3W2JA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-135
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-135
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w2jA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w2jA01
1F2JA 3VI2A 3LXCA 1OFOA 4JN6A 2B7OA 1MEHA 2G95A 1EP1A 2NV1A 4IX0A 4AXKA 3A24A 3W7GA 2CLFA 3TAOA 1W5PA 1WX0A 3PULA 2YGYA 4UTUA 4ML9A 1XCFA 1OFQA 4H4IA 1WBJA 3NOEA 2QJHA 3SGZA 2P10A 1XBYA 1W0MA 4GUFA 2VOMA 3C8FA 4IQLA 3IIPA 1RZMA 3E9AA 1H1YA 2OCZA 3P62A 3LHVA 5K4XA 4PEKA 2E5BA 1I4NA 5J5DA 1AL8A 1XC4A 2V5BA 3BLFA 1P0NA 1W3NA 3UNDA 4LOCA 2JGQA 3MI2A 1YXDA 2Y63A 3LV6A 5KZEA 3W7IA 4E2DA 1ADOA 3G1HA 3G0UA 1VHCA 3W7DA 2A1YA 4DF1A 2P0OA 3W1QA 4B5NA 5LGZA 1WOBA 4MUZA 4Z1AA 3C2FA 2GJLA 1ZAJA 4BF9A 3HOJA 4Y9AA 3NPUA 2NX9A 1VCFA 3DZ1A 3K30A 1JQVA 3M6YA 3W1RA 3GYEA 4QISA 3L67A 1OK6A 1KW1A 1EWDA 2QAFA 3QFEA 1FUYA 2FDSA 1VGAA 1JRBA 3PM6A 4IXHA 4UTHA 4MZ1A 1UASA 3DXIA 3B05A 1HL2A 5FEXA 4QQ3A 4O0ZA 1T96A 3W7OA 2EGZA 4YWIA 1KTNA 1TRDA 3DBPA 4NT0A 2QCDB 1S3HA 1AK5A 5H91A 4LVAA 2ZZ7A 6ALDA 3NQEA 1DOSA 3TX9A 4WUIA 4JX4A 2A21A 1IIHA 3NQMA 1IF2A 4CNOA 1YTDA 3L68A 1QAPA 1QPRA 3NL5A 3EWBX 3UWQA 7TIMA 3S1XA 2NUYA 4R33A 2EPHA 3UY8A 1YTEA 4N9EA 3CWNA 4GE8A 2NWRA 3I7RA 1XXXA 1H7OA 4IX2A 4XZ9A 2Y7GA 5DY2A 1KBIA 3KVMA 1TPVA 4NJIA 2V82A 3G1AA 2RDUA 3EKLA 5CPMA 1OFAA 1UUMA 1K03A 1F6KA 4AHPA 3LI1A 2C13A 1F6PA 1BEUA 4K37A 1QPOA 3DH7A 4WXZA 2XFWA 5EMUA 4M5PA 3C6CA 2X1TA 2J9YA 2Y70A 3U6WA 2Z6JA 3CHVA 4H6KA 1LYXA 2DU2A 1DHPA 1M7OA 3W71A 1NVMA 1LOQA 1TPC1 2YDAA 4UNLA 4DO4A 3E49A 2VFIA 3O06A 4NZJA 3S5NA 2Z0IA 3NQAA 4BI6A 3S1WA 4GUIA 3BPWA 1PV8A 3WJYA 2J9XA 1WBHA 2ZQ0A 3MYPA 5AYXA 2DORA 1PHQA 2J9ZA 2WPBA 4JX5A 3W87A 3H53A 2A0NA 2QCDA 1OJXA 5G5IA 3QEZA 1FDYA 1OG0A 4IMFA 4MY1A 4A2SA 1H61A 2CLKA 3NVTA 4M7TA 2X30A 3LLDA 3BK0A 4L4MA 2OX1A 3Q94A 1L6SA 1O5KA 1RR2A 3FOKA 3BO9A 3OA3A 4FX6M 3W2MA 1SZEA 4MKNA 1OFRA 2VFFA 3G3MA 4HSOA 3LCXA 1Q3NA 1YLVA 1JRCA 1N55A 1Q45A 3OHIA 3HPSA 1FCQA 2ZZ5A 1GVRA 1YXCA 3LCHA 1LOLA 2ZRWA 3LM7A 3PR2A 4WY0A 1J4EA 3M5YA 1R2RA 3DFTA 1QPNA 1W37A 1V7YA 1QCWA 2GQ8A 3S1VA 3TW7A 2VC6A 3A5VA 3M1ZA 5G1YA 3EEGA 2HTMA 3M0ZA 3W1AA 2E1DA 4O10A 3M5ZA 1XDMA 3TMQA 1VJIA 3LV5A 3R12A 2VEIA 4FEZA 1PL9A 5K3VA 3MMTA 4FNPA 3P84A 1SR9A 3F4WA 3B04A 3CTLA 2V2HA 5AB3A 3ELFA 1KLYA 3MHFA 4IJBA 3H55A 2CLHA 3BW3A 3G3DA 2FFCA 3IIXA 3Q2DA 3SZ8A 2FQIA 1X1OA 2Q8LA 4FXSA 2E6AA 1PE1A 3PG9A 1PCWA 4XBKA 3W07A 2JKPA 1ZFJA 3IEBA 3JS3A 2QR6A 2EF9A 3PSVA 2QDHA 3S0CA 1JULA 3LDVA 3VNDA 2O7SA 2BSLA 4CCEA 8TIMA 1ZY9A 1K8ZA 1OX5A 3LXAA 4ZZ9A 1XBZA 3MP4A 3UWYA 5HR6A 1M5WA 1X7FA 3V1PA 4AEOA 5F4SA 2Y6ZA 3W2LA 3W7PA 1K7XA 3TAKA 1ZENA 3TFCA 4ADSA 5CPNA 3IIVA 1EPXA 3CEPA 5I3KA 4FF7A 2X1SA 4X3ZA 1LRQA 1MEIA 1L6YA 4Q4KA 4AWTA 2X1UA 4YCOA 1UCWA 4N02A 5IBXA 5C54A 5LNWA 4Z0SA 1SW0A 5CZ0A 4LC6A 3LGEA 1NEYA 2JK2A 1LBFA 1TPFA 4O52A 2GJNA 1RV8A 3GNDA 3MW7A 2QCGA 1H7WA 1G4EA 1O94A 1YDOA 3TFXA 4A29A 3QQ0A 4RKAA 1VYRA 3IIOA 3G1XA 1HFBA 3KXQA 3M9YA 2FPVA 2V9DA 2Y7DA 3THAA 1GVQA 5LHFA 1TJRA 3GDMA 3SECA 3W2NA 1P1XA 2XN2A 3HGSA 4GFSA 4MIMA 1OFBA 3L5MA 3NGJA 2DZPA 2VFEA 3EWWA 4E38A 1C29A 1LLZA 1VQTA 1NF0A 2NXGA 1K8YA 2WO5A 3W7LA 3CQ0A 1OX4B 3C2VA 1LROA 4ADTA 3GAKA 1AW5A 3PB0A 1JJKA 1MSSA 1I8JA 2YFOA 4JTLA 2ZA3A 5C5YA 1SUXA 3UZJA 3O6DA 3EX1A 2YW3A 4HPJA 4DEFA 1G4TA 5E0KA 2CWNA 2RDTA 4DQWA 4JD4A 5D32A 3CEUA 5FF2A 2R94A 1GG1A 3BG5A 4IPIA 4UTLA 3SW6A 1Q6RA 4E2BA 1DBTA 4AWUA 2H8XA 4K6AA 4A2RA 4A21A 1XI3A 4UR8A 2A2IA 2WQPA 1XBXA 1L9WA 1I2NA 2IQTA 4DF0A 4FNUA 3R8RA 3ABQA 2QKFA 2EKCA 3GR7A 3GAYA 2R14A 3R13A 4N2YA 2B7NA 1IGSA 2I9EA 5U7SA 1XUZA 3C2OA 2C1HA 4JTEA 4AVFA 3N34A 5F1VA 3W7KA 2Y89A 4S2BA 3W86A 4NNBA 3TQ0A 3QPYA 3PF3A 1T99A 1VPXA 4UIOA 3W7RA 3UWUA 2Y85A 3KX6A 5D38A 2DZVA 2HSAA 3DGRA 5BOOA 1ML1A 1QWGA 3MBDA 4QSHA 2VELA 1JUEA 1BKSA 4A3UA 1R46A 1FXPA 1GOXA 4UTKA 2DZSA 2ZTJA 4UCGA 3EWUA 4GUHA 3BW2A 2J88A 1FCUA 1NAL1 2GUUA 3IRDA 1OX4A 2ZRXA 3P61A 5CKSA 1SO4A 4GRSA 3LTYA 1JUKA 3TJLA 1VCGA 3N2XA 2B7PA 4LRSA 3LBMA 1GQNA 3ABRA 5EBUA 5GVJA 4JDYA 1QNVA 5K7JA 3PC0A 3PS7A 2YZRA 1IIGA 1OYBA 3EX4A 1OFDA 1XKYA 1XM3A 3W1UA 3PSWA 4JTHA 3HIJA 2H3BA 2VFHA 5HWMA 3PB2A 1X1ZA 4X22A 4NX5A 4WJEA 1GPWA 3TH6A 4BWLA 1XL9A 3PUOA 2HMCA 1VC4A 1KM4A 4IOTA 2CW6A 5HUOA 4BWLC 3C2EA 5AYZA 2O7QA 3C3NA 3CU2A 3QPZA 1OHLA 4WOZA 4MVAA 4O1BA 4EF9A 1IXOA 2WSQA 3Q58A 4QNEA 2W0UA 3P8JA 2ZZ6A 3GX9A 4LVDA 1AW1A 5DCDA 4MFDA 3T7VA 1DVJA 1TMHA 5G2WA 5DLCA 1X8FA 5LHEA 1SU5A 1FQ0A 4PFMA 1SZGA 3B03A 2C16A 3NQGA 4MLJA 4R34A 2J6XA 3Q37A 1TV7A 3HG3A 4O28A 1H7RA 3NEVA 1TREA 1CI1A 3NQ8A 3GNNA 2A6LA 4N9DA 2XN1A 4PODA 3BV4A 1RVGA 4CCDA 2D73A 1I2QA 2ZCGA 3GDTA 3TC7A 5E93A 4NXSA 1VS1A 3W72A 1G7UA 3UXAA 1Q6LA 1TPDA 3PWAA 3FKRA 5LNUA 3W7MA 3W1XA 4TU1A 1FDJA 4O0KA 4UMCA 4JTUA 1DORA 3AJXA 5TBOA 1H60A 4M6PA 3I6RA 4Y8FA 3PY2A 3LERA 5HNRA 1MO0A 3EKZA 3N9RA 5T26A 3RFAA 3NL3A 1SFJA 3TKFA 5I3IA 4A22A 4FO4A 3VKJA 3G1SA 4ZQRA 3FFSA 2LLEA 3PUDA 1OF8A 3KOFA 5D03A 4CLMA 1BTMA 4GWEA 2CZDA 2ZZ1A 3QW3A 2Q3OA 4HKPA 1Z42A 2NUXA 1SO3A 3QH2A 1SO6A 3GDLA 3TA6A 2ZDRA 4XUGA 3VE9A 1QPQA 3RLVA 1WXJA 4UTIA 5FEZA 3DI0A 4ZQCA 3W1TA 3HF3A 1VLIA 1KM3A 4HHPA 1TJPA 4O18A 4UUIA 3CM4A 1OF6A 2G96A 3G1FA 1LP6A 3AO0A 3CLMA 5AYYA 3KVLA 5C55A 4LVBA 1K02A 2RH9A 4LW7A 3EX6A 5G2IA 4H3DA 3WK0A 3W73A 3W2KA 4KFNA 1F7BA 3LCGA 4JIQA 3TR2A 1LCOA 3LHWA 1JCYA 3BGJA 4JGDA 5TIMA 1KFJA 3WJWA 3ZR4A 2E6FA 4O4WA 5AHNA 3TUUA 3EX3A 2VKZG 4RXGA 3P82A 4LWWA 3M7WA 3PG8A 4ZMGA 1PHWA 3TNOA 4DBDA 4NXKA 5FF7A 3N19B 1ME9A 1R2TA 2QCHA 3GR8A 4U28A 3UY7A 2ZTKA 5DXYA 2RDWA 3TU9A 4AF0A 1JCMP 3T44A 4HSNA 1EWEA 3W7QA 4JIPA 4UMAA 4DPPA 3R89A 4TIMA 3O1NA 3STEA 4JXCA 1R2SA 4O17A 2RHGA 4WY0B 3LCWA 3N9SA 2WKJA 2QUTA 1H63A 3A21A 3D0CA 4IWWA 1TPWA 5A5WA 4O54A 1EX5A 4PH6A 2CLLA 4LNYA 3SGUA 4UTWA 4YLWA 1GTHA 3U8GA 5AN7A 1LTDA 2V0TA 1OABA 3W6YA 5CG7A 4UTWC 5C6MA 1GVOA 2C0AA 1YPIA 2JBMA 3DFSA 4AHQA 3RMJA 1F76A 5AHFA 1EP3A 2PC4A 3P74A 1KTBA 3P8IA 3EWZA 4S2CA 5F4WA 3INPA 4OV4A 1ICQA 3GVGA 4Q32A 2ATMA 4O1CA 3USBA 2VFGA 4KWVA 1V5XA 3W7JA 4MYAA 3I7SA 5LNRA 3KAOA 4PL2A 3O6YX 1AW2A 3FS2A 3RF9A 3NPXA 3NQCA 4IMDA 3HG4A 1NSJA 1K7EA 4EVZA 2F84A 3C0JA 2AGKA 3S8HA 3W84A 3NQ2A 5D2XA 3CPRA 4OQVA 3S5ZA 5G4WA 1HUVA 3P7YA 1VCVA 3L0NA 2JGYA 2NX3A 2QJIA 5BMWA 1W5OA 1DQWA 3W70A 2WNNA 1M7PA 3QMRA 4K8EA 4W9TA 3CIWA 3GKAA 2Y88A 2E68A 4JTSA 3GB6A 4TR9A 1H51A 3WJSA 3HO8A 1P5BA 2YXGA 5AHMA 3WK3A 2FTPA 3WJZA 4ORMA 1ZCOA 4RX0A 5D2VA 1CW2A 4X9SA 2QJGA 4YL2A 3NM3A 3L2IA 2YYUA 3OVRA 3QRHA 3KHJA 3C56A 3TSBA 3G8EA 4DPQA 1AL7A 3PBYA 4R53A 1WA3A 1MEWA 4POCA 5EKYA 3NG3A 4O53A 2CU0A 5G2HA 4QITA 4JY8A 1B4KA 1K8XA 3STGA 2OT0A 5D33A 3ZWTA 3LI0A 4O19A 2C15A 4XQ6A 3W23A 2V30A 3MP5A 1U5JA 3A22A 4UFMA 1K7FA 3PBUA 5SWUA 5CZSA 3UPWA 4K39A 4NVTA 3EXRA 3DENA 3O8AA 4O11A 3M47A 2V81A 3RK8A 1QO5A 3LRMA 4K7VA 1KV8A 3UYCA 4AAJA 3W2UA 1L2UA 2Q8ZA 2A7RA 3FJLA 4OE7A 5EL1A 4GXMA 5HJLA 1GVSA 1Q6QA 4BR1A 2Y61A 1EIXA 2DZUA 4MFEA 3BW4A 3NQFA 3P5ZA 3UPBA 3G0SA 1R30A 4O1DA 2YPIA 4O14A 5ABTA 5F2LA 5A8GA 3WFAA 5D37A 1KBJA 2A85A 1EB3A 3W3OA 4CNPA 4AB4A 1QO2A 1VR6A 4P61A 1SSDA 3UZ5A 3STFA 2QCMA 1TQXA 1O60A 4E0CA 3B0VC 3S5YA 2ISWA 1GJPA 4MJZA 5D04C 3TK7A 1O5XA 3NR0A 3I65A 4K36A 1KFLA 5HQEA 3SI9A 2E09A 4Z1CA 1R47A 3BVJA 3P5YA 4J9JA 1LBLA 3KRZA 3G1YA 4LU0A 4CQ9A 3TSDA 3MP3A 5EY5A 4MOZA 1B3OA 4LUJA 5H2ZA 3H54A 2ZFAA 1Z44A 3NQ7A 3NZRA 3G0XA 3E12A 4IXXA 1B57A 3S42A 3T78A 3N14A 3W7CA 3FJ6A 1U83A 4BK9A 2A4AA 4LVFA 3ATZA 4N9BA 3LHYA 1C9DA 4FNTA 4NJKA 1AMKA 2TRSA 4O13A 4IUOA 4NJJA 4BFAA 3TE9A 2E5CA 1LDCA 5DCBA 1G4SA 3L66A 5DY3A 2WV8A 1S5VA 4UNKA 1PCKA 3TROA 5IM51 3MHGA 2FJKA 4O4VA 2WNQA 2X1RA 3O63A 3QSTA 1H7NA 3L5AA 1JCLA 3TDFA 3MJYA 1GYLA 1TO3A 1KV5A 3QYQA 5E1QA 2GPTA 4UR7A 2VXNA 3S9YA 1DQXA 3P81A 4QAIA 3HMJG 1W31A 4PL1A 2NX1A 5KZMA 3ABSA 3CB8A 2ISVA 1A5SA 4OHQA 3SFKA 4O15A 1YDVA 2EAWA 4Y96A 3TJXA 1FDZA 1OYAA 5HMSA 5BNKA 5L9FA 1RPXA 2YFNA 1EUNA 4QIUA 1SZNA 3QC3A 3TQKA 3JR2A 4MLRA 1LOSA 1TTPA 5I3GA 1P0KA 4UXDA 1G6CA 1FY6A 4PC8A 5I3JA 1FWWA 1H62A 3SJ3A 3JRKA 2Z2UA 2QCFA 4MY8A 3C2RA 1P4CA 4R7JA 2C14A 3DFNA 4UTJA 3KVKA 4WXYA 5D05A 3W76A 4LVGA 2NV2A 4DXVA 4FNQA 5HR7A 3NDOA 5DN1A 3L0KA 5D30A 2Q3RA 4N4PA 5D2WA 3QJAA 2ZBTA 2AQWA 1ZAHA 2NUWA 1IXQA 4O16A 4IGHA 2B7QA 1Q6OA 4TMBA 3HGJA 2ISSA 4HT3A 4NQ1A 5DCEA 4JTKA 1WAUA 3ZS4A 5FEWA 3EXTA 4AMAA 1VH7A 1I2PA 3QMSA 4OT7A 3QSRA 1TPUA 4UFJA 3IGUA 5AC6A 4LUIA 2C18A 3PBWA 4HPXA 1UUOA 2EHHA 5CPOA 1GYNA 2ZA1A 5CZTA 5D2YA 2RFGA 1SFLA 1TSIA 4M7SA 3E02A 1SO5A 3MO7A 4MPQA 1QOQA 1FXQA 3B8DA 3TV8A 1H50A 1WDWA 4OBTA 5K2ZA 3PAJA 3CC1A 3KRUA 1ICSA 5LZLA 2C6QA 2PURA 3GXPA 4OWGA 2FLIA 2UV8G 3LBCA 1UJPA 2FPYA 4NJHA 3LTPA 3F4NA 3L0GA 3MI3A 3HJZA 3HPXA 1JUBA 2XN0A 3MUXA 3NO5A 4IMGA 5K9XA 3W1PA 2JKAA 2QF7A 3P67A 2JKEA 2DZWA 4NNAA 1N7KA 1IXNA 2GOUA 2WSYA 4BI5A 3IVSA 3UWVA 1KFBA 4P2VA 4AWSA 4WZHA 1KM5A 3OG3A 4QJ1A 3NM1A 2DJLA 1T0OA 3NA8A 1F05A 4FIQA 1M6JA 5F4XA 2PRLA 2I14A 1Y0EA 3F03K 3A5FA 4C1KA 1ZAIA 4JDBA 4XWUA 5AHLA 3FLUA 4RJEA 3I68A 3DU0A 2E77A 1OX6A 3OBKA 4MYXA 2RKXA 1GWJA 1LM1A 2WOQA 3GDKA 3UQNA 2ATSA 3M5XA 4NX0A 1Z41A 4FXRA 4MZ8A 3SY5A 4I7UA 1FWRA 1SPQA 1BWKA 3S1UA 1EP2A 2ZRUA 1W3TA 5HINA 4WY0F 4ONVA 4LT9A 1WOAA 1G67A 5F2GA 4UFKA 4KFOA 4CCCA 2OJPA 4RLIA 1KM1A 2TPSA 5LNSA 1QR7A 1IXPA 1QFEA 1KTCA 2Y7EA 1JR1A 3O07A 2GVJA 1TYGA 2VFDA 3LCIA 3BARA 4S1FA 1OK4A 1D3HA 4ICNA 4AF0B 2W6RA 2NLIA 4HIBA 1VZWA 3KRSA 4IMEA 1CX9A 2V5LA 2FIQA 5FESA 3NQDA 3W1NA 4Z08A 2GQ9A 4ZQMA 3LTSA 4Z1BA 5KITA 6TIMA 1OVDA 3P60A 3BG3A 1HO1A 1SW3A 3SIZA 2BZNA 4JYEA 3F1QA 3MHUA 1FWSA 2QCEA 3L21A 1EA0A 3KFTA 3GKFA 1I2OA 2FB2A 5LSMA 2F7FA 3STCA 4O8RA 3A23A 3DHDA 4RK8A 4MY9A 3HQ1A 2KZHA 3E0IA 1JCXA 4GUGA 3UWZA 1DJQA 3NQVA 1YADA 3A9IA 1ONRA 3B0UX 1SQ7A 2WNZA 4HNNA 4BI7A 3G1VA 2VEMA 3DI1A 4RZ5A 2VEKA 5LKYA 3GLCA 3NPVA 2BXVA 1GG0A 3DFOA 5D02A 3M43A 1H7XA 2ALDA 3T55A 1KFEA 1VYSX 2C19A 4DELA 3FIGA 3MBFA 3W7HA 3GDRA 2QEZA 2YX0A 2NXHA 3ATYA 3T40A 4WX2A 3CT7A 4JEQA 3LB0A 5FEPA 3HB9A 1ZHAA 4LTSA 3C61A 2GVLA 3TIMA 4NU7A 5AC8A 1TPB1 1I2RA 4Q33A 3IGXA 5LGXA 3B06A 1N8FA 1Z48A 2WJZA 1GTEA 1LRNA 1YTKA 1XDLA 5I3FA 1RD5A 1DL3A 1XBVA 3LCLA 1LORA 5CZJA 1B4EA 5KINA 4PA8A 3EXSA 4NNCA 1TTJA 5AHIA 4FX7A 3N73A 5FF0A 1ZJIA 4JX6A 2BWGA 2X2GA 3QW4B 4N9CA 1A5CA 2PRHA 3NQ6A 4M6QA 3TC6A 1O95A 3HG2A 2CLMA 2CZEA 3VE7A 2QUUA 4LRTA 4GUJA 4FNRA 1GZGA 1YDNA 2H3DA 3DKJA 2H90A 4JR5A 1ZALA 3O16A 2A5HA 2QCNA 4N6EA 4KFPA 2ZA2A 3W74A 3W1LA 2E6YA 4O12A 5J5RA 1TB3A 4PCFA 1VYPX 2GVGA 4RZ6A 1KM0A 4NJGA 3HPZA 5HWJA 2Z6IA 2B0MA 3KVJA 5CPLA 1WQ5A 4ZQOA 5TQLA 5EA9A 4AH7A 5HUPA 4IPJA 1TPEA 3R5EA 1FWNA 2E6DA 3W1MA 3LOTA 4ZL1A 2HS8A 3LX9A 4PTNA 2G5WA 1HTIA 1KLZA 5DELA 4JTJA 5F1UA 4UFLA 3HBLA 1FBAA 3UXDA 1FX6A 2TYSA 5FF3A 3TMLA 4JTFA 3MWAA 4I7WA 2H6RA 2NZLA 2CLIA 3HGRA 1KFKA 3N2MA 1NF7A 1D9EA 4NUWA 3RU6A 3ZWSA 3WK2A 2DJXA 2NXIA 4OGZA 3B4UA 4GC4A 2C3ZA 2OZ0A 2DP3A 1JQXA 1KFCA 2TMDA 2V2DA 1S5WA 4EF8A 5AFDA 3NAVA 3PBVA 5G4EA 3ZFHA 5BMXA 2YW4A 2ZZ4A 1LLWA 3E96A 2OMAA 4JNMA 2E5DA 1EEPA 1JCJA 1X6UA 3V75A 4G1KA 3OVPA 1J5TA 2HS6A 4WOQA 1KA9F 3THQA 3L9CA 1EUAA 4FNSA 4NZFA 1XUUA 1XFBA 4UTTA 1JVNA 2G97A 2X16A 3QF0A 1RQEA 4UTTC 1TV8A 4DF2A 2ZZ3A 1W56A 5F2MA 1RQHA 1G7VA 1O4UA 3M5VA 3NL6A 3EB2A 3OVQA 4Z0JA 4FB7A 4FHAA 4RZ4A 3VCRA 5KMYA 4K38A 1ZNNA 4FIRA 2A7PA 4DBEA 2DZTA 1NFBA 4O57A 2AAMA 3TCEA 3G24A 3NZ1A 4X2RA 3FKKA 3BG9A 3EWYA 4LV4A 1WYIA 3IVUA 1W8SA 1A50A 3HG5A 4EIVA 4XKYB 2CFFA 1E51A 1ME7A 3NYZA 5KSWA 2BX7A 1HG3A 1KM6A 2QUVA 2YYTA 5I3HA 3G22A 2QDGA 4QNWA 1SZFA 5BW6A 3VFLA 1TTQA 3M16A 3MYOA 3O05A 1QMLA 4GBUA 4YMZA 3NXFA 5HWNA 4L4LA 5U4NA 3G1DA 1W5MA 4IMCA 4HNUA 4RCXA 5EPDA 1C8VA 1W5NA 1QOPA 1H7PA 4ZQNA 1K3UA 3RNDA 3O6CA 2YCEA 4C1LA 4EWND 1DV7A 4HNVA 2ABAA 1GEQA 3SR7A 5IBXC 1WV2A 1TQJA 2CLOA 3MI6A 1TV5A 2Y62A 4CNNA 1TPH1 4JYDA 1KM2A 3WK1A 3NPWA 4UC5A 4XTDA 4JICA 3LHTA 1F74A 1HO4A 2ZRYA 3LRLA 3ABOA 4CQAA 5D09A 2CLEA 3BLIA 5KZDA 3IGSA 4ZVJA 3GIYA 3YPIA 4YCPA 4TO8A 3G8RA 1QDSA 4Y6GA 4UTMA 1FCVA 4HNTA 4FX8A 1B9BA 4LV9A 2BLEA 4GJ1A 3UD6A 1SSGA 5CSSA 5HULA 3LXBA 3FEMA 1MZHA 1PS9A 4U4MA 4JTIA 4RR4A 3NNTA 3T4CA 1OFEA 1ICPA 3LRKA 1TCDA 4UFIA 2A6NA 2ZRZA 4ORIA 1W3IA 3W85A 2PRMA 3EWXA 4OV9A 4XKYA 1W54A 4N6FA 5DBTA 4M6VA 2VEPA 3LCFA 3QQ1A 3W83A 1GVFA 4K8HA 2I1OA 2Z1BA 4TMCA 3RLUA 2BTMA 5EYWA 3QMTA 1LZOA 3L65A 4RXFA 3N3MA 1PIIA 2J27A 4JTGA 2A7NA 1VHNA 3C52A 3LHZA 3IIZA 2QCCA 4QM1A 4WD0A 3DHFA 2OT1A 4HN4A 1F73A 5BRBA 1YPFA 3G18A 4GNJA 2QAPA 4RV8A 3DAQA 5LNVA 3BGGA 4JY9A 4CQ8A 1H5YA 3GXNA 1DJNA 4O50A 3SSJA 2PE4A 4XTIA 2B4GA 3O15A 1PVNA 4MJMA 1S5TA 2ZZ2A 2Y7FA 1VLWA 1YXYA 4JTTA 1LRTA 2YSWA 3CWOX 2WSRA 1I45A 1W1ZA 3M44A 2H8ZA 1T8XA 2P1FA 3P80A 1DKWA 3HGOA 1OFPA 4LY8A 2GQAA 4DO6A 4I7VA 1FCBA 5L6UA 5C2XA 3C4UA 3EX2A 5K9CA 5CGQA 3W75A 3DKLA 5MHBA 3LHUA 4M19A 4YXGA 1J2WA 3W7NA 4OU1A 1YYAA 4XBSA 4UFHA 1MXSA 3GK0A 2R91A 4EOUA 3GZ3A 4O1AA 1THFD 3TW6A 4KWWA 3PVFA 4ALDA 3I7QA 2PCQA 5K9DA 2R8WA 5CSRA 1TRIA 2W79A 1L6WA 2CZ5A 4DO5A 3FA5A 4MZYA 3CIXA 4TX9A 5DXXA 1G69A 1UBSA 3ANYA 1SW7A 3PUEA 3W7EA 2DZXA 5D2TA 1A5BA 4LS2A 2YR1A 2ABBA 2J24A 5AHEA 3UWWA 3FYOA 1F5ZA 3BLEA 2NWSA 1ME8A 4N4QA 1W5QA 2ZYFA 3OEXA 3R2GA 3L5LA 3GXTA 3TQVA 1D3GA 2V8ZA 5FI8A 1BWLA 3S6DA 3IVTA 2TSYA 3QZEA 2VENA 3TXVA 1UB3A 4K7YA 5AOUA 5KTLA 3IV3A 3TSMA 4LC8A 4I9AA 1GT8A 1A53A 1G4PA 1OYCA 2CZFA 4JS3A 4Z1DA 3W2JA 2ZRVA 3WJXA 2V2CA 3FYPA 3OIXA 4ADUA 4LS1A 5F2IA 1ALDA 1AG1O 4JYFA 4LS0A 2QCLA 3B0PA 5G1TA 1TIMA 1TTIA 3QM3A 3U2OA 5DBUA 3TXZA 3NL2A 4D2JA 1RQBA 1A5AA 3W9ZA 4KKXA 4ZQPA 3M41A 4WQ6A 5AC7A 1FWTA 3DFQA 1JCNA 2FB3A 4UMBA 3W22A 5FF4A 3LLFA 5K4ZA 1H1ZA 3W88A 1VRDA 3S5OA 3DFPA 2FPTA 4Y90A 4AHOA 1LBMA
chains in the Genus database with same CATH superfamily
1F2JA 3H2AA 5CQ1A 2F6UA 3LXCA 1OC5A 4L64A 4JN6A 2XINA 4JQ4A 2G95A 1I6NA 3F4CA 2E7FA 4AXKA 2D22A 1EA9C 3TAOA 3H2EA 3SQLA 1WX0A 1WB0A 4ML9A 4AMCA 1WBJA 2CBIA 2OG9A 1OC6A 1CYGA 3MZNA 1XBYA 6REQA 1JD9A 4AQLA 3C8FA 1WDQA 4IQLA 1O1HA 3IIPA 2NSOA 2J75A 1RZMA 5LIUX 3RDKA 2OCZA 3SURA 5K4XA 5FOOA 2V5BA 1Q6EA 4LOCA 2DH3A 3MI2A 3BC9A 2IW0A 2RUSA 2AMGA 3IRSA 1FH9A 3G0UA 4TX8A 2D3NA 2A1YA 4DF1A 2P0OA 5LGZA 3BJFA 4GIEA 4Z1AA 3TYBA 1BXBA 4L1XA 4BF9A 3S6TA 5I00A 3NSMA 3GZAA 4XAGA 1NM9A 1X7IA 5LA1A 3W1RA 2CPUA 3R8HA 1OK6A 5C8BB 3RCMA 4D6HA 2A3CA 5BWFA 1JRBA 4IXHA 4UTHA 2IKIA 4MZ1A 3NWRA 4WSKA 3MANA 4QG8A 3B05A 5FEXA 1UWRA 4YHGA 3WH8A 4B5WA 1HKWA 1KTNA 4GYKA 3I6TA 1AK5A 3BMXA 2WK2A 3CHFA 3NQEA 3RRXA 2V38A 3CUGA 3MTWA 3O9NA 4HK5A 2PDKA 4U31A 3UWQA 3CQIA 3LUTA 3V18A 2EXOA 2EPHA 3I7RA 4M1RA 4KCWA 2V82A 3G1AA 3UVIA 4NASA 1ECEA 4NILA 2RDUA 2WNWA 5CPMA 1UUMA 2HXTA 1CLKA 4K1GA 1BEUA 4RUBA 4Y9OA 2XVNA 1XLHA 5EMUA 1YE6A 4M5PA 1NY1A 2VD8A 4MG4A 3H12A 2F8QA 3EOLA 5A8PA 3U6WA 4TVDA 4C60A 3PWIA 1LOQA 1JGMA 4ZTYA 4K3ZA 4QEHA 3TCSA 2XFRA 4NZJA 1BSLA 1S2AA 2Z0IA 4BI6A 2DUZA 4GUIA 3S1WA 4QXIA 1IEVA 3CQKA 1SMAA 3BPWA 2YOCA 1PV8A 4R27A 3GVQA 3K4AA 1K1DA 2DORA 4EAMA 2G3NA 3AU6A 2HBVA 5C7VA 1EDQA 1R85A 4LUSA 2X30A 3BK0A 4L4MA 4WDUA 1RR2A 3OA3A 3U4FA 4F9DA 3N11A 3NCOA 4H2HA 4LAUA 2X7VA 2ZDSA 2BY3A 1K70A 1PKNA 4REQA 2VHLA 5EFFA 3UGVA 1Q45A 3ZIZA 3GSMA 2ZZ5A 1EBHA 4J2PA 3PR2A 4WY0A 3B8SA 3K8LA 2OR2A 4Q8PA 3DFTA 1JPIA 1PBGA 4QG6A 2WCSA 3S1VA 4KBXA 4MWAD 3M1ZA 5G1YA 1OINA 2DSUA 2E1DA 1TA3A 1CZ1A 1PL9A 3P84A 3F4WA 4RPQA 1SGJA 2V2HA 3ELFA 4JQ1A 2CLHA 2XVKA 3BW3A 1HF6A 2OQHA 1BVNP 4FXSA 3NDZA 2OVLA 2Q01A 3PG9A 4IICA 3WZ0E 3RGTA 1PCWA 4YVVA 2JKPA 1ZFJA 3W38A 3W6MA 1V02A 3S0CA 4CQBA 1KBKA 3MUY1 3LDVA 4HTBA 2O7SA 4DYJA 4WIWA 8A3HA 2XH0A 5DMYA 2HNEA 1J10A 2W27A 4AC1X 3CV7A 3UWYA 1NDWA 2ISDA 1X7FA 5F4SA 4JCMA 1F9CA 2Y6ZA 1Q7QA 2IPJA 5LXXA 1ZP3A 4ERGA 1YPXA 4FF7A 3PPGA 2X1SA 4X3ZA 1LRQA 2QDDA 3GR4A 2X1UA 3BQ6A 1UCWA 4N02A 1J12A 5C54A 5CBBA 4LYQA 3FN9A 5H8PA 3R11A 1TPFA 5GNYA 4RW5A 6TAAA 4IT1A 1UJQA 1CGYA 1NDZA 2D20A 3PK7A 1G4EA 2GVEA 2YXOA 3QQ0A 3WLSA 1VYRA 2VTFA 1HFBA 4NRSA 3BOFA 4PZVA 5D8ZA 2Q02A 5LHFA 1DJWA 3HGSA 3D46A 1NIUA 3MUZ1 2WMGA 4HHMA 5HMFA 2IXUA 4E38A 4QLLA 3T1GA 4GYPC 2OKTA 4C6PA 3RRAA 3C2VA 1LROA 1G94A 1XLKA 1WKDA 3D47A 2HZGA 1I8JA 5D9NA 5C5YA 5M17A 3UZJA 1JDCA 1KGWA 1J0JA 4HPJA 3T0CA 4DEFA 4JD4A 1REQB 3WDIA 4H9ZA 5CZKA 1GG1A 2PZNA 1HXJA 1IT7A 2DY3A 2Y0FA 3T08A 2W4XA 3PZIA 1Q6RA 2XIMA 1F4AA 3WQEA 4A2RA 4A21A 1XH2A 2A2IA 1J0ZA 2WQPA 1KKRA 2E9MA 1XV8A 3CAWA 4DF0A 4FNUA 3CS2A 3R8RA 4PSRA 1XWYA 2EKCA 3VKDA 1P1MA 3R13A 5FACA 4HYWA 1EIBA 3C2OA 4LPCA 1KB3A 4C6QA 1TV4A 3K2GA 3SUVA 2VD9A 1Z9AA 3RX3A 1TZZA 1S1PA 1XLLA 1EO5A 1XX1A 2BGQA 1AJ2A 2X05A 2J47A 4OIFA 3PWGA 1XLAA 2DZVA 2HSAA 2FGLA 1IT8A 2Z24A 1E40A 1JUEA 4A8NA 4PB4A 3SADA 2GDVA 2DZSA 5I0DA 2FGZA 3GO2A 4UCGA 3EWUA 4GUHA 4MMWA 4B9ZA 2J88A 2QV5A 1OX4A 3IJDA 2ZRXA 2ZICA 3UGRA 1VCGA 2QPXA 3N2XA 4KIEA 2O0TA 3F5KA 1M3UA 5GVJA 1EZ2A 4C7FA 3PS7A 2XIOA 1E0VA 3KOZA 3R10A 1OFDA 3N4FA 3VILA 4GMEA 3PSWA 1UWTA 3W82A 2Z25A 5I07A 4JBRA 4IFKB 4MWAB 5HWMA 3BTNA 1X1ZA 3G5EA 4X22A 4NX5A 4WJEA 3DFHA 2BFGA 2PTDA 4IQJA 2HMCA 1XLDA 3L4UA 1EXBA 5HUOA 4DI9A 4MVAA 4NSBA 4EF9A 2PWFA 2WSQA 1QK2A 4GVFA 5DFAA 3VX1A 4XSMA 2Y8UA 3SCSA 1N2VA 3T7VA 2R1LA 2CETA 1TMHA 3N18A 1PTAA 5DLCA 1E5JA 4ACZB 4JTRA 4PFMA 3B03A 3VVGA 3F2BA 2J6XA 2PGFA 3KS6A 1EYEA 1OT1A 1B1YA 1V4YA 1TREA 2H9AB 4PODA 1GW9A 2OZ3A 2D73A 5E93A 1XDJA 3OZOA 4Q4MA 4AG0A 4NXSA 5C71A 4GI4A 3GU2A 3W72A 3IK4A 1GZJA 1Q6LA 3M0HA 1NFPA 2WZIA 4OBSA 3W7MA 2TODA 4PMDA 4TU1A 4HP5A 3F2CA 4S3JA 3KP0A 5TBOA 4AD1A 4JQ3A 4Y8FA 1KQYA 3LERA 5HNRA 1MO0A 1Y5VA 3EKZA 3N9RA 3PTKA 3NL3A 3BLDA 3TKFA 5TD4A 5LIYX 1A0EA 5A2AA 3LPFA 4J2MA 1FWIC 6CGTA 1EC9A 2QMKA 5CJ5A 1OF8A 5D03A 4I90A 1XIIA 4CLMA 4QP0A 2JEQA 4GWEA 1UWQA 3QW3A 4HKPA 4NI8A 1QPQA 3ZM8A 1T40A 4XX6A 3DI0A 3AI0A 3V0TA 3W1TA 1U5VA 4HHPA 3VMNA 2VGBA 1E43A 5C9WA 1U1HA 4UQ9A 3CWHA 4BEUA 1FFRA 2RH9A 4E8CA 3MUCA 4HMDA 3V1HA 2QULA 2GQ3A 4KFNA 1XQKA 5HAOA 3IACA 9RUBA 4DBUA 4JGDA 1KFJA 1UH3A 2C0HA 3TUUA 3AUJA 3CO4A 1TUXA 4XAPA 1PHWA 3DYPA 3TNOA 4DBDA 4DLMA 4NXKA 5FF7A 2BG5A 3GU9A 5REQA 3SRKA 1ME9A 3QR1A 1QI3A 4X9YA 3RPMA 2D69A 3TU9A 2XSAA 4O1EA 2Z1SA 4D6EA 4AF0A 3J7HA 3UWEA 3KUMA 3W7QA 1R3TA 1B3YA 4TIMA 4UQEA 3VC6A 2BOGX 1H63A 4WKFA 3D0CA 1RY0A 3ONBA 3CUIA 2OELA 1UWIA 4UTWA 4UB9A 3WDJA 2CXGA 3VPLA 1KD0A 5C6MA 1CGTA 3R8GA 3DFSA 3ARVA 4ZE5A 1XYZA 2RDXA 3COTA 4CNTA 2PC4A 3N04A 4H6EA 1TVPA 4XAFA 5E70A 3E0FA 2V5CA 4XB3A 1DHKA 2BHUA 3BMVA 3GVGA 4O1CA 3USBA 3S4TA 2VFGA 4PBGA 3ZR5A 3KAOA 3PZVA 2NQZA 4AVNA 1PKYA 3NPXA 4PBEA 3RF9A 3FHAA 2HE5A 5CJMA 1FHUA 3SCRA 2ZX9A 3B97A 3QV8A 3UCCA 4F4RA 4B5SA 1XCWA 1HUVA 1VBHA 1VCVA 4KEUA 4WRHA 3L0NA 3DG7A 1DQWA 7ODCA 5DF0A 1O7AA 2R1NA 2C8NA 3VD3A 2OEKA 2PB1A 3GB6A 2FFIA 2PDHA 2YXGA 1FWCC 3M0IA 3WN6A 4DJDA 2BOFX 3GFXA 1N8WA 3BJTA 4JTAA 1BRLB 1MUMA 3ARYA 3WYZA 4XG1A 3IPWA 4POCA 4IL0A 1ITCA 4DBSA 4GQBA 4O53A 3JZUA 5G2HA 3G6MA 3SCOA 4US5A 1B4KA 2FYMA 3ZWTA 4C6MA 3KBWA 2PTXA 3MP5A 2PFHA 1RY8A 3OW1A 1WXYA 2WVVB 1QO5A 4DUXA 5ECUA 4K7VA 1ELSA 3DG6A 2ACSA 2XSBA 2VX6A 4GXMA 5HJLA 2Y61A 1EIXA 1OGSA 4KCTA 3NGFA 2XGBA 3QGKC 2EG7A 4TV5A 5D37A 2A85A 3ZVIA 1EB3A 4O1FA 3W3OA 1QO2A 3T0DA 4P61A 4A8IA 3W29A 4C6IA 1SSDA 3UZ5A 5CGMA 1E0WA 1YBQB 4HA3A 4JIRA 2ISWA 3WSUA 1UZ1A 1NFGA 4GFIA 3R58A 4DUOA 1NDYA 1S2VA 3MU7A 3SI9A 4F0HA 4Z1CA 4HN8A 3U9IA 4EAYA 1R3RA 3TSDA 2GFTA 2CHOA 4MOZA 2EQDA 4MHBA 2J78A 4Y9NA 3S42A 3T78A 3SBFA 1R9YA 3W7CA 3VTRA 3IGHX 2G3JA 4JL1A 3WH9A 1AMKA 1LQ0A 1JL8A 3H7UA 5MKGA 1N82A 3TE9A 2E5CA 1JZ2A 4HGXA 4ZB5A 4KRTA 2FJKA 4O4VA 3O63A 3TDFA 4RE3A 1GYLA 1TO3A 1KV5A 3S9YA 1DQXA 3P81A 4QAIA 2YBUA 3OGSA 4PL1A 1JNEA 1XW8A 3H22A 4UCFA 4KEVA 1DYSA 3SFKA 4O15A 1YDVA 4CD5A 1OIMA 4J3XA 1OYAA 4ZB0A 5L9FA 1SZNA 2Q09A 3QC3A 4MLRA 3M64A 4UQDA 5I79A 4XZNX 5I3JA 2BVWA 1H62A 2A3HA 1MMFA 3SJ3A 3C2RA 1P4CA 1BXCA 2WVUA 4UTJA 3UJSA 4BQ5A 5D05A 3W76A 3WBXA 1YIXA 2JALA 3GTNA 1E6XM 3NDOA 5DN1A 2OLAA 5CLTA 4DXKA 1HKVA 4N4PA 2WXDM 5D2WA 1KRCC 4FXFA 5IDIA 2WJDA 2GZXA 2QJNA 1ZAHA 2X7WA 3UG5A 4O16A 4F79A 5BRQA 2ISSA 4V1XA 3BAJA 2NW0A 1ZP4A 2A3EA 3NYDA 1PB0A 4MAVA 3RCNA 1A5KC 4OT7A 1S5MA 1VP5A 4LUIA 4HPXA 3F2DA 2EHHA 1QU4A 1Y5XA 4MDOA 1TSIA 4JN8A 5G1MA 3MO7A 1R9ZA 1HN1A 4GIAA 1FXQA 1UIOA 4ERAA 5E6ZA 1H50A 1PIFA 4OBTA 2IPWA 1S2CA 4HMCA 1OGGA 3CC1A 3MB9A 3PAJA 5CPQA 3UT0A 5FA5A 3QN3A 2C6QA 1WDDA 2PURA 2XH7A 1K9TA 1ZBVA 3HTWA 1R3SA 1ECQA 3UXKA 2BXYA 3F4NA 3QHOA 3UR8A 3FJNA 4IPPA 1KWGA 1PZ2A 4QRNA 4IMGA 4K1WA 4DZHA 1QPKA 2QF7A 3OIHA 1FP9A 5C70A 1S3TC 5JH1A 1L0PA 1JDDA 2V3DA 1L2QA 5JIPA 4WZHA 3EZ4A 1IGWA 3BSMA 3NM1A 3UW6A 2DJLA 2Y8KA 3NA8A 1ZU8A 4FIQA 1JZ8A 2X42A 5F4XA 4XZIA 2J8FA 3IJ9A 4C1KA 1ZAIA 3QY7A 1BPLB 3CASA 1HIZA 2E77A 3R0DA 2DSKA 3NQBA 2P50A 2CESA 2WOQA 1CTNA 3WNKA 3M5XA 4ZXLA 3I6EA 3AQUA 4I7UA 4YTQA 2UY3A 3S1UA 3ZLHA 3TYUA 1ENUA 2ZRUA 1W3TA 3AJ7A 3LK6A 2AOSA 4DJFC 2VZUA 4F66A 2OXNA 5DT5A 3KTCA 4DWSA 2V5DA 1VBGA 5LNSA 1ZBKA 4RW3A 1JR1A 3O07A 2GVJA 4PTXA 1XSJA 3LCIA 1UZHA 1RJRA 2OX4A 1OK4A 1D3HA 1NOUA 3DOPA 2W6RA 2NLIA 1VZWA 1W3KA 2FIQA 3NQDA 3W1NA 5E0CA 4ZQMA 4DRSA 4PUUA 5KITA 6TIMA 1CB2A 3KLKA 1HO1A 3QLLA 4LYRA 3U7VA 1MUWA 1VIWA 3MHUA 1FWSA 3CL6A 5E5CA 3PNUA 4FPSA 1KC7A 4GQ0A 3A3WA 2FB2A 3GH7A 1Q65A 4KCVA 1UZDA 4QJ4B 1OG6A 1P7TA 1V6XA 1OD8A 3RJXA 5BYWA 1R3QA 4D1IA 1DJQA 3TLLA 2JF7A 1BGAA 4HPNA 4AZIA 2RGMA 4RZ5A 2VEKA 3M46A 5LKYA 4NZ1A 5KETA 2POZA 4CCZA 3MSRA 1YNPA 2ALDA 1KFEA 3GFYA 1VYSX 2C19A 2NVCA 3AXHA 3MBFA 2HRWA 3P2VA 2VEGA 1KWKA 4MADA 3AYTA 1ZHAA 4LTSA 4NU7A 4XUYA 1I1XA 4Q33A 3MKKA 1UKTA 3IGXA 1XG3A 3B06A 4F2UA 1LRNA 3M0XA 1EOKA 3LCLA 4OECA 3EXSA 3CAVA 1Z3NA 5AHIA 3N73A 3ONCA 1IWAA 5KEZA 4JX6A 2X2GA 1W9VA 2PGRA 3UU0A 4M6QA 6XIMA 3HG2A 2PDNA 3TTYA 1JPDX 2VC7A 4HZ8A 2P0IA 1N8IA 3CHDA 4G7EA 1YDNA 3NJ3A 4XD6A 1ZALA 5DEZA 2XTKA 2A5HA 1B0IA 5BOEA 1NTHA 3ARWA 2XIJA 3SN1A 4GVIA 5J5RA 4PCFA 3S2LA 1VYPX 5GQBA 1KM0A 3HPZA 2POTA 2Z6IA 2B0MA 1WQ5A 4IZGA 4P7RA 5HUPA 1TPEA 4EPBC 3UYIA 4R3UA 3XIMA 1KRAC 3W1MA 4BEQA 4ZL1A 3FGCA 4RDVA 5IHSA 1KLZA 3KBMA 4JTJA 7XIMA 2TYSA 4JTFA 1NOWA 3AALA 1D9EA 4P5UA 1GOOA 3LD5A 3ZWSA 1XYFA 3M0KA 4GC4A 3WMLA 3EB3A 2BHZA 1DQUA 5CC6A 1KFCA 2DZAA 3CL8A 1YDYA 1GEHA 2V2DA 3ZVHB 4PMNA 2AAAA 4H83A 3CJPA 1IT0A 4QQUA 4JNMA 2E5DA 4KEMA 3V75A 4KW2A 1UD3A 2YCLB 3OA5A 4BF5A 2Z00A 4AUBA 4IFOA 3ALGA 3VAVA 4FF5A 3L9CA 2F9RA 2PDPA 1XFBA 3OHMB 5ABHA 2EJ1A 2UY5A 4DF2A 2ZZ3A 1XSIA 4ZR8A 3WBYA 2OO0A 2ALRA 3LNPA 1J6OA 4ZO6A 4LB3A 2AKMA 5IRPA 4HPHA 3VCRA 4K38A 4ICCX 4DBEA 2DZTA 2WQDA 3IJIA 3A3XA 4X2RA 4GGBA 3BG9A 3LPGA 1HJUA 3TLQA 1WYIA 4M80A 1FWFC 1M53A 2VYOA 3H7RA 3CQJA 4NZ4A 1GVIA 4E2OA 3SN4A 4D71A 1FHDA 1ADSA 5JMUA 4M51A 4ZE4A 5I3HA 1EDGA 3B9AA 3OLIA 2PMQA 2C1IA 1SZFA 4W8LA 3M7SA 4GBUA 4XO6A 4RCXA 5EPDA 4RL3A 1QOPA 4H9YA 4KWOA 1K3UA 1P0BA 3RNDA 5AVHA 1FWHC 5A6TC 2Z7GA 1QWKA 3U2ZA 2CLOA 1TV5A 5AECA 3A4XA 3WK1A 2V63A 2C7FA 4MF4A 4HD5A 4JICA 1HO4A 2R9RA 2CLEA 3VIPA 4OZOA 3I3EA 4TO8A 1GOQA 1Q7ZA 4UTMA 2PTYA 1PX8A 4FX8A 4LV9A 2DQXA 3P6LA 3EB4A 4HU4A 1SSGA 5CSSA 1Q13A 1RBLA 4DB7A 4NYYA 3FEMA 3VD5A 3IJ7A 4EXQA 2FKPA 3L23A 1SZRA 2QS8A 3UZWA 3T4CA 1OFEA 3NO1A 2PDYA 4E4UA 4U10A 2ZRZA 4ORIA 3W85A 1R8LA 5DBTA 2VEPA 4ZB2A 3LCFA 3QQ1A 2PS2A 1GVFA 2Z1BA 4TMCA 7REQA 1LZOA 1LL4A 2X1IA 1GOMA 1KCXA 1PIIA 2J27A 2R6OA 3WLHA 2A7NA 3VIGA 4WD0A 3DHFA 3CLWA 3OQ8A 1VBRA 3G18A 2QQ6A 4GNJA 2DH2A 4JIEA 3NUKA 4WK9A 1XGDA 5LNVA 4IQEA 3DESA 2PWHA 4GOAA 1QNSA 1Q4NX 4CQ8A 4GZEA 3TW9A 2HVMA 3LU2A 1HJXA 3AIQA 3QBUA 2WC3A 2NQLA 2O9RA 4WCJA 3ENLA 4L1GA 3NSNA 3M4HA 2B4GA 4RDWA 1HKJA 4MJMA 1S5TA 2ZZ2A 4Z2JA 2CERA 2WWDA 2Y7FA 2YBVA 1E4MM 4P8WA 1WDSA 4R7WA 5LA0A 3UG3A 3IJQA 2VVNA 4H9TA 3I3DA 2WWCA 2GVYA 4UTFA 3P80A 4I7VA 5C2XA 3A6OA 4QHRA 4M6UA 3GIQA 4I9MA 3LHUA 1V6VA 4AXNA 3BCJA 2WANA 1HZYA 3B4YA 3W7NA 3GG0A 4DZ5A 4OU1A 3TN3A 4XBSA 4UFHA 3GK0A 4EOUA 4Q4PA 3TW6A 2WMIB 4JTDA 4KWWA 4XZHA 2R1PA 2PCQA 3AU2A 1TRIA 3N9KA 1GVYA 4XD5A 4TX9A 1G69A 3ANYA 3QXBA 4LS2A 4JIHA 1V02E 2PP3A 2E67A 1I60A 3BLEA 4J3VA 1W2VA 4PMZA 3GXTA 4GISA 1CEOA 5DANA 3TYZA 6REQB 4IIDA 3TQVA 1UQYA 2G50A 1HGWA 2TSYA 3GDBA 3QZEA 5EGRA 1UB3A 3ITGA 5KTLA 3TSMA 4I9AA 4TXEA 4GIRA 1F3TA 1G4PA 1OYCA 4A8LA 3OB8A 4JS3A 2FJUB 3W2JA 2ZRVA 4PRRA 1US0A 1DWJM 3GW3A 2FH6A 3VOGA 3OIXA 4R5EA 3VMPA 5F2IA 1UP0A 1AG1O 4JYFA 2QCLA 5CGTA 3WD3A 5BU9A 3KBVA 1DTUA 1CGWA 4QTGA 1WP6A 3M41A 1FWTA 1XPGA 4UMBA 1H1ZA 4C6KA 1ZJHA 2BOEX 3S5OA 4BCEA 3KM8A 3E1F1 4Y90A 3A12A 3FV9A 3VI2A 1SM9A 1P6BA 4IFKA 3W7GA 1W5PA 4LBRA 2YGYA 4UTUA 2QMJA 1XCFA 1OFQA 1BQGA 4H4IA 3U2EA 4HZ7A 2QJHA 4FOUA 3SGZA 3S2JA 5A6MA 4H7CA 4JTCA 4GUFA 1K6AA 1XG4A 3E9AA 2Z7KA 4L7ZA 3LHVA 3KZSA 4CGTA 2QNEA 5J5DA 1IEXA 1U1JA 4UWMA 3UNDA 4ACZA 3ZJ8A 2Y63A 1EJSC 3SB0A 2QPSA 4P7LA 1VHCA 1OZQA 3KOYA 1LL6A 1DWAM 1WOBA 4V15A 2H9AA 3C2FA 3VOHA 1S2TA 2VR5A 3NDYA 3MV01 4Y9AA 3WQPA 2NX9A 1VCFA 3DZ1A 1KGUA 3EWCA 1EHNA 3MSDA 4IIHA 4OUIA 4NY2A 2QAFA 1VGAA 2XWDA 2Z2AA 1E6NA 1W91A 3NXLA 3BH4A 1Y8BA 3DXIA 2PBOA 3CYVA 1BD0A 3WELA 4O0ZA 4YWIA 2C91A 2Z1VA 3DBPA 1TX2A 4LVAA 2ZZ7A 3NZQA 4AVOA 1DOSA 4CU8A 3T8QA 4LUSB 4JX4A 1IIHA 4HK6A 3MSGA 2J6VA 4Q8WA 1XICA 1IF2A 4CNOA 1YTDA 3L68A 1QPRA 3EWBX 7TIMA 8CGTA 3EMQA 3T4WA 4HSHA 1YTEA 5JUVA 4N9EA 2R1MA 2NWRA 1XXXA 1H7OA 5DY2A 1KBIA 3WBEA 2PTZA 3XINA 4NJIA 4A3RA 1W9XA 3EKLA 1OFAA 4HHHA 4AHPA 2C13A 1F6PA 4K37A 3DH7A 4PB3A 2XFWA 3CTTA 1Q6GA 3FVMA 5C9XA 2X1TA 2Y70A 3WEMA 5HNNA 2PDGA 3WQVA 1NVMA 1TA3B 4PCTA 2WZTA 4Z42C 3ZR6A 4ROQA 1MI3A 2WC4A 1BGGA 2JFEX 3REQA 4HU8A 1EF3A 3S5NA 3NQAA 1W9PA 3ZOAA 3WJYA 2J9XA 2PGEA 1Z7AA 2ZQ0A 5AYXA 4K2SA 4JX5A 4OBRA 3W87A 3R25A 2A0NA 1OJXA 1FDYA 3H7VA 2O9OA 3IJ6A 4MY1A 3PZUA 8XIAA 3AXKA 3DECA 2CLKA 3NVTA 2O9PA 4M7TA 3CMFA 2OX1A 1P0DA 4Z2IA 3CB3A 4RE0A 3BO9A 3W2MA 1E4IA 3LSCA 1J2BA 1KR0A 4MKNA 2ACRA 2KX9A 1OFRA 2HK0A 4L1WA 3LCXA 1UD6A 1YLVA 5FIPA 1N55A 1KXVA 1UKPA 3OHIA 4DJFD 1GNXA 1YXCA 1LOLA 2ZRWA 3LM7A 1V3HA 1J4EA 2HVNA 1W3JA 1JDFA 1R2RA 1QPNA 1V7YA 1QCWA 3TW7A 1MQPA 1XH0A 3VNLA 3PZMA 1PKLA 3TMQA 3LV5A 2VEIA 3A64A 1QHOA 1HW6A 3B04A 2PWEA 1UHVA 5AB3A 1KLYA 1X98A 3G3DA 2VR4A 3HV8A 3SZ8A 3LLXA 2FQIA 3QGAC 3BUVA 4NYUA 4BQ3A 4XBKA 3IEBA 2HJPA 3GXFA 4PTWA 2DW7A 3KBNA 1H49A 4OJYA 1V3LA 1GORA 3RR4A 3VNDA 2XYLA 4L9ZA 4GNVA 5A6AA 2ISFA 2BSLA 2ONEA 4WJXA 4XIMA 4HZMA 1ZY9A 1H3GA 1OX5A 3LXAA 1NQ6A 3MP4A 4F0MA 5HR6A 3EOSA 3V1PA 2HK1A 3W2LA 4IUGA 4JIIX 1CECA 3TAKA 4W89A 3TFCA 4XZMX 5I3KA 4MB5A 3T2PA 2MANA 1MEIA 4Q4KA 5DMLA 1JPMA 4YCOA 4PUKA 4Z0SA 2VP8A 1SW0A 1FP8A 2ZKMX 3LGEA 3EA3A 4U2YA 4XVEA 2PD5A 3CPGA 2GJNA 1EGVA 4LNCA 1EJ7L 3MW7A 2GJPA 2E1WA 4S39A 2Z1XA 2D2HA 1UR4A 4UBPC 2BVYA 3IIOA 2WVVA 3G1XA 3M9YA 5FD0A 5CLWA 3CUHA 3AZTA 3UP8A 3L5MA 3NGJA 2PU1A 3MZ2A 1C29A 3ZJKA 1VQTA 1K8CA 2GDQA 2NXGA 1RXOB 4GA8A 3QQWA 3CQ0A 1OX4B 2X41A 3UCQA 2VJXA 1J6PA 4ADTA 3GAKA 5BCAA 1MXGA 1F4HA 1AW5A 3PB0A 1MSSA 4L5ZA 1WDPA 2ZA3A 3POHA 1SUXA 1TE1A 3HM7A 5E0KA 4DQWA 2FZ9A 1V7AA 1XLFA 1CXHA 3H4XA 3UFYA 2ZUNA 4E2BA 2H8XA 2PDUA 1HKIA 3GQYA 2ZXAA 1I2NA 5GJNA 2HQAA 5I3DA 4I9JA 2VX7A 5GJMA 4LEQA 3STPA 1O68A 2QKFA 4XD4A 5BZAA 2I5GA 2DT3A 2B7NA 2I9EA 3WF0A 1XUZA 2C1HA 4JTEA 4AVFA 2FHCA 1LT7A 1ZQ5A 4NNBA 3QPYA 1XINA 1T99A 1XIDA 3MCOA 3W7RA 3QY6A 2Y85A 3KX6A 4IIFA 1I0DA 2J7BA 3VNYA 4QBXA 3MBDA 4A3UA 2DGAA 1FXPA 2J7DA 4A3QA 2XIQA 3KTXA 3KBJA 3KP1A 4FLQA 4JAWA 4AIBA 1FCUA 2GUUA 1A3WA 4LBSA 4DM1A 5CKSA 1JF5A 1BG4A 1AMYA 2IMRA 5E09A 2XVLA 1QHZA 3LBMA 1GQNA 3ABRA 4AZBA 3QV7A 2FGBA 3W37A 4RNJA 4AY7A 3WBWA 4BA0A 5AZ1A 1HP4A 3BXWA 3VDHA 4XVDA 1UBPC 3CZEA 4PMJA 3K8MA 4HMNA 3HIJA 2ZUSA 2H3BA 2OODA 2VFHA 3KCLA 3GYCA 3UJFA 3TH6A 2E25A 4BWLA 1VC4A 2CW6A 2PGWA 4LANA 3C2EA 4PUJA 3CU2A 1Q4WA 1OHLA 4WGXA 3HQNA 1E6RA 3N25A 4O1BA 4B2DD 1W3LA 1DE6A 1EJXC 2PWUA 3P8JA 4YN5A 3GX9A 4LVDA 3M6DA 1AW1A 3VNZA 3VGBA 3QR3A 3G77A 3BAYA 1GCYA 1X8FA 2ON3A 1FFQA 3QKZA 1CXFA 3NQGA 4MLJA 4R34A 4F0SA 3Q37A 3HG3A 1EOMA 3QV9A 3AZRA 1H7RA 3L4TA 3NEVA 3WLNA 3GNNA 2A6LA 2XN1A 3BV4A 2IQDA 1RVGA 4PMUA 2PLKA 3RX4A 3WDHA 1CXIA 4J35A 4G56A 1GZ1A 4PMOA 5JH2A 2NT0A 5EMYA 3Q65A 2P53A 1FDJA 4B92A 1UP3A 4JTUA 1DORA 4LALA 3AJXA 1H60A 4JZ5A 3H26A 2VX5A 3I6RA 3PY2A 1PUDA 3RFAA 2MNRA 5T91A 3JVAA 5D9PA 4FO4A 3VKJA 2XG9A 4J7RA 1A5MC 2FMOA 3G1RA 3FFSA 2LLEA 2AMXA 2X2YA 3MCNA 3UZYA 1MVYA 3IUIA 2Q8XA 2ZZ1A 2NUXA 1VIZA 4BHYA 3QH2A 1E70M 1M65A 3GDLA 1O5QA 3VE9A 5FEZA 3DHPA 1XISA 1UD4A 3CM4A 2MUCA 1AQHA 1HJWA 5BWAA 1UROA 3DIPA 3GG7A 4AFYA 1B3WA 2G96A 5IFTA 1LP6A 3AO0A 2GDUA 2J13A 2OWWA 3RPTA 3SCUA 4L6HA 5I24A 3WK0A 1F7BA 1AD1A 1DJZA 1E6SM 1QVBA 3MMWA 1NWTA 2YL6A 3IJ8A 1POJA 1LCOA 1XCXA 3WJWA 3ZR4A 1UMYA 5T9BG 2DT0A 3M7WA 3WF4A 4ZMGA 2IQ0A 1I0BA 4GH1A 1JNDA 1RP8A 4BJHA 3N19B 1WO2A 3RJYA 1R2TA 4U28A 3UY7A 3VKBA 1J18A 3FW6A 2HVOA 1QT1A 4TVCA 4LFYA 3RUBL 4KIRA 3BAXA 1EWEA 4DPPA 3O1NA 3C3UA 4MDPA 3N9SA 3WNNA 1TCMA 2WKJA 1WUEA 1UR9A 3ZJ7A 1SFTA 4EPKA 2I7GA 1GTHA 3U8GA 4AU0A 1LTDA 5CG7A 4UTWC 4DY1A 1D8WA 3DHUA 5A3HA 1XIFA 3RMJA 1J11A 2ODOA 1F76A 5AHFA 2D0GA 3ID7A 1EP3A 3QGVA 4H8VA 4CN1A 1LG1A 3UEQA 4LB4A 4S2CA 1UC4A 3INPA 4OV4A 1ICQA 4NZ5A 2ATMA 1U33A 1H09A 4GZJA 3RHGA 4I5XA 1KGXA 3VYLA 2QW5A 4C6NA 4MYAA 4J3WA 4IMDA 3DFYA 2BY0A 2DSVA 4EVZA 4F0RA 3W84A 3NQ2A 3WLLA 2G3FA 1PAMA 5D2XA 2GYIA 4Q7IA 3VOFA 3S5ZA 3ARUA 1UKSA 4S3EA 3T07A 2NX3A 1OSEA 4QE1A 2CITA 4K8EA 3QMRA 4W9TA 3GKAA 4DVOA 2Y88A 2E68A 3HO8A 4OUEA 5M03A 3WK3A 1X6NA 3WJZA 4ORMA 5D2VA 1CW2A 4ZOBA 2QJGA 4YL2A 4DJDC 3U5UA 3KL0A 3L2IA 3QRHA 4DPQA 4FALA 4R53A 1MEWA 1JZ3A 3NG3A 3GM8A 3L2MA 1K8XA 1TWZA 3LI0A 4CQCA 1U5JA 3A22A 3F5JA 4UFMA 1K7FA 5FJPA 2GGGA 3WD0A 5SWUA 5CZSA 3UJEA 3B8WA 4XAYA 1M1BA 3GC4A 3ECQA 3DENA 1BYAA 1F3WA 4O11A 3RITA 4C6LA 1WNOA 5LIKX 3W2UA 1NWUA 2Z4GA 3QVQA 5MKGB 1CB7B 1Q6QA 4BR1A 3BW4A 3DGBA 3E38A 3E2QA 3P5ZA 3UPBA 4O1DA 2VDHA 3P0WA 5ABTA 1US2A 5F2LA 1OIFA 5A8GA 2GWNA 1Y65A 3T0BA 3AIBA 4Y2WA 3EBVA 1HJVA 3CHEA 3VD4A 4CNPA 2J7CA 3STFA 4E0CA 3S5YA 1AH0A 1BWVA 4J27A 3IS4A 2WPGA 5D04C 4GI8A 3IUDA 5B7YA 3NFUA 3NR0A 4HOWA 4TUFA 1GHRA 3NOYA 4K36A 1KFLA 3ZVHA 3DERA 1KQZA 1QW9A 5FJJA 7PTDA 4CQ9A 5EY5A 1J79A 1B3OA 5H2ZA 3DCPA 1I1WA 3TWBA 1Z44A 4L80A 3IAPA 1XD1A 3E12A 4LYPA 1RK6A 4Q6JA 3FJ6A 4BK9A 3LHYA 1C9DA 4NJKA 4O13A 4IUOA 4C5YA 3AMCA 1LDCA 3ANUA 3N6HA 1G4SA 3L66A 5DY3A 4XAZA 2WV8A 4ZXOA 7A3HA 1S5VA 4GD0A 1S38A 4UNKA 1PCKA 3TROA 5IM51 1B9ZA 1TIWA 1TJ0A 1H7NA 5E1QA 2BVTA 2QIIA 2VXNA 4B5UA 3RU8X 4LCRA 4C6DA 2ZUTA 1XFCA 9XIMA 4A35A 3OODA 5KZMA 4GGHA 3BLLA 4DZAA 1CNVA 1E55A 3F4VA 4JEJA 1W32A 3V5CA 1PDYA 1GGOA 3AXXA 2BS9A 2EAWA 1ZRQA 1AJ0A 2ACQA 4GYFA 5BNKA 1RPXA 3CUJA 1EUNA 3FHQA 3JR2A 4HTYA 1TTPA 1P0KA 4FLOA 1G6CA 3DUGA 1DWHM 4MY8A 2C14A 4F40A 3SSZA 3SQSA 3DFNA 3KVKA 1DPMA 2HDJA 4JQ2A 2CKRA 5AYBA 5AVNA 2Q3RA 2GK1B 1HKMA 4NF7A 2OZTA 2GUBA 2B7QA 1Q6OA 3B3DA 4Y8EA 3AIUA 3OBAA 1UWUA 1RALA 4JTKA 3PJUA 4XV0A 1WAUA 3KEHA 3EXTA 4ZOAA 4AMAA 3CK5A 1VFHA 1I2PA 3QMSA 2G4JA 4GO9A 3QSRA 5AC6A 5BROA 2NV9A 1BAGA 3T2QA 2C18A 3XISA 3PBWA 2VOTA 1AFSA 1GYNA 5D2YA 3VFCA 4ZEPA 3PZQA 3KHDA 4HB7A 5D4YA 1LF1A 3E02A 1LQAA 1WZKA 5AZ0A 4ZCWA 5FAJA 1TR9A 1WDWA 5K2ZA 3KRUA 1TZ7A 1S1RA 3WD1A 4DWSB 1T5AA 4OWGA 2UV8G 1J0IA 3ZZ1A 3DX5A 5CSYA 1JPKA 4WEVX 3D6NA 3L0GA 3MI3A 3MUXA 2XN0A 7TAAA 2Z27A 4UOQA 2PAJA 3BWWA 3VGGA 3W1PA 2JKAA 3PTMA 3P67A 1IXNA 1ZGDA 2WSYA 3B0YA 2CLPA 4BI5A 3IVSA 1KFBA 2OO6A 4AWSA 1UKQA 4MNJA 2EEXA 3OG3A 1U1UA 1QOXA 3CUZA 2E9BA 4MNMA 5LYRA 1C8QA 3IJLA 3O0KA 3P93A 4QE5A 3KRBA 3E6EA 3KOXA 1R3VA 4BKNA 4URIA 5A8OA 3F03K 2XIIA 3CUFA 4QG9A 3BZJA 3O3RA 1MDLA 2FZDA 3FLUA 2FVMA 4RJEA 3W24A 1W1TA 3F5LA 3DU0A 2XFYA 4W85A 5HMEA 1J0HA 1OX6A 4LUTB 5CAKA 1FWEC 2RKXA 3FX4A 2J79A 3GDKA 3BOLA 3QHNA 4M56A 1KXTA 1LLOA 1JI1A 4Z1YA 4NX0A 5LXEA 5I7GA 3VOJA 7CGTA 3EPNA 4FXRA 3P14A 1FWRA 2PDLA 1BWKA 4UZUA 2WMIA 4H04A 5HINA 4WY0F 2P76A 4GO8A 3BJSA 4CCCA 3WD2A 2DFAA 3LG3A 4GIYA 2TPSA 1IXPA 3VIHA 5FJOA 1QFEA 1KTCA 2Y5JA 1W9DM 3MUAA 4S1FA 2XH4A 4ICNA 3NZGA 4HIBA 1DIKA 3IAQA 3MS8A 4X63A 2GQ9A 2PC8A 4PUEA 1Q63A 3I4EA 3K4WA 3IUHA 4YTUA 3SIZA 2BZNA 1Z89A 3L21A 1EC7A 3B8IA 1Z8AA 3KFTA 4KWUA 4HA0A 2VDGA 3ITLA 5AKQA 3CO8A 5I5RA 2Y4SA 4MY9A 1F8MA 2OZ8A 4YS1A 3RM4A 3TOYA 4G7EB 3GH4A 1OCQA 4LQ1A 2BGNE 3NQVA 4GI6A 2XWEA 3B0UX 1SQ7A 3GFZA 4JFVA 1BYCA 3TWAA 6A3HA 3N4EA 1GKRA 3NPVA 3DFOA 3M43A 3RN6A 3VNIA 1ISZA 4DELA 4CKQA 2WKLA 3ZJ6A 5TF0A 4HPGA 3T40A 1NJJA 1H0GA 4JEQA 2ZUVA 3LB0A 3FGCB 4E2VA 2HPIA 2WHMA 2IS7A 5ECVA 1K77A 1AQ0A 1GTEA 1VFSA 5I3FA 1NDVA 3FAXA 2R1KA 1V08A 3TEVA 3BQ5A 2F38A 4FZIA 4KPLA 1ZPTA 3AIVA 5KINA 3ERPA 1XYCA 1ZJIA 2WKGA 2BWGA 3AMDA 3JU2A 3QW4B 1QK0A 1Q2SA 2CLMA 5FSEC 2CWXA 2OLHA 3H2OA 1PDZA 1Q8JA 3URBA 4QEEA 3T0AA 4GUJA 4D72A 1M04A 3GW0A 3O16A 5EBAA 3CZLA 4KFPA 3VCCA 3BCDA 3LQLA 1MQQA 4QCFA 3W74A 2PP1A 2PSNA 3W1LA 1TG7A 4O12A 2X0HA 5DRCA 3B0XA 3B8UA 1FWBC 1RPKA 5PTDA 4YTRA 1S2WA 4C1NB 2NSXA 3EDFA 3K8KA 3WLOA 4UQAA 5LIWX 2DVUA 4AH7A 4IPJA 4UQBA 1FWNA 1V93A 1X6LA 2FZ8A 4PTNA 2WMKA 5XIAA 2G5WA 5DELA 3MC5A 3VDCA 5F1UA 2WHLA 3WD4A 1PWMA 1FX6A 2PWVA 2JE8A 5HQLA 2NZLA 1RA0A 1KFKA 3N2MA 1NF7A 1WDRA 3LPPA 4JKMA 2OGJA 1GOWA 1JQXA 4EE9A 3CT2A 3D5HA 4GX8A 3EDEA 4UZSA 2Z1WA 4EF8A 3ITTA 1V77A 1PO9A 4AW7A 3ZFHA 3EMZA 2YW4A 4S38A 4QX4A 2OMAA 1Q7MA 4MWAE 3EAUA 4W7WA 4J1OA 1WE5A 2YL9A 1EEPA 3CQHA 1X6UA 4G1KA 2G37A 3R94A 4G6CA 2C1GA 3BGAA 3WUFA 5A6BD 4NZFA 2AGTA 4UTTA 1JVNA 2X16A 1BTCA 3URQA 1YW1A 4DI8A 2V6AA 1RQEA 2WMJA 1TMLA 4PEEA 1MQRA 1G7VA 1O4UA 4XBJA 4H1ZA 2VWTA 1E1CA 4YNGA 1BSIA 3SRHA 3A13A 4YYCA 2QLYA 4EK7A 2VM8A 4O57A 2AAMA 3TCEA 1UH2A 4ZO8A 1MRAA 3EWYA 4AD5A 1E0XA 4LV4A 3IVUA 1YNQA 4Q3MA 1E51A 2V3FA 3VDAA 4IJRA 1OZMA 1HG3A 5A8MA 5C9ZA 2GJXB 3S9ZA 1TMQA 7REQB 3G22A 4RNFA 4QNWA 4HA1A 4B3LA 2EPKX 3M16A 1J96A 3MYOA 1R6WA 8RUCA 5HWNA 3G1DA 3KCOA 4IMCA 4HNUA 1H7PA 1IV8A 4X61A 1PIGA 2VCAA 3OGRA 3F7JA 3HV9A 2XGIA 1GEQA 4OOUA 5IBXC 2PCEA 1HVQA 1WV2A 1TQJA 2HNHA 1E5NA 2Y62A 1UYQA 1TPH1 5AY7A 3S46A 4UC5A 4LF2A 1F74A 3ABOA 1QNQA 3BLIA 3E3HA 3U7BA 5KZDA 3IGSA 4ZVJA 3GIYA 3YPIA 1DJGA 5E6YA 5CC7A 1Q85A 1M01A 3G8RA 4M82A 4Y6GA 3CGTA 4Q4SA 3VOCA 4JQAA 1QASA 3UD6A 1QI0A 3OVGA 1KCZA 1T6MA 5HULA 1IZKA 1MZHA 3BCFA 4F9JA 4XISA 4IG2B 3LYEA 2JIEA 3NNTA 4IPLA 1XLBA 1LWIA 4C6BA 1UG6A 4PMVA 4JFUA 4J3UA 2QPUA 4M6VA 4NZCA 2VT0A 2I1OA 3GC2A 4CD8A 2BTMA 3WQDA 1F8IA 4RXFA 3N3MA 3W02A 4F0LA 4AZ5A 4DJED 4HN4A 3CAKA 1KNWA 2BY1A 3Q4DA 1PTDA 2WBGA 3BGGA 4JY9A 3POCA 1JFXA 1X8CA 3CXOA 3WO8A 2X0SA 2IKHA 3GTIA 2VMFA 2PE4A 1H41A 3HPFA 1PVNA 3O15A 4KERA 1VJSA 2QHAA 4PMYA 3AC0A 3N2TA 1VLWA 1YXYA 1ZJBA 4WF7A 4GLEA 1BVZA 1LRTA 3C5QA 3CWOX 4HCLA 1PJ9A 3BMWA 4LXFA 2P1FA 4H2CA 3HGOA 1OFPA 4LY8A 2GQAA 3U57A 3BANA 5L6UA 3SCQA 3WLJA 4CD6A 1EF2A 1VEPA 4HCDA 4M19A 4A4AA 4YXGA 4JNZA 2XGZA 4ZODA 1YYAA 4YWSA 3IANA 1AQFA 3ABZA 3GZ3A 1E56A 1THFD 1HT6A 2XVPA 3ME3A 1OM0A 1GOIA 3ZLFA 3CIXA 4F3HA 3PUGA 1UBSA 4MM1A 3N29A 5D2TA 1BFNA 1A5BA 2PDCA 2QGYA 2ABBA 1EDTA 3PPCA 3FYOA 1F5ZA 3GNOA 1ME8A 4N4QA 1W5QA 3WG6A 5BXTA 3L5LA 2ADAA 1R5YA 3IVTA 1SJAA 3VIMA 2VQTA 3P0XA 4K7YA 5AOUA 2UY4A 3IV3A 2XU2A 4JKKA 1GT8A 2PP0A 4J40A 2GJRA 4ACYA 2CHNA 1D7KA 4NAEA 5JU6A 3HQOA 2PF0A 2FVLA 4LS1A 3TTSA 4PUNA 5DBUA 5FAGA 1HNYA 2CHRA 4D2JA 2BGSA 3W25A 4ZA0A 1E6QM 3NSXA 3W9ZA 2V68A 4ZQPA 4WQ6A 4QLJA 1JCNA 4DJFA 2YJQA 1VRDA 4UOZA 1D2KA 3PANA 3WBAA 1JF6A 4AHOA 2FPTA 2XPKA 3WLRA 1OFOA 4AEEA 2B7OA 1E1FA 1MEHA 2ZWYA 2YA0A 2PD9A 4RNIA 4GC3A 2NV1A 4IX0A 2REQA 1H0IA 3A24A 2YDRA 3MT1A 2CLFA 3U5YA 4C6EA 4GZ7A 4MWAC 1GUVA 2B31A 2D2OA 4G1NA 1V0MA 1GONA 3VIFA 3WX7A 1EEXA 1Y7VA 1G0CA 2VOMA 4A3YA 2BBFA 2A3AA 2D24A 3P62A 4DX3A 4PEKA 2E5BA 1I4NA 1AL8A 2WLZA 4WDTA 1M68A 1P0NA 4WKAA 1W3NA 1YRRA 1J0YA 3D3FA 5KZEA 3AICA 4E2DA 3G1HA 3L4VA 3L4WA 2AKZA 3W1QA 4B5NA 5T8GA 4X0VA 4MUZA 4AIUA 3DG3A 4DZIA 2GJLA 1CENA 2ZE0A 4M24A 4G2DA 3IARA 1UR1A 3K30A 4G5DA 1JQVA 7ENLA 3M6YA 3GYEA 3LGGA 3OZMA 4CD4A 4FAMA 4J5NA 2CKSA 2E40A 1FUYA 3EPOA 3REQB 5HOSA 3FSTA 2YLLA 3ARTA 4YU1A 1T96A 3W7OA 1U30A 3V5OA 2FH8A 4Y7EA 1TRDA 1VJZA 1S3HA 5H91A 2YIHA 1VFMA 1K9EA 6ALDA 3TX9A 1OCNA 4AIOA 3VXGA 1WKYA 4WKHA 3NL5A 3SO7A 1PWLA 3S1XA 2NUYA 3K1DA 3LM3A 4R33A 3WQ8A 3VKKA 1PPIA 4JTQA 3CWNA 4GE8A 4XZ9A 3OU8A 5BXPA 3KVMA 1SYTA 3MVIA 4C5ZA 3RG6A 4XZBA 4Z2GA 5IHRA 4GI9A 4B91A 3AIRA 3ES8A 3PP7A 1GW1A 1QPOA 5AYIA 4PBFA 1R38A 1W8GA 1AZ1A 2Z6JA 4GY7A 2I5IA 2JEPA 3U3HA 1Z6KA 4A3HA 2ZOXA 3KLLA 1RCOB 5JVLA 4H7VA 4NIRA 3E49A 3MJMA 3WF1A 1H5VA 1QW8A 2ACUA 4Z17A 3NO3A 4KCUA 5BXRA 2PDQA 4B4FA 3MYPA 4I3GA 3ZMRA 1PHQA 1BYBA 2J9ZA 2WPBA 4LYKA 3W28A 3H53A 2QCDA 4B5TA 1C9WA 1J8VA 4IMFA 4A2SA 3ZXWA 1H61A 3LLDA 1HVXA 3Q94A 1G5AA 2YLAA 1O5KA 4PTDA 4A6GA 4R85A 4FX6M 1SZEA 2F2KA 4FS9A 2Y5EA 3L4YA 3VM5A 4HSOA 4D6GA 4IF2A 3WL1A 1OEPA 1DIDA 3TJ4A 4YHEA 1FCQA 3VZXA 1XGZA 1GVRA 3LCHA 1GQIA 2WM0A 2AL1A 5FL0A 3SRDA 1W37A 2GQ8A 3UR2A 2VC6A 1V3KA 3A5VA 2B81A 2HTMA 5HNTA 2ANUA 3M5ZA 1XDMA 1VJIA 3R12A 3AYRA 4FEZA 1VEOA 3APTA 3MMTA 4MJ4A 4PTMA 1D7FA 4FNPA 4EP8C 1SR9A 4IJBA 2UBPC 3MHFA 2X40A 1X1NA 3H55A 1QBAA 2PPGA 2HPMA 3Q2DA 1RAKA 4KQNA 4U5KA 1X1OA 2Q8LA 3ITXA 2E6AA 1PE1A 3B9DA 2WCGA 1V6WA 3JS3A 2PLMA 2QR6A 2PDMA 3PSVA 2QDHA 5HA7A 3CH0A 5HANA 2D1ZA 1L6FA 4B2DA 1CGXA 4GINA 4L65A 4I8DA 1K8ZA 3T09A 4ZZ9A 4LSBA 1M5WA 3PTQA 1K7XA 2PZ0A 3NTYA 1ZENA 1K6WA 5CPNA 1YNYA 1SJBA 3CV2A 3R4IA 4BQ2A 3CHCA 1ZSXA 3RR1A 5LNWA 3VUPA 4HA4A 2WHKA 3LMYA 4LC6A 4W87A 1NEYA 2ZADA 1R0MA 2WW5A 1RJQA 4LGXA 2FDMA 2J7EA 5HMDA 1RV8A 2OEJA 1C8XA 1H7WA 1YDOA 3BOXA 3TFXA 1ODZA 4UR9A 3VNJA 3GRIA 4AZGA 4S3AA 2V9DA 2Y7DA 3THAA 1TJRA 2PDJA 3GDMA 3W2NA 1P1XA 1V3JA 2XN2A 3CMGA 2DZPA 5EFDA 3M07A 1LLZA 4GQRA 1ITUA 1K8YA 3W7LA 2WO5A 3N4AA 3TJIA 3KDNA 1TWWA 2D0HA 2W66A 4E8GA 1R9XA 4JTLA 4G9PA 5AC4A 3VKAA 3AYVA 1LUCA 3O6DA 3EX1A 3WQ6A 2CWNA 2RDTA 1IEIA 4A05A 2EG6A 2R94A 1KXQA 3PTDA 4UTLA 3SW6A 5A2BA 1DBTA 4K6AA 4M81A 4UR8A 1ZJAA 1UD2A 4HCHA 4NKCA 3EMCA 4QCEA 3KWSA 1XLJA 2IQTA 1T41A 3ABQA 5FJRA 1UD8A 4IHCA 3GR7A 3H6OA 2I9UA 3HPAA 3RILA 1IGSA 1EQCA 3S6OA 4V27A 4TOQA 3W0KA 4LAMA 3N34A 1X39A 1TV3A 3W7KA 5F1VA 5HXMA 2Y89A 4S2BA 2JIWA 2XFFA 2QV4A 4J28A 2ZX8A 2J8TA 1W1IE 3GUWA 4UIOA 5A94A 3UPMA 3K46A 5D38A 1HJQA 2O9TA 5BOOA 4C6FA 4MKSA 2VELA 2FVKA 1R46A 3CL7A 2ZTJA 1EGZA 3IRDA 1E71M 3P61A 1ISYA 4GRSA 3TJLA 3SM0A 3PFMA 1W1VA 2QUNA 2JF6A 2VCCA 4CVUA 1HGYA 3CZJA 1QNVA 2YDSA 3DYMA 2YZRA 1IIGA 1OYBA 3K13A 3EX4A 1XM3A 4ICMA 2DPEA 5I78A 2OEMA 4PB5A 5FSDC 4YTSA 3L12A 4JTHA 2J74A 1XIEA 1IEQA 4IIBA 3QY8A 1HP5A 4PUMA 2IXVA 4RE2A 3ZO9A 4IOTA 3GU1A 2KAUC 4BWLC 2O7QA 3I4KA 3QPZA 2NQHA 3MWCA 4WOZA 1A3XA 1A49A 2QJMA 5A1AA 5HBFA 2ZVIA 3Q58A 5G4HC 2C71A 4QNEA 4FA3A 4FR1A 2D23A 1JDEA 2OGYA 1V6YA 4MFDA 3N12A 1DVJA 2GK1A 4QLKA 3B8TA 1SU5A 2VUYA 2YL5A 3R0UA 2QDEA 2C16A 3HFYA 1TV7A 3WFZA 1GJUA 3UESA 3KOWA 3NQ8A 3AYSA 2EBNA 1Z32X 2J4GA 4CCDA 4B90A 3FVDA 1I2QA 2ZCGA 3GDTA 4AISA 1QBBA 1RP9A 2PDBA 4H9UA 4KGLA 4MNKA 1UP2A 1VS1A 4U5IA 1ISVA 4LBUA 1JIBA 3ISIX 1J5SA 1TVLA 1XLEA 1TPDA 3PWAA 4LAZA 2QVNA 3R43A 3FKRA 4V28A 2GLKA 3BSHA 3R6IA 1G9HA 4O0KA 1AQMA 4UMCA 3M0YA 2P3ZA 2NLYA 4I5UA 5A2CA 4KS0A 2W9MA 1SFJA 5I3IA 1OY0A 5A95A 1H1NA 3G1SA 1US3A 3LGDA 3WENA 2RJGA 4M1BA 3KOFA 3ZT5A 3URNA 3SUTA 3B9NA 1GK8A 2CZDA 3IK2A 1MRQA 2Q3OA 1ONXA 1Z42A 4Q4OA 1SO3A 1X38A 4LUYA 3TA6A 3OZYA 2CXEA 4XUGA 1RUSA 3AHVA 1TE6A 5JIWA 1WXJA 4UTIA 1XP3A 4ROPA 1E4NA 1TJPA 4O18A 3MSYA 1OF6A 4E8DA 3G1FA 3CLMA 4S3KA 5C55A 3THCA 2IKJA 5D8WA 5I2UA 4LW7A 3EX6A 4LUTA 1K4HA 4CUCA 2QGHA 4H3DA 1FHVA 3W2KA 1AD4A 4FR6A 3LCGA 3C0QA 4JIQA 4C6JA 1MW2A 1JCYA 5TIMA 3WEZA 3TTEA 2E6FA 1GQLA 2VKZG 3VGFA 3AXIA 4RXGA 3P82A 4LWWA 3VC5A 1TJ1A 4XD3A 5HNUA 4ECLA 3QFWA 1W3HA 2OYMA 3BV7A 3P3BA 3GR8A 2CCRA 2QCHA 5D9OA 2ZTKA 5DXYA 3AAMA 1IHIA 3KL5A 1JCMP 1P6CA 2GSJA 4UMAA 4S3GA 1ESWA 3STEA 1R2SA 4O17A 1RBOB 2QUTA 2F6KA 3A21A 2CBUA 9XIAA 4F48A 4PH6A 4LNYA 3SGUA 2EG8A 2X0YA 5AN7A 4Z2LA 2V0TA 1OABA 3W6YA 3NEHA 4QDMA 1E72M 3THUA 3WMCA 1FHLA 1GVOA 1YPIA 2JBMA 2VWSA 5JBFA 5GNXA 5KZ6A 1LWJA 3P74A 3HZ3A 1RJPA 2BB0A 3MMDA 1E9ZB 5F4WA 1A5UA 4Q32A 4YIWA 2Y8VA 2HWGA 3K1GA 3I7SA 3FK4A 1UOZA 3HG4A 1NSJA 1CDGA 2OU4A 1K7EA 2F84A 3C0JA 2AGKA 3VU2A 4Z2KA 4QJ5B 3S8HA 1NQKA 1ZBWA 3SCWA 4J3TA 4OQVA 3ZQ9A 1XRTA 2VUNA 3P7YA 4GQGA 4E3TA 3FY1A 1A4MA 2PODA 3B9OA 2QJIA 3WQOA 3UVAA 1M7PA 5A6SA 4D8ZA 3CIWA 3GWQA 1EJWC 5I23A 3S9IA 4TR9A 1H51A 1GOKA 2BV9A 3WJSA 1UWAA 5M2FX 3VKCA 2FTPA 3BAIA 1K4GA 1FRBA 1PYFA 4FK9A 4DHGA 2V67A 3NM3A 1IYXA 4L56A 3UERA 1UIPA 4KESA 3RLGA 3VIOA 3KHJA 3C56A 3G8EA 3NZPA 1PX3A 4ATDA 5EKYA 1B5TA 2BHYA 3SAZA 1TFVA 1E9YB 5HK4A 4JY8A 4LCQA 3STGA 4O19A 1QATA 2V30A 1U2YA 1QW7A 3PJXA 5C0QA 4IGNA 3AUOA