3W2JA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-135
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-135
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w2jA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w2jA01
3DU0A 3CEPA 5I3HA 3PSVA 3RFAA 1OX4B 2YX0A 3QEZA 1BTMA 1XI3A 1QFEA 3B4UA 4JN6A 3W83A 3SI9A 1LBMA 1NVMA 3B8DA 3L0GA 3DKLA 1MXSA 4I7UA 4PCFA 4E0CA 1ICSA 1THFD 1WXJA 1T8XA 1CW2A 3B05A 1ZHAA 3N34A 3KFTA 4HSOA 1HUVA 1Z41A 2HS8A 2O7SA 2QCLA 5F4XA 1CI1A 1VGAA 5K9DA 5G4WA 1SO6A 3LRKA 4O0ZA 1X1OA 1SQ7A 1VS1A 3P74A 1RPXA 1NEYA 1F73A 1HO4A 1RV8A 4UFJA 4O57A 1DQWA 3I7SA 3LCWA 3MP3A 2NUWA 1XBXA 3PF3A 4JEQA 3NR0A 3OBKA 1P5BA 1TRIA 3TH6A 1M7OA 2BWGA 4QAIA 1EWDA 2WQPA 4FNTA 3S5NA 3W1TA 3OA3A 2VENA 3FEMA 4MZ8A 3T7VA 3O07A 4NJIA 3NNTA 3IIZA 1ZALA 3C2OA 4O53A 1YTDA 2RKXA 2EAWA 1SZNA 4GUIA 3SY5A 5AC6A 1RQHA 3OVPA 5AN7A 1A5CA 3MYPA 1VH7A 3OHIA 4RX0A 4S2BA 1JCYA 3O1NA 1FBAA 4FIRA 1UUMA 3W87A 3FA5A 1RZMA 1B9BA 1W1ZA 3GB6A 3MW7A 1KTNA 2IQTA 2C15A 1R30A 3MI2A 4O13A 4IMGA 1XUUA 1L6WA 3O16A 1A50A 2BTMA 4BWLA 1I45A 1F2JA 1MEWA 4UR7A 5AHIA 5IBXC 3SGZA 2ZYFA 4NX0A 2RHGA 3NGJA 4FNQA 2VXNA 2Y89A 5KITA 3UWVA 1HG3A 3H55A 4FO4A 2ZRYA 2E68A 2H8XA 5AB3A 3PG8A 3W7IA 3B06A 3N9SA 3TMLA 4PL2A 1MSSA 3FJLA 4LVGA 4OE7A 5CZTA 5BMWA 3GLCA 5I3KA 1K7EA 3LDVA 3G8RA 1W5PA 1UJPA 3HGRA 4IXHA 1AG1O 3DKJA 3SIZA 4FNUA 5TBOA 3HOJA 1IXOA 2ZA1A 2V82A 5HR7A 2G95A 4CQ8A 4M19A 4BI7A 4K39A 3TXZA 3WK2A 3BLFA 1PCKA 1JVNA 4YL2A 2ZTJA 3W7OA 3W1RA 3TR2A 4MVAA 1JUBA 4LOCA 4C1KA 4GFSA 2Z6JA 1FUYA 1GVSA 2YW3A 2XN1A 4TO8A 5FI8A 2YR1A 2YGYA 3M5YA 5K9XA 5EMUA 1S5TA 4IXXA 2B7NA 3WJSA 2V5LA 3B0UX 1P1XA 1EUAA 4HN4A 2A2IA 3ZWSA 3GKFA 1H7RA 1H62A 3UWZA 4WY0B 2TPSA 1LZOA 4TIMA 2CLKA 1B3OA 5I3GA 1LP6A 3S1VA 3PBYA 1ALDA 4A22A 4S2CA 3KX6A 3QSTA 3HPSA 1EPXA 5I3JA 4UNKA 2A1YA 5E0KA 4N9DA 1J4EA 3W7NA 1QOQA 2BLEA 1TO3A 4NT0A 4LC8A 1ZAJA 1UUOA 1DOSA 2ZDRA 3L5AA 1WAUA 4B5NA 3NL5A 3F1QA 1EUNA 1DKWA 3W1NA 2PC4A 4HKPA 2D73A 2X30A 1GWJA 2FQIA 2NV2A 3W7MA 3W7LA 3IV3A 2RH9A 3OEXA 4L4LA 3VKJA 3EWZA 2QAFA 3PBUA 2E1DA 3DHFA 3NQMA 2BXVA 4FXRA 5F2MA 1W3NA 3VFLA 2NV1A 1VPXA 1YXYA 3LRMA 3N73A 3IIVA 1O5XA 3ATZA 4M6VA 5F2IA 1W3TA 5DBUA 1W8SA 1TPDA 1JJKA 2ZBTA 4X2RA 4XZ9A 2VKZG 4XBSA 1EA0A 2ZRWA 1G69A 1A53A 2C14A 5CPOA 5KSWA 3NYZA 3A22A 1DBTA 4N2YA 3UY7A 5CZJA 4H6KA 4NX5A 3P8JA 1C8VA 4MYXA 3LCHA 1T96A 3W7EA 1KM4A 4LVBA 4A29A 3C4UA 4LTSA 2DZVA 3HQ1A 4UXDA 2J6XA 3LHVA 5F4WA 3L9CA 1ME8A 3QPYA 5D04C 3C52A 2V30A 3NO5A 3NL6A 3TK7A 4EOUA 3GDLA 2ISVA 3M44A 3W72A 4O18A 2C6QA 3GAYA 5D05A 4K7YA 3PUEA 1O5KA 1W5OA 4UMAA 1VJIA 3GXNA 3BGGA 1SO5A 4M6QA 1ONRA 3JR2A 3CQ0A 1Q6RA 2W79A 3ABRA 1JR1A 4X22A 4YXGA 2ZRUA 1V5XA 4PC8A 4IMCA 4LY8A 4Y90A 1SO4A 4A3UA 4K6AA 4O19A 4JX6A 3L66A 3TKFA 4NNAA 3M1ZA 3T40A 4JTFA 1X7FA 1JCXA 3K30A 3W1MA 1KM6A 1W56A 2GQ9A 4RXGA 4O17A 2YSWA 4FHAA 4EVZA 3W1AA 3W3OA 4O14A 1WDWA 1R46A 4AVFA 5AHFA 1G4EA 1UCWA 2NXHA 2Q8ZA 4CNNA 5CSSA 2QJGA 1OFBA 3TA6A 5AFDA 3O6CA 4DPQA 3LLDA 3G1HA 3CIXA 4A21A 3IIPA 1OFOA 2ISWA 3W1QA 1A5SA 1S5WA 2CLEA 2CLLA 3ABQA 1LBLA 4R7JA 3HGSA 3UY8A 3WJXA 4JNMA 1GVRA 1VLWA 3W74A 3W76A 1UASA 2NX9A 1SFJA 1R47A 1EIXA 3R13A 1IXQA 1LM1A 4H4IA 5HNRA 1TIMA 3PBVA 4BK9A 2VOMA 1TCDA 2J9YA 2XN0A 4ADSA 2QCCA 4QIUA 2G5WA 4QM1A 5J5RA 2Q3RA 3NQ8A 2GQAA 4UTMA 4Z1DA 3CC1A 4MFEA 2WPBA 3I7RA 4N02A 2CFFA 1LDCA 1OVDA 4GUJA 4XBKA 2JGQA 4IWWA 3NQFA 3G1AA 1ZFJA 4UNLA 3TQKA 3HJZA 3CPRA 3TFCA 2AQWA 3TQVA 4KWVA 1H63A 3CLMA 2CLMA 3QZEA 1DJNA 4PH6A 4PTNA 3F03K 4PA8A 4MLRA 2I9EA 3LI1A 2Y7FA 3IVUA 4UFKA 4CNOA 1IGSA 5G4EA 2QDGA 2NUXA 3QPZA 3PVFA 1I2OA 3L67A 1ZAIA 1GEQA 2JKPA 3S8HA 1SFLA 1KM0A 2OT1A 1W5QA 2GUUA 4LU0A 1LLZA 1H7WA 1OFDA 3PUDA 3TSDA 5SWUA 2W0UA 2KZHA 3BW3A 2NXIA 4RJEA 2A7RA 1KM5A 2GPTA 3EXTA 3PR2A 4N6FA 2ZZ5A 1JQXA 4UTLA 1N7KA 3O63A 1FDJA 3MJYA 4ZQOA 2X1SA 4P61A 3QSRA 5BNKA 2RDUA 2QAPA 4KFPA 3MP5A 4AMAA 3MHUA 1O95A 2BZNA 3DFNA 1M7PA 2GJLA 4NJGA 5HWNA 3FIGA 2NZLA 4UFIA 4JGDA 4ZQRA 4O4VA 1GYNA 1H5YA 3W2NA 3P67A 1B57A 5F1VA 3W1UA 1H51A 4OT7A 4DBDA 1G4SA 1H1YA 4E2BA 5HUPA 1AK5A 1L6YA 3L68A 1KV8A 3HB9A 1EP2A 3W2UA 3PAJA 3NL2A 3CWOX 3EWWA 1YTEA 1P0KA 2C0AA 3DFOA 5AOUA 4O11A 1KM3A 3NQGA 3B0PA 3TJXA 5CZSA 3NAVA 5EKYA 3INPA 4NNBA 1NAL1 1ZENA 3UXAA 2JKEA 1XFBA 5C2XA 1EP1A 5BMXA 5DCBA 4MY8A 2E6AA 4UR8A 2GQ8A 1OHLA 3BLIA 2ATMA 4YCOA 4UTTC 4JS3A 1TV7A 3IIXA 3RMJA 3MP4A 3QRHA 1QR7A 3HIJA 3IVTA 4J9JA 1BEUA 3MI6A 3T4CA 3B0VC 4ORMA 1FWNA 5HWMA 1JCLA 1A5AA 5EY5A 3MUXA 3NPVA 3GDKA 4IX0A 5DELA 4AH7A 4JR5A 4ZQCA 1F5ZA 3FS2A 4WY0A 1NF0A 1X8FA 2HMCA 2TYSA 4U28A 1EEPA 4OU1A 1SSDA 1KW1A 2GJNA 3GR8A 4MZ1A 1VCVA 1EX5A 3DAQA 3PB2A 2EF9A 3LTPA 1LTDA 1W3IA 5D03A 4C1LA 3O06A 4FEZA 1W31A 1ME9A 2B7OA 2ZCGA 3DZ1A 2WO5A 4IMDA 3FJ6A 3S42A 2WV8A 1VCGA 3A23A 1OK6A 1JRBA 1NSJA 3W85A 1K8YA 5D2XA 1BWLA 3M7WA 4DO4A 4UMBA 3G8EA 5TQLA 3MI3A 1OFEA 1RQBA 5C6MA 4CNPA 1TPC1 4I7WA 2VFEA 1DL3A 1XDLA 1GJPA 1QMLA 1GVFA 1KFKA 3IRDA 3GDMA 2QR6A 3BG5A 1KTBA 4QITA 1GPWA 1T0OA 3C56A 4JDYA 1AW2A 4QSHA 3C2FA 3L5LA 2ZQ0A 3RLVA 2E6FA 1QPOA 3G24A 1SW7A 1KTCA 3KXQA 3TMQA 3NM3A 2R91A 1V7YA 2P0OA 1D3GA 2W6RA 1XBVA 3THAA 1F6KA 2X1RA 3C8FA 4MLJA 3P60A 3HG5A 3SZ8A 2Y61A 1YXCA 1ZY9A 3EEGA 1QAPA 4WUIA 3W7GA 2A7PA 1KFCA 4Q33A 3CHVA 5BOOA 1G7VA 2Y7GA 2ZFAA 3HF3A 4WQ6A 1ICQA 3W1PA 3LHYA 3TX9A 1E51A 2QUUA 2J88A 3NXFA 5J5DA 3E02A 3TC6A 5U4NA 3W23A 2FDSA 1JUEA 3W07A 4LUIA 3WK1A 3R89A 3HMJG 2NUYA 2A4AA 3N2MA 1ZAHA 4N9EA 2DJLA 2TSYA 4WJEA 3NQEA 3M47A 3LBCA 4UTJA 2V2HA 5KMYA 2DZUA 4XQ6A 3QMTA 4IMEA 5I3IA 2A85A 1PVNA 1NFBA 4Z1BA 4MOZA 3VE9A 2EKCA 3G0SA 3M6YA 3AJXA 4JIQA 2QEZA 4DPPA 3E0IA 1I2PA 3R8RA 3PWAA 5FESA 2CZDA 3MMTA 4U4MA 2E77A 1YYAA 3EWXA 2A5HA 4BFAA 2X1TA 3RU6A 4ALDA 1RR2A 3HGJA 2NX3A 4ONVA 3FYOA 2VEIA 5U7SA 1LCOA 3S1UA 4LT9A 3T78A 4FNRA 1JCNA 1IIGA 4N6EA 1OFQA 4TU1A 2VFIA 1TSIA 3LHTA 3TSBA 1QOPA 3V1PA 3A5VA 3KAOA 4YCPA 3EX3A 1R2RA 3CEUA 4IJBA 3LXBA 3EXSA 2X16A 3L0NA 5AHEA 5AC7A 1KBIA 4NXSA 3LOTA 1SUXA 4LS0A 3YPIA 5EA9A 4S1FA 3OVQA 3QQ0A 1IXNA 2YYTA 2CLHA 1LRNA 3BGJA 1UB3A 2NX1A 4M5PA 1TMHA 5D33A 3DENA 2J9ZA 3STGA 3RLUA 4N9CA 4RK8A 4HNTA 4O1AA 1O4UA 2R14A 4NJKA 2FPVA 3MBDA 5HQEA 4Z08A 4A2RA 1C9DA 1VR6A 3W7QA 4YWIA 1TTQA 4MZYA 2ZZ1A 2ZA2A 5AHNA 2CWNA 3DGRA 1F7BA 1SU5A 1GZGA 1LYXA 1XUZA 5HULA 2X1UA 5F2LA 3PULA 4AB4A 3QC3A 2EPHA 2Z1BA 3LI0A 3CM4A 1SSGA 3N19B 5FEXA 3UQNA 3W7HA 1R2SA 2A0NA 3UPWA 4NJJA 3PUOA 3GX9A 3M43A 4UTTA 3BG3A 1LBFA 3M5XA 6ALDA 3TC7A 5HINA 4UTKA 5D09A 1AMKA 2DZPA 3C2RA 1RD5A 4O10A 2AGKA 1ZNNA 3W88A 3DI1A 1JULA 1ICPA 4LV9A 4JTHA 4LVDA 3SSJA 4UC5A 3CTLA 3FKRA 3KVJA 3HBLA 4OBTA 3E9AA 4MY9A 4FB7A 1OF8A 3ELFA 4X9SA 4I9AA 3GXTA 2DZXA 4QNWA 4Z1AA 4Z0SA 4CCEA 1TB3A 3GIYA 1TYGA 4NZFA 3W75A 2NXGA 1YADA 2CU0A 4ADUA 5CPNA 4UTHA 3UD6A 3QW4B 3F4NA 4JTLA 5L9FA 2WSYA 2VC6A 1W54A 4HPJA 2GVGA 3LCFA 1H7XA 1AL8A 3W2LA 1OFAA 4LVAA 3PG9A 1DORA 3RF9A 3L2IA 5G5IA 5BW6A 3B03A 3WJZA 2OJPA 3S6DA 4TMCA 3EX6A 4ZMGA 3NM1A 5FF7A 5K7JA 2GVLA 2J27A 3I7QA 3KVKA 5CPLA 7TIMA 4CLMA 1YDOA 5CZ0A 4FX7A 3STCA 1QPQA 3FYPA 3STFA 5HJLA 1MEIA 4FIQA 4JTJA 2J9XA 1TPH1 2V0TA 1OX4A 1NF7A 3M9YA 1LOSA 5FEPA 3N14A 4RZ4A 1GTHA 4GBUA 3HO8A 2PE4A 1HO1A 2DZTA 1TQXA 3O05A 3WJYA 1Z44A 2FFCA 4RV8A 4ZL1A 2XN2A 4DF0A 2F84A 2E6DA 1L9WA 4AF0A 4UTWC 3Q94A 5LNVA 3NDOA 2ISSA 1B4KA 3IIOA 2R94A 3HPZA 5EYWA 4D2JA 1VLIA 1XCFA 3OVRA 3L5MA 3EWBX 1GTEA 2E6YA 3DBPA 1GQNA 2Y7DA 2A21A 3CWNA 4JYEA 2YYUA 2QCFA 1XBZA 3S1WA 5F4SA 5G1YA 3QW3A 5FF3A 3S5OA 1LOLA 3P5ZA 5LNSA 1LORA 3IGUA 3O6YX 3NOEA 3H54A 4HNVA 4ADTA 1W5MA 4AWTA 4WOQA 4XTDA 1YPIA 5E1QA 3SW6A 4HNUA 1XC4A 1YPFA 3LLFA 4LWWA 5D32A 3WK0A 4KWWA 4FNSA 2PCQA 5KTLA 3Q58A 1VZWA 1PIIA 4UMCA 4M7TA 3USBA 1WA3A 1WQ5A 4GRSA 4PL1A 3E96A 1QO5A 4OQVA 2H8ZA 2V2DA 1XXXA 3M5ZA 3R12A 4NQ1A 5LNRA 5G2HA 5G2WA 1BKSA 2ALDA 3TV8A 3W7RA 2QUVA 5FEZA 3LM7A 2OZ0A 2NLIA 5LKYA 3W22A 4UFMA 1P4CA 2Y70A 5E93A 1T99A 2PRMA 1K8ZA 3PY2A 3TE9A 3ZFHA 1K8XA 2H3BA 4ZQNA 3HGOA 3PS7A 1AL7A 4DXVA 4JICA 4AWSA 4FX8A 1VCFA 2LLEA 3NG3A 3GNNA 4JTSA 2RFGA 1GG0A 1VYRA 2ZZ4A 3NL3A 3N3MA 1EWEA 3EX2A 3DFTA 4EIVA 2I1OA 2OMAA 1ZCOA 2J24A 1FWTA 1VRDA 3AO0A 2EGZA 5MHBA 2VFGA 1B4EA 2I14A 5AYYA 4Y6GA 3C3NA 1W0MA 5IBXA 1TTIA 5LHEA 4G1KA 5K4XA 3W7DA 1F76A 4NZJA 1LRQA 5D2TA 2QF7A 2HTMA 3GR7A 4IUOA 4JTKA 4CQ9A 5LGXA 2OT0A 3HG3A 4P2VA 3P5YA 1WYIA 1WOBA 1I2NA 2YXGA 5DCEA 2QCDB 1MO0A 3W9ZA 5LZLA 3WJWA 3H53A 3NA8A 3UZJA 2JBMA 3QF0A 3U8GA 1GYLA 5FF0A 3MBFA 4WX2A 3G0XA 3LBMA 3DFSA 2WNQA 3G1SA 3M16A 1G4TA 4O52A 2YW4A 3GVGA 1WV2A 3UWYA 3F4WA 1H60A 4O4WA 4RCXA 4JTGA 4RZ5A 4MJMA 5K3VA 2YPIA 3G3MA 3QYQA 4ORIA 1GVQA 3LTYA 1OYAA 3IGXA 3O15A 3PM6A 1C29A 1GT8A 4CQAA 1G6CA 4K8EA 2Y88A 3N9RA 3G3DA 5D37A 2ATSA 5C54A 4EWND 1FX6A 4ZZ9A 1LRTA 4YLWA 3W71A 1OX6A 4L4MA 4AHPA 1FWWA 3NPWA 3LCIA 1K7FA 1GG1A 4Z0JA 3TSMA 3CIWA 4WOZA 1FCUA 4JTEA 1I4NA 5DY3A 2GVJA 1SPQA 5KINA 5EBUA 1TRDA 1AW5A 2YDAA 2ZZ7A 3A9IA 1H7OA 1F74A 1PHQA 4OV4A 3FOKA 1PHWA 3MHGA 2TRSA 3MWAA 4JY8A 3UWWA 1FXQA 5HR6A 3L21A 4OHQA 2FLIA 4LW7A 4O1BA 4GXMA 2H6RA 3NVTA 4KKXA 1AW1A 1WX0A 3VCRA 3QQ1A 3C2EA 2Q3OA 2O7QA 4JYDA 4LNYA 2CLFA 3LCXA 5F1UA 3TW7A 1O94A 4LS1A 3P81A 4O0KA 1TJRA 3UXDA 3GK0A 2YZRA 3BG9A 2JKAA 3W1LA 2C16A 5DXYA 3S1XA 4BI5A 4FX6M 2ABAA 3EX1A 4CCDA 1DJQA 3G1FA 3W73A 1DQXA 3BK0A 3G22A 2BX7A 4N9BA 1SZEA 4GUHA 4K7VA 4AHOA 4HPXA 1WBHA 3IGSA 3R5EA 1G7UA 4GWEA 3NQ2A 4MPQA 2ZRZA 2YCEA 3MYOA 2ZRVA 4GC4A 3NPUA 1DV7A 4NUWA 4MY1A 2DORA 1GVOA 1H50A 1MEHA 3GZ3A 1KFLA 1Z48A 1G4PA 4ZVJA 1OX5A 1WBJA 3EWUA 3W84A 5G2IA 4QJ1A 5BRBA 1OJXA 3G0UA 2G96A 4MJZA 5DBTA 2QCMA 3TROA 3CU2A 1PCWA 4UUIA 4R34A 3QH2A 1GOXA 1TTJA 3W7JA 3NEVA 4QISA 2CZ5A 2DU2A 1HTIA 1K02A 1PL9A 5K2ZA 4AXKA 2QCNA 2C19A 2JGYA 5C55A 2QDHA 5DCDA 3TAOA 4MYAA 1D9EA 5AC8A 3O6DA 3Q2DA 1XL9A 3C61A 4Q32A 4HIBA 1VHCA 3W7KA 1J5TA 4QQ3A 4DELA 4DO6A 4E38A 1FCQA 3FFSA 1LLWA 1LOQA 1HL2A 1KM2A 4K36A 3W7PA 2NWRA 5AHMA 4RKAA 3HPXA 4M7SA 5LNWA 3LERA 2VELA 5D02A 1KLZA 3A24A 5KZEA 2WSRA 4UFHA 4O1CA 4DO5A 1D3HA 1TQJA 2G97A 2V9DA 1L6SA 1JCMP 3W1XA 1ZJIA 2RDWA 3KRZA 4IPJA 3W2JA 1Q6LA 2B4GA 4HNNA 4DF2A 4I7VA 3KVLA 4HT3A 5C5YA 4FF7A 1YXDA 2DZWA 2V8ZA 3PSWA 3G1DA 2PURA 3E12A 3D0CA 4O8RA 8TIMA 3PB0A 3RK8A 3GNDA 3MHFA 1OYCA 3STEA 4IPIA 4UTUA 4ZQPA 4ICNA 1M5WA 3P80A 5H91A 2HS6A 4WD0A 1Q6QA 3S9YA 4JX5A 5A5WA 3TJLA 4BR1A 3TAKA 3HG4A 2Q8LA 3BARA 1Q3NA 3U6WA 4WXYA 3L0KA 5AHLA 1YDNA 2XFWA 1W5NA 1JQVA 3TDFA 2H3DA 2QCHA 4W9TA 4IOTA 4NJHA 2CW6A 3VE7A 1Z42A 1H61A 4NNCA 5FEWA 1PS9A 4RZ6A 1EB3A 1RVGA 3Q37A 4O12A 3ANYA 1N8FA 4XWUA 1VC4A 3G1VA 3PC0A 3PBWA 3UPBA 1OYBA 1IXPA 5T26A 4FXSA 4AAJA 1BWKA 2C13A 3I68A 2B7PA 4KFOA 3VNDA 2FPTA 4QNEA 3QM3A 3HG2A 3KOFA 1TPVA 4K38A 3M5VA 1R2TA 4XKYB 5ABTA 1TV5A 5CGQA 2B7QA 3G18A 3W2KA 2RDTA 1U83A 3SR7A 5LHFA 1TJPA 3UWQA 1VQTA 3NQ7A 3P84A 3LX9A 2B0MA 4LVFA 4JY9A 2CLIA 5F2GA 2H90A 4JTUA 3P62A 2V81A 1DHPA 1SW0A 4MUZA 2HSAA 5FF2A 1WOAA 3NZ1A 3THQA 3NZRA 3TQ0A 4BI6A 3BLEA 4K8HA 3B04A 4MIMA 2Y63A 1OF6A 2VEPA 2DZSA 5LSMA 5G1TA 1I2QA 3LHWA 4UTIA 4JYFA 1QO2A 3FKKA 2DJXA 2WSQA 3EX4A 5AYXA 3WFAA 3NQAA 1KFEA 5DY2A 3W7CA 3BW4A 3T55A 3W70A 3C2VA 1QPRA 1FWRA 3SFKA 3LV5A 2GOUA 2E5BA 3I6RA 1MZHA 4R33A 5CKSA 1W37A 3IVSA 4DBEA 3LRLA 3MO7A 4JTIA 4TX9A 3C0JA 1XDMA 3W2MA 1PE1A 3T44A 2TMDA 1TPEA 1OABA 4TMBA 1S3HA 2EHHA 4E2DA 4AEOA 2QJIA 3WK3A 1K03A 5D38A 4IMFA 4N4PA 3A21A 5K4ZA 3LCGA 3P61A 4OGZA 3P7YA 2PRHA 4RR4A 5D30A 1LROA 2FIQA 4PODA 4ZQMA 2AAMA 3M41A 5TIMA 2FJKA 1FDYA 1YDVA 3NQVA 5HWJA 1EP3A 3BV4A 2QCGA 3DFQA 5CG7A 1XM3A 1SZFA 1TPFA 3SECA 1VYPX 3LGEA 4TR9A 3QMSA 3FLUA 1OG0A 1O60A 2JK2A 3ZS4A 1K7XA 3NQ6A 4IGHA 3LXAA 1X6UA 3ABOA 3GDTA 3EWYA 2E5CA 4NXKA 5AYZA 5H2ZA 3SJ3A 6TIMA 4MFDA 2WKJA 1N55A 4Q4KA 2FB2A 1XBYA 1HFBA 3JRKA 4OWGA 3QMRA 3GDRA 3CT7A 1QCWA 1OFRA 4PFMA 2QJHA 3U2OA 1VYSX 3DHDA 4GUFA 1I2RA 2Y7EA 1SW3A 1KFJA 4LC6A 4HHPA 3TCEA 5KZMA 2VFFA 2Z0IA 5CPMA 3KRSA 4IX2A 4WY0F 1IF2A 4PEKA 2A7NA 2E5DA 1QWGA 1PV8A 2A6LA 2P10A 3BPWA 3M0ZA 3EXRA 2YFOA 1G67A 1L2UA 2CZEA 5EPDA 1UBSA 2C3ZA 2QKFA 4XUGA 4DEFA 4Y8FA 3QFEA 5HMSA 1FCVA 4LRSA 4JDBA 3KVMA 2UV8G 3EB2A 2DP3A 1YLVA 3C6CA 3S5ZA 4X3ZA 4Z1CA 5KZDA 2Z6IA 1F05A 4AF0B 1M6JA 2F7FA 4JTTA 4JD4A 4LS2A 3QJAA 2ZZ2A 4AWUA 4M6PA 2ZRXA 5I3FA 3V75A 2ZA3A 1SO3A 4JX4A 4GE8A 4GNJA 4YMZA 1FY6A 3BVJA 1QNVA 3W6YA 3ABSA 4UFLA 2QCEA 2OX1A 4GJ1A 5DXXA 4O28A 4O1DA 3EKZA 1TV8A 3NQCA 3IEBA 3S5YA 4BWLC 1F6PA 1KV5A 1KFBA 1ME7A 4Y96A 5LNUA 3A5FA 1KBJA 5FF4A 2ZTKA 5LGZA 1FQ0A 5EL1A 3G1YA 4UIOA 4UCGA 3G1XA 4DF1A 2P1FA 4OV9A 1KM1A 4GUGA 1X1ZA 2VFDA 3UZ5A 2NWSA 3OG3A 3UNDA 3TU9A 3TNOA 2CLOA 3W86A 4CCCA 1KA9F 1K3UA 4JXCA 4O50A 3S0CA 4Y9AA 1FCBA 1U5JA 2YFNA 3DFPA 4KFNA 4EF9A 2FTPA 3TW6A 4K37A 3NQDA 4O16A 4POCA 5A8GA 4EF8A 2R8WA 1JUKA 1VHNA 3ATYA 3TXVA 1J2WA 4H3DA 1P0NA 1ADOA 4FNPA 5DLCA 1YTKA 2E09A 3CB8A 3P82A 3UWUA 1IIHA 3LTSA 4WXZA 3BO9A 4WZHA 3RNDA 1Y0EA 3EKLA 3N2XA 3KRUA 2VEKA 1RQEA 1TREA 1JRCA 2V5BA 3LV6A 1H7NA 3LB0A 5CSRA 1DVJA 4RXFA 3SGUA 2ZZ6A 2Y6ZA 3NPXA 3TFXA 1Q6OA 2FB3A 1FDZA 2PRLA 1H1ZA 2A6NA 1CX9A 3LCLA 2QUTA 5L6UA 3O8AA 2VEMA 1JCJA 1QDSA 2WNNA 4HSNA 3DH7A 2OCZA 5DN1A 3TUUA 4N4QA 3ZWTA 2QCDA 3GYEA 1TPUA 1Q45A 5D2VA 2ZZ3A 4O15A 1TPWA 3DI0A 5HUOA 1I8JA 1FXPA 3LHUA 1TPB1 1S5VA 5IM51 3LHZA 4UTWA 3TIMA 1XKYA 1OFPA 4LRTA 2WOQA 3L65A 5D2WA 4XKYA 3E49A 3OIXA 4DQWA 2X2GA 1QPNA 5K9CA 4BF9A 2C18A 5D2YA 2ABBA 2BSLA 1KLYA 3ZR4A 4JIPA 2Z2UA 1SZGA 1H7PA 2VFHA 4MKNA 4XTIA 2C1HA 2V2CA 3UYCA 3LXCA 1OK4A 5GVJA 2WNZA 3I65A 3DXIA 4RLIA 2WJZA 2CZFA 4ML9A 4A2SA 3KHJA 3GKAA 3P8IA 2Y62A 2FPYA 1ML1A 4NVTA 1A5BA 4IQLA 3GXPA 3VI2A 2Y85A 1FWSA 1TTPA 4O54A 3GAKA 4LUJA 4LV4A 1SR9A 4AHQA 3JS3A 3BW2A 3R2GA 4NU7A 4R53A
chains in the Genus database with same CATH superfamily
4RW5A 2QPXA 3CEPA 4A4AA 3QHOA 3AYSA 2XZ7A 1XYFA 4HBKA 1EF2A 3W83A 5HMEA 2GSHA 3L0GA 4PCFA 1UKQA 2FVMA 3WH7A 1VIZA 2O7SA 1J8VA 5BOEA 3OLGA 1CYGA 1VGAA 3OODA 4PUNA 1Z3NA 1UQYA 1KCKA 3LRKA 5RUBA 4GNVA 1X1OA 1UR9A 3T0TA 2FHCA 1NEYA 1F73A 1RV8A 3P2VA 4UFJA 3N04A 3WNOA 4O57A 3PPHA 3NR0A 1M7OA 1AZ2A 5IFPA 4FNTA 5FAGA 4GH1A 3BQ5A 3EDDA 2ZIDA 2V5DA 3C2OA 1SZNA 1YIXA 5DF0A 1WZKA 2V6AA 5BXSA 5AN7A 1R3WA 3WLQA 1HX0A 4HCHA 1JCYA 3O1NA 1FBAA 1S2UA 1UMYA 4L1XA 3CWHA 2QQ6A 3PAOA 3EPMA 5EMYA 2HDJA 1B9BA 3MW7A 1KTNA 1OWQA 3VINA 2C15A 1R30A 4O13A 2DW6A 4H8VA 1ADDA 3AHVA 1L6WA 4HGXA 1G0CA 4J4KA 3GR4A 3H24A 3FSTA 1DIEA 1F2JA 1W2PA 1MEWA 2VD8A 5AHIA 3VK5A 3B9DA 5CBIA 3WMLA 3AU6A 4LBRA 5KITA 1PPIA 3UWVA 4B91A 3PG8A 1WZLA 3AUJA 3CAWA 3CV7A 3IUHA 4RE3A 3TMLA 2QUNA 1E0TA 3VZYA 1FH8A 1K7EA 3LDVA 1UJPA 4J3ZA 3HGRA 4IXHA 4WLCA 4CD6A 5TBOA 4JQ4A 3UETA 3S1GA 2D0GA 4HCLA 3BLFA 1LT8A 4YL2A 1XIFA 2X40A 1EXPA 1F3EA 4GFSA 2YW3A 2XN1A 1GVEA 4J3XA 2YR1A 1M7XA 5G4HC 1S5TA 3WJSA 3B0UX 3ZWSA 1CENA 3GKFA 3KZSA 1TZ7A 4AIOA 2TPSA 1F07A 1LZOA 1H0IA 5JBDA 5I3GA 2GJRA 1EJRC 1EDTA 4A22A 4BA0A 3KX6A 2ZWYA 1W1TA 5I24A 4X60A 1GZJA 3CIVA 2A1YA 4IQEA 2PA6A 2BLEA 1TO3A 5CPTA 1W9BM 3R6IA 1V93A 2WC7A 1DOSA 2D2GA 4ZGYA 2OLSA 3KCJA 3TN4A 3FDGA 3HQPA 5C71A 2AAAA 3ARSA 3UR2A 2Y8VA 4ACZB 2PPGA 3THCA 2PBGA 2WBGA 1VKFA 3WBAA 3VKJA 3BZJA 2QAFA 3PBUA 4Q7IA 4DB7A 3FV9A 2VURA 3CAVA 2ASHA 2WHKA 5F2MA 1UC5A 3MSGA 3LBOA 4E8CA 3LRMA 3N73A 3K5XA 3VNYA 1C7SA 4PUDA 1EA0A 1QNOA 5CC3A 5KSWA 3COTA 2BASA 2ADAA 1FOBA 4GQQA 4N2YA 3UY7A 5JUVA 1SR0A 3GE7A 3HZ3A 4NX5A 4MYXA 5IRPA 3LCHA 3TWAA 1ZL1A 3UCDA 4LVBA 3VM7A 2DZVA 4UXDA 3LHVA 3MQTA 2HBVA 3TK7A 3ZZ1A 3TTOA 3OZPA 4EOUA 7ODCA 3UXIA 1PWMA 3W72A 2CBVA 5D05A 2JIWA 3PUEA 4Q8QA 1ONRA 2G3JA 3WH9A 2Z2AA 1ADSA 3C8NA 3F5JA 4WF7A 1D8WA 4ATDA 1UH3A 1FWIC 4R7OA 1C93A 4REQB 1ISVA 4NNAA 1X7FA 3VIIA 3K30A 1ZTVA 4O17A 3C5QA 1J0HA 1G4EA 1A5OC 2VGIA 3WLTA 1WDSA 4CNNA 2CKSA 2QJGA 1MW2A 5REQA 3UG5A 2NVDA 4M1BA 4QLJA 3WKZA 3G1HA 4A21A 4HNOA 3MZNA 3W1QA 1A5SA 3RO8A 1LBLA 4KCVA 3HGSA 3KP1A 3GIQA 1GVRA 2PD5A 3QHMA 5C7HA 4GZ7A 1TZ9A 3MU7A 4HZ6A 4BK9A 4FS9A 2DSKA 1KC7A 2J9YA 3CL7A 1HKKA 3U2CA 4ADSA 5C9RA 4PUUA 2E7FA 3MCOA 4KH2A 2DW7A 3WL0A 1KGWA 2DZBA 4CD4A 4A3YA 4Z1DA 3CC1A 4CCZA 4MFEA 3D3FA 2OPJA 4EXQA 2CFFA 1JCTA 4H6QA 4IWWA 3G1AA 3HJZA 3NQBA 5D4YA 4MNKA 4W86A 5DMNA 2BOEX 4S3GA 1DJNA 3SUSA 3F03K 2W4XA 1UPPA 2NUXA 1I2OA 1ZAIA 1VBJA 3GVVA 5A2CA 2GUUA 2FGBA 4LU0A 5GNYA 1H7WA 1PZ1A 2HNEA 3UF9A 3TSDA 5SWUA 1WXYA 4ENLA 4KCTA 4RJEA 4IIBA 4ZSTA 1QNPA 1VB9A 3KM8A 1DQUA 3O63A 3VDAA 4LYKA 2YB4A 1EOMA 3RPTA 1DPMA 4ZQOA 2O4MA 4LB3A 2WMFA 3EMCA 4P61A 2E8ZA 2RDUA 4KFPA 2OYLA 1DJIA 2X1IA 1PZ0A 3AMGA 3DFNA 1XLKA 3TLQA 2NZLA 1XIHA 4O4VA 1UWIA 4JFUA 4RE4A 4AYGA 3P67A 1KB3A 2E0PA 1H51A 4OT7A 1G4SA 1H1YA 4Q4PA 4E2BA 1B2YA 4V1XA 2Z7KA 3L68A 4U3AA 1KV8A 3HB9A 3W2UA 4A3QA 3MUZ1 4PTWA 5CCZA 1BFNA 1YTEA 4DIAA 2P5NA 3DFOA 3NFUA 5CZSA 3NAVA 3INPA 4NNBA 3PBGA 1NAL1 1TJ2A 4PMZA 4F0LA 4HPHA 5DCBA 4MY8A 1RLCL 3Q4DA 2GQ8A 3BLIA 4Z42C 4GX8A 4UTTC 3IIXA 1TWSA 3RMJA 3MP4A 3AS2A 1H5VA 3NOYA 1R9YA 5E5CA 8RUCA 1A5AA 2HNHA 2BG5A 5EY5A 1PDZA 3TA9A 1P6WA 4IX0A 3FS2A 1EQCA 4F0MA 1QW8A 3FCPA 1EEPA 3GHTA 4DAFA 3CZLA 4UQAA 1GOWA 1LTDA 1WB0A 3VD7A 4QE4A 5PTDA 1MQRA 2ZCGA 1A3XA 2J79A 2Y5JA 3DZ1A 1G9HA 1HJWA 3FJ6A 3IJ8A 1MI3A 2D3LA 2DIJA 1K8YA 7CGTA 2ZX7A 4DO4A 3WIJA 4DYEA 2OSWA 5TQLA 3B3DA 2YJQA 3SURA 4WDXA 3ZR5A 1RQBA 2IW0A 4I7WA 2VFEA 1DWHM 1US2A 1XDLA 3NSMA 4AUBA 4DJDA 1UWRA 2B31A 3RCMA 1U5VA 4KRTA 1B31A 1KTBA 2ALRA 1CXEA 1GPWA 4UZSA 3DFHA 2I17A 4JDYA 4A8LA 3C2FA 3IV8A 3L5LA 2OYKA 5H6HA 9CGTA 1GCYA 3G24A 1KTCA 4HA4A 3TMQA 3RLGA 1XRSA 1MWOA 1US3A 1I1WA 2VVNA 3C8FA 4MLJA 4PCSA 2BVDA 1CECA 4CU7A 1ZY9A 2XHYA 3CHVA 2OKTA 1G7VA 2ZFAA 4WQ6A 1E51A 1TA3A 3PZOA 3W07A 3WK1A 3O2LA 3MUCA 2A4AA 2IQDA 1WPCA 2TSYA 2ZE3A 4WJEA 1KQZA 1KQYA 3TCSA 4UTJA 2V2HA 3PTDA 3I6EA 2PTXA 4YTQA 2XIMA 3QMTA 4IMEA 1US0A 2A85A 1PVNA 1NFPA 1RVKA 3DBNA 4IP7A 4Z1BA 1XG4A 3G0SA 3AJXA 4IFOA 1T5AA 2W63A 2F9RA 3IANA 3E0IA 4ECLA 4IJCA 3R8RA 3PWAA 3SAZA 5FESA 8XIMA 4J7RA 4Z2KA 3EWXA 4ALDA 3LLXA 4C6IA 1F8IA 3BQ6A 1YHTA 4UQDA 3QR0A 1GKPA 2FVKA 1XICA 3S1UA 5HMFA 1JEZA 3ZM8A 3V16A 1XIDA 2VX6A 3LHTA 1QHZA 3A5VA 4YCPA 3EX3A 1R2RA 2A3AA 4JL2A 1TVLA 3WFLA 2J78A 1UA3A 1IWPA 3BL3A 3BLOA 4NXSA 5EFDA 3PZNA 3YPIA 5EA9A 3AIWA 1IXNA 3PTKA 1E6PA 4B2DA 3U0HA 1LRNA 3MUAA 3UESA 3I4KA 1UB3A 2NX1A 4J1OA 5D33A 3S4TA 3MKCA 5HMDA 3IS4A 3STGA 4DUXA 3RLUA 4LUTB 2X42A 3GTHA 4O1AA 3ARYA 2FPVA 3MBDA 1HXJA 3AXKA 1R3RA 2BHYA 3M6DA 1MYRA 3DGRA 4XKMA 1RPKA 1GZGA 1RXOB 3N9KA 4L80A 3HFTA 4YTRA 3WQWA 1P6CA 3GXFA 3PULA 1J79A 3QC3A 4LUSA 3N19B 1SSGA 1GOIA 3FA4A 5D8WA 4B5WA 2YBUA 4L5ZA 1ZBWA 3GX9A 3M43A 4GKTA 1LBFA 4UBPC 1IT0A 5E0CA 3VKCA 4JTQA 2GGEA 1AMKA 3ITOA 1RD5A 1C9WA 3H7VA 2AL2A 1JULA 1XIGA 2F8QA 3I3EA 2ZUSA 3AIUA 1K4HA 1MVYA 4RDYA 1W2VA 1PDYA 2OYMA 3HBLA 4OBTA 4MY9A 3EOUA 3QV8A 4HYRA 4X9SA 4QNWA 4CCEA 4FZIA 1IEXA 3MDWA 2NXGA 4D6DA 5GNXA 4AY8A 4ADUA 3QLLA 3CJPA 4GLEA 4UTHA 1JGIA 4S3AA 3VD9A 2VC6A 4HPJA 4DNMA 1HKVA 2GVGA 2EPLX 1H7XA 2Y8UA 3PG9A 1DORA 3L2IA 3S83A 5G5IA 3RMEA 2EO7A 4EPEC 3EX6A 2AOSA 4XO7A 1IV8A 4OBRA 3SQSA 5M17A 3KVKA 3VIMA 1BLIA 1CGWA 4CLMA 1YDOA 1K9DA 3STCA 2HK0A 2QJNA 3DCPA 5HJLA 4B9YA 3AAMA 3VIJA 1VBHA 3N14A 1BVZA 1GTHA 2IPFA 2PE4A 5IHRA 2REQB 4TX6A 2FFCA 1Q5MA 1FKXA 2XN2A 1K9FA 4DF0A 4M81A 1K6AA 3IJLA 1L9WA 2O9OA 3TYCA 3Q94A 3QPEA 1NOFA 2YCIX 3IIOA 2R94A 2B81A 4IIDA 3APGA 5E9XA 3EWBX 4H9VA 3DBPA 3VOCA 3W26A 2DSUA 2X0HA 5A2BA 3OLDA 1V3HA 4O1FA 1XBZA 3NSXA 4KESA 3T08A 4Q4QA 3V5FA 4DWDA 4FI4A 5FF3A 3P5ZA 4KQNA 1Q4NX 1TR9A 3IGUA 3O6YX 3M0XA 3NOEA 1UA7A 4TTUA 4AWTA 3SW6A 3SFWA 4C6OA 4GC3A 6REQB 2PCQA 5DMMA 4MTVA 3Q58A 4UMCA 4M7TA 3USBA 1WA3A 2PP0A 3BLLA 3E96A 1JYXA 1EJTC 1WDDA 5G2HA 2FTWA 1VFUA 4J2MA 3WN6A 4NL1A 4Y9OA 2ALDA 5HANA 2J7DA 3NIYA 4JL1A 5LIKX 2NLIA 3H2FA 2ZDSA 2R1MA 2XVLA 4M80A 4UFMA 2HRWA 1KGUA 2O9RA 5E93A 4DJFD 1EFZA 4H9MA 3UA4A 3BGAA 2C7FA 4ZQNA 1K8XA 3B8TA 4ZCWA 4JICA 4FX8A 3ITGA 4PSRA 3GNNA 2RFGA 3PK7A 1AMYA 3DFYA 2CLPA 4NRSA 3CASA 1HGWA 3NL3A 1EWEA 2QULA 1I9CB 2Z4GA 3U4AA 3E2RA 2I1OA 1D7KA 1Q66A 1G94A 1ZCOA 5MHBA 4A05A 3F4VA 3OLIA 2PSNA 3TYEA 4D6FA 1W0MA 1Z32X 2VQTA 2H9AB 1QK2A 3NZQA 4G1KA 4D8ZA 3VCNA 4ACZA 2PDIA 3UG8A 5K4XA 1ITQA 3T42A 2ZXQA 2HTMA 2D0FA 3GXMA 4WKHA 1JDCA 3B4YA 3WD0A 4H6RA 1WOBA 1V77A 5A69A 1AZ1A 3WJWA 3NA8A 1DJGA 4P7QA 4WKFA 3SB0A 3UZJA 2JBMA 3ID7A 1RY0A 3QF0A 3PPCA 4TVCA 4FLSA 3MBFA 3G0XA 1WAWA 2WLYA 4LBUA 4EX4A 1MRAA 2Z7GA 1JAKA 2OSXA 1UWTA 3BLDA 1KR1A 1XIMA 2G37A 4B3ZA 4JTGA 3L4VA 1K6WA 2P53A 2WCGA 2YPIA 2HWGA 4ORIA 1GVQA 5A95A 1YBQA 3RU8X 2Y88A 4LH8A 4YLWA 1OX6A 2C0HA 4H04A 3BSMA 2OLHA 4IJRA 3UT0A 2OEKA 4KIEA 4QTGA 1I4NA 5DY3A 2GVJA 4W8BA 3WDIA 1GJUA 2YDAA 3A9IA 2X8RA 3WF4A 3FOKA 2VQUA 3VUSA 3MHGA 2TRSA 4YS1A 4D6GA 1Y5VA 1TCMA 4KT2A 3CZEA 4JY8A 4C60A 1FXQA 3BUVA 2IQ0A 4OHQA 4FAMA 4LW7A 3UBPC 5EMKA 3NVTA 4KKXA 3C3UA 1XLDA 1AW1A 3VCRA 3OGVA 4PEEA 4M82A 1VFTA 1UIPA 3CPGA 2CLFA 2PWVA 4S3FA 1SJCA 4RNFA 3TW7A 4LS1A 2JE8A 1TJRA 4ERAA 3BG9A 4I9TA 4IF2A 1MW3A 1HW6A 2C16A 1N8IA 3N4EA 5I02A 1XJBA 4CCDA 1L2QA 1QJWA 3ITYA 1DQXA 3BK0A 4IFKB 3WH6A 2BX7A 4N9BA 5C2GA 1MUCA 2P76A 4HPXA 1E4IA 2G3FA 3IGSA 4UNIA 2ZRZA 3MCNA 3E2QA 3AHZA 2ZRVA 2XFYA 4NUWA 3NPUA 4MY1A 2DORA 1FH9A 3BJSA 3ZO9A 2IKGA 2E9BA 1KFLA 3UJSA 4KEVA 2WW5A 3HU7A 1WBJA 2Z28A 2UY4A 3EWUA 3RM8A 5G2IA 2VUNA 1RP8A 4G5DA 4PCNA 3G0UA 2G96A 3D3AA 3TROA 4LCSA 3W7JA 2CZ5A 5CC7A 2DU2A 1HTIA 1K02A 4UOQA 3L7RA 4HU3A 1PL9A 5K2ZA 2P8CA 4AWEA 1EIBA 5E70A 1JYNA 4L61A 4MYAA 1E3XA 2J6VA 1VHCA 4XK2A 3AJ7A 3QFWA 3JVAA 4MKSA 4DELA 1FCQA 3LZ3A 4K36A 3VNZA 3W7PA 2IPGA 4ZO7A 2NQ5A 3PZIA 4RKAA 1UR0A 4YTTA 2WJFA 1DJHA 3DYMA 3A24A 1R38A 2A3EA 1VFSA 3W01A 2GFTA 2PDGA 2V9DA 4EP8C 3IK2A 1ZJIA 4IPJA 3W2JA 1Q6LA 2B4GA 1P7TB 4DF2A 2WZIA 3R1ZA 4PSPA 4HT3A 5A8PA 5C5YA 2Z1SA 5LIWX 1TIWA 4IQDA 4N7QA 4ICMA 2INZA 1XC6A 3STEA 4UTUA 3CV2A 1UR8A 4ICNA 4AD4A 1WNOA 1M5WA 2HE5A 2EEXA 1JZ8A 4B2DD 2HS6A 4WD0A 5I23A 2WC4A 3TJLA 4BR1A 4NILA 4Y7EA 3TAKA 1TG7A 1HL9A 1Q3NA 2ACRA 3W37A 1W5NA 1RP9A 4W9TA 2OQLA 1NU5A 3KBVA 4IOTA 3WQGA 5TF0A 1H61A 4UB9A 1KBLA 4NAEB 3Q37A 4EPBC 5C2CA 2XJ7A 2XGZA 1AJ0A 2OG9A 1DP0A 1I6NA 3N15A 3UJFA 5J04A 3A3XA 2B7PA 1BRLA 3IARA 1J0IA 3TJIA 5I07A 1XRTA 3HG2A 1U1JA 3KOFA 4KGJA 1JYVA 4HK5A 2YOCA 2EPNA 2V3EA 2PWEA 1W1PA 1DXEA 1UWAA 3TN5A 3SUUA 2WK2A 2B7QA 3W2KA 1PKMA 5LHFA 3LA4A 1V7AA 2DV0A 1CB2A 4Q7BA 3MCMA 3U57A 2CLIA 3Q65A 1U1UA 1AH3A 1KXHA 1J0KA 3P62A 2XM1A 3VMPA 4GPNA 5CH9A 1M9HA 4YN5A 1JZ5A 1B3ZA 3TQ0A 4BI6A 4K8HA 3B04A 1UD8A 5LSMA 3AXXA 1FRBA 4UTIA 1ITXA 3IRSA 3OW1A 4YWSA 1QO2A 3WNMA 4Q4MA 5GPRA 4B92A 3WFAA 1C8XA 2YDRA 3T55A 1GHSA 3C2VA 1QI0A 3WUEA 4JFVA 2XVPA 4IIFA 1MZHA 5CKSA 4ZFMA 3ISIX 1IE7C 4DBEA 1R3TA 2VUYA 3MTWA 2TMDA 1TPEA 1OABA 1P7TA 5AZ0A 2EHHA 2QJIA 3WK3A 1K03A 2QT3A 3N6JA 4H1ZA 2YKKA 3NGFA 5D30A 1OSEA 1LROA 2G3IA 4KCUA 2FJKA 1FDYA 5TIMA 3NQVA 2CHNA 5CG7A 1TPFA 1VYPX 4TR9A 5JH2A 4JCLA 1O60A 1WKEA 1EO7A 4JKLA 3K8MA 4A8IA 2PODA 1CLXA 1KCZA 1D7FA 3EWYA 4RW3A 2E5CA 5AYZA 1QHPA 1JF6A 1CXKA 3LNMA 4MFDA 1BKHA 3JZUA 1XBYA 2PDJA 1X39A 2ONEA 1QCWA 4PFMA 4F3HA 4E5TA 4H01A 1KFJA 4HHPA 3EB4A 5KZMA 3KRSA 3ALGA 1EXBA 6ENLA 4CQBA 4PEKA 1EJWC 2E5DA 1QWGA 4GACA 3BPWA 1ECEA 3EXRA 2INFA 1Z89A 2CZEA 5EPDA 4EPKA 4DEFA 1LT7A 3W29A 5M03A 3UEQA 4C6LA 3UR7A 1BGAA 3EB2A 3CZ8A 4Z1CA 1UWSA 5KZDA 1TX0A 1Y7VA 2Y1HA 4J40A 2R1PA 4IHCA 3P14A 4HOWA 2F7FA 4LAMA 3V35A 4AWUA 2VC5A 2ZRXA 1JI1A 3V75A 3EWDA 4NAEA 4WHBA 1VIWA 2P50A 4NRRA 1Q65A 4YMZA 5BU6A 3PJWA 3SCQA 3W6YA 2X0YA 3UW6A 4PBGA 4O28A 4PYSA 3S2JA 4OTKA 5BROA 1FWGC 4NZ5A 3I3BA 1AH0A 2OKOA 3MANA 3A5FA 1KBJA 1FFQA 3DYOA 2DEPA 2ZTKA 1RSCA 3W28A 2PGEA 5EL1A 1GGOA 4I8DA 1JPIA 3WBEA 1KM1A 1J2BA 4W7VA 2PMQA 4YYCA 4IFKA 1X98A 2O4QA 4MB3A 4O50A 3SCOA 1MDRA 1E55A 3DFPA 1R7OA 4KFNA 3A47A 1MNSA 4DYKA 1VFFA 4K37A 1BD0A 4POCA 4O16A 5A8GA 4EF8A 3MS8A 3ATYA 3TXVA 4PBEA 3R7MA 4GYPA 4XZLX 4DJEA 2J74A 3QOKA 5DLCA 2HISA 3CB8A 3P82A 3UWUA 1IIHA 2P3EA 3BO9A 2BY3A 4WZHA 2DSZA 3UG3A 3RNDA 1Y0EA 1NELA 4IM4A 4CU8A 2AKMA 1H7NA 4RXFA 3S2MA 3KCLA 4LAOA 4E2OA 1H1ZA 2A6NA 3CUXA 1XGEA 5L6UA 3O8AA 1EOKA 2WNNA 3DH7A 2OCZA 4FK9A 2QCDA 3DIPA 3GYEA 1TPUA 1RA0A 3DI0A 4XZNX 5HUOA 2VEFA 6PTDA 2PWDA 1W8GA 4ZXLA 3REQA 1XKYA 1G01A 3MUY1 3CZGA 4DHGA 3R11A 4LRTA 2WOQA 3W81A 5D2WA 1B9ZA 4XKYA 4F9DA 1W9PA 2BSLA 1KLYA 3ZR4A 4JIPA 4HD5A 1SZGA 1H7PA 5A8MA 2VFHA 2QUMA 3MWCA 4HA1A 2V2CA 2QF8A 2YCLA 4BF7A 3LXCA 2OU4A 2IKHA 2WNZA 2D24A 1WKDA 2QVNA 2WJZA 3KHJA 3GC5A 3P8IA 4JKMA 1ML1A 4C1NB 2XVNA 3W00A 4AEFA 4IQLA 1GVYA 1JD7A 1JI2A 3CUZA 3P0XA 4YYFA 2QIIA 2XISA 4O54A 1TWWA 4LV4A 1XCWA 1LG1A 2XM2A 3RPDA 4NU7A 4AIBA 3DU0A 5I3HA 3PSVA 1OX4B 1JZ7A 3KOYA 2WVVA 4H8HA 2BBFA 4GJJA 3RG6A 3GYCA 4BZYA 4KBXA 4PUJA 3B4UA 3B8DA 4GIEA 3E6EA 2E8YA 4E0CA 1THFD 4D6JA 3ERPA 3B05A 1E1CA 3N34A 4OJYA 3EMQA 3WLJA 3ARVA 1HUVA 3H4XA 1KRCC 3UXKA 2F2KA 2WVTA 1CI1A 1FWDC 3M7SA 4YTSA 2R1KA 3B97A 3LEPA 4TV6A 5HNNA 1P1MA 4LUSB 3CAQA 1KNWA 3T8QA 2BGQA 4MAVA 1HO4A 1PEZA 3AS1A 2Z24A 3I7SA 2NUWA 1XBXA 3T07A 1ZRQA 3OBKA 1XLAA 2BWGA 4QAIA 2WQPA 3OA3A 1S5MA 2WZMA 3FEMA 4MZ8A 3OOQA 3O07A 1OBAA 1P0DA 3IIZA 1V6UA 1YTDA 2RKXA 5AC6A 5EBAA 2AL2B 1XLJA 3OVPA 4LSBA 4RX0A 4FIRA 5AVHA 3W87A 2NSXA 5JVLA 5IHSA 4LB4A 3GB6A 3MI2A 3BLPX 4IMGA 4AZHA 4CVWA 5A6TC 5F7UA 3WQ6A 4KRZA 4UR7A 3SGZA 3PP7A 2EKGA 3IJ7A 5EMJA 3BZGA 3N9SA 7A3HA 1MSSA 2EPKX 1EQPA 3II1A 3M0JA 3AHXA 3EDFA 5I3KA 3H2OA 4QG9A 4Y2WA 3U48A 3VTRA 4H9TA 3DKJA 3MV11 4BQ4A 1LWIA 3H2NA 4DZ5A 3FYYA 1CB7B 3STPA 2YL9A 4D1JA 1W9VA 1PCKA 1NFGA 3VIFA 4ILSA 4LOCA 4URIA 4E2VA 1SGJA 1S38A 5EMUA 2NLYA 4HN4A 3B9OA 2ZC8A 3N12A 4AVNA 3K46A 3N17A 3OBEA 4HQVA 4MKVA 1ALDA 3VOIA 1XH1A 3MVIA 5BWFA 2HEJA 3KOWA 4UNKA 4HA0A 1E15A 1FWAC 4A8NA 4EACA 5JIPA 5E0KA 4HU4A 1J4EA 3W7NA 5C9WA 1QOQA 4L9XA 3EEZA 3NO3A 4LC8A 1ZAJA 2ZDRA 2V3FA 3A12A 3NDZA 1EUNA 5GJPA 3M64A 5C9ZA 3BH4A 4HKPA 2D73A 3ZLFA 1GWJA 4NZ3A 1HJQA 4G7EB 3W7MA 3W7LA 4L4LA 4TVUA 2PWGA 1XLHA 3BSHA 1OG6A 3AQUA 1C3FA 3DHFA 1TE1A 2BXVA 2PDPA 4FXRA 1W3NA 3UR5A 1O5XA 3IIVA 5F2IA 1W8SA 4X2RA 1S2WA 3RJYA 4DVOA 1G69A 4AC1X 2C14A 3NYZA 1HL8A 3QBUA 2ZVIA 1QT1A 3DECA 3LMYA 1HVQA 1BYCA 3W7EA 1KM4A 5AC4A 3AHYA 2ZX8A 4A29A 4WSHA 3T0CA 3QGAC 5ECVA 5D04C 2V30A 2V5JA 3ARTA 3NL6A 4DI8A 4M6UA 1UYQA 1Q8JA 3GDLA 1WO2A 2UY3A 3PTMA 4OKDA 4DWSC 2WBKA 4O18A 2C6QA 4K7YA 3WUBA 1U5HA 1CXLA 1O5KA 1N8WA 4UMAA 1VJIA 4HVXA 4CKQA 1XIEA 4M6QA 4LX4A 3JR2A 2W79A 3HPAA 1V5XA 4PC8A 4IMCA 4LY8A 1H0GA 1SO4A 1JDFA 4A3UA 3GTNA 4O19A 4JX6A 2XH0A 5FJTA 3BDKA 4GFIA 2GVEA 4XSMA 4JTFA 4NZCA 4BY3A 6TAAA 1W56A 3SEPA 4FHAA 3W1AA 1W6TA 1R5YA 2D22A 2AMGA 2VTFA 4AVFA 1ZLPA 5AHFA 1UCWA 4GIRA 2NXHA 4AZGA 5J8LA 3ZVHB 2VEGA 2D0HA 3IPWA 3QYSA 2HE8A 2R24A 1AQHA 4XVDA 1RUSA 5E9AA 1OFOA 1XV8A 1LQ2A 1E56A 2CLLA 1AVAA 3L23A 3K4WA 4JIEA 2WWCA 3UY8A 3WJXA 1VLWA 1XLLA 2GGJA 3GW3A 2BNJA 2NX9A 3SCNA 1SFJA 2DUZA 2CBJA 1EIXA 3R13A 2KX9A 2D2OA 2VX7A 4H4IA 5HNRA 3PBVA 2ESCA 2VOMA 4GQ0A 3ABZA 2D2HA 3VX0A 2C1GA 4DZHA 2Z25A 3FAWA 3WYZA 2RGMA 4QM1A 2VL4A 2CZVA 1E6NA 2Q3RA 4HHHA 3ZIZA 4QQUA 3AICA 2WPBA 4GI4A 3I7RA 4N02A 1OVDA 3A3HA 2JGQA 1WKYA 2HXUA 2OGYA 5LA0A 3SCPA 3CPRA 2PCEA 3KTXA 4KEUA 1Q6GA 2PDNA 4KWVA 1OEPA 1H63A 1M65A 2CLMA 3QZEA 3ITVA 4PH6A 1OC6A 1V03A 2QNEA 3EZ4A 2QDGA 3ME3A 1XG3A 1GEQA 4O0QA 1SFLA 1W5QA 3WDPP 2I5GA 4KEMA 1NDZA 1J01A 3C0SA 4V2XA 2NXIA 2GPTA 1C8QA 1A0EA 3PR2A 4FMVA 1A5MC 4HMCA 1JQXA 1GNXA 3W6LA 3QKZA 1XDJA 1PXGA 3MJYA 2MNRA 4LGXA 5BNKA 4ZO8A 2BOFX 1W1A1 4BQ3A 1KCXA 2XG9A 3MHUA 1OT2A 1O95A 2BZNA 4B15A 3TTYA 5HWNA 1AQFA 1JFHA 5A8QA 3WO8A 4JFWA 4L1GA 1B57A 1PSCA 4WGXA 4ZB0A 1IZCA 1UZHA 2VGFA 3T0BA 3URAA 4XD5A 4YVXA 3WH5A 3GDBA 3DX5A 3NL2A 2PZNA 3I10A 1R3SA 5D8ZA 2BGNE 3EWWA 1UP0A 2C0AA 5AOUA 4CNSA 3TJXA 5HNUA 5EKYA 3RR1A 4JFSA 1ZENA 1UZ1A 2BXYA 3UXAA 3VIGA 1XFBA 5C2XA 3TZNA 1EP1A 4DWSD 4GGHA 2E6AA 1OHLA 2ATMA 4JS3A 1R8LA 4EANA 1V08A 2NVAA 5A2AA 4AD1A 3XIMA 3HIJA 4H19A 3IVTA 1BEUA 4KW2A 4I8YA 2W91A 1JCLA 4ZO6A 2CYGA 3A4JA 4JR5A 4WY0A 1EGVA 3UCQA 1C90A 1EPVA 1E4NA 2ACUA 4HHLA 4Z2JA 3CGTA 4HMEA 3T2OA 4S3BA 1F4HA 3PB2A 5FCZA 2EF9A 3LTPA 1W3IA 1BVNP 3U7VA 4J3UA 3O06A 1W31A 1ME9A 2B7OA 2WO5A 4MADA 5CEWA 3FGCB 1R85A 2WV8A 5CSYA 3A23A 1HJUA 1NSJA 3ZVIA 5D2XA 4DUVA 3M7WA 5HJXA 2P8BA 3MI3A 1JZ3A 3FJ4A 1OGBA 1EYWA 4US5D 3VDCA 4QLLA 3W53A 3N18A 3GVWA 1XW8A 4QITA 3GD6A 4V33A 4QG8A 3RLVA 2ZQ0A 3M0VA 2E6FA 1XYMA 1QPOA 3WG6A 2P0OA 3VILA 4QS6A 3N4AA 4JBRA 5FJIA 3ZT7A 4HYVA 3UZXA 2PAJA 3P60A 4L6OA 3VGDA 3F5KA 3VGEA 1QAPA 5ENLA 1T41A 3EPOA 4IP5A 3EOLA 1KFCA 1ECQA 1G5AA 4YPJA 5FD0A 5EU9A 1EJVC 3MB9A 1U30A 3BLKA 3TX9A 1VEOA 2CEQA 2ZXDA 3WQOA 2J88A 2XINA 3KEHA 2A3HA 3NXFA 5M1TA 4GQRA 4MF4A 1GJWA 5HPOA 1WZMA 4N0RA 4QAWA 3T4WA 3HMJG 4LUIA 3SM0A 3R89A 4DJED 3LUTA 1YRRA 3DG7A 1YNPA 2PFHA 3POCA 1UR2A 1A0DA 3LBCA 4H8UA 3ZOAA 4S3EA 3W27A 4D6EA 4P8WA 1E6XM 1VJZA 1XQLA 4MOZA 3VE9A 2ACSA 4FA3A 4WR3A 3PWIA 1R3VA 4JTAA 4L7ZA 5H8MA 1W9UA 3GFXA 2CZDA 2DT0A 1W1IE 4U4MA 2E77A 2A5HA 2PDMA 3SADA 4C6QA 3TYBA 2VEIA 1LCOA 1AQ0A 3T78A 1PTAA 3A64A 5ABHA 1JCNA 2PS2A 4WIWA 1KXTA 1E0WA 4TU1A 3S5SA 2VFIA 2JQXA 3PANA 3LENA 1QOPA 5FJOA 2VWTA 4MJ4A 3WFZA 2OQYA 3AMKA 2X16A 3CUFA 1CGTA 3ZSSA 1MFUA 2OELA 1ZS2A 3LOTA 1GQJA 1SUXA 4F9JA 4YHEA 1O12A 2VYOA 4S1FA 3PTQA 4CGTA 3BGJA 4L9YA 3OGRA 1GOQA 3IAPA 3GTXA 1O4UA 5HQEA 3WDRA 1JFXA 4Z08A 2ZUWA 3W7QA 1TTQA 2ZZ1A 5C9UA 2ZA2A 2GDUA 4GZEA 5AHNA 2CWNA 3LN3A 1LYXA 3IAQA 5F2LA 1E6RA 1CBGA 3KE0A 5I00A 3LI0A 1TUXA 3UQNA 5FEXA 3HN3A 2A0NA 3UPWA 1Q4WA 2O9TA 1YE6A 1VPQA 4GABA 2GVYA 3BG3A 2G3MA 3H7RA 3TC7A 2MANA 1VF8A 1CPUA 1TVNA 2DZPA 4GQGA 1ZNNA 2VVSA 2TAAA 4J3SA 3W88A 1Z8AA 4GQBA 2J8GA 4DM2A 2V69A 4JTHA 2WMIB 3FKRA 4LPCA 3KVJA 3ZLHA 4Q6XA 4FB7A 1OF8A 2DZXA 4DX3A 4Z0SA 2VGGA 3GIYA 3A4WA 3NWRA 4CVUA 3R10A 2C8NA 1QASA 3UD6A 5CGTA 5CJ5A 4JNYA 4B3KA 3LQLA 3F4NA 4XZMX 1E6ZA 5T9BG 2C79A 3SCUA 4LVAA 3FEQA 4DJDC 3B03A 2OJPA 3GVQA 1Q2SA 3PZQA 1IEIA 3HJEA 3NM1A 5FF7A 3FAXA 2F61A 3L4XA 4KWUA 2J27A 3FJNA 3I7QA 4IG2B 5FAJA 5CZ0A 2PDUA 4WCJA 3FYPA 4FIQA 2FH6A 3V3WA 2QGYA 1OX4A 2VO5A 3TWBA 4IL0A 1M03A 3UWEA 3HO8A 3KBJA 3N4FA 1W17A 2DZTA 4LAZA 2Q02A 3LZ5A 3DESA 2Y8KA 4PRRA 1S2VA 3SRKA 1S46A 2QYGA 3CO8A 4ZR8A 4ES4A 2PWUA 1CGVA 3CZKA 1PTGA 5E09A 5IXEA 4K2SA 2OZTA 3E74A 3RILA 4OUEA 1DE5A 1W9DM 3HPZA 5EYWA 1H1NA 2Z26A 1EBGA 2XSAA 2EBNA 4DUOA 2E6YA 4GVGA 1GQNA 2CPUA 2A21A 2OXNA 3CWNA 1VFLA 4FOJA 2QCFA 4C6KA 2ZUMA 3V4BA 3S1WA 5F4SA 1PZ2A 2HQAA 3FDKA 5LNSA 2WXDM 1IWBA 3H54A 4WOQA 3WK0A 1YPFA 2NT1A 4KWWA 1YDYA 1WKFA 1P0EA 2QHAA 1VZWA 1YQ2A 4YHGA 1WQ5A 5BXPA 4GRSA 4OQVA 3OZYA 3M5ZA 4PMXA 2GWGA 1O66A 4X0VA 2GSEA 4E4FA 1PO9A 4PMYA 1VFHA 1XLGA 3VAVA 4K8GA 5CGMA 2D2JA 4Z2IA 1A80A 3RX2A 3URBA 5I78A 3PY2A 2O92A 3TE9A 1HJXA 4FF5A 4I9MA 2LLEA 3BAYA 4JTSA 3E1F1 3N3MA 3NZGA 3EX2A 4XAPA 1J9YA 3AU2A 2OMAA 3DC0A 2UY2A 3VNKA 4D6IA 1FWTA 1LF1A 1L8PA 3BAXA 4HOXA 1B4EA 5AYYA 4G7EA 4H9YA 5LHEA 1E6QM 3O6AA 1PJ9A 4PMQA 1ISZA 3B8VA 1RCOB 2PDKA 1M01A 5D2TA 3BMWA 2WPGA 3GR7A 4IUOA 4CQ9A 3EBVA 3HG3A 4P2VA 3P5YA 4YVPA 1I2NA 4DBSA 1MO0A 3AYVA 3W9ZA 2Q6ZA 1GHRA 1MW0A 1UKTA 3WCZA 2F6KA 3GXDA 2I56A 1GYLA 2VT0A 1K1DA 2Z1WA 4WX2A 2QV4A 3M16A 3G1SA 4O52A 2CITA 4CD7A 1H60A 2W67A 4RCXA 4M29A 3UGVA 3PPGA 1XISA 3ZLGA 1QATA 4H8NA 3IGXA 3O15A 3PM6A 1C29A 4CQAA 4I5RA 5HQMA 3WSUA 3N9RA 3G3DA 4MWAB 2ATSA 1JL8A 2VDHA 4JQ1A 1A47A 1QW9A 2G50A 1ODUA 3W71A 2VP8A 4REQA 4L4MA 4E8GA 3D47A 1GG1A 2E9MA 2XGIA 2G4JA 1FCUA 4PFHA 4B5TA 2IKJA 1A5UA 4RE0A 1AW5A 1H7OA 5FL1A 4OV4A 5H8UA 1PHWA 1HIZA 3DOPA 3T0AA 1U2YA 5FJJA 5HR6A 4LYQA 3L21A 4Q8VA 4O1BA 4LAKA 1O7AA 1QHOA 2EJAA 1KFWA 3ITXA 5M2FX 2Q3OA 2VMFA 3RPMA 4OVXA 3OQEA 4XZIA 4QSFA 4JFTA 4LNYA 3RM9A 1ENUA 3CMGA 3G2GA 5F1UA 1UKPA 1GPFA 1O94A 4RDWA 1OCQA 3H12A 2WWDA 4KRUA 4BI5A 2QPSA 2X7WA 3CUIA 4CNTA 1DJQA 3UVIA 1A3WA 3G22A 4PMNA 1SZEA 4AD2A 4K7VA 2BHUA 1WBHA 1IWAA 2A3BA 4GVIA 2YCEA 1H49A 2I5QA 4E3TA 1JXKA 2DH2A 1G4PA 3N3TA 1X96A 5BRBA 1UD5A 1OJXA 2XTKA 4MJZA 5DBTA 5E6YA 2DPEA 9RUBA 1Y65A 2PDCA 1DTUA 3QH2A 4PRWA 3JZEA 3V5OA 1BG9A 4PR4A 3BURA 5AYBA 2C19A 4X0NA 2QDHA 2WHJA 1C91A 3M46A 4CD8A 3Q2DA 1QNRA 4H00A 1PBGA 3GWQA 3RYSA 3ABXA 3AMDA 1J5TA 2YCJA 8XIAA 3GNXA 1Y5XA 4F4RA 1JZ6A 1HL2A 1BGGA 3UZZA 2FDMA 1S1RA 1R3QA 3LERA 1PIFA 3GU2A 1EDQA 2FH8A 1ZUAX 3PZMA 1TQJA 2G97A 3EA1A 1L6SA 2ZUTA 2WMKA 2W9MA 1JCMP 5CJNA 5DRCA 4HNNA 3KOZA 1OCBA 5BCAA 4FF7A 1YXDA 1UD2A 3ARPA 2DZWA 5BYWA 4EXBA 2PURA 4GVFA 3D0CA 4IT1A 4O8RA 8TIMA 2WMGA 1TWDA 1FHUA 3PB0A 1OYCA 4IPIA 2QJJA 4ZQPA 5C8BB 1OC5A 3FHQA 3CH0A 3P80A 5H91A 4W93A 4BCEA 4PMVA 2FTYA 1V6TA 3S9YA 1X1NA 3VDGA 4CUCA 1YKWA 3LGGA 1Q6FA 3HG4A 1KO0A 4Q8PA 4S39A 3U6WA 3OHMB 1YDNA 5TNVA 3TVAA 4KS0A 1KRMA 1QNSA 4L65A 3S2NA 2A3LA 2GOKA 4NJHA 3TYDA 1REQA 2CW6A 4TV5A 3UU0A 3VE7A 1Z42A 2YL5A 4NNCA 1PS9A 3RR4A 3ARRA 4O12A 1N8FA 4XWUA 2Z2BA 3G1VA 3GU9A 2HV5A 3PC0A 4DO7A 2VGBA 3UPBA 1OYBA 4AAJA 5A94A 2JIEA 5JIWA 1BWKA 2C13A 3I68A 5DMLA 4QNEA 3QM3A 3B8SA 5HQLA 3UP8A 1TPVA 4QG6A 2PDFA 4F0SA 4F8XA 1HJVA 4Z17A 3CUGA 1U83A 3C2YA 3URNA 3QY7A 3P84A 3SQMA 1E4LA 1Z7AA 2PC8A 4MSSA 5A8OA 2HSAA 4C65A 3NZ1A 1SJBA 5I79A 2ZUVA 3AHTA 4NYUA 3FKKA 1I1XA 2DJXA 2J7CA 2JEPA 2Z1XA 3EX4A 5AYXA 3VA8A 2PU0A 1XSKA 4GY7A 3W7CA 4KEZA 4R27A 4I5UA 2E5BA 1ITUA 3IVSA 3MO7A 1ZB5A 1LG2A 3WH8A 1V3MA 1M3UA 4TX9A 3C0JA 3E38A 3W2MA 1S3HA 4UWMA 3PZVA 3UCCA 1WUEA 2QMKA 4C5YA 6CGTA 2Y5EA 1WUFA 3KDOA 4GI8A 4HHMA 3LCGA 4OGZA 4MWAD 3UZYA 2PRHA 4RR4A 3PHAA 3RCYA 4GK8A 3D5HA 4PODA 1Q6CA 2RJGA 2AAMA 1YDVA 3EOOA 1EP3A 3BV4A 2QCGA 3CQJA 4C7GA 1UG6A 1SZFA 2GK1A 3SECA 3GY1A 1R3YA 3CV6A 3LGEA 3QMSA 3FLUA 1T7LA 3NQ6A 1X6UA 3H2EA 6A3HA 2QLYA 3GDTA 4Z1YA 1YMYA 1OB0A 1OC7A 3SDOA 4XD4A 1KD0A 3LSBA 5AVNA 1BVWA 1V02E 3JRKA 1KRAC 4EXAA 2OWXA 5HPCA 3WD2A 3CT7A 2VM8A 4QFUA 3HTWA 2R9RA 2E67A 2QJHA 3LY0A 3DHDA 4GUFA 1I2RA 2Y7EA 3VGBA 4U2YA 5KEZA 1MNZA 5CPMA 1CZ1A 4IX2A 4WY0F 1POJA 4JEJA 1VEPA 1RHCA 3VNLA 1O1HA 1PV8A 2P10A 2GGIA 1G67A 1PYMA 2OEJA 2C3ZA 4Y8FA 1AUSL 5HBFA 2X09A 2XIQA 3QZAA 3KL3A 1R9ZA 2DP3A 4PUWA 4LUTA 1E6SM 2PDLA 2Q09A 3C6CA 1LJYA 2PGRA 1EX1A 3NZPA 4MNLA 2PP3A 1F05A 1UOZA 4AF0B 2ZUNA 4K1GA 3TC3A 3QJAA 3LD5A 3H8AA 4AX6A 5I3FA 4BKNA 4AZ5A 1AH4A 4JX4A 3AIQA 4GZIA 4LALA 4O1DA 1V8EA 2Y0FA 1TV8A 3NQCA 3IEBA 5H8PA 2XIBA 2XZ9A 3BC9A 3TR9A 1KV5A 4QCFA 1ME7A 4Y96A 3VZZA 3NUKA 4DWSB 3MKKA 4JIRA 3AROA 3G1YA 4AYSA 4UCGA 2H9AA 4DF1A 3TNBA 4GUGA 1VBGA 2CKRA 5LXEA 1J18A 3K13A 4DZAA 3TNOA 1PYFA 1KBKA 3W86A 4S3DA 3FHAA 3VDHA 1K3UA 2PLMA 4JXCA 3CL8A 3EYPA 2I57A 2DQXA 5JBEA 7PTDA 1FCBA 5LIUX 4DNHA 4NZ1A 4EF9A 2FZBA 1DXIA 4YIWA 4HZ7A 4RNIA 1VHNA 2CXEA 2OWCA 3AC0A 1P6BA 5DQPA 2O9PA 3OYZA 1E71M 1YTKA 1EZ2A 1FWBC 2I5IA 2RJHA 3J7HA 1IHIA 2BXZA 3EKLA 1RQEA 1TREA 1JRCA 2V5BA 3ES7A 3LV6A 4IIHA 1FDZA 2PRLA 2D23A 3LCLA 1XLEA 1KXVA 2VEMA 3CAKA 2IXVA 3VZXA 5DN1A 1BYAA 3AMLA 4N4QA 2OX4A 3F2CA 3ZWTA 2XFFA 1TMLA 1F8MA 1Q45A 1Q6EA 4O1EA 5FJPA 1S5VA 1RD6A 2NT0A 5EB8A 4DJDD 1TX2A 3R0DA 3VGFA 3OIXA 4BF9A 1O5RA 3VD4A 2PDBA 3AI0A 1AQMA 3WD4A 4MKNA 1Z9AA 4XTIA 4BQ2A 2ZXAA 1HNYA 3UYCA 5CBBA 1OK4A 3KL0A 3G6LA 4YTUA 4GCXA 1EJUC 4RLIA 4ML9A 1Q6DA 3CHCA 3CQIA 3IUDA 4UTFA 1JF5A 4HA3A 4P5UA 1A5BA 1EC7A 1MQQA 3TW9A 3RN6A 3UJ2A 2Y85A 3QC0A 3SSZA 4AD0A 3GAKA 1U22A 3BW2A 1P0NA 1DJXA 2NSOA 4TUFA 2YX0A 3QEZA 1BTMA 1XI3A 3VKDA 1QFEA 4UOZA 5CAKA 4JN6A 1LBMA 1NVMA 4UQEA 3S3GA 4I7UA 3PWGA 1XGZA 1P43A 1ICSA 3AWNA 1T8XA 5M5DA 3GG7A 4MB4A 4P7OA 4L1WA 3WBWA 3QGKC 4QXIA 2HS8A 3KBMA 4LCQA 2FZMA 4FLOA 5F4XA 1ZJBA 2DUXA 5K9DA 5G4WA 1SO6A 1B54A 4WSJA 4U33A 4O0ZA 1QW7A 3GG8A 4IZGA 2EG8A 4YU1A 3KZPA 1ITCA 4BHYA 3GUGA 1KCLA 1DQWA 3R0KA 3DN5A 3LCWA 3MP3A 4ZB2A 2HJPA 1UROA 4S38A 4UCFA 5B80A 4LEQA 4R88A 4TX8A 3W1TA 3LNPA 2JALA 2VENA 3T7VA 2UZ9A 3A9BA 3NNTA 3LYEA 1ZALA 2EAWA 4GUIA 1G1YA 4JN7A 4LYPA 1Y8BA 3G6MA 3IUIA 1GYMA 1A5CA 3MYPA 1VH7A 3TEVA 1H3GA 3E0LA 5I5RA 3FA5A 4Q6JA 1W1ZA 4M1RA 5HOSA 2BTMA 1QU4A 2E25A 1MXGA 2ZYFA 3AS3A 3UXLA 1FP9A 4FNQA 1UHVA 2Y89A 3PPFA 1HG3A 1CXHA 2QJMA 4KIRA 3W25A 4MB5A 2ZRYA 1SJAA 1BHGA 4PL2A 2OSYA 1F6YA 4LVGA 4OE7A 1FH7A 5BMWA 5GQBA 1T8QA 4ERGA 3GIPA 2XIIA 4OFCA 1V0KA 1Q7MA 4TXEA 3K4DA 4US6A 3U3HA 4QHRA 5HR7A 4M19A 2ZX5A 1NWTA 3FGCA 4G6CA 4K39A 4ZE5A 2P0IA 2GLKA 3WK2A 1JVNA 2ZTJA 1POKA 3W02A 5IOBA 3AZSA 4S23A 3H2MA 4C1KA 2Z6JA 1FUYA 4TO8A 1CWYA 2YGYA 5K9XA 4HNLA 4IXXA 2V5LA 1P1XA 2A2IA 4E4UA 1AJZA 1H7RA 4HTYA 5IDZA 1Q8AA 1JDDA 2WVSA 1H62A 3WDQA 1QTWA 4L9ZA 4TIMA 1B3OA 2PTWA 4BS0A 3S1VA 3PBYA 2Y24A 4S2CA 3HPSA 1EPXA 4RE2A 5I3JA 5HNTA 2F2HA 3KBNA 4W85A 1QOXA 3E2SA 3QOMA 5A6SA 4NT0A 3GC2A 4TQTA 1WAUA 1VBUA 2DT3A 3R43A 3S47A 3GW0A 2XVKA 3OA5A 1BPLB 2JF6A 1DWGM 1JNEA 2J7FA 2PC4A 3SY8A 5CPSA 2FQIA 3GSMA 3HPFA 4B4FA 3IV3A 2RH9A 3ITLA 1B90A 1GOMA 2VZUA 1J10A 4ROQA 2E1DA 1V6XA 3NQMA 3VFLA 2VR2A 4FR1A 1VPXA 3AMCA 1YXYA 3ATZA 4M6VA 1W3TA 3KDNA 4P7RA 1NQ6A 1QRQA 4NF7A 4DXXA 1TPDA 1JJKA 2ZBTA 4XZ9A 4DAIA 1PB0A 4XBSA 2ZRWA 1A53A 5XINA 5CPOA 1OD8A 5A6JA 1YW1A 4PTMA 5CZJA 3IK4A 4H6KA 3N6QA 1T96A 4B5SA 2VHLA 3C4UA 2VC9A 5C70A 3GNRA 2FHFA 4V15A 1KWGA 3AZRA 2J6XA 2PDQA 5A3HA 4W8LA 4HJWA 3RJXA 1DIOA 1Y5WA 8CGTA 3DYPA 2ISVA 4Q8NA 2WJDA 2WCAA 3DDMA 3WLRA 3UYIA 1QVBA 2PTYA 2CWXA 5EFFA 3GXNA 3U4FA 1SO5A 1Q6RA 1JR1A 4X22A 3WQCA 2ZRUA 4IISA 2XIOA 4PGLA 4ZXOA 4RL3A 1EYEA 3CMFA 3L66A 3TKFA 2PLKA 3CL6A 4JQAA 1KM6A 2XSXA 2XDFA 2YSWA 3OGSA 5B7ZA 1UW9A 3W3OA 4O14A 1QK0A 1MRQA 4R5EA 4WGHA 1W3HA 1OFBA 4CNUA 3CH9A 5DX7A 1CXFA 1XQKA 3O6CA 4IIGA 3IIPA 2FZ9A 2ISWA 4Q22A 3RRAA 1S5WA 4R7JA 5HJYA 4X2PA 4A35A 3W74A 1UASA 4L4OA 1HF6A 1R47A 1NM9A 3QHNA 3WLMA 1M04A 3U9IA 1OT1A 5IDIA 3H22A 1FWFC 3CLWA 2QCCA 5ABEA 3GH4A 2GQAA 1HKIA 4UTMA 2VNCA 1JIBA 1XLFA 1E1FA 1LDCA 1CLKA 1QBAA 2AKZA 2BP1A 1NQKA 4GUJA 4I5XA 4XBKA 2W3ZA 4XX6A 4ZOEA 3TFCA 2J8FA 1J96A 3TQVA 1LL4A 3CLMA 1ZJAA 1KXQA 1B0IA 2F6XA 1TMQA 4PA8A 4PRTA 4AXNA 2DIKA 3IVUA 4CNOA 4DRSA 1IGSA 3BXWA 1H41A 4GXPA 3L67A 3S8HA 1Q7QA 2C1IA 2J7HA 4GXWA 3PUDA 4IL2A 3AALA 1XYBA 2OTDA 2KZHA 3EKGA 4LFYA 1KRBC 3SBFA 2A7RA 1KM5A 3EXTA 1E70M 2ZZ5A 3ALFA 3UNTA 4UTLA 3Q45A 1XYAA 1DTNA 5JQ9A 2DT2A 2X1SA 3KS6A 3QSRA 5CJMA 1JD9A 4OECA 1R0MA 3MP5A 3W38A 2BV9A 4ZQRA 2NQHA 1GYNA 1H5YA 1BG4A 1J6PA 5IFTA 4KF1A 3W1UA 1KKRA 1R9XA 3DUGA 3SJNA 2WVUA 2D20A 1L6YA 1CIUA 1XLCA 1EP2A 2RGLA 3PAJA 1E0XA 4H9ZA 2GJPA 4EAYA 3CWOX 4H2CA 1QI4A 2QV5A 4O11A 1KM3A 2GGGA 1K70A 4E3VA 3A4XA 4AMCA 5CLTA 4C91A 5BMXA 4UR8A 3N11A 1S1PA 4UQCA 3QV7A 7ENLA 2BY0A 5A1AA 1QR7A 3UZWA 3A3WA 2DVUA 4J9JA 3UPMA 3F2DA 4C90A 3B0VC 2EJ1A 4ORMA 5HWMA 1JDEA 3CNYA 3MUXA 3NPVA 3FVDA 3H2CA 5DELA 4AH7A 1F5ZA 1XRVA 2AGTA 2DIEA 2HMCA 2TYSA 2EQDA 4IPPA 1M1BA 1SSDA 2GJNA 1ZP3A 4QJ4B 4J2PA 4MB1A 3LPFA 4QCEA 3DAQA 2DVTA 2PTDA 2IXUA 4PZVA 2PDWA 4AVOA 4TOQA 2HVOA 4ZOBA 4IMDA 3S42A 1DJYA 4R7WA 3BJTA 4UMBA 3QY8A 5C6MA 1XYZA 4I3GA 1GJPA 1S2AA 2HPMA 3L4UA 2QDDA 1QMLA 3EA3A 3KS5A 4L64A 1GVFA 1KFKA 3EOSA 3C56A 3TP4A 4WDWA 1AW2A 4QSHA 4IG2A 1SW7A 4IP4A 3NM3A 1V7YA 3WF3A 8A3HA 1XBVA 3LM3A 3PN8A 1K9TA 2J4GA 3THAA 1F6KA 2X1RA 4KERA 1X8CA 3SZ8A 3IJ6A 2BY1A 2Y61A 3EEGA 3RRXA 2MUCA 4OZOA 3W7GA 1V6YA 4Q33A 3BICA 5BOOA 2X0SA 3L2MA 3HF3A 1UIOA 3EMZA 2QUUA 2ZWZA 4ZOAA 5J5DA 1TV2A 1EDGA 3TC6A 5U4NA 3W23A 2G3NA 3QGVA 4M51A 1JUEA 4GCAA 1IQ8A 3S2CA 5A6AA 5BXRA 4N9EA 1HP4A 1PKYA 1IZJA 1NY1A 2A79A 4EPDC 4J5NA 1YX1A 1NFBA 4CN1A 1PIGA 3EAUA 4C6FA 3M6YA 1ISYA 4JIQA 4GO9A 1I2PA 1S5NA 4MDOA 5M3WA 3T81A 2P3ZA 3MMTA 1HGYA 4XZWA 2V3DA 2PF0A 4DZIA 3MC5A 2TODA 2NX3A 2RDXA 4ZSUA 1SJDA 4ONVA 5XIMA 5REQB 4GYFA 4F40A 5U7SA 3MMDA 4LT9A 4Z2GA 4W84A 4ROPA 4P8UA 1IIGA 4N6EA 1OFQA 3ARZA 4LF2A 3WNNA 4ZEPA 3TSBA 3V1PA 3CEUA 4CU6A 3LXBA 3EXSA 5AHEA 5AC7A 1OGGA 2D3NA 4C6MA 4F0RA 4LS0A 4F2BA 2WM1A 3N25A 2W5FA 2YYTA 2CLHA 4LUYA 3V7PA 3VKBA 2FYMA 2X7VA 2CNCA 3DENA 3ZR6A 1O68A 2PBOA 2J9ZA 4N9CA 4PTXA 2WKGA 4NJKA 1PUDA 1VR6A 4YWIA 3WQEA 1TA3B 3AIEA 4ZBCA 1E40A 1GOKA 2HVMA 3OZMA 5LYRA 1SU5A 1F7BA 1XUZA 2VI0A 5AC5A 3VD5A 4RNHA 4AB4A 3VNJA 2R82A 3CM4A 3W7HA 1R2SA 2XVGA 2E40A 3KTSA 4W89A 4H41A 3M5XA 1ZBCA 6ALDA 4GISA 4Q8TA 1B3YA 3TN6A 1YNYA 1E43A 4UTKA 5D09A 3C2RA 1NOWA 5I6SA 2CIPA 1FHLA 4I90A 3DI1A 1ICPA 4CQDA 3SSJA 3MT1A 1E4MM 4UC5A 2RUSA 3E9AA 3ELFA 4JKKA 4I9AA 3GXTA 3T1GA 3AWOA 3MA8A 3TJ4A 1YADA 5FJUA 4BEUA 2QS8A 4HP5A 1PX8A 3SUVA 1HQTA 1TELA 4JTLA 5L9FA 4U5KA 1X7IA 3LCFA 1OY0A 3W2LA 2CHOA 3RF9A 1TE6A 1XD1A 2O55A 5BW6A 2CBUA 3BCFA 3GFZA 3S6DA 4TMCA 2EG7A 1ELSA 4XIMA 4ZMGA 2XPKA 1TWZA 3S9ZA 2ZX9A 4MG4A 3NCOA 5K7JA 9XIMA 2GVLA 4XD3A 3FNDA 3CPUA 1QPKA 4FX7A 3UJEA 2YIHA 3BE7A 4FR6A 1MEIA 3STFA 4UQBA 4E4PA 1NF7A 3DERA