3W2JA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-135
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Trypanosoma cruzi
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-135
rcsb
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w2jA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w2jA01
1EPXA 1Q3NA 4PCFA 3B8DA 3TX9A 3MYOA 2PC4A 2NXHA 3SJ3A 3TJLA 3W85A 3QW3A 1Z42A 1D9EA 3L65A 3MUXA 5MHBA 1H1ZA 4QJ1A 2Y63A 3KVJA 3TAOA 3GDMA 3LTSA 5HR7A 1TMHA 4IPIA 2E77A 1MZHA 2W79A 4R53A 1QDSA 3P82A 1C29A 2B7OA 1LP6A 3DZ1A 1L6WA 4LC6A 4CLMA 3NQGA 3N2XA 1M6JA 3GDRA 5C2XA 1JVNA 3NQ6A 1N7KA 1Z48A 5AOUA 1L6SA 1SO6A 1OX4A 2TYSA 2NXGA 3QSRA 1W5QA 1L9WA 3T78A 3NQAA 3QYQA 4LS1A 1SR9A 4JDYA 4R7JA 4NVTA 3O05A 3BLFA 4Z08A 3CIXA 3GB6A 4FX6M 3C2VA 4JIPA 2WSQA 2DZWA 2HTMA 3LXCA 2W6RA 1DJQA 1F74A 2A7RA 4LWWA 1ZENA 2VEPA 3O6YX 4N4QA 3NZ1A 5C54A 2WOQA 3QF0A 2GVJA 1LRNA 3EWYA 3PAJA 2JKAA 3PBWA 3GIYA 1OYCA 3R89A 4E2BA 1FX6A 4QNEA 1XBXA 3N34A 1K7FA 5I3HA 4GUJA 1EB3A 3G22A 4MOZA 1KM1A 2ZTKA 3NZRA 5HNRA 4BWLA 1QAPA 4E2DA 1KW1A 3FKRA 1FXQA 5LSMA 1F2JA 1KM3A 4JTSA 1A5AA 3EX6A 1YXDA 3EKLA 4DPQA 3W7MA 3KRUA 4XWUA 1PE1A 4ZQNA 1LCOA 1LBFA 1I2OA 4Q32A 4CCDA 4K39A 4FNRA 2W0UA 3C6CA 1YDVA 1EA0A 1LORA 4IXHA 2Z6JA 3QH2A 1O4UA 5LGXA 1TPDA 5TBOA 1JQXA 1NEYA 3B03A 2WPBA 4JGDA 3A22A 4NJJA 3LHVA 4UFMA 2DZTA 1GTHA 2CLKA 2V81A 1V7YA 1S5VA 3BV4A 3M5XA 3W7QA 3EX1A 5G1TA 3G1DA 3KAOA 5K7JA 3G8RA 4LUIA 1T99A 4Z1CA 4MLRA 1ALDA 3U2OA 1RQEA 1TJPA 5LNUA 1TPH1 4H4IA 3B0VC 1VCFA 4UC5A 1ONRA 3SR7A 3W1LA 2ZBTA 2QCLA 3M41A 3NPUA 1ML1A 1TRIA 2VFIA 4M6PA 4WY0A 1QPRA 4WX2A 2B7PA 2TMDA 1W1ZA 1W5OA 5HULA 4P2VA 4CNPA 3LB0A 4MY9A 1DHPA 2YW3A 4MVAA 1PHWA 1RZMA 3CM4A 2R8WA 3GDKA 4DF0A 1XBYA 3C2OA 4M7SA 2TRSA 1QPQA 1N55A 2E09A 3KX6A 4JYEA 3W1AA 3W1PA 2RFGA 5F4WA 3NL2A 1VYPX 2YXGA 3CLMA 1QNVA 4G1KA 3P8JA 5U7SA 2P10A 3WJYA 2CLLA 4A22A 4DBEA 3IIVA 1SUXA 4E0CA 3THAA 2B7NA 3LGEA 1DBTA 3PF3A 4AF0A 3PULA 1W5PA 5HQEA 4N6EA 2C19A 3LV5A 2QAFA 4O54A 3CB8A 1F6PA 1D3GA 1U83A 4K38A 1J5TA 1IXPA 5HWJA 5BOOA 3RNDA 2QCFA 4UFKA 1DVJA 4YLWA 3TK7A 5I3IA 3TUUA 3PUOA 3LERA 2CW6A 4CCCA 3UZ5A 2Y7GA 3O15A 1JCMP 2Y88A 1TO3A 3G8EA 3NQDA 2J9XA 3DFSA 3LHZA 2YSWA 1LTDA 3W7CA 2FB3A 1BTMA 4LS0A 1A5SA 4UIOA 4NNCA 3ABQA 4FX8A 4O1CA 3ABOA 2YW4A 4JTJA 2V82A 3GDTA 4XTDA 1O5XA 1JJKA 5G4WA 4OU1A 5CKSA 4PL1A 4XZ9A 3G1HA 2WO5A 5CSRA 3CWNA 3UWVA 4YMZA 3UQNA 3CPRA 5EMUA 1FCVA 2QKFA 3MP3A 3W1NA 4MYXA 3M9YA 2Y6ZA 3W83A 1A50A 1YDNA 1W56A 3TMLA 1TPWA 3MHUA 1LOQA 2V30A 4JDBA 4FNSA 3RF9A 2CLFA 2C3ZA 3QM3A 1IF2A 2ZZ1A 4RK8A 4XTIA 1B9BA 1OF6A 4LC8A 1ZAIA 2Z6IA 1TB3A 2DORA 3M16A 4A29A 2E6DA 4Y96A 3FJ6A 5F2IA 1NF0A 4ALDA 1DL3A 1H7WA 5LNSA 3ZR4A 5KSWA 3JRKA 1QOQA 2NV1A 4HSOA 3O6CA 1JR1A 1P0NA 3EWUA 1SO5A 4A3UA 3GNNA 3MJYA 5FF7A 2BWGA 3TXZA 3TJXA 1J4EA 4LUJA 4CQAA 4GFSA 3QMSA 4IWWA 3O6DA 3P74A 3P84A 4WY0F 2XN2A 2DZUA 4MKNA 2BZNA 5F1VA 4FIQA 1KLZA 3PSVA 3QPZA 3B04A 3W3OA 2QCNA 2QJGA 2ZA3A 1U5JA 1PCKA 5I3JA 2C1HA 3STFA 3EWBX 1A5BA 2E6FA 3TH6A 2CLIA 3GAKA 2WKJA 5BMWA 1H63A 2A4AA 1AK5A 3BW2A 3M43A 3KVKA 2QUVA 1TRDA 4IMEA 3WJZA 1KFLA 3C2FA 3BARA 2Q8LA 5FF3A 3TQVA 5FF0A 2GPTA 3KXQA 4ZVJA 1FDJA 1XXXA 4AWTA 3DXIA 2DZSA 5HWMA 5BNKA 2B4GA 1KM5A 3EX3A 2E5BA 2ZQ0A 3BO9A 4AWUA 5D2YA 2ZZ7A 4N6FA 5AHMA 3T7VA 1WA3A 1L2UA 3LTYA 5AC6A 3B0UX 4JY9A 1BKSA 5ABTA 3FJLA 1SPQA 3MMTA 4RX0A 5DY2A 3G3DA 4KWWA 1MEHA 2V5BA 2QR6A 3OVRA 3DH7A 3SGZA 5DY3A 1H1YA 2ATSA 3LCHA 5TIMA 3DFPA 3LCGA 5G2IA 4CNNA 4O50A 1R46A 2CZ5A 2V8ZA 3DU0A 1UASA 3SW6A 5K4ZA 4HPJA 1R2TA 1B4KA 1FUYA 3T4CA 2B0MA 3S1VA 4OBTA 3BLEA 3I6RA 4UNKA 3G18A 3O63A 4TIMA 2ZZ6A 5A8GA 5I3GA 2WSYA 3G1SA 3A24A 3MP5A 2VFHA 1TV8A 3NA8A 2YFNA 4IMGA 5FEWA 3N73A 1S5TA 3HB9A 4IX0A 3GYEA 1LBMA 1ME8A 1EP1A 3FKKA 1JQVA 2ZCGA 1OYAA 3NPXA 4OWGA 3UWUA 5DN1A 2NX9A 1OFOA 4LY8A 3HG4A 1QCWA 5CZSA 4O15A 1HFBA 3C4UA 3M5VA 5DCEA 5SWUA 2RDUA 3P5YA 5IBXC 1KFJA 2EHHA 3LI0A 3TFXA 1QR7A 3W1UA 2CZEA 4HKPA 2G96A 4OHQA 2V9DA 1KFBA 5FF2A 1VYRA 3LI1A 1WOAA 4LRTA 3M6YA 1YPFA 1TQJA 3W2LA 2NWRA 5G5IA 1QMLA 4MLJA 3SFKA 4J9JA 3IIOA 1S5WA 3BG9A 1JUBA 3C52A 3UXDA 4UR7A 2J6XA 4NT0A 2ZRZA 3KRZA 3EKZA 3P62A 3TIMA 4QIUA 4AVFA 4FX7A 4OE7A 1WBJA 3LCWA 5KINA 2XN0A 1BWKA 1D3HA 2ZRVA 2XFWA 3BPWA 5KZDA 3MP4A 2GJLA 3CHVA 4JXCA 4GRSA 4HNUA 4K8HA 3G0XA 2JGYA 4N9CA 4CQ9A 1TPEA 3TQKA 3NL3A 2KZHA 3W74A 8TIMA 3VFLA 2GQ9A 3KVLA 3QMTA 4KWVA 2YYUA 5AC7A 1LRTA 4JTIA 2QUUA 4YCOA 4UR8A 3P60A 1AMKA 2JGQA 1JULA 4O57A 1MXSA 3GXPA 4JTUA 1VC4A 4FNUA 1KTCA 3VI2A 3W1TA 4M7TA 4AMAA 3LHUA 4FB7A 3GAYA 1KV8A 1XDLA 3S1XA 3WK3A 1H7PA 2WNQA 5CPMA 3DHFA 1K02A 3M5ZA 1KM0A 1R2RA 4GXMA 3GXTA 5EA9A 3T40A 3C56A 3LCXA 3GXNA 4IMDA 3HIJA 5FEPA 3CQ0A 1XDMA 2JBMA 5D09A 4A2RA 1SW7A 3HG3A 1QPNA 3L2IA 4JICA 4HNNA 3WK2A 3PBYA 4Q33A 4ONVA 3S5YA 5CPLA 5E93A 3A5FA 2E5DA 1O95A 5T26A 4E38A 1B57A 4JTTA 3R5EA 2NUWA 3C61A 5I3KA 3GR7A 4YWIA 3M44A 4O8RA 3U8GA 1K8ZA 3TW6A 2E6AA 1EWEA 4XKYB 4W9TA 3R12A 1G67A 2R14A 1LM1A 1M7OA 1X7FA 1TPB1 3B06A 2J24A 1G4SA 3W71A 2H8ZA 6ALDA 3W2MA 3PY2A 3PBVA 5EPDA 5E0KA 5FEZA 3LRKA 1GT8A 5D2WA 1ZNNA 2TPSA 3KOFA 1EUNA 1FCBA 3W7NA 4C1KA 1R47A 5FI8A 4GUIA 2FTPA 1VHCA 1EIXA 4CNOA 2I9EA 5K9DA 4OV9A 4X2RA 4UTMA 2QDHA 4C1LA 4JYDA 4NQ1A 3SY5A 3WK0A 3DENA 3LBMA 4JX6A 1LYXA 1AW5A 1B3OA 3YPIA 1OHLA 2E5CA 4HPXA 4I7WA 3W2UA 1C8VA 3IIXA 3NYZA 3S8HA 2QJIA 2P0OA 4RR4A 1VCGA 1LOLA 5HUPA 4ORMA 4HT3A 3GZ3A 3P61A 3S5NA 4PL2A 1FWSA 1OK6A 2QCHA 2A6NA 2J9YA 5G1YA 5HWNA 3CEPA 4MPQA 2VOMA 4MY8A 2LLEA 1GVRA 1L6YA 3SI9A 3W1XA 2WSRA 3L0NA 3OVQA 3QJAA 1LZOA 2Z2UA 3LRMA 3TFCA 1DKWA 1X6UA 1JCLA 4HHPA 1K8XA 1X8FA 4O19A 1OFEA 4UTJA 3PR2A 3DHDA 4K7VA 2HS6A 3NQ8A 1NFBA 3L5AA 1VHNA 4M6VA 3W73A 4FO4A 5F1UA 3LXAA 2QCGA 3W07A 3DFTA 5G4EA 2G97A 4PC8A 1QPOA 2IQTA 3TXVA 4H3DA 3IVUA 3SGUA 2H3DA 4WJEA 1Q6RA 4OV4A 5D33A 3PM6A 3PC0A 2CWNA 4UFLA 3HPZA 1FWTA 3BGGA 1MEWA 4ZL1A 4FF7A 3P67A 1VH7A 5I3FA 1DV7A 1PV8A 2YZRA 2RDWA 2CZDA 4N9BA 1OG0A 1TYGA 4O14A 2X30A 1DORA 2VFGA 3C8FA 1FY6A 1SZNA 1HO4A 2G95A 1SW3A 3DAQA 4MZ8A 3DKJA 2DJXA 4K36A 5CZTA 3UZJA 3NQFA 3BG3A 3M1ZA 5CSSA 1THFD 3IV3A 4MUZA 1KA9F 3DFOA 3G1FA 4I7VA 5CGQA 3HGJA 3FEMA 4AEOA 1XFBA 5F2LA 4EIVA 3PUDA 4M6QA 3LCLA 3P80A 3NO5A 4LVAA 4NZJA 1VS1A 1QFEA 1CI1A 3S5OA 1G69A 2OT0A 3LOTA 3KFTA 3U6WA 2CFFA 4BF9A 4NXKA 2QDGA 1VLWA 3W76A 4O0KA 1ME9A 1SO3A 5LGZA 2V0TA 3ZWSA 2E68A 1UB3A 1GPWA 1TREA 5GVJA 4YXGA 2WNNA 4Z1DA 3TC6A 2PRLA 2A5HA 4UMBA 1GG1A 2WNZA 2NZLA 5C55A 5IM51 3CEUA 3G0SA 5C6MA 3L5MA 4TO8A 3W1QA 1EUAA 1H50A 4UCGA 4XKYA 4FEZA 1YTDA 2VELA 4FXSA 3CC1A 2VC6A 4K7YA 4JTFA 5K4XA 3E49A 2F84A 2Q3OA 4O1AA 4WXZA 3HBLA 3P8IA 1JUKA 2ZA2A 1ICPA 5H91A 2DJLA 2VXNA 1UJPA 3RK8A 3VKJA 4LT9A 3E0IA 3QRHA 4NUWA 1RV8A 4DPPA 3AJXA 1TTPA 1GVQA 4N02A 4HSNA 4JTGA 1ZALA 2CLHA 2C0AA 4UTWC 5AHEA 1RPXA 1IXQA 4XQ6A 1O5KA 5D32A 4FNPA 2DZVA 1G7UA 5K2ZA 4UTWA 1LLZA 1XL9A 3TMQA 4A21A 4WXYA 1IGSA 4LW7A 3D0CA 2VFFA 4AHPA 3BLIA 3V1PA 3WJSA 3W7JA 3Q37A 3W9ZA 1FXPA 1OF8A 4UFIA 4WOQA 1TPC1 5IBXA 1P1XA 3R13A 2UV8G 4RKAA 1JRBA 5CZ0A 1SZEA 3QPYA 1FWRA 4LVGA 4JR5A 3A23A 1GYLA 4EF8A 5LZLA 3PBUA 1QOPA 3W22A 1FQ0A 4PTNA 3UPBA 1OFPA 2VFEA 3QEZA 1FWWA 4IUOA 3P81A 3V75A 3LHTA 3G24A 4L4MA 3NG3A 1O94A 1G4PA 3MWAA 2YFOA 3L68A 5KTLA 2F7FA 4IX2A 3H53A 1ICQA 1W54A 2CZFA 3I68A 3FOKA 3W7LA 4MY1A 4JNMA 3GKAA 1T96A 3VCRA 3S6DA 3EX4A 4GUGA 3E02A 1FBAA 4IGHA 3UY7A 3ATYA 2FFCA 3NPVA 2C18A 1GOXA 4NU7A 3R8RA 4TR9A 3IIZA 2X2GA 1IXOA 3FLUA 4JY8A 3O06A 5AC8A 1FCUA 3LDVA 4Z1BA 2OCZA 4HIBA 2GOUA 4FNQA 1XKYA 1Z44A 2P1FA 5AYXA 1SU5A 3DBPA 1Y0EA 3F4NA 1K7XA 4LS2A 1OX4B 3W7KA 2A0NA 4RZ4A 3CWOX 3NGJA 3IEBA 4EVZA 3NR0A 4H6KA 3EWXA 2Z0IA 3GKFA 3S42A 1ZJIA 3OEXA 1ZAJA 2RKXA 3W6YA 1TIMA 1GWJA 4IXXA 1VRDA 3PWAA 3A21A 5AFDA 1LROA 2ZFAA 4MZYA 1XM3A 4IMCA 1LLWA 2ZDRA 4HN4A 5CPNA 1WX0A 1K7EA 3KVMA 2ZRUA 4TU1A 4QITA 3DFQA 1PCWA 4FXRA 1GZGA 3MBFA 2H90A 5AYZA 1R30A 5LKYA 1IIGA 3M7WA 1UCWA 3M0ZA 3DI1A 1ZY9A 5C5YA 3VE9A 3UWQA 1JCYA 1EWDA 3NQ7A 3N19B 1WYIA 3NPWA 3TE9A 2OT1A 1W8SA 3MO7A 3TCEA 4OT7A 4ZZ9A 1GTEA 4JIQA 3BG5A 3TDFA 1NAL1 2C16A 2C6QA 1WAUA 5L9FA 2JKPA 1S3HA 3TROA 3INPA 1F5ZA 2WV8A 2Y61A 1H60A 2A85A 5D38A 2A21A 2Y7FA 4ML9A 5KZMA 3GLCA 5G2HA 4HNVA 1OABA 4QISA 3QC3A 2C13A 5DBUA 3I7SA 3K30A 1OFRA 1MSSA 3TQ0A 1H7NA 3N9SA 4EOUA 4B5NA 2CU0A 2R94A 1KBJA 3W2JA 3BVJA 4Y6GA 3W88A 5FF4A 3DGRA 2FPYA 3TKFA 1YXCA 4Q4KA 1TJRA 3RLUA 3MI6A 4BFAA 1FDZA 4A2SA 4DELA 1QO5A 3LX9A 3ABSA 1G4EA 4Z0JA 3WJWA 2FIQA 2DU2A 3NQVA 2EAWA 2A6LA 4UFHA 3QW4B 5KMYA 2OJPA 3HOJA 3LCFA 1GVFA 2ZRXA 2J27A 1KFKA 2GVLA 2X1TA 1EP2A 3W7RA 1NF7A 4X3ZA 1FCQA 1VLIA 1Q45A 4MZ1A 2QF7A 4UTHA 2GVGA 3NM3A 3OA3A 1SSDA 4UNLA 2JKEA 1VCVA 3OHIA 5D04C 1AG1O 2FB2A 2Y62A 3HGSA 5D2VA 1YPIA 5H2ZA 5D03A 4I9AA 3UYCA 3FFSA 3O1NA 2ZYFA 4KFOA 1HL2A 3QFEA 4HNTA 1OFAA 5EL1A 4XBKA 1C9DA 3UWYA 1H61A 2ZZ2A 4MFDA 1KM2A 4P61A 3DI0A 3S0CA 2YX0A 1PHQA 2I14A 1F76A 2AQWA 3ELFA 1Q6QA 2HMCA 1LOSA 3HJZA 2ABAA 2NUXA 4EWND 4NX5A 4IPJA 3HG2A 4LNYA 2X1SA 5F2GA 1CW2A 4ZQOA 3B0PA 3UPWA 4S2BA 3TR2A 5HJLA 1W37A 5D2TA 2ZZ3A 4M5PA 3EX2A 1YXYA 4CQ8A 4BWLC 4K6AA 5F4SA 3NEVA 3MI3A 2I1OA 4NJKA 1HG3A 4XUGA 3LRLA 3S9YA 4AWSA 2O7QA 3S1WA 4WUIA 3QZEA 4RZ6A 1OX5A 1VQTA 4TX9A 4KFPA 4RV8A 5LNRA 1AW1A 1W3NA 2A7NA 5FEXA 3NL6A 5DCBA 3UWZA 1RD5A 3DFNA 2VEKA 2E1DA 1DQXA 1FWNA 4N2YA 4EF9A 1H5YA 1ZHAA 4Y90A 2VEMA 3NOEA 4YCPA 2NX3A 2V5LA 3G1AA 4PFMA 3NL5A 2YPIA 4ADSA 3AO0A 3RU6A 4RLIA 3W75A 3L67A 2PURA 2EF9A 4O52A 5F4XA 1T8XA 1TCDA 3W2KA 3LHWA 2CLEA 4AF0B 1SSGA 3IGSA 1TPVA 4NX0A 1H51A 5TQLA 5D02A 5KITA 2Y7EA 4JS3A 4NNAA 4UUIA 4AB4A 1AL8A 2CLMA 3NXFA 1M5WA 2YCEA 4UTIA 1VGAA 5A5WA 2RDTA 3H54A 1ZCOA 2YR1A 5DXYA 1EP3A 3LLDA 3FA5A 2ZZ5A 1RQHA 5HINA 3ABRA 4ADTA 3C0JA 3OBKA 1I45A 3BW4A 4QM1A 4MJZA 4QQ3A 3C2RA 4UTUA 1K8YA 1AL7A 1QO2A 3FIGA 1T0OA 4WY0B 2X1RA 4Z0SA 2GUUA 2Z1BA 4TMCA 3VE7A 2NX1A 2B7QA 3VNDA 3W70A 2X16A 4OQVA 3TNOA 3OG3A 3W7DA 1KLYA 4O10A 4UMCA 3MYPA 1TPUA 4FNTA 4KKXA 1ICSA 1I2RA 1W5NA 2V2CA 5DXXA 2QCCA 6TIMA 1WOBA 1HUVA 1F6KA 1VR6A 3A5VA 1TTQA 3ZFHA 5BRBA 3TA6A 2GQ8A 3E9AA 5BW6A 3W87A 3L21A 2C14A 2ZA1A 1Q6LA 5LNWA 5LHFA 1F73A 3EXTA 3PVFA 1UBSA 1DOSA 3GNDA 1YYAA 2Y7DA 4TMBA 5CPOA 2FQIA 2FPTA 2PE4A 1JCJA 3BGJA 3IRDA 3F4WA 2H6RA 3RMJA 4MFEA 2Y85A 1EX5A 2AAMA 2JK2A 2ISVA 3NM1A 2ZZ4A 1WXJA 2A7PA 1OX6A 1GQNA 3KRSA 1JRCA 4UFJA 1G4TA 1OJXA 4ZQRA 4PH6A 1YTEA 2HSAA 5K3VA 2DZXA 5BMXA 4N4PA 2H8XA 3ANYA 1BEUA 4NJIA 3G0UA 2H3BA 2Y89A 4NXSA 3NQMA 1TTJA 4MIMA 4O17A 1NSJA 3PG8A 3O8AA 1KM4A 2V2HA 3W7EA 4UTTA 4K37A 4PEKA 3NQCA 1YTKA 1VPXA 3UXAA 2EKCA 4FHAA 2BSLA 3THQA 3NQ2A 4QNWA 4R33A 4M19A 4O53A 2X1UA 2RHGA 5DCDA 2VEIA 3R2GA 5AHFA 1LBLA 4QAIA 5HUOA 4XBSA 1N8FA 3HPSA 2FLIA 3L9CA 3QMRA 3TC7A 2BX7A 3EWZA 2BLEA 4JTEA 4KFNA 4O1DA 1QWGA 4GNJA 1H7XA 3PSWA 1R2SA 4JD4A 3MHFA 3QQ0A 5AN7A 3GX9A 1ZFJA 4Y8FA 1W0MA 1PS9A 1TQXA 4AH7A 1LRQA 3W1MA 3SZ8A 3HG5A 1PIIA 1I2QA 2AGKA 1KBIA 1E51A 4DXVA 7TIMA 3KHJA 3TU9A 1SO4A 1GVOA 3G3MA 1IXNA 4DO4A 3P5ZA 3JS3A 4WQ6A 5E1QA 1MO0A 4U4MA 4NJHA 2D73A 4RCXA 2FPVA 1WDWA 4IQLA 3USBA 3N14A 1GVSA 3PS7A 3N2MA 1P0KA 1KV5A 3W7PA 5DELA 2ISSA 4ADUA 3GR8A 5U4NA 1SQ7A 2YYTA 4OGZA 1I8JA 3MBDA 1HO1A 1W3TA 3W7OA 1YLVA 3HPXA 2PRHA 2DP3A 3W2NA 1P4CA 3HQ1A 1OFDA 3IIPA 2FJKA 3Q58A 3RFAA 1H7OA 3FYOA 2YGYA 1JCXA 2ABBA 3GK0A 3ZWTA 3SSJA 1W31A 1X1ZA 3STGA 1KTNA 4JN6A 2VFDA 4ORIA 1OK4A 3C3NA 3W72A 3L5LA 1GEQA 3G1YA 3WK1A 4BI7A 2FDSA 4DF2A 2QCDB 3NVTA 1I4NA 1YDOA 3L66A 3W23A 4CCEA 4IOTA 1A53A 1PL9A 2NLIA 2YDAA 4JTLA 3L0KA 3L0GA 3NQEA 1TPFA 1OYBA 4R34A 1GJPA 4DF1A 3S1UA 1M7PA 1DJNA 4X22A 4X9SA 3LM7A 4LU0A 3W7HA 2GJNA 1TV7A 4UTKA 1WV2A 2QAPA 3MHGA 1XI3A 4PA8A 2EGZA 5LNVA 4ICNA 1P5BA 3EEGA 1RR2A 3IVSA 3LHYA 2QCDA 3Q94A 4QSHA 2WJZA 1O60A 4LVDA 4U28A 5K9XA 1W3IA 3I7RA 4UMAA 2EPHA 3TSMA 3TV8A 2OX1A 2ATMA 2ZRWA 1MEIA 2DZPA 3UD6A 1XUUA 4RZ5A 5AHIA 1RVGA 1HTIA 3PB2A 4DBDA 3WFAA 5FESA 1KTBA 3TSDA 1G7VA 4I7UA 3WJXA 1UUMA 1H7RA 4WZHA 4LTSA 4BR1A 5CZJA 2OMAA 3A9IA 1VYSX 3UNDA 4ZMGA 4JEQA 1J2WA 4LV4A 2ZTJA 1I2NA 3TAKA 1H62A 5L6UA 3GVGA 2HS8A 1A5CA 2BTMA 3IGUA 5D05A 1XC4A 3CTLA 4UTTC 3W7IA 2XN1A 4Y9AA 1AW2A 2VKZG 1GYNA 4O1BA 2A2IA 5AYYA 4O11A 5HR6A 5D30A 4JYFA 4GUFA 1IIHA 3SIZA 1WBHA 1JCNA 4LOCA 4NNBA 2V2DA 4DO5A 1LDCA 1RQBA 4AAJA 3N9RA 4UTLA 4NZFA 5J5RA 3Q2DA 3ATZA 5AB3A 3HMJG 3GDLA 1SZGA 2J9ZA 1KFCA 5CG7A 1SFLA 3EXSA 3CT7A 3DKLA 4K8EA 4ZQPA 3B05A 3T55A 4D2JA 1W5MA 3HGRA 4UXDA 4IJBA 1XUZA 3H55A 3W7GA 4WD0A 3S5ZA 3O07A 1Q6OA 1NVMA 3O16A 3HGOA 5AHNA 3TSBA 2TSYA 5HMSA 3HO8A 1YADA 4FIRA 5AHLA 1G6CA 5D2XA 1GG0A 2A1YA 3UWWA 3BK0A 3W86A 5EY5A 3STEA 4O4VA 3NAVA 4BI6A 5KZEA 2QJHA 3I7QA 1F7BA 3LBCA 4ZQMA 4S2CA 4L4LA 1SW0A 4WOZA 2R91A 1JUEA 1TV5A 2WQPA 2NWSA 3BW3A 3E96A 1TSIA 3ZS4A 1FDYA 3C2EA 2O7SA 1EEPA 2G5WA 4GJ1A 3E12A 3PG9A 5DBTA 5EKYA 1XBZA 4LRSA 1VZWA 4RXFA 1Z41A 2Q3RA 2VENA 2NXIA 2QCEA 4BI5A 4GUHA 2Q8ZA 3LLFA 1F05A 3RLVA 4GBUA 2Y70A 1OFQA 2E6YA 3NNTA 2ISWA 3M5YA 3EXRA 4AHQA 4PODA 2QEZA 3EB2A 4BK9A 4AXKA 4GC4A 1CX9A 2PRMA 4O0ZA 4AHOA 1ADOA 3SECA 2RH9A 4JTHA 4JTKA 3PUEA 1I2PA 4GWEA 5LHEA 2NV2A 2ALDA 5D37A 1SFJA 5DLCA 4N9EA 1XBVA 3G1VA 1K3UA 2CLOA 2J88A 3EWWA 1ZAHA 3OVPA 4JX4A 3W1RA 3P7YA 4Z1AA 3QQ1A 4RJEA 3UY8A 4O13A 3W84A 1B4EA 1UUOA 5J5DA 3F1QA 1WQ5A 3TW7A 5EBUA 5F2MA 3T44A 1OFBA 1XCFA 4DQWA 1KFEA 3LTPA 3JR2A 2NUYA 4N9DA 4O18A 4O16A 4DO6A 3MW7A 4O28A 2ZRYA 3CIWA 4LVFA 1X1OA 3QSTA 1DQWA 1V5XA 2QCMA 3M47A 3LCIA 4ZQCA 4RXGA 3CU2A 4JX5A 4LVBA 5EYWA 5G2WA 3FYPA 1KM6A 4LV9A 3NDOA 3I65A 2PCQA 2QUTA 1TTIA 4IMFA 4S1FA 4MYAA 3FS2A 3IGXA 3N3MA 2OZ0A 1BWLA 4DEFA 3OIXA 4NJGA 1ME7A 4O12A 1SZFA 1PVNA 4GE8A 3HF3A 3PB0A 4MJMA 4O4WA 3F03K 2GQAA 2BXVA 3IVTA 3MI2A 3B4UA 4YL2A 1VJIA 3G1XA 3STCA 1OVDA 3LXBA 4POCA 2C15A 5K9CA 3LV6A 1K03A
chains in the Genus database with same CATH superfamily
1A5KC 3CPGA 3B8DA 3STPA 1FWEC 3LYEA 3MYOA 2PC4A 2NXHA 4NY2A 4W8AA 3W85A 1Z42A 3E0VA 1B3XA 1EQPA 1RALA 3WQCA 2A3HA 4QJ1A 1MUMA 1GW9A 2Y63A 4FLQA 3TAOA 6TAAA 5HR7A 4RL3A 3TC3A 4XD5A 3P82A 3ONBA 2YKKA 1EC8A 4G7EB 4LC6A 3VD9A 5A6AA 3N12A 1WE5A 1RLDA 2OYKA 5C2XA 1PTDA 2G41A 5C9WA 1NDVA 1N7KA 4R7WA 5FJPA 4AD4A 3OZOA 2ZXQA 2D0GA 4QE5A 1FFRA 3AXXA 2WM1A 1L9WA 2PD9A 3NQAA 3LGGA 4Q8QA 2F38A 3ANUA 1WAWA 4Z08A 3C2VA 4JIPA 1KKRA 3CGTA 4MNKA 2W6RA 4HA3A 4XVDA 1DJQA 4KETA 4LWWA 4ZFCA 1HIZA 2QT3A 1LRNA 1LWHA 3EWYA 3PBWA 4LYPA 3GIYA 4E2BA 1FX6A 3TVAA 1XBXA 1JDEA 3R8HA 4TV5A 4BQ3A 4LAZA 1MW2A 2B81A 4BWLA 2GVYA 1GYMA 5CJ5A 3EYPA 2G0WA 4OUIA 3ICJA 3ECQA 2CBVA 1A5AA 1W3LA 4C6EA 3EX6A 4ERGA 1YXDA 3EKLA 4D8ZA 4DPQA 3KRUA 4E8DA 4ZQNA 1LBFA 4Q32A 3SRDA 2I9UA 4K39A 1BG4A 3VIMA 4CD5A 1YDVA 4HU4A 3VKKA 1LG1A 1MXDA 3QH2A 3CUJA 1I9CB 3AOFA 2WPBA 5A6JA 4MPKA 4NJJA 4Z42C 3LHVA 4AZIA 4ERIA 4E4PA 5A8PA 3W7QA 5G1TA 3G8RA 1B3YA 1T99A 2UY3A 1ALDA 4MSSA 1RQEA 5LNUA 1O66A 2R9RA 4H4IA 2VP8A 3B0VC 2OKOA 4ENLA 4PTWA 4E4FA 1P1MA 4LAOA 2BVWA 3W1LA 2QCLA 3M41A 3NPUA 4PUDA 1JPDX 4WY0A 1QPRA 3BL3A 4B5WA 2FGLA 5EU9A 3B8UA 1RZMA 3GDKA 2R8WA 3ES8A 2HJPA 2F8QA 2IXVA 4OKDA 3W1PA 3A4JA 2RFGA 3GFYA 5F4WA 1MFVA 3S3GA 3PNUA 4ZE5A 2YXGA 3CLMA 1CB2A 3TWBA 1JXJA 2CLLA 4S3DA 3PZQA 4OBRA 3THAA 2B7NA 1DBTA 4TTUA 2VUNA 1UZDA 3CB8A 1F6PA 3CL6A 3OZPA 2DQXA 3QLDA 1IXPA 5HWJA 4LUSA 1W1PA 1XLMA 4EPDC 4MWAE 1GVIA 4CCCA 3M0MA 4FXJA 1JCMP 1EJRC 2J9XA 1LTDA 3R10A 1BTMA 4AZ5A 1M3UA 2P76A 1EC9A 4NNCA 3ABQA 4FX8A 4IGMA 4O1CA 2CPUA 2V82A 8CGTA 1O5XA 5GNXA 3O0FA 3GG7A 2Y0FA 4PL1A 3ZT6A 5A2CA 5CSRA 1OG6A 3N25A 3CWNA 3N15A 3VX1A 2ZIDA 1UMYA 3ZR5A 3UWVA 4YMZA 4AU0A 3MP3A 4GIRA 2Y4SA 1YDNA 1TWDA 3N6QA 5H1WA 4BF7A 2D1ZA 3BJTA 4JDBA 4FNSA 2HDJA 1NIUA 1C9WA 3K8LA 2Z6IA 2DORA 1ISYA 3M16A 4A29A 2E6DA 1UR0A 2FVLA 3PPHA 3AHZA 3FJ6A 4ALDA 2WM0A 3DOPA 3ZR4A 1QOQA 2NV1A 4H8HA 3AHXA 3AS0A 3ID7A 2V5DA 3GNNA 3ARTA 2QF8A 2CBUA 1A5NC 4W4QA 3TJXA 4L9ZA 1K77A 1MRAA 4MNJA 2VEFA 3TN4A 3P74A 4WY0F 2DZUA 2XVKA 4AD3A 3GH5A 2PSNA 4C6OA 3K8KA 2QCNA 1PCKA 1CENA 2C1HA 3TH6A 2UBPC 2WKJA 3D5HA 1AK5A 1EOMA 1TA3A 1XW8A 4FK9A 3UJRA 1TRDA 2DV0A 4HGXA 2GGJA 1DWGM 1FDJA 1E6SM 4AWTA 4NZCA 3DXIA 4KBXA 2Q09A 3WO8A 3VM7A 2E5BA 2ZQ0A 1E9ZB 4YHEA 3WD3A 1RCOB 4GKTA 4V28A 2F2HA 2ZZ7A 5GQBA 1HJUA 4GCAA 5AC6A 1V93A 4JY9A 2HBVA 1BKSA 4NRRA 2HBXA 3WFZA 3MMTA 1XSKA 1W1IE 4IMAA 3OOQA 5DY2A 4QAWA 1MEHA 3OVRA 3SGZA 5DY3A 1Z69A 3D46A 3DFPA 3H2CA 4GVIA 4M81A 2GFTA 3MSRA 1YNQA 1WDRA 3DU0A 3UNTA 3WDJA 3SW6A 4GINA 2PWGA 1FUYA 3N1AA 5AVNA 3AIUA 3O63A 2ZZ6A 3Q67A 1E4MM 3NA8A 4KMQA 4HNCA 3WLNA 3ZJ7A 3HB9A 4IX0A 4U33A 3GYEA 1EP1A 4WK9A 1GKQA 4Y2WA 2ZUUA 1XG4A 2YBUA 1OYAA 4RUBA 1V51A 3WYZA 4GXPA 5DN1A 4L9YA 4AIOA 1OFOA 4LY8A 4FMVA 3VKAA 3O2LA 1IYXA 4LY4A 3GHUA 2WPGA 5IBXC 3LK6A 2PGEA 3HFYA 3VDCA 1PPIA 4OHQA 4DWSC 4D6JA 1TMLA 1KBKA 1UC4A 5FF2A 4LRTA 3LZ5A 1G94A 4N7QA 3BANA 3U2EA 1JFHA 1MWOA 4LBUA 2BVTA 2J47A 3BG9A 1JUBA 4UR7A 4MB5A 4Q7BA 4NT0A 3EKZA 3P62A 4DBUA 2GGEA 1TWSA 4FLOA 4PCNA 1KNWA 3R11A 1D3HA 1OGBA 4HMDA 1DE6A 2XFWA 5KZDA 2GJLA 5DFAA 3SIMA 4JXCA 1H5VA 2D3NA 3N2CA 5CPTA 8TIMA 1H2JA 4DWDA 4KWVA 1AODA 1V3LA 3ARRA 3H4XA 1RK5A 2BP1A 2QUUA 4J3WA 3WNOA 3P60A 2PP1A 4F3HA 1JG9A 2F6UA 3GWQA 4HCHA 4Q8VA 5HOSA 3W1TA 4BQ4A 3CUHA 3LHUA 2OB3A 3GAYA 1HJSA 2PDQA 3S1XA 3WK3A 4C7GA 1H7PA 2WNQA 2F61A 3DHFA 1FWFC 2XZ9A 5CZKA 4GXMA 4X9YA 3LQGA 1QXLA 3S4TA 4LYKA 1R3RA 3ARYA 3HIJA 3QV7A 2YCLB 5FEPA 3CQ0A 3WMCA 1LT8A 2ON3A 3N3TA 1XDMA 2JBMA 4Q4PA 1KGUA 4DBWA 4A2RA 4JICA 5BXPA 4Y9OA 4ONVA 2BXYA 1EC7A 3IK4A 1NM9A 5CPLA 2VR5A 5E93A 3DERA 4HK7A 1O95A 3PZUA 1IGWA 5I3KA 3GR7A 3N04A 5I00A 4YWIA 4O8RA 1BFNA 2PGFA 1G01A 3OYXA 1RA0A 3TW6A 4XKYB 3R12A 3EDKA 1W3HA 1JDAA 1TPB1 6A3HA 3PAOA 1J0YA 4AWEA 2RJGA 4A8IA 4PZVA 3W71A 2H8ZA 3KEHA 3TLLA 2VQTA 2WHKA 5D2WA 2TPSA 3KOFA 4IFRA 3W7NA 1EIXA 1PB0A 3WENA 4CNOA 3V16A 1E0WA 3PBGA 3QV9A 4X2RA 4UTMA 2V67A 2DT2A 4D6CA 1Z7AA 1AW5A 1B3OA 2PWUA 1C8VA 1MW1A 4KW2A 3NYZA 1W91A 1F3EA 3KCOA 4E2OA 4QDPA 2P0OA 1KFWA 4AFYA 1PX3A 1VCGA 1LOLA 5HUPA 6REQB 4ORMA 3TTOA 3P61A 2FHFA 4F79A 2JEPA 2J9YA 1XS2A 3UW6A 3CEPA 3GXDA 2LLEA 3SI9A 4M0XA 2R24A 2DUZA 4DVOA 1TMQA 3TFCA 4HU0A 3WEMA 1FOBA 4XSLA 1X6UA 4HHPA 2G3NA 2OOFA 5FCZA 1K8XA 3PR2A 4UQ9A 3RYSA 1M65A 1SMDA 3F4CA 1KRAC 3L5AA 3H2AA 4M6VA 3WSUA 2GWNA 2WVVA 3LXAA 3W07A 4IQDA 4DRSA 2G97A 1H0IA 3PTQA 4H3DA 3IVUA 1K4HA 1JCTA 5ECUA 1K6AA 2ZWYA 3PM6A 4X0NA 4UFLA 3HPZA 4ZL1A 4A8RA 2YOCA 4PMNA 3P67A 3L4YA 3LZ3A 1UKQA 2J62A 4BA0A 5I3FA 1DV7A 1PV8A 2EEXA 3CL7A 4N9BA 3ZR6A 2X1IA 1OG0A 3GHTA 2X30A 3N6JA 1SR0A 1EYWA 5AYIA 2DJXA 4R5EA 3ZSSA 3BG3A 4XG1A 3AU2A 3M1ZA 5CSSA 2ZVRA 1W3JA 1DXEA 1J01A 1KCKA 1Z9AA 3MY9A 1J6PA 1V3HA 3SEPA 4CU6A 1UP0A 5JVLA 1XFBA 3JZUA 4M6QA 3R25A 3KUMA 4HVXA 3S5OA 2OT0A 3LOTA 4AYGA 1KGXA 3KTCA 3S2JA 4Q4SA 3U6WA 2CFFA 4EK7A 2QDGA 1E71M 3W76A 1SO3A 2J8GA 3OP2A 2PDBA 5M5DA 3ZWSA 2E68A 3SCPA 3H12A 1GGOA 1V02E 4Z1DA 1BTCA 3EOOA 4YIWA 1GG1A 1KBLA 3WLIA 5C55A 2J4GA 3S2LA 2FH6A 3L5MA 1H50A 4UCGA 3ITLA 1VKFA 1C3FA 1YTDA 2VX5A 2VELA 4K7YA 2YCKX 3CZLA 3ZQ9A 2DSKA 3HBLA 2FDMA 4J2PA 1UJPA 1YEYA 2H9AA 4C65A 4NUWA 1RLCL 3V7PA 5JBFA 1POKA 4W5UA 2DW7A 3OGRA 2IKGA 2UZ9A 4M1BA 3ME3A 4MDOA 2IUZA 4X61A 3BLIA 3W7JA 3Q37A 3EPNA 4P8UA 1TELA 3CYVA 4WOQA 4FR6A 4YJ5A 1OWQA 3DHUA 2UV8G 1H09A 4RKAA 1LF1A 1FWRA 4G5DA 4JR5A 3UETA 3A23A 4XZBA 4EF8A 5LZLA 3PBUA 2V3FA 1QI0A 2BY3A 3C86A 4UR9A 1XG3A 1FQ0A 1V0MA 1YIXA 3NUKA 2CBIA 2VGIA 1WKEA 5AZ0A 1DJIA 1T40A 2YFOA 3AZRA 1XYCA 3L68A 1OB0A 4WKAA 2FMNA 4IP5A 3WQGA 2EJAA 4MHBA 1U1UA 4AD1A 3FOKA 4R85A 2BHUA 1T96A 3VCRA 1RVKA 3EX4A 1S2AA 4UZUA 1YE4A 5TNVA 4IGHA 3ATYA 3MDWA 3FJNA 1JEZA 3CT2A 4NU7A 4CVUA 5FJUA 2X2GA 2Z1XA 3FLUA 2VX7A 2GOUA 3HU7A 1XKYA 4XKMA 4FNQA 4JQ3A 1CWYA 2ZX8A 1XF0A 4LS2A 5I2UA 1OX4B 2A0NA 1S2UA 4RZ4A 4U31A 4D6GA 2ZX9A 3CWOX 1B3ZA 3GW3A 1BXNA 4JQ4A 2EQDA 4H6KA 4PBGA 4FSAA 2RKXA 3W6YA 1GWJA 3A21A 1FFQA 3U3HA 1LROA 4MZYA 3H7VA 3VFCA 4PYSA 1LLWA 4CQDA 4IH3A 1WX0A 3S46A 3R43A 4ASTA 1WZKA 4GGBA 4TU1A 3CXOA 1X38A 3DFQA 1JDFA 4TTGA 3IJLA 1E6RA 3O9NA 3VIFA 4IQJA 1IR1A 1US3A 5FJJA 1MXGA 1IIGA 2A3CA 3N4AA 3M0ZA 1CXKA 1KRBC 4PTVA 5C5YA 3UWQA 2CITA 2GDQA 3IUDA 4BS0A 3N19B 1WYIA 3TE9A 1P0DA 4AUBA 5HQMA 4GD0A 3M0HA 4J2MA 3W24A 2C8NA 4HB7A 2X7WA 3KBMA 1BQCA 2C6QA 2PGRA 4EKJA 1H1NA 4L1WA 3P0WA 2QUMA 2Y61A 1H60A 4ML9A 4GQBA 4U3AA 1OABA 3UR8A 1B30A 3RN6A 2WZIA 1S5MA 5DBUA 4WEVX 2DY3A 4AQLA 1MSSA 3TQ0A 3PJWA 1EF2A 3BTNA 3T08A 4B5VA 4AIUA 1C8XA 4DJFA 5A6BD 1IT8A 3MKKA 3DGRA 4IP4A 4LXFA 4Y8EA 4Q4KA 5IRPA 4A3RA 4HNOA 3KOZA 3MI6A 4A2SA 5HPCA 1SJCA 4A8NA 3ABSA 2J7FA 4Z0JA 1K9EA 3WJWA 1DPMA 2XIBA 2EAWA 5J04A 4B5TA 1R3WA 2OJPA 1GVFA 2BGSA 3LPFA 2HNEA 2ZRXA 1A4MA 1UH3A 1KFKA 2EG6A 2GVLA 3W7RA 3IARA 5MKGB 3UG4A 3CZJA 2ACUA 3BICA 2QF7A 2WMKA 4OIFA 4UTHA 1NP2A 1AH3A 3F4VA 4BQ5A 4PB4A 4KCWA 3QOMA 1VCVA 5D04C 4Q8UA 4HA0A 2HK1A 4LEFA 1YPIA 1AUSL 1O1HA 1Y8BA 5A3HA 5CLTA 4K1GA 5EL1A 3WCZA 4XBKA 4Y7EA 5ABFA 4XAZA 1EPVA 1XSIA 2ZZ2A 1OEPA 1K1DA 3RX3A 4NASA 3S0CA 1GJWA 2WJFA 1F76A 2GUYA 2ZC8A 1Q6QA 1UZ1A 1D7FA 3AXMA 2NUXA 1JAKA 1R3VA 5HMFA 3HQOA 3HG2A 4QEEA 4PMDA 5F2GA 3AHTA 3TR2A 3VA8A 2ZZ3A 4M5PA 3B8SA 4CQ8A 1ISZA 4BWLC 3VU2A 3VOGA 1XIGA 1UBPC 2REQB 3S1WA 2BG5A 4RZ6A 2QULA 1WZAA 3DG6A 1M7JA 3BURA 1H5YA 2VEMA 1J93A 4YCPA 4YS1A 2WCAA 1V6UA 1RY0A 3LSCA 6XIMA 3NL5A 3QV8A 3ITXA 3W75A 4NAFB 3L67A 2EO7A 4HSHA 3THUA 2EF9A 1MQQA 5F4XA 3M4HA 3LHWA 1YX1A 1SSGA 2WMIA 1Q66A 1R85A 1TPVA 4H8NA 3DCPA 1H51A 1PX4A 1QVBA 2V3DA 3WNPA 4AB4A 1X6NA 4J27A 2CLMA 4HTBA 3T0TA 2X2YA 3NXFA 4PMOA 4UTIA 3P0XA 4PBEA 1PZ1A 3LPOA 1VGAA 3U4AA 2ISFA 5DXYA 4JCMA 1RQHA 4ADTA 3D6NA 4B4HA 4HK5A 3MUAA 4MJZA 3CZKA 1PWMA 1K8YA 1VBGA 5I06A 1CEOA 1OCQA 4OQVA 3TNOA 2XINA 1KLYA 3V5OA 2XG9A 4M3PA 3UT0A 1NWRA 1HNYA 1TPUA 2V2CA 1B2YA 3HZ3A 1VR6A 3A5VA 3LENA 1ITXA 5BRBA 2GQ8A 4LBSA 4IFKA 1ADSA 2D2HA 2Q71A 3ABZA 3UA4A 3UU0A 2EBNA 3PVFA 3WNLA 1UBSA 5CPOA 1JGIA 4H9YA 3VNIA 4Q6XA 4MFEA 1EX5A 2AAMA 5EMKA 2E28A 3SRHA 3MA8A 1WXJA 4DJEC 4UFJA 3KRSA 5JQ9A 4PH6A 2WJEA 1BYBA 1FWJC 1CXLA 3NQMA 2ACRA 4MIMA 4O17A 4IISA 1FHDA 1KM4A 2OKTA 4NRSA 2V2HA 3W7EA 3WQOA 4K37A 3MMDA 2EKCA 3MTWA 3THQA 4GHRA 4GQQA 4Q4QA 4R33A 1I1XA 5FJTA 5H8MA 2PTXA 2RHGA 4G1NA 5DCDA 2VEIA 3W81A 1QW7A 1ZGDA 5AHFA 4QAIA 5HUOA 2WWCA 4DAFA 2OOGA 4QROA 5EMJA 3CHEA 2WLYA 3TC7A 3EWZA 4DI8A 5CAHA 4KFNA 4CGTA 1H7XA 3PSWA 3CTTA 1D2KA 1R2SA 3B9NA 2DSUA 4ATLA 3QQ0A 3GM8A 4GYJA 1PKMA 3ITVA 1ZFJA 3BSMA 1WZLA 4EE9A 4AH7A 1IZJA 3HG5A 1Q8JA 2OYMA 4HHHA 1E51A 2I57A 4JCLA 7TIMA 3KHJA 4KEVA 1HT6A 1E0XA 5FKYA 3TEVA 1NDWA 3OTRA 1MO0A 1E43A 4NJHA 2E4TA 1WDWA 1E9IA 3N14A 2HNHA 1GVSA 3CAWA 5I5RA 2FTWA 3SJNA 3TA9A 1L0PA 3S1GA 5FOOA 1W1B1 4UTFA 8RUCA 3GR8A 1SQ7A 2ZUSA 4PMYA 2WC3A 1I8JA 3AXHA 4MB1A 3GBDA 3FXGA 2DP3A 1OFDA 3I3DA 1HKKA 3AI0A 5DRCA 3RFAA 1H7OA 1AH4A 3NCOA 4Q4RA 2YGYA 3GK0A 1W31A 1WDQA 1X1ZA 3M0VA 4JN6A 4GI8A 2E3ZA 4H7VA 1GEQA 3BMXA 2QCDB 1X96A 1DE5A 3EDEA 2NLIA 4IIHA 1IEWA 4RDVA 1WB0A 3WLHA 4MADA 2VC9A 4DF1A 5I3DA 4MAVA 4IFKB 4LU0A 4UQAA 3S47A 2YIHA 1WV2A 4I5RA 2VRJA 4PA8A 2EGZA 5C9XA 4PMZA 1P5BA 3EEGA 6REQA 2PZ0A 1RR2A 1QNSA 3IVSA 1BRLB 2BV9A 4QSHA 3V36A 3OLGA 4GNVA 2WJZA 4U28A 5K9XA 3I7RA 4G7FA 3M0XA 3WQPA 2OX1A 1XIFA 3GU2A 1ECQA 1FKWA 1HTIA 3TYCA 3KOYA 1LL6A 3WJXA 3AROA 4H8UA 1RCQA 4LTSA 3A9IA 2PMQA 1VYSX 4ZMGA 1Q65A 1XLHA 2BY0A 4MMWA 3PJUA 1A3WA 1H62A 3GS6A 3VIOA 1A5CA 5HA7A 2HEJA 3IGUA 3UFYA 3TR9A 1ONXA 4Y9AA 4U10A 1PKYA 3ZLFA 3VABA 2VKZG 4O1BA 5AYYA 4O11A 3QPEA 1IE7C 4JYFA 4FA3A 4M29A 2ALRA 4P8XA 1Q7QA 1LLOA 1WBHA 2VX6A 4NNBA 4AAJA 3CJPA 3KWSA 4NZFA 3LA4A 5JH1A 5AC5A 3T0AA 2PGWA 5AB3A 3HMJG 1SZGA 1EX1A 2J9ZA 1RJPA 4KWOA 2PDPA 1UKOA 1FWHC 3T55A 4PUEA 3HFTA 1J11A 2REQA 1XUZA 3O07A 3A4XA 1Q7ZA 3HGOA 1VD6A 2TSYA 5HMSA 2XH4A 3NFUA 2HV5A 4PRTA 1G6CA 5D2XA 2A1YA 4KERA 2X09A 4O4VA 1W2PA 1Z6KA 3H21A 1V3IA 3NAVA 5KZEA 1F7BA 3U2CA 3ALGA 1U1JA 5E5CA 4L4LA 1GQKA 1A5UA 3W4RA 4WOZA 5LIXX 1BF2A 2YA0A 3PWGA 1UPPA 1XIMA 3HM7A 3MB9A 3ZS4A 1BGGA 5PTDA 1FDYA 3C2EA 1MUCA 1QJWA 4Z2IA 5DBTA 2VC5A 4AZBA 4LRSA 5DO8A 3G2GA 1MDLA 4BI5A 4U5KA 3KOXA 2Y70A 1EGVA 1OFQA 3MV01 1DWIM 3HQPA 1GORA 2PWHA 1CZ1A 4GABA 4DYEA 4BK9A 3MQTA 4HOZA 1BKHA 4AHOA 1ADOA 9RUBA 3O6AA 2PDLA 1R3TA 1I2PA 1E0VA 4LAKA 1S39A 1WDDA 4N9EA 3G1VA 2CLOA 3OVPA 3W1RA 1CIUA 3R0DA 4O13A 1UUOA 3F1QA 4KPLA 5FA5A 4L6OA 1CXHA 3OODA 1XCFA 1A49A 3VM5A 4G56A 2RUSA 1LQAA 4QJ4B 4O16A 2RGLA 4O28A 3CIWA 4LVFA 1X1OA 2DUXA 1V5XA 2QCMA 3M47A 4RXGA 4JX5A 2VZUA 4LVBA 3R58A 5G2WA 3NGFA 3NDOA 3IV8A 3LBOA 3G1RA 3N4FA 3RXZA 4MYAA 2OZ0A 1OQFA 2PTWA 1ME7A 4MKSA 1FP9A 4O12A 1SZFA 2W67A 3HF3A 3PB0A 4G6CA 3E74A 3N29A 4OECA 1A0CA 5E0CA 3B4UA 4XISA 2H9AB 1VFSA 3POHA 3AMKA 3LXBA 2C15A 3LV6A 1Q3NA 3BCFA 3LS9A 3TJLA 1ZP3A 4PCPA 1R9XA 1JZ7A 1H1ZA 2DVTA 1NY1A 3GDMA 3QOKA 5HBFA 3LTSA 1TMHA 1I1WA 3GSMA 1C29A 1LP6A 1L6WA 3NQGA 2PDKA 1YW1A 3GDRA 5A6LA 4V27A 3NQ6A 1X1NA 1XIDA 3UF9A 5ABHA 3WLMA 4HN8A 1T8QA 1SO6A 1PAMA 3F5JA 4R88A 1OX4A 3ARVA 3UJEA 3USZA 2NXGA 2CHRA 1WNOA 1YRRA 3BV7A 3VUSA 3FW6A 3T8QA 4ZBCA 3KCLA 1TJ2A 3QYQA 2DH2A 4R7JA 9XIAA 1ZCCA 3O05A 3BLFA 1IWPA 3RUBL 3CIXA 2GJXA 2WSQA 3VNJA 3WH6A 1REQA 4JKKA 3LXCA 1QWKA 6PTDA 1VBRA 2CLPA 2CKRA 1EEXA 3NZ1A 5C54A 2JKAA 2J7HA 3LMZA 3R89A 1C93A 5B7YA 1UOKA 3SUSA 1EO5A 4X60A 3BLLA 1EB3A 1DIOA 2DH3A 5CXPA 1GOOA 1KM1A 3NZRA 2VGFA 3OQEA 1QAPA 3E0FA 2KAUC 3FKRA 1FXQA 2V6AA 1S1PA 5CSUA 2AQVA 3M7SA 2CZVA 3D47A 3E6EA 1DJYA 1F2JA 1KM3A 5A6SA 4DUOA 3E5PA 1LCOA 4B92A 4CCDA 1Q6FA 4FNRA 1CGWA 3DG3A 3RU8X 3UJSA 5FSDC 3AU6A 3VC6A 1TFVA 1FH8A 2GUBA 4IXHA 4GQGA 3BH4A 4BCEA 4GI9A 4P8WA 3RCYA 4KEUA 4QRNA 1TV3A 4NP7A 1JQXA 3TZFA 1NEYA 3B03A 2J8TA 3TQPA 5KEZA 2V81A 1AZ2A 4IL2A 3GG0A 1KCLA 3OG2A 4ZFMA 3G1DA 5K7JA 4QSFA 1AD1A 4PB3A 1E4NA 3HMCA 5AZ1A 1DXFA 3RCMA 2WXDM 4NHVA 1TRIA 1ML1A 4X2PA 4MWAC 4FAMA 2VFIA 3CPUA 4M6PA 1HKIA 2A3BA 2B7PA 2TMDA 1RAKA 1W5OA 5HULA 4P2VA 1J9YA 4PCSA 2YCJA 2GSEA 4DF0A 3CUZA 3QY8A 2O4QA 4IF2A 2E09A 3NTYA 4L1XA 4LH8A 2YZ5A 2NQ9A 3CS2A 2IQ0A 8A3HA 1QNVA 2YDSA 4H00A 3IIVA 2YXOA 4GYFA 1U2YA 3K5XA 3PF3A 3WDPP 3FSUA 3PP7A 4J35A 1FHUA 4N6EA 5REQB 2C19A 3LV5A 1FWAC 5AKQA 1ZBKA 1UWRA 5JIWA 2GSJA 2VM8A 1DXIA 3DGBA 5BOOA 3PZ9A 1JNDA 2QCFA 3KDOA 4HD5A 1DVJA 4YLWA 3TUUA 1VEMA 3LERA 4ZB2A 1QPKA 1TO3A 3MPGA 3NQDA 5A6BA 1U1HA 1ITQA 3LHZA 4J3TA 1QW8A 2OG9A 1BPLB 4M1RA 4UIOA 3ABOA 2YW4A 4XTDA 2CBJA 1JJKA 3DDMA 3AYVA 3W37A 1UWQA 2P5NA 3UCDA 1EIBA 3VOFA 4GXWA 4XZ9A 3G1HA 2AMXA 4RV3A 3T4WA 3MDUA 3WUBA 4PTDA 1NQ6A 2Y2WA 5EMUA 2OQHA 3F2BA 5DEZA 1Q6EA 3FHAA 2Y6ZA 1F4AA 1IT0A 3MHUA 1LOQA 4HPGA 5BXSA 1X7IA 3RF9A 3TTEA 5LIWX 1AQMA 1IF2A 2ZZ1A 3OLEA 4XTIA 1OF6A 1FH9A 1TB3A 4YNGA 1DWHM 2FZDA 3C0LA 1H11A 1GOKA 3IAQA 4ERAA 2VZTA 1CGVA 1S2CA 3MSDA 5LNSA 5KSWA 3JRKA 4LF2A 5I23A 4IIBA 4GZJA 2I5QA 1P0NA 1XR2A 3EWUA 4QJ3B 2QW5A 4B3LA 2JIEA 2WWDA 5DRIA 3MJYA 1XLDA 2BWGA 3TYEA 1J4EA 4S3FA 4LUJA 4CQAA 1JZ2A 1AQFA 3ES7A 4DJED 3VZZA 3P84A 1RSCA 1GKRA 1HJXA 4DN1A 2GDUA 4GIAA 4MJ2A 3RILA 4FIQA 3U5UA 4DM1A 1V3JA 4BQ2A 3W3OA 1XLCA 4P7LA 5I3JA 3TLQA 3EWBX 1A5BA 3VD4A 2CLIA 1XRTA 5BMWA 3LY0A 3V0UA 1F3TA 3TW9A 3BW2A 2PWDA 3M43A 3KVKA 4MWAA 4HZMA 2QUVA 4IMEA 3WJZA 1OIFA 1G9HA 1R7OA 4ZVJA 4B5UA 1KM5A 3EX3A 3PHAA 3PZOA 3BAYA 5GPRA 1QNQA 4AWUA 5D2YA 1WA3A 2QNEA 3B0UX 1BAGA 3FJLA 2AKZA 4H19A 2JQXA 4WDWA 4FLSA 3RITA 4RX0A 1VPYA 1O5QA 3CBWA 2VCCA 2GDVA 4US5D 2VHLA 2X05A 4QXIA 4NF7A 4HMCA 4CNNA 4O50A 1R46A 1ESWA 2CZ5A 2V8ZA 1UASA 1BG9A 4HPJA 4YYCA 4BZYA 3UR2A 4QS6A 1ZJHA 2FKPA 3S1VA 1W2VA 2O9PA 3I6RA 4UNKA 3G18A 1V77A 4TIMA 4IIDA 2Z4GA 1GKPA 2NSXA 5EMYA 4GGHA 3MP5A 1P7TB 2YFNA 1NP0A 5XINA 1WZMA 3WF2A 4QGCA 1ME8A 4GIEA 3RJXA 4TX6A 2ZCGA 1HP4A 3RM8A 4NILA 2QHAA 3PZVA 2VDIA 4W8BA 1EXBA 4RPQA 3HG4A 3VNLA 5CZSA 4O15A 1HFBA 3C4UA 2RDUA 3P5YA 1XD0A 1KFJA 2I5IA 2X0HA 3LI0A 3TFXA 1QR7A 3W1UA 3H2NA 2D20A 2IKJA 4HKPA 2EPOA 2G96A 4Q4MA 4GVHA 5HJXA 2PDFA 3W38A 2WMHA 2XGZA 2V9DA 3U5YA 4Q6JA 3W6LA 1WOAA 4QJ5B 1OD8A 3MO4A 3S2CA 1E9YB 2NWRA 2X40A 1QMLA 3S6TA 3SFKA 4J9JA 1S5WA 3C52A 3UXDA 3AYSA 2C71A 4L7ZA 1ZQ5A 4H6RA 3HURA 4CNUA 2ZRZA 3KRZA 3TIMA 5EFFA 3LCWA 5KINA 2ZRVA 3BPWA 4B5SA 3MP4A 3QKZA 3VK5A 2ICSA 2JGYA 4N9CA 4CQ9A 1TPEA 4A3HA 3NL3A 4NG3A 2WNWA 3MT1A 3W74A 2GQ9A 2POTA 2XH2A 3NZQA 5AC7A 3VGEA 1LRTA 4DNHA 3BMVA 2D3LA 4JTIA 4YCOA 4UR8A 1W9XA 3SADA 4JTUA 1VC4A 4FNUA 2JEQA 1HL9A 2QVNA 4AMAA 1TVLA 2BBFA 2VX4A 4HOWA 4H9TA 2CIPA 1K02A 1KM0A 3GXTA 3ITOA 5CC6A 2YA2A 4GQRA 2V63A 4IMDA 4ATWA 3JU2A 5D09A 2VL4A 1JIBA 1QPNA 3L2IA 4HNNA 3WD0A 1Q7MA 3WK2A 3PBYA 4Q33A 4S3AA 4L65A 3GTIA 1GZ1A 3B9OA 2E5DA 3GVVA 3QFWA 5T26A 1B57A 1JPHA 4H1ZA 3GR4A 3ZYZA 3T6CA 4GKLA 3WDQA 5CAKA 3M44A 4LSBA 1XYMA 2E6AA 3UZYA 1W9PA 4W9TA 2J77A 2IKIA 3D3AA 3RRXA 1Q85A 2XVNA 3WLLA 3P2VA 3PY2A 1EBHA 5E0KA 5FEZA 3ARWA 3LRKA 4FOJA 4CUCA 3NXLA 1ZNNA 1TVNA 3CHDA 4PRWA 1WXYA 5FI8A 4DXKA 5D9PA 2ZC1A 3IJ7A 1Q5MA 4YVXA 3AJ7A 3II1A 4DYKA 1EDQA 1DTUA 4OV9A 2QDHA 3R94A 2XU2A 4C1LA 4NQ1A 1AA1B 3WK0A 5HDRA 4QS5A 1G5AA 3VO0A 1LYXA 3YPIA 2E5CA 3KCJA 4XK2A 3LD5A 1AFSA 4U5IA 4I7WA 5MKGA 3LNPA 1CLKA 4I6VA 3D3FA 3EZ4A 4HU3A 2WVTA 4XZWA 2RJHA 3EOLA 5FL0A 1MW0A 4ZO9A 3GTFA 1E9LA 2FJUB 3GZ3A 1FWSA 1OK6A 1GCYA 1VFHA 2QCHA 2ACSA 5D8WA 2A6NA 5G1YA 3TYBA 5HWNA 2HXUA 4Z2JA 3DECA 1W9VA 1L6YA 3WUFA 4CU8A 3SUUA 2WSRA 3L0NA 1XIBA 1F6YA 2WZMA 4FXFA 1XH2A 3A4AA 3I3BA 3UCCA 1HJVA 2IXUA 4O8AA 1OFEA 4UTJA 2CYGA 3NQ8A 7TAAA 4WIWA 1VHNA 5DF0A 5F1UA 3DFTA 5G4EA 1TCMA 1QPOA 2IQTA 4UCFA 1P48A 4F0RA 3CUGA 4IPPA 1Q6RA 2W63A 3PC0A 4L6DA 3UERA 2CWNA 4FF7A 2Z25A 4H7ZA 2XFFA 1XYLA 1VH7A 3EDFA 3L7RA 2ZE3A 3QN3A 1V6VA 2OX4A 2UY2A 2VFGA 4O14A 1FY6A 2X7VA 5LIYX 3CIVA 3SY1A 4K36A 2OEKA 3NQFA 1JPMA 3RAOA 3GFZA 3AQUA 3QBUA 1KA9F 3DFOA 3QZ6A 3HGJA 4AEOA 1UA7A 1JXKA 4AVNA 3LCLA 4EXQA 2BY1A 3P80A 2DSWA 3NO5A 1CI1A 4CNTA 3TP4A 5CC3A 1HX0A 1IT7A 3FDGA 2QV5A 4BF9A 1VLWA 1MMFA 4XV0A 2Z28A 4DM2A 5LGZA 1CYGA 4HYVA 4KRZA 3G77A 1GPWA 3AMGA 2HQAA 3T05A 3TC6A 2PRLA 2PP3A 1L6FA 3VOHA 3Q65A 2NZLA 5IM51 3CEUA 3G0SA 3BLKA 2W3ZA 4FEZA 4IT1A 4J3ZA 3CC1A 2R1KA 2VC6A 4JTFA 2XSBA 3E49A 1XV8A 4O1AA 1JUKA 2ZA2A 3RK8A 4LT9A 4PSPA 3QRHA 2QYGA 1TTPA 5GJNA 1Q6GA 1NDZA 1NWUA 4HSNA 3F5LA 2IS7A 3P14A 2XM1A 1RPXA 4BHYA 2VUYA 2Y8KA 3NDZA 4LUTB 3IWPA 1NJJA 3O0KA 3TMQA 4A21A 4LYQA 2JE8A 4LW7A 2QIWA 1EXPA 2ZUWA 3WJSA 1TWWA 4ROPA 3BC9A 2BVDA 5H6HA 1OF8A 4UFIA 2CERA 5EBAA 3M6DA 2R1PA 1UQYA 5IBXA 1P1XA 4HPHA 2F2KA 5CZ0A 3QPYA 3EOUA 4LVGA 5GNZA 3V4BA 1BYCA 3CNYA 2VR4A 1XKJA 1QOPA 4XO6A 2VFEA 3P81A 1XPYA 3NG3A 1O94A 1W6TA 1U30A 4WHBA 3MWAA 2FZ8A 2F7FA 4IX2A 5AVHA 1Z8AA 3W7LA 3GKAA 3AXIA 4RE2A 2XWEA 1XQKA 4PTMA 5ABEA 4REQB 4JEJA 2C18A 1E5NA 1QHOA 1NU5A 5JXQA 3LN3A 1O68A 2YDRA 4C7FA 1IXOA 1GHRA 5T9BG 5DMNA 1EL3A 1Z44A 5AYXA 1Y65A 1K7XA 2P0IA 3W7KA 1RBOB 3K1GA 2NQJA 1ZS2A 4ZOBA 3UVAA 3A3HA 1ZRQA 1PO9A 2HRWA 1UR9A 3FGCA 3GKFA 3S42A 1ZJIA 5IDZA 3OEXA 1J6OA 1DIDA 1OCJA 3T1GA 4AC1X 4IXXA 3EPOA 4QX4A 3PWAA 5JU6A 2ZFAA 4IMCA 4HN4A 1NH6A 1K7EA 1XFCA 2WVSA 3BQ5A 3KVMA 1P6CA 3LMYA 2ZRUA 3N2OA 3LG3A 3SCUA 3XINA 2VWSA 4QITA 1KGWA 3MUZ1 2VNCA 2UY5A 4ROQA 4JTQA 3AFBA 1GZGA 5GJMA 4FF5A 2H90A 4L80A 3ZJKA 1R30A 5LKYA 3BJSA 4CN4A 4H9MA 1ZY9A 1DWFM 3VE9A 1JCYA 1E73M 3VZXA 5C2GA 4EXAA 1R3YA 3GU9A 1JDDA 2QJJA 1V7AA 3MO7A 2X42A 1GTEA 3TDFA 1V6WA 1XLJA 3WLKX 1WAUA 5L9FA 1L2QA 1S3HA 3INPA 5I78A 4NAEA 1K6WA 5I02A 2Y7FA 1JPKA 2OGJA 4EPKA 3SAZA 1UA3A 2XVPA 4HNVA 4QISA 2VVSA 1PJ9A 2C13A 4J3UA 1W17A 3I7SA 4CU7A 3K30A 1TZ7A 3GVQA 4EOUA 4B5NA 2R94A 1PSCA 2HE8A 4CNSA 2FPYA 1US0A 1IWBA 1XLFA 4EPBC 2QGYA 1TJRA 3RLUA 4LAUA 4BFAA 4ILSA 1HJWA 1VFFA 3LX9A 2EPLX 3FHQA 4C5ZA 1G4EA 4IM4A 2A6LA 3G5EA 2QQ6A 5C8BB 4G2DA 4KIRA 2GOKA 4OFCA 1E15A 5KMYA 3WQVA 1T7LA 2HCVA 3UXKA 3HOJA 4PUNA 1F8MA 2OEJA 2J27A 1XLIA 2X1TA 1EP2A 4J3SA 3EGJA 4QLJA 5BWAA 3ZLHA 4XD4A 1VLIA 4JL1A 1E1EA 3EDJA 2JIWA 2HROA 1ITUA 2JKEA 4A3QA 1AG1O 3W25A 1HVQA 2Y62A 3HGSA 2VJXA 3OW1A 4I9AA 3UYCA 3TTQA 2XYLA 4HNTA 5BU6A 1OFAA 3WMBA 2ZOXA 3AYTA 5C7HA 3WLSA 4HCLA 2YX0A 1UC5A 3AIBA 1PHQA 2AQWA 1LOSA 1XC6A 3HJZA 3M46A 3GC5A 4S3CA 4GMEA 2Y1HA 1HVXA 4KCTA 3B0PA 3B0YA 3EB3A 3EX2A 3CH0A 1Y7VA 5F4SA 4NJKA 1HG3A 2BXZA 4Y9MA 3S9YA 3VGBA 3H4WA 1DQUA 1C7TA 1W32A 4KFPA 2WKLA 5E6ZA 1AW1A 4KESA 1W3NA 3NL6A 2BHYA 1RD5A 3DFNA 4J4KA 2E1DA 1FWNA 1OINA 4Y90A 1BSIA 4N0RA 2NX3A 2V5LA 3G1AA 2WMJA 4QG8A 3GUGA 4GH3A 3WD4A 4KIEA 3VIJA 4RLIA 1FVPA 4LFYA 2PURA 3KLLA 2HVOA 1CLXA 3VIIA 1W1TA 4FOUA 4PMXA 1HXJA 1NTHA 4GVFA 3W2KA 4EPEC 4UQDA 3FEQA 3AIVA 4NX0A 3ZZ1A 4MG4A 5KITA 2CETA 4TX8A 4V1XA 3S2NA 3HV9A 2CESA 3QQWA 3EKGA 4D6HA 3AICA 2YR1A 1EP3A 1O1ZA 1YDYA 2ZZ5A 5HINA 1EZ2A 1H3GA 4AZHA 2PD5A 3C2RA 4F0SA 1AL7A 3FIGA 1T0OA 4WY0B 3QR0A 4JFTA 3BLOA 3L23A 2NX1A 3VNDA 1XRSA 4UWMA 4NIRA 3W7DA 3MYPA 3OLDA 3Q4DA 3AS1A 1Q13A 1PZ2A 4WSKA 1HUVA 1F6KA 1TTQA 3QR1A 4C6LA 2Y5EA 2QUNA 4TOQA 1UWSA 3N6HA 3E9AA 2EG7A 3R7MA 2C14A 1Q6LA 5CGMA 3V35A 4ZA0A 1P0EA 1DOSA 1YYAA 4TMBA 4QR6A 1VRXA 3IRDA 2H6RA 3CAQA 1NWSA 2ISVA 1BXBA 2ZZ4A 4AYSA 4JFSA 1OX6A 1E6PA 4ZQRA 2NVDA 5K3VA 2DZXA 5BMXA 4D1IA 3PZIA 4XIAA 3G0UA 4O1FA 2VRQA 2Y8UA 3H24A 5FSEC 1TTJA 4B3KA 3PJXA 1AZ1A 1NSJA 2WHJA 3PG8A 3AALA 3R1ZA 2NT1A 1GK8A 3HTWA 1WUEA 2P53A 4M19A 2OSXA 1W9BM 3URQA 2DQWA 1LBLA 3OBAA 4XBSA 3M0IA 4UQBA 3VIPA 1D8CA 5DQPA 2V5JA 5HMEA 1SYTA 2BLEA 3QV6A 3T2QA 2WSKA 5LXEA 3SN0A 1REQB 1UKSA 4HTYA 2PDYA 4DBSA 1AJ0A 1YHTA 2DIJA 1PS9A 1LRQA 1UD6A 5CPQA 3SZ8A 5ENLA 4DWSA 1DP0A 2AGKA 4X63A 3WQEA 3TU9A 2WBKA 3G3MA 3I6EA 3L2MA 4NZ1A 3UBPC 4L61A 1FKXA 3B8TA 4DYJA 3WQWA 4R9XA 4A6GA 3BQ6A 2FPVA 4IQLA 3C8NA 3IRSA 3USBA 3V5FA 3DHPA 3PS7A 3N2MA 4ACZA 2NQHA 3W7PA 5DELA 1B3VA 2EXOA 5U4NA 1R9YA 1V4YA 2XHYA 2YYTA 1HO1A 4I5XA 2PBOA 1YLVA 3HPXA 2Z27A 4WF7A 2BGQA 3HQ1A 2KX9A 3I4KA 2VYOA 3NQBA 3FYOA 1QI3A 4QDWA 3ZWTA 3SSJA 3K46A 1OK4A 4IZGA 3L5LA 3OB8A 4JQ1A 5FJOA 3WK1A 2FDSA 4H01A 1NWTA 1I4NA 4AIEA 3ERPA 3L66A 2XTKA 1PL9A 1EA9C 4JTLA 1TPFA 2BOFX 1GJPA 3OBEA 4W7WA 3S1UA 3TJ4A 7PTDA 1M7PA 1DJNA 4B16A 2GJNA 2Z1WA 1TV7A 1VENA 1J5SA 3S6OA 3UXLA 2RDXA 2J6VA 3MHGA 4KRUA 1V02A 2PWFA 5E9XA 4EACA 3Q94A 3ITGA 1WCGA 4LVDA 1W3IA 3WQ4A 4UMAA 2EPHA 3B9DA 4IGNA 1SVDA 2DIEA 2VURA 3ZJ6A 2ATMA 2ZRWA 1MEIA 3UD6A 2C91A 3WEZA 1RVGA 5IXEA 4C7DA 4GH1A 2CXEA 1ZBVA 1B9ZA 5FESA 1KTBA 5JIPA 2PCEA 3TSDA 2X41A 2NW0A 3CMFA 1MVYA 3E2QA 4WRHA 2A3LA 4WZHA 4LUTA 2OMAA 3SUTA 5ABFB 3KM8A 1EJVC 3UNDA 4AXNA 4JEQA 4DLMA 2ZTJA 2Y8VA 3TAKA 1E55A 5L6UA 3LLXA 3CK5A 2BTMA 2VCBA 4F0KA 1FWDC 1XC4A 1EO7A 4TV6A 2XN1A 1AW2A 1F9CA 2YLAA 4PMVA 2OLHA 5HR6A 2VO5A 4IQEA 2XH0A 4GUFA 3TN3A 3SN1A 1IIHA 3NJ3A 5FACA 4TUFA 4LOCA 4ZO7A 2V2DA 4DO5A 1CT5A 1RQBA 5HANA 3TZNA 3ZXWA 3BAJA 1SFLA 3EXSA 3H23A 1UROA 4D2JA 1W5MA 3W7GA 4HA4A 3S5ZA 1XYAA 1NVMA 3O16A 3TSBA 4Y9PA 2UY4A 3VIKA 3E0LA 3UEQA 2DZAA 4H41A 3BLPX 4HOXA 3STEA 3GTXA 5J8LA 3I7QA 2R1MA 8XIAA 1B0IA 1VJSA 2ESCA 4I6KA 3GXIA 1XLEA 2WQPA 4Z2KA 1YBQB 2PWEA 3N17A 1TSIA 3AUOA 1K9FA 2O7SA 3VGDA 4JBRA 2XVGA 3E12A 3APTA 2XGIA 1VZWA 2E40A 1OM0A 4GI4A 2Q3RA 5D9MA 2QCEA 3BE7A 3WNMA 4GUHA 2Q8ZA 3IJ9A 2Y5SA 1F05A 3RLVA 4V15A 4DUVA 3NNTA 2Y24A 2OZ3A 3EXRA 3PPGA 2O92A 3EB2A 4GK8A 4M82A 3WL0A 1VFLA 4W85A 1CX9A 3OU8A 7ODCA 1TUFA 1UP2A 2RH9A 1XLAA 4JTHA 4DWSD 4JTKA 3WBEA 4GWEA 2NV2A 3W82A 3NIYA 2D24A 3C2YA 1KXHA 5DLCA 3UVIA 1K3UA 2B31A 1ZAHA 2OR2A 1XGZA 3UY8A 3REQB 3W84A 3VIHA 8XIMA 1OCNA 2XISA 3BLDA 2JALA 2D2JA 5F2MA 3T44A 4HYWA 3URBA 2PDHA 1I75A 3LTPA 3WUGA 1IEIA 2Z1VA 3JR2A 3MC5A 4DO6A 2FZBA 3TYDA 3VMPA 1DQWA 3CU2A 1VBUA 4PUMA 3I65A 3QYSA 4JNZA 5RUBA 4JTRA 4DJDC 2DSVA 1TTIA 1LG2A 1Q4NX 3FS2A 3WNKA 3IGXA 1DJXA 3NOYA 2J7DA 7CGTA 1HF6A 4R3UA 4MJMA 3F03K 2WC4A 3KBJA 3IVTA 4P7QA 1SFSA 1VP5A 3MI2A 3U9IA 1K70A 4YL2A 1VJIA 1NQKA 4GY0A 1OVDA 1LUCA 5K9CA 4PCFA 5CJMA 3UESA 3MVTA 3UR5A 4AX6A 3L65A 2V68A 1SGJA 5DT7A 6CGTA 3B8VA 2W79A 3MSYA 1G1YA 4R27A 2B7OA 1X98A 2WVUA 4CLMA 1M6JA 3F7JA 3VDHA 3VUPA 1JVNA 1QW9A 2J7EA 4H9UA 5HQLA 4TVUA 3CHFA 5AOUA 1KWKA 4NL1A 4NI3A 2DUAA 1PKLA 1OC5A 1DJZA 3WLTA 3MKCA 4LS1A 1SR9A 5IDIA 1A5LC 2PTYA 2PDIA 3QR3A 4NVTA 3FN9A 3AWNA 3KLKA 3GW0A 4YVVA 2WHLA 1E6ZA 1F07A 3ARUA 3RM4A 2DZWA 2E7FA 3QGKC 3WQ8A 2A7RA 4N4QA 1VEOA 4PMJA 2I16A 1KCXA 2WOQA 3V0TA 3ZT7A 3PAJA 3AS2A 3RCNA 2TODA 3KBVA 1R7AA 1K7FA 5I3HA 1RPKA 3G22A 4GOAA 3ONCA 1K4GA 3A12A 4C6BA 5HNRA 1BD0A 2BOGX 2WCGA 2FH8A 3E2VA 2VGGA 4JTSA 4HBKA 1GONA 4QEHA 2R82A 1I2OA 1XLGA 5IHRA 3EA2A 2W0UA 4WDTA 3FYYA 3RLHA 2O9OA 3C6CA 3FX4A 1EA0A 1LQ2A 1NFPA 2QDDA 4W7UA 4R9OA 1TPDA 2D2GA 4LGXA 3N9KA 3OQ8A 1UIPA 1UKPA 4JGDA 3LU2A 4LAMA 2DZTA 1GTHA 2CLKA 2F6XA 3UPMA 3BV4A 3M5XA 3OO2A 5I09A 4M8UA 4D6FA 4LUIA 3SCWA 4MLRA 1TJPA 2IKHA 1TPH1 2WYSA 1VCFA 3KRBA 4UC5A 5DMLA 5A94A 2ZBTA 4DI9A 4K3ZA 1UR2A 4H9XA 3GIPA 3GTNA 4XZMX 3VD5A 5MF5A 2PPGA 4CNPA 1C8QA 3T0BA 1XJBA 2FGBA 4MVAA 2CC0A 2GK1B 2R1LA 1WO2A 4E8CA 3CM4A 4EWJA 5C9RA 1XBYA 3C2OA 3RR4A 1J2BA 3KX6A 4AZ7A 2JF6A 3NL2A 4W86A 1W9UA 1ZL1A 3PFRA 3RM9A 4G1KA 2HXTA 5U7SA 4A22A 4PUWA 1J96A 1SUXA 4E0CA 1IHIA 4DWSB 3LPPA 3PULA 1W5PA 1HJQA 2C0HA 2QAFA 4FPSA 1IWAA 1D3GA 4K38A 3ARZA 4OUEA 4MDPA 3SO7A 1DWJM 3TK7A 3UZ5A 4UQEA 3O15A 1XIEA 1Z89A 2Y88A 2ODOA 3G8EA 2E8ZA 3NYDA 3XISA 3DFSA 1BYDA 4ZTYA 3W7CA 2FB3A 3GNXA 4LS0A 4JKLA 2QGHA 1ZLPA 3MVIA 1UQZA 4DUWA 3OIHA 3PTDA 3GDTA 4OU1A 3CV6A 5CKSA 3UA3A 2DDXA 4HNLA 2CXGA 2WO5A 3UQNA 3CPRA 4MYXA 3W1NA 3I10A 4L6HA 3W83A 1W56A 1TPWA 2CHOA 2V30A 4CKQA 3QGAC 2QDEA 2C3ZA 1E3ZA 3OGVA 1BVWA 4GZ7A 1B9BA 1J0KA 4HP5A 4LC8A 1NOWA 3SN4A 3UZZA 2GLKA 1XD1A 1CLVA 1QBAA 3ARXA 3ZMRA 2PP0A 4DO7A 4Y96A 1NF0A 1RH9A 4Q8WA 4S3KA 1XYFA 1DL3A 5C2CA 2VGBA 2V5KA 4HSOA 5CGTA 1JR1A 1XGDA 3A13A 3LPGA 1UYQA 2IPFA 2G8ZA 5FF7A 4D9PA 4TVCA 3TXZA 1N2VA 3GUWA 5C9ZA 4MJ4A 4GFSA 3QMSA 3O6DA 3URNA 2XN2A 1EQCA 2BZNA 1MQRA 1H0GA 4GJJA 3P6LA 2PS2A 3K8MA 1KLZA 4F40A 2QJGA 1F61A 2NLYA 3PN8A 1I0DA 2P3ZA 4LYRA 1SJAA 5I0DA 1UH4A 1KFLA 3WH9A 4F2UA 1VIZA 3B4YA 5CSYA 3TQVA 2VQUA 4KH2A 5FF0A 2GPTA 3KXQA 5D4YA 5GJPA 2DZSA 2B4GA 2J7GA 4D6DA 2D69A 4MTVA 2QV4A 2BY2A 3LTYA 1S2WA 2MNRA 3O3RA 1S2TA 5C9UA 2OPJA 1OGGA 1RBLA 3NZPA 4KWWA 3QLLA 2GJPA 2V5BA 5HNNA 2QR6A 3GBEA 4XX6A 2W5FA 1ECEA 1J8VA 1XICA 5TIMA 3LCGA 1JD7A 5G2IA 5IFTA 3GVRA 4IJRA 4CQCA 3E3HA 4IUGA 2BOEX 5K4ZA 1R2TA 2NVAA 2VDHA 3T4CA 1TR9A 2O9TA 2GGIA 4DJDD 3RRAA 2E0PA 3BLEA 2HK0A 5I3GA 3U2ZA 3A24A 3CUFA 3KS6A 4HQVA 1OBAA 5FEWA 3N73A 3FKKA 4UOQA 3T07A 2E9BA 3NPXA 4OWGA 3BAKA 7A3HA 3WDIA 3UWUA 2E1WA 4C1NB 1W1A1 1DJHA 4AX7A 1TE1A 3K1DA 5CH9A 5DCEA 5CEWA 3PZTA 3IUHA 2CZEA 2C1IA 2E8YA 3GXFA 1KFBA 4PCTA 1VYRA 3LI1A 3GC2A 3M6YA 5CBBA 2WSPA 1W9DM 4GYPA 1HKVA 3ZO9A 1DYSA 4MNLA 2J6XA 4AVFA 4FX7A 3FGCB 4OE7A 3NSMA 4GG9A 1BWKA 3KS5A 3QY6A 1AVAA 4HJWA 3U7BA 1HKMA 4HNUA 3G0XA 1JPIA 3TQKA 1PBGA 1ISWA 2KZHA 5I6SA 4W84A 3QMTA 2YYUA 4LB4A 3EWCA 1UJQA 1JYXA 3SUWA 3WF4A 3VAVA 2OQYA 1AMKA 4O57A 1MXSA 3GXPA 3NEHA 3EMQA 2YBTA 1C8YA 3FXYA 4FB7A 4HPNA 4WCJA 1W3KA 3U4FA 4UOZA 3GC4A 4RNIA 1R9ZA 3M5ZA 3VDBA 1R2RA 1N8WA 4DLFA 3N11A 3T40A 1E6QM 1S3TC 3C56A 3LCXA 2QPSA 5JUVA 4L4OA 4ZODA 5LA0A 3KDNA 2Y5JA 3CL8A 5JH2A 3GXMA 1SW7A 3HG3A 2WMGA 1GVYA 2PDWA 4RDYA 3VVGA 3UG8A 3TTYA 3DFYA 3A5FA 3R5EA 3LM3A 4F8XA 3U8GA 1AJZA 4HK6A 3LNMA 1EWEA 1BYAA 3H2OA 3V0SA 1VAHA 3IJIA 2R14A 2ACQA 1LM1A 4FP1A 1X7FA 1M41A 3CB3A 3KBWA 3B06A 2WZTA 2OWXA 3IJ6A 3W2MA 5EPDA 2FVKA 3WL1A 2ZX5A 2VEGA 4KEMA 1GT8A 1VIWA 1L8PA 1BQGA 2Z2BA 4OBSA 1FCBA 2IPWA 1KBBA 3SM0A 4GUIA 2FTPA 1VHCA 5A95A 3GQYA 5K9DA 4S3JA 4DJFC 5FJRA 1FWCC 1K03A 4JYDA 3SY5A 3BAWA 3DENA 3LBMA 2WANA 1OHLA 1J10A 3W2UA 3IIXA 2YL9A 3PZGA 3BAXA 4YVPA 4RR4A 1PTGA 4PL2A 4IG2B 3ZVHA 4PSRA 5KZ6A 3V5CA 5A2AA 4MPQA 1ZJBA 4AZCB 4MY8A 1GVRA 3W1XA 3QJAA 1QK2A 1S2VA 2Z2UA 3LRMA 1QI2A 4DZ5A 2W62A 4US5A 4IPNB 1JCLA 3DYOA 2J8FA 4ZO8A 5TF0A 4S3GA 4NYYA 4O19A 4QCFA 2I5GA 4K7VA 4H9VA 1BHGA 2BNJA 1UOZA 3M0LA 1Q2RA 4PC8A 4MGGA 1YMYA 4WJEA 4LJ3A 2OU4A 5D33A 3VOCA 2J78A 3BGGA 1MEWA 1GEHA 4Z1YA 2XFRA 4OZOA 2X0SA 2E25A 2ONEA 2RDWA 2CZDA 1TYGA 1DORA 3C8FA 1SZNA 2G95A 1SW3A 2BASA 3DAQA 4MZ8A 3DKJA 2R6OA 1EH9A 1THFD 1JZ3A 2DW6A 5LIKX 3SSZA 3DC0A 3HQNA 5F2LA 4DX3A 2DIKA 3PUDA 2J79A 4JHZA 4EIVA 2NT0A 1KB3A 3UG5A 5IHSA 4GPNA 4LVAA 1G69A 2E67A 3ORWA 2FYMA 3KFTA 1E1CA 2PDGA 4NXKA 3S2MA 4GI6A 4O0KA 1ME9A 1JFXA 4GY7A 4ACZB 4HJFA 3RR1A 3GHRA 3W00A 2V0TA 4H9ZA 1UB3A 4R7OA 1TREA 5GVJA 4YXGA 1ZSXA 3VNMA 2WNNA 1E1CB 4XZLX 4JZ5A 4UMBA 3WDHA 4LPCA 2OSYA 2WNZA 3C0QA 4TO8A 3W1QA 1MZRA 5G1MA 1IR2A 4XKYA 1SM9A 2GYIA 1QRQA 3AIQA 3M0JA 5K4XA 3CV7A 2F84A 4RNFA 2ZE0A 1ZPTA 3P8IA 1XIJA 5I77A 4F2BA 1ICPA 5H91A 2DJLA 3RGTA 2VXNA 3VKJA 3WKZA 1RV8A 3CASA 3OJGA 4N02A 3DN5A 3WIJA 4JTGA 3PZNA 4JN7A 2CLHA 4W5ZA