;  1NDD A;  3ECI A;  3KW5 B;  5JH5 C;  1MG8 A;  1C4A A;  4LNI A;  2LAS A;  1H4R A;  3PLV A;  2CHZ A;  4ZYS A;  3LJ3 A;  3PVL A;  4WH4 A;  1Q10 A;  5EE0 A;  3U52 E;  4M8M A;  1WX8 A;  3W5U B;  1OEY A;  3ZRC A;  4WWO A;  4MM3 A;  4BBN F;  1SE4 A;  1T3Q A;  5L83 A;  4MH0 E;  5DPR A;  4HCN B;  5E6J A;  2E6X A;  2FCS A;  5EE1 A;  4K7U A;  3BK1 A;  3QHT A;  4N6E B;  3DDC B;  3H7P B;  2OJR A;  3DWM A;  4XWT A;  1WE7 A;  1C76 A;  1UEL A;  4BAX A;  1V2Y A;  2PMV A;  4URK A;  2CU1 A;  2JT4 B;  3W9C B;  1KRH A;  2XK5 A;  1FXT B;  4AJW A;  1YOV B;  3R7Q A;  1WXS A;  3M3J A;  1TT5 B;  2M17 A;  2O6V D;  3NY5 A;  4KDI C;  2BWE S;  4TUU A;  5IOI A;  2R2O A;  2MJD A;  2WHI A;  2UYZ B;  3WAL A;  1P7F A;  3Q8B A;  4RF0 A;  2HTM E;  4XE0 A;  2LVP A;  1MPE A;  3PRE A;  4KX6 B;  4JE3 B;  2KN4 A;  5E6P A;  1R4M I;  1JWM D;  2C7H A;  3PT2 B;  2I1J A;  1HA5 A;  1V49 A;  2N9K A;  2MBE A;  3E9S A;  3JYU A;  3RN9 C;  3RNE C;  2D11 A;  1YD8 U;  4ZRP A;  3PZ7 A;  4JWU C;  5FR6 A;  2C7M B;  2D10 A;  1ESF A;  2ICI A;  1PGA A;  2WYQ A;  3NVZ A;  1V5T A;  3BIN A;  5J18 A;  2AX5 A;  4W9D A;  2L32 A;  1MFW A;  2TSS A;  3DBR I;  3RCZ A;  3ZJV A;  3TMP B;  3NS1 A;  3ZJT A;  4FJZ A;  1F2R C;  2WXO A;  3NVV A;  3KYC D;  3AEA B;  3Q2A C;  3ZUN A;  2JYE A;  1OTR B;  3DHG C;  3ZXV A;  3EFC A;  3RNB C;  2M0A A;  1IPG A;  1F0Z A;  1PGX A;  1ZOY B;  3A9J B;  4E3C A;  2LHD A;  1SJH D;  4K3B A;  3AE9 B;  2NBU A;  4OZA A;  5KHQ A;  2WXK A;  1IGD A;  1YX6 B;  1VCB A;  4MJS B;  2OHF A;  4KZ0 A;  2WDR B;  1MHH E;  4M00 A;  3DPD A;  3I5J C;  2MW5 A;  3ML9 A;  1HZ6 A;  1AW7 A;  5G55 A;  3TUO A;  5D3I B;  2L76 A;  3W1S C;  3CF6 E;  1ET6 A;  2RSU A;  4RF1 A;  2LJI A;  1V1P B;  3UIN B;  4TV3 A;  4BVU C;  4YXD B;  2BYV E;  3PHW B;  3WIM A;  4DK5 A;  4OZB A;  3K9P B;  2M19 A;  2N7J A;  2N9X A;  2KWU B;  2REX A;  2A5U A;  2BF8 B;  2KWD A;  3NS8 A;  2AL6 A;  4K1R B;  2DBY A;  2JXX A;  3ZNZ B;  1RWS A;  3O65 B;  4NQK E;  4EEW A;  3WAN A;  3BWU D;  3CST A;  3U30 A;  4LK0 M;  5C3J B;  3AM9 A;  2KAN A;  4CQN A;  3GE3 C;  1MI0 A;  3I9V 1;  4P16 A;  1TKY A;  2FIF A;  2V4L A;  2IGG A;  3DHI C;  3MJW A;  2V4I B;  3ZNH B;  1E6E B;  3VRA B;  3O13 A;  1UH6 A;  2LEK A;  2VZK D;  3LXF A;  1DOI A;  2IO3 B;  5IKC M;  2KJR A;  4E74 A;  1XF5 L;  3RPF C;  4IM0 A;  4HK2 A;  2W82 A;  1J19 A;  3BK2 A;  1JW9 D;  2I1K A;  3Q69 A;  5EDS A;  3A4R A;  1ZXI A;  2ZW0 A;  4O1N A;  2MSE D;  3DHH C;  2KDI A;  1NI2 A;  4HRO A;  5CHW A;  1T0Y A;  3RNF C;  2WX0 A;  2WDQ B;  1V1P A;  3QAR A;  4BKT A;  4ZRQ A;  4F1S A;  1KFY B;  4HWI B;  1A70 A;  4HXD A;  4DXG A;  1ZDX A;  2LVQ A;  2BKR B;  2K5P A;  3ETR A;  2AL3 A;  3VQI A;  3B08 A;  2KC2 A;  3A1Q B;  1FFU A;  5LXI B;  2JVC A;  4LNN A;  4DBG A;  1N60 A;  3RI7 C;  3AEE B;  1ZKH A;  2L3Z A;  3P4S B;  3V62 A;  2MWS B;  2K6Q A;  2GMI C;  2GBK A;  1Z5S B;  4I6L B;  1L0X B;  2Q5W D;  1WYW B;  4MEM A;  1WJ6 A;  2BQQ A;  3N1Y C; 
#chains in the Genus database with same CATH homology
 3NHE B;  4NQL B;  4EKU A;  4NAW A;  4NJ6 A;  3VTV A;  2JRH A;  2K25 A;  3AI5 A;  3JSV A;  3MTN B;  1WGG A;  3W1S A;  2KFJ A;  2BWF A;  1EO6 A;  3PRM B;  1WJ4 A;  1WM3 A;  1WXA A;  4NNJ B;  2BYF A;  1OGW A;  2G3Q B;  2DAF A;  2LI5 A;  5JHA A;  5D2M B;  4BOZ B;  3N30 A;  1E8Z A;  4GDK B;  3JVZ X;  3ZTD A;  3MHS D;  4K7S A;  2ZJD A;  2ZVN A;  3M95 A;  3VTW A;  1P0R A;  3ZNG C;  1V9J A;  3QJZ A;  1SE9 A;  2PE9 A;  1P9D U;  2NCN A;  2DZI A;  1L7Y A;  4W9F A;  4PS7 A;  1L2N A;  2GBR A;  3VUX A;  1E8Y A;  5HKH A;  4GGQ A;  4JIO U;  2DZM A;  4G3X B;  4GSW A;  2ZPN A;  2FCN A;  2MLB A;  1EF5 A;  3OJ3 A;  4FUL A;  3IHP C;  5AZG A;  4FAD A;  2K39 A;  2KQS A;  1G6J A;  2FUH B;  4ZYN A;  3VHT C;  1I42 A;  2O6V B;  1KOT A;  2CHX A;  2G4D B;  2LGD A;  3EC8 A;  3DBS A;  1Q0W B;  1KLV A;  2ZVO A;  1WJN A;  4J6I A;  3K9O B;  2N4F A;  2GOW A;  3L16 A;  3DVN U;  4IWP A;  3U8Z A;  2ZEQ A;  1J8C A;  2IYD B;  1J0G A;  4MSQ B;  4MEL A;  1CMX B;  2KMA A;  3PGE A;  3L13 A;  4PYZ A;  3VAW A;  4EUT A;  1HE8 A;  4HLE A;  1Q1O A;  3HHM A;  4LDT B;  1WFY A;  3QWZ B;  5J17 A;  2GBN A;  4BKS D;  2DAJ A;  2NBW B;  1WXV A;  2N9E B;  2A4Z A;  3A1Q A;  1RAX A;  3WAO A;  3IBE A;  2DYB A;  2AYO B;  3APF A;  2ZCC A;  2KWV B;  1TBE A;  2V1Y A;  2ZNV C;  2L8J A;  3UGB B;  2O2V A;  3A33 B;  2D2Q A;  4MSM B;  3VTU A;  4TQ1 A;  3KYD D;  2M1M A;  2FNJ B;  3UIO B;  3ZDT A;  2KN5 A;  3A9J A;  1Z2M A;  3QA8 A;  2KKC A;  3OLM D;  2KTF A;  4HPL B;  4KVG B;  5D6J B;  5D94 A;  2L0F A;  2KLC A;  1P3Q U;  1WZ3 A;  2IO1 B;  1E8W A;  3JW0 X;  3L17 A;  5G2N A;  2DZK A;  4A3O A;  1IYF A;  5CHV C;  3DBH I;  4MJS A;  4MGK E;  4BKS A;  3ZKJ C;  2WWZ A;  2KJH B;  1KJT A;  3IVF A;  4EZL A;  2KHW B;  5TR5 A;  1OQY A;  4HDO A;  4LCD E;  1D3Z A;  2LRW A;  1X1M A;  2LZ6 A;  3X0W A;  3NZU A;  4KSL C;  2FAZ A;  4HVB A;  5KHO A;  5DPS A;  4OVU A;  2LXA A;  5DPT A;  3AUL A;  2CR5 A;  3VUW A;  5LXH A;  4WJQ A;  4HCP B;  4ZDV A;  3DCG A;  2L05 A;  3PSE B;  1Y8R C;  2KXJ A;  3NOB A;  3PTF C;  3L0W B;  2RGF A;  4W9I A;  2LGY A;  2IZV B;  2O6V A;  1A5R A;  2LUE A;  2MRP A;  3H6N A;  1WRD B;  2HD5 B;  4CYE A;  1E90 A;  2K8H A;  1WIA A;  2KNB A;  1WF9 A;  2AWT A;  1LQB A;  2MQJ A;  1WI0 A;  3L54 A;  2JPH A;  4B95 A;  2C9W B;  2KD0 A;  2Z0E B;  3C0R B;  3R7R A;  2R2Q A;  4KV2 A;  4GDL B;  2RR9 A;  4JL9 A;  4DWF A;  2MP2 A;  1WMH B;  3L10 B;  5AZH A;  3I3T B;  2W9N A;  3H9D A;  2LJ5 A;  3WA0 A;  2XK5 B;  3AXC A;  3RUI B;  2KTR B;  2VRR B;  3N3K B;  1F9J A;  2YLM A;  4TQ0 A;  5C1Z A;  1R4N I;  4LJP B;  4FJV B;  4WWP A;  2PE6 B;  4EZJ A;  2V3S A;  3PRZ A;  4PYU A;  5CX3 A;  2G45 B;  4RMA A;  2KLG A;  4WQO B;  4K7W A;  2KWC A;  2D07 B;  2PEA A;  3ZDM C;  1V80 A;  2PPH A;  2WDT B;  2QHO A;  1NDD A;  3ECI A;  4WJN A;  5J2R A;  4A20 A;  3KW5 B;  5GMV A;  2BKF A;  3APC A;  2KOX A;  5JH5 C;  2LXC A;  4ASW C;  1MG8 A;  3VVW B;  4ANU A;  2IO0 B;  2JF5 A;  1LXD A;  2LAS A;  1H4R A;  4EOY A;  1RRB A;  3PLV A;  2BGF A;  2CHZ A;  2IBI B;  3ZIM A;  3LJ3 A;  1GUA B;  1WGH A;  1M94 A;  5LLI A;  3PVL A;  2Z0D B;  2N7D A;  1AAR A;  4IG7 B;  2LRU A;  2HE7 A;  3PHX B;  3DVG X;  4M8M A;  2UWQ A;  3UQA A;  1WX8 A;  1SIF A;  1OEY A;  3EHV A;  3ZRC A;  2DZJ A;  3N32 A;  4WWO A;  4IWQ A;  4JLC A;  2KFK A;  4MM3 A;  5C23 A;  4BBN F;  2NS5 A;  1E8X A;  2N1V A;  1JRU A;  2HJ8 A;  4AWJ A;  2L00 B;  4PS3 A;  4MH0 E;  5DPR A;  4HCN B;  3TL5 A;  4B9K A;  5L83 A;  1P98 A;  2LD9 A;  1WE6 A;  2FCS A;  3DQV A;  1WM2 A;  2GBJ A;  2KZR A;  5DCN A;  2KX3 A;  2DX5 B;  3BY4 B;  3H1U A;  1C3T A;  1E7V A;  4WJP A;  4K7U A;  3DOW A;  3QHT A;  1EF1 A;  4MGY E;  3T8M A;  1H8C A;  3KVF B;  2BPS A;  3DDC B;  4DHZ B;  1WY8 A;  3H7P B;  3RD2 A;  3RUL A;  2OJR A;  4W9C A;  4ANV A;  2JZZ A;  1WR1 A;  1LM8 B;  3QX1 A;  1S1Q B;  3L08 A;  2GBM A;  1WE7 A;  4GXB A;  4FN2 A;  2DHZ A;  1UEL A;  1V2Y A;  1K8R B;  1ZW7 A;  4GDL A;  4TKN A;  4URK A;  2CU1 A;  2C7N B;  2JT4 B;  1GG3 A;  3AU5 A;  3KUD B;  2KDE B;  3EEC A;  4W9K A;  4W9H A;  3A9K A;  3TBL D;  4BKG A;  4A3P A;  3HK0 A;  4KIK B;  2XK5 A;  3Q3F A;  5DPW A;  3WAM A;  1WGR A;  2KTR A;  3PS6 A;  4ICV A;  4G11 A;  3GOE A;  3D32 A;  1FXT B;  4AJW A;  3R7Q A;  2ZCB A;  2L7R A;  4BOS C;  1V86 A;  4MGZ E;  1WXS A;  2KC1 A;  2NBV B;  3M3J A;  3T9L A;  4HJK A;  1E7U A;  2D3G A;  1ZGU B;  2M17 A;  3SDL C;  2MBH A;  5IA7 A;  1IP9 A;  5CTR C;  2O6V D;  2C60 A;  3NY5 A;  3TJP A;  4KDI C;  2BWE S;  2HTH A;  4TUU A;  4F7Z A;  2K8B A;  1S3S G;  3DVG Y;  2R2O A;  3JSV B;  3ZTC A;  3VXW A;  4DHJ D;  2UYZ B;  2CS4 A;  3WAL A;  2FCQ A;  2MA9 B;  4WJO A;  4GDK A;  2KK8 A;  3TIX A;  2LVP A;  1GNU A;  2K1F A;  3PRE A;  4LDT D;  2K6D B;  2IO2 B;  1ISN A;  4PS8 A;  4W9J A;  3ML8 A;  5E6P A;  1YX5 B;  1R4M I;  2G4S A;  2C7H A;  4II3 B;  2KVR A;  3PT2 B;  2XBB C;  1QZE A;  4DDI D;  2I1J A;  2J0M A;  1V49 A;  3A4S C;  2MBE A;  3JYU A;  4KDL B;  4MDK E;  4ZRK A;  3WAP A;  2D11 A;  1C1Y B;  1YD8 U;  4RM9 A;  4CHK A;  4G50 A;  4AUQ C;  1WX9 A;  2OOB B;  5FR6 A;  3U7D A;  4IM3 A;  2MCN B;  2C7M B;  2D10 A;  3V60 A;  1Q5W B;  4G0N B;  1XT9 B;  4LJO B;  4XC2 A;  3VH4 B;  1WH3 A;  2J0J A;  2WYQ A;  1TZ1 A;  3ONS A;  4NJ7 A;  2J0K A;  1GC7 A;  1LFD A;  3OJ4 B;  5IAA C;  4W9G A;  1V5T A;  3HIZ A;  3BIN A;  4DXA B;  5J18 A;  4ICU A;  4W9D A;  2NR2 A;  5JZE B;  4NY0 A;  2KDB A;  5E6N A;  3DBR I;  2DYO A;  3RCZ A;  5L95 C;  2DYM A;  3TMP B;  4E71 A;  2AEH A;  3R66 C;  2MBQ A;  4FJZ A;  4I6P A;  2PJH A;  4W9L A;  2M8S A;  2BYE A;  2LVO A;  3KYC D;  4I6N B;  3RZW C;  4GMV A;  2FID A;  3ZUN A;  1YQB A;  2KX0 A;  1WGD A;  1OTR B;  4KIK A;  4FA6 A;  2KMC A;  1UD7 A;  2O2V B;  1NBF C;  4BBN C;  4M0W B;  5JHB A;  1IPG A;  4FLH A;  3M62 B;  4CO7 A;  1PQS A;  2JZ3 B;  3GZN I;  1YIW A;  2N1W A;  1WZ0 A;  2EMT A;  3A9J B;  5E6O A;  3RZF A;  4E3C A;  1TTN A;  3QK0 A;  2YVC A;  3SHQ A;  1XD3 B;  3LDZ E;  3ALB A;  4IW0 A;  2CHW A;  2NBU A;  1KM7 A;  1WXM A;  3R3M A;  3QIJ A;  5KHQ A;  4BFR A;  1YX6 B;  1VCB A;  4GIV A;  4M8N A;  4MJS B;  4WWN A;  4XX5 A;  3APD A;  2JWZ A;  4KZ0 A;  5AZF A;  4WAA A;  1RLF A;  2ZZP B;  3DPD A;  3SD5 A;  2MW5 A;  3ML9 A;  2K8C A;  3KUZ A;  2CKH B;  3PPA A;  3DVN V;  5G55 A;  3ZNI D;  2L76 A;  3W1S C;  3CF6 E;  4GOC A;  1BT0 A;  4EFO A;  2RSU A;  2JRI B;  3UIN B;  4K81 A;  3QAQ A;  4FHJ A;  4NPN A;  4TV3 A;  4BVU C;  2BYV E;  3PHW B;  3QCA A;  2N7E A;  3WIM A;  3H7S A;  4DK5 A;  1RFA A;  4IC7 B;  4FJY A;  4JQW C;  4OVV A;  1UBI A;  2IY1 B;  1VD2 A;  4ANW A;  3K9P B;  2MX2 A;  2N9X A;  2KWU B;  2REX A;  5D7G A;  1WMH A;  4HPM B;  2A5U A;  2BF8 B;  4DHJ B;  2EKE C;  4N9F 4;  1YJ1 A;  3NS8 A;  2AL6 A;  3QQ8 B;  4X57 B;  4K1R B;  1SGH A;  1GC6 A;  2LWP A;  2MP2 B;  3CSF A;  2JXX A;  3ZNZ B;  4AJY B;  3V6E B;  3O65 B;  4NQK E;  2NPT B;  5BO4 B;  4EEW A;  2C5L C;  3VUY A;  3RT3 B;  3WAN A;  5AEK B;  3U30 A;  3CST A;  2MBO A;  2KAN A;  1GJZ A;  3V61 A;  3VFK A;  1V81 A;  3EFU A;  4KZC A;  2NVU I;  3B1L X;  4NAW B;  4GB9 A;  2XEW A;  3V6C B;  4B6W A;  4AP4 C;  2FIF A;  2N9P C;  2V4L A;  4IUM B;  4ZRI A;  3ZLZ A;  1UBQ A;  1UZX B;  4ZRJ A;  4EZK A;  3MJW A;  4F8C B;  3RYT A;  3ZNH B;  2MBB B;  3ZRF A;  3P2B A;  1UH6 A;  3UF8 A;  3NZS A;  4JGH B;  2IO3 B;  2Y5B B;  3DBL I;  1E5W A;  3UQB A;  2IY0 B;  2KO3 A;  2KJR A;  2RD0 A;  4RM8 A;  4DDG D;  4E74 A;  4ANX A;  1V5O A;  1P1A A;  4IM0 A;  4HK2 A;  4DHZ E;  4II2 B;  1J19 A;  3UIP B;  2I1K A;  5EDS A;  3SU8 X;  3A4R A;  2KQ7 A;  2KDF B;  2MSE D;  3PRP B;  3HM6 X;  2KDI A;  3B0A A;  1NI2 A;  2KFK B;  3M63 B;  3KH0 A;  5CHW A;  1T0Y A;  1WJU A;  4FHK A;  3ENE A;  2WX0 A;  2DEN B;  2J7Q B;  1U4A A;  2EMS A;  3QAR A;  1TGZ B;  4BKT A;  4F1S A;  2LGX A;  4W9E A;  1UGM A;  3H7P A;  3QC8 B;  4HWI B;  4IM2 A;  3X23 A;  2KJ6 A;  2ZPY A;  4HXD A;  1XQQ A;  2ASQ A;  2JUO A;  1I35 A;  1OEY J;  2LVQ A;  3AU4 A;  3VH3 B;  2ZNV B;  2BKR B;  4AOF A;  3IFW B;  4XZ4 A;  1WR6 E;  3CMM B;  2AL3 A;  3IG3 A;  3KUC B;  4GN1 A;  4HDQ A;  2Z59 B;  4IWO A;  3B08 A;  2WX1 A;  5CHF A;  3VQI A;  4FBJ B;  2KC2 A;  3A1Q B;  1WX7 A;  1EUV B;  5LXI B;  4YL8 A;  4GU2 A;  2JY6 A;  2M4N A;  2JVC A;  3Q3J A;  4KSK C;  4DBG A;  2B3A A;  3VDZ A;  3ZO5 B;  1ZKH A;  2L3Z A;  3PZD A;  3V62 A;  2MWS B;  2NPT A;  1WGY A;  2RPQ A;  3A9K B;  2FCM A;  3PV1 A;  3W1Y A;  2K6Q A;  4P7I A;  3ZVV A;  2L0T A;  3PLU A;  2GMI C;  3ZW3 A;  2GBK A;  3OAW A;  1V6E A;  1Z5S B;  4I6L B;  1WYW B;  4MEM A;  1WJ6 A;  4MGI E;  2M0X A;  3TCA A;  3HM3 A;  3S2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...