3W2NA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-185
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-185
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 107
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w2nA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w2nA01
2H90A 4NJKA 1YDVA 2A6LA 1XUZA 1GJPA 1BKSA 3ZR4A 1ZCOA 1ZFJA 3G8RA 3WJWA 3P84A 1XDLA 3UXDA 3GXTA 3KXQA 2WV8A 5EYWA 3HGOA 2QUTA 5G1YA 5D05A 5H91A 3BW3A 1W3TA 2OCZA 3DU0A 3FJLA 1QPRA 1VS1A 2F7FA 3G1DA 2DU2A 2XN2A 3GXPA 2NX1A 1JCLA 4Z0SA 3QPZA 4RZ5A 4K39A 2X1SA 4R7JA 2QJIA 3F4NA 4LVGA 1D9EA 3CQ0A 4LV4A 3H55A 1R47A 1XCFA 2CLKA 2WSYA 4FHAA 4XUGA 1HFBA 2FLIA 1YYAA 2FPVA 4LS0A 4UTTA 4UR7A 3GDTA 3W1QA 3B04A 4WD0A 3BK0A 5KZDA 5HWNA 3TQKA 4AB4A 2E5CA 3FLUA 1QO5A 3NVTA 4O13A 4NNCA 1G4EA 1OFBA 3IGUA 5HINA 4A21A 3N73A 3C2FA 4O0KA 3E96A 2QDHA 4JX6A 1TTJA 5HQEA 1ZAIA 2E77A 4O28A 1OFPA 3E0IA 4JTGA 3LXBA 3BW2A 4UTTC 1PHQA 5D09A 1SW3A 3EX3A 1GVRA 1OFRA 1TIMA 1Q45A 4K6AA 1BEUA 4EIVA 1SQ7A 1WBHA 4XKYB 3UY7A 3WK0A 4KFPA 3PBVA 3W7LA 1A5SA 2NUYA 1TCDA 1EB3A 4UTJA 2ZZ4A 3TMLA 4Y8FA 3VE7A 3TXZA 4PODA 5ABTA 6ALDA 2G95A 4JY8A 3A5FA 4QJ1A 2YW3A 2RKXA 1I2PA 4MFEA 3LTPA 3QMTA 2RDWA 1TMHA 2WKJA 1XL9A 1N7KA 1FUYA 3CM4A 4HNTA 1TQJA 4CNPA 2R8WA 4WOZA 1YLVA 4LUIA 1SW7A 2QF7A 3U6WA 3PWAA 3QSRA 4CQAA 3ATYA 2Y70A 4LC8A 5BNKA 3WJXA 2CZDA 1EP2A 2EF9A 1QO2A 5CG7A 1AW2A 2FJKA 2A4AA 2BWGA 3VNDA 4RXGA 4PEKA 5CZSA 4GJ1A 3W72A 3GIYA 4BK9A 3TUUA 3OVRA 2VFGA 1QDSA 4S2BA 1Z41A 3GDRA 2X2GA 4N6EA 4W9TA 1Q6LA 5C6MA 4JXCA 3E49A 1H7OA 1M7OA 1WX0A 3W1TA 3N19B 4UMAA 5LNSA 1JRCA 3LV6A 3HB9A 3TQ0A 2E09A 4JYDA 3UWZA 4RV8A 1IXPA 3B03A 3G1HA 2B0MA 1ZALA 3CC1A 5AYYA 1QFEA 1WA3A 4O15A 2YX0A 2QUVA 3MP4A 1LYXA 3BLIA 1O94A 1EEPA 3UZJA 4O14A 3LERA 1C8VA 3TKFA 3L68A 1Z42A 1RR2A 2GVJA 5DLCA 3O15A 4AVFA 1XM3A 2V0TA 3B05A 1OFQA 4IXXA 1KFCA 5K3VA 3VCRA 5U7SA 4DF1A 3STFA 3HBLA 4NJHA 2RH9A 3GNNA 2CWNA 1EWEA 1K3UA 2NWSA 4KWVA 4N02A 5G2IA 2Y63A 3OIXA 3L0NA 2J24A 4S2CA 4IOTA 4LS2A 3TE9A 3I7QA 1YTEA 5D2YA 4LY8A 3EX2A 3KRZA 3W7IA 2FB2A 3NL6A 5D30A 3TH6A 1V7YA 2PRHA 3N2XA 3W6YA 2EHHA 3P62A 1J4EA 2JGYA 3A23A 3GR8A 3NDOA 4XBKA 1H51A 2NV2A 4FB7A 3HOJA 3DZ1A 3N2MA 5D2VA 4C1LA 3SGUA 3NQGA 5EKYA 3HGSA 5AFDA 2VEMA 4JN6A 3CIWA 5HULA 3EKZA 3FOKA 1NF7A 4OE7A 1DQXA 2HS8A 3ABOA 3LV5A 4AXKA 3L65A 1MEHA 1HG3A 1YTKA 3LTYA 4AHOA 1SSDA 3GXNA 3UWWA 3WFAA 5BMWA 2J9YA 3HIJA 4LRTA 1MXSA 2YPIA 2DZTA 3DKJA 3S42A 2XN0A 3I6RA 4GUGA 3PC0A 2QCFA 1VYPX 1LOLA 3MP5A 5AOUA 2Y88A 4Q33A 3A5VA 1Z44A 2QCHA 4N4QA 4UR8A 3KVKA 4FNQA 4FNSA 2ZA1A 4QAIA 2C15A 5FEPA 3BARA 3H53A 3MBDA 2YXGA 3O06A 1ME7A 3WK2A 2QKFA 1X6UA 3L5MA 3B0UX 1QPNA 3BVJA 3PG9A 1W5OA 2F84A 1PL9A 4OWGA 2CLLA 3NG3A 4JS3A 2BLEA 1XDMA 4DXVA 2ZA3A 1FWTA 1HL2A 2A1YA 3PUOA 1TTIA 4JEQA 4AF0B 4ZZ9A 2V2CA 3G3DA 2W6RA 2I9EA 4IXHA 3ABRA 3S5ZA 2AQWA 2V81A 1GG0A 1IXQA 4I9AA 1F5ZA 1TYGA 5E0KA 1RD5A 5LGXA 5CZTA 4DO5A 1JR1A 3GKFA 4RZ4A 1LRNA 4I7VA 3BV4A 2QCMA 3DI1A 4YCOA 3LHVA 5U4NA 1TPH1 3Q2DA 2C13A 3TSMA 1KM3A 2J88A 4U28A 2DZPA 4HPXA 3ZFHA 5CGQA 2CZEA 4JNMA 2WPBA 2Y89A 3W7KA 5F2IA 4O1BA 4NU7A 2FQIA 2JKEA 4LU0A 3M9YA 1H62A 4A29A 4MY1A 4H3DA 1JQXA 1FX6A 2E5BA 3GX9A 3NQDA 2ATSA 2FTPA 3P81A 1R46A 3GDLA 1KFJA 4JYFA 5LHFA 3RFAA 2Z0IA 1XBXA 4HHPA 4NXKA 1I2OA 1I8JA 3GDMA 4FO4A 4DEFA 3L5AA 4FX7A 4RLIA 1PV8A 1VHCA 4FIRA 1OG0A 3P8IA 3IGXA 2VEPA 1ME8A 2YCEA 2V8ZA 5CPMA 3NA8A 2QCDB 3RLVA 5FEXA 4IQLA 5K4XA 5KTLA 1O4UA 1SFLA 3GB6A 3BGGA 3HPZA 3ABSA 5D03A 3HPSA 4UC5A 5CPLA 5I3GA 3NQ6A 1GQNA 3GKAA 2X1RA 5EY5A 5SWUA 1FWSA 3VFLA 1EWDA 4O57A 3W1AA 2QCGA 3KAOA 3PSVA 3GR7A 3W1XA 1IIGA 1ZJIA 1L6SA 2CLFA 4WOQA 3ANYA 1W3NA 1AK5A 1YADA 3ABQA 4QISA 4LTSA 1TTQA 3QM3A 5FESA 4NJGA 1VC4A 1VRDA 2DZSA 4N9EA 4ZQRA 1T8XA 3NQ2A 3O05A 3KVMA 4FNRA 3LDVA 5E1QA 1L2UA 4FNTA 2DJLA 3B0PA 3ATZA 3W84A 1TRDA 1U83A 1DKWA 1Z48A 3ZS4A 2QAPA 4O1CA 2YGYA 3S9YA 5D38A 4PTNA 3NL3A 1M6JA 3HG5A 4M6VA 5EMUA 1W5NA 2RDTA 4DF2A 4JTIA 4MUZA 4AHPA 5A5WA 1WBJA 2Y85A 1GEQA 3W22A 3W2NA 1A53A 1H7WA 2ZA2A 4UFHA 3C2RA 3LI1A 3V1PA 1B9BA 1TPB1 4A3UA 4UFKA 1O60A 1QCWA 2GQAA 4OBTA 1H1YA 2FDSA 5CZ0A 4AWUA 3UY8A 2J6XA 4IMCA 4AWSA 3LX9A 2RFGA 3EWYA 3JR2A 1ALDA 5KMYA 3E9AA 2VFIA 5KSWA 2ZTJA 2NUXA 3BLFA 1W54A 2QCLA 3W1UA 3SZ8A 4MZ1A 3W7DA 3LCHA 3FKKA 4JIPA 3T7VA 4DO6A 2ABBA 1P4CA 3OVPA 2R14A 4MZ8A 2NX3A 3M7WA 4CLMA 4EF8A 4JTUA 3THAA 2B7QA 1T99A 3PAJA 1VCVA 5C2XA 3S5OA 3L0GA 4HKPA 4R33A 4HPJA 3DENA 1GTEA 4OGZA 4X22A 4OV4A 2PRMA 3IIVA 3THQA 1WXJA 4Q4KA 4KFNA 2NXHA 3NM3A 1K7EA 1FY6A 3TMQA 1ZAJA 1G7UA 4RR4A 1X1OA 1TPUA 2CLIA 4M6QA 3CTLA 5AN7A 3W73A 3MMTA 1LOSA 3F1QA 5CZJA 1KLZA 3TJLA 3LI0A 4NX5A 3NZRA 1FDZA 5DELA 2QCCA 3BG5A 4Z0JA 3N3MA 1S5TA 1W5MA 3W85A 1ZENA 1SSGA 1Q6RA 3NZ1A 1TPFA 5DY2A 2A21A 4TMCA 1D3HA 1ZAHA 5FF4A 3TW7A 2QUUA 5F1VA 5F4SA 3UWVA 2ZQ0A 1VZWA 3EEGA 1AL8A 1VJIA 4IMDA 3RF9A 3W88A 2QAFA 1WQ5A 2CZ5A 3OA3A 1X1ZA 1G67A 1VLIA 4TIMA 2C14A 3GAYA 3P7YA 4UFJA 3U2OA 4MIMA 3G24A 1SW0A 4IJBA 5F2MA 3DGRA 3N9RA 4M7TA 3MI2A 3P67A 1LLZA 4AMAA 1Q3NA 4A22A 1SO3A 2C1HA 1FDJA 2Y7GA 2A7RA 2AAMA 4NXSA 1A5AA 4EOUA 2A7NA 3M43A 4GNJA 4KKXA 1VYSX 3NPVA 4ADTA 1EX5A 4HNUA 1VYRA 3PM6A 3DFSA 3HF3A 5LNRA 3LXCA 1SZEA 4O12A 4MFDA 1H1ZA 2E6DA 1HO4A 2Y6ZA 3LBCA 4LWWA 5EPDA 2ZRWA 4EVZA 1TJRA 1UB3A 3STEA 1TJPA 3W70A 1YPIA 5T26A 4A2SA 1W3IA 1K8XA 2Y61A 3S6DA 3UNDA 5D2TA 2FB3A 4R34A 4IUOA 1PHWA 1ONRA 3PUDA 1O95A 1TO3A 2OZ0A 1W5PA 1DHPA 3JRKA 3W71A 2AGKA 3LM7A 5IBXA 1KM5A 2P0OA 5LKYA 2GOUA 1TTPA 3LBMA 2V9DA 4FNUA 3CB8A 5D02A 1OX4A 3P82A 3C8FA 3FYPA 3KFTA 4WZHA 3LXAA 4WJEA 4CCDA 1VPXA 3MHFA 2HMCA 4Q32A 4C1KA 2ZRZA 5AHNA 4LVDA 3NXFA 3WK3A 4GUJA 1LRQA 3TA6A 3CWNA 4MJMA 3T4CA 3R5EA 1TV7A 5IBXC 2VFEA 4YLWA 1LRTA 4UTHA 3DAQA 3S5NA 4Y96A 3SGZA 1GWJA 4JTFA 4NZJA 4QM1A 5F4WA 3DFQA 3PUEA 2ZTKA 3C2OA 1R30A 4DF0A 4MVAA 4IGHA 5AYXA 1KBJA 5C54A 3W2LA 4O1AA 2H3BA 4UIOA 4FIQA 3C61A 4LVFA 1GYNA 2V5BA 3W7RA 3D0CA 4ONVA 3RNDA 2Y7EA 3HG2A 3NO5A 4MOZA 2R94A 3T40A 5AC8A 5DBTA 1YPFA 2JBMA 3G1AA 1OVDA 5AHLA 3DH7A 4YXGA 4ICNA 2QEZA 3W2KA 2PURA 1JVNA 1OFAA 1MEWA 1FWRA 1O5KA 4KWWA 4QIUA 3N14A 2QCEA 3B06A 5D33A 2ZZ7A 3M16A 5C5YA 5I3JA 2BXVA 3EB2A 3WK1A 1DORA 3U8GA 2CFFA 4P2VA 2BX7A 3S0CA 3IVSA 4GUFA 5K7JA 3VE9A 4Z1AA 5TBOA 2W0UA 1LBLA 1VR6A 4JGDA 3L5LA 3KX6A 4UNKA 1TV5A 3NL2A 3NPUA 2GJLA 4LRSA 2NV1A 3NQEA 5I3HA 2V2DA 1FBAA 4LS1A 4IX2A 4WQ6A 5LNWA 5HWMA 2EKCA 1TQXA 2ZZ1A 1OFOA 4UTWA 1BWKA 3TK7A 1LCOA 5TQLA 4O18A 2X1TA 2PRLA 2ZZ3A 3EX4A 3QEZA 3UD6A 1KFBA 3EXRA 4OU1A 2FIQA 1KM0A 1B4KA 2GVGA 1YTDA 1ICPA 2X1UA 2H8ZA 3EX6A 1VCFA 3SI9A 1GT8A 1O5XA 1K02A 3OBKA 3DI0A 2E6FA 3L67A 1MSSA 3IVUA 1GOXA 2RDUA 2HS6A 3S8HA 2O7QA 4UTWC 4CNNA 1UJPA 2VXNA 3LGEA 4N9BA 4BF9A 3C4UA 2DZWA 1XFBA 3NEVA 4XBSA 3DHDA 2EGZA 1HTIA 2OMAA 3S1UA 5EBUA 4N9DA 1SR9A 4AH7A 3B8DA 3T55A 3BG3A 3AO0A 1KM2A 3W1LA 1LOQA 1YXCA 3G1YA 3M41A 2I1OA 3VI2A 2ISSA 3G1XA 1ICSA 1JCJA 3E12A 3V75A 1H50A 3TQVA 1OX6A 1QWGA 3W2JA 5FI8A 1JCMP 4ZQMA 3DKLA 3R2GA 3NQCA 4PCFA 4IMGA 1OX5A 3MI6A 4ZQCA 4KFOA 2WNQA 4M19A 2X30A 2ZFAA 3QZEA 4LC6A 1X7FA 3IIPA 3M5YA 1DBTA 1OF6A 3JS3A 1PIIA 4FNPA 1Y0EA 1NF0A 4WY0B 3C52A 3S1WA 2TRSA 1Q6QA 3LRMA 2FPYA 1JUBA 3A22A 1TPEA 2UV8G 4Y6GA 4A2RA 4PL1A 5FF2A 3TXVA 3R89A 2A5HA 3QC3A 4O0ZA 3IEBA 1JUKA 4UNLA 3KRUA 1L6WA 1DVJA 3QFEA 3TAOA 3M1ZA 4HSOA 5AC7A 2PCQA 2YYTA 2G96A 4LNYA 5E93A 2XFWA 3SR7A 5FF3A 4I7UA 4UFIA 1QAPA 1LP6A 1RQHA 3I68A 2A2IA 4ORIA 1KM4A 2DZXA 1S3HA 3GLCA 1BWLA 4GBUA 1DJNA 3W7JA 1YXDA 1ME9A 1SZGA 4MYXA 1DQWA 3L0KA 1Q6OA 2A85A 5AHIA 4U4MA 1F7BA 2YYUA 4IMEA 5LNUA 4LVBA 4ML9A 4P61A 4PA8A 3VKJA 1KTBA 1WOAA 1E51A 3STGA 4LOCA 2ISWA 5AHEA 3OVQA 3SSJA 1OYBA 2OJPA 3M47A 3EX1A 3LCLA 2VC6A 2GJNA 1JCNA 3IRDA 3W23A 3WJYA 2GQ8A 4Y9AA 2Z6IA 1K7XA 4OQVA 2E5DA 3QSTA 4O19A 3GZ3A 2LLEA 1OF8A 1I4NA 4DPQA 3ZWTA 3LRLA 4NZFA 2QJHA 2DJXA 3CPRA 1RQEA 1CI1A 2ZRXA 3KVJA 3CU2A 4JY9A 4RCXA 3UQNA 5A8GA 4HNVA 3SW6A 3NPXA 2ALDA 4Z08A 1R2RA 4EWND 2GVLA 4UMCA 2J9XA 1YXYA 1NSJA 3UWUA 4RX0A 1SO4A 3P61A 2YDAA 3PB0A 1XBYA 1FXPA 3BPWA 5AHMA 3HGRA 5DCDA 5FEWA 3MHUA 3DFPA 1W31A 3G1SA 5AYZA 4NVTA 1B3OA 5K4ZA 4MPQA 3NQVA 4UFLA 3W2MA 3N9SA 3W7HA 1PCWA 4QNEA 1NAL1 2A0NA 4E2DA 3GVGA 3TV8A 1KM6A 3O8AA 3W1NA 2C0AA 3BG9A 2CLOA 2GPTA 3M5VA 1PCKA 3F4WA 3UPBA 2EAWA 4POCA 3HPXA 1FCUA 5K9CA 1PVNA 2CU0A 1C9DA 1DJQA 3LCXA 3MI3A 5LZLA 2CZFA 2P1FA 3QRHA 3TNOA 4NJIA 4GXMA 1F05A 5FEZA 1THFD 1QOPA 3M0ZA 1DV7A 2E6AA 1KFEA 1B4EA 1XKYA 2FPTA 5DXYA 5G4WA 1TPVA 5AB3A 3CEUA 2Y7FA 1JJKA 1WV2A 3SECA 2KZHA 5IM51 3EKLA 3I7RA 2VFFA 5EA9A 5H2ZA 4G1KA 3I65A 3L2IA 4CCEA 4UTKA 2C19A 1GVOA 5CPOA 1IGSA 2WQPA 4QSHA 5DBUA 2E1DA 4UMBA 4FXSA 3P5ZA 1EP1A 5AC6A 1OFEA 4GE8A 4K38A 5L6UA 1GVSA 3UPWA 3IGSA 4UTMA 2ZRUA 4MLJA 3TAKA 4N6FA 4XTDA 1WAUA 1VQTA 2ZDRA 3PBYA 1UUMA 4JX4A 2WNZA 4O4WA 4DPPA 2V82A 3NPWA 3FA5A 4HNNA 1H61A 2C3ZA 1FWWA 2HSAA 1F2JA 4TU1A 1S5WA 4XTIA 3TFXA 1KFLA 2ATMA 1VGAA 3W3OA 4QQ3A 3SJ3A 4PC8A 2Q3OA 4NNAA 1RPXA 2DZUA 3SFKA 2Q3RA 3MUXA 4UTLA 3USBA 3HG4A 4DO4A 4WY0F 4Y90A 3YPIA 4IX0A 1JRBA 2G5WA 3GK0A 4BWLA 1H7NA 4UFMA 4ZQOA 4O1DA 3W7PA 2JKPA 1OX4B 2NZLA 2OT0A 3CT7A 4RZ6A 1WOBA 3TC7A 3Q37A 2OT1A 3PVFA 5K2ZA 4TX9A 2YW4A 2Y7DA 1XC4A 4DBEA 4GC4A 4MJZA 3TFCA 2PC4A 4JDBA 1IF2A 3EWZA 1W0MA 3G0XA 4BWLC 4QITA 4ALDA 5LNVA 1KW1A 1ADOA 1OK4A 4JICA 3G0SA 1IXNA 1PE1A 2DORA 5I3IA 5CSRA 8TIMA 1QPOA 1FXQA 4JX5A 5K9XA 4UCGA 4NT0A 5AHFA 1I2NA 2ISVA 3PR2A 4OHQA 4JR5A 3UXAA 1TRIA 3G1FA 4NJJA 1SFJA 1EPXA 3FJ6A 1W5QA 2B7PA 5HWJA 3R8RA 1SU5A 2B7NA 3LLDA 4ADUA 2WNNA 3PG8A 1DOSA 4BI6A 1KFKA 4JTLA 2IQTA 2W79A 2YFOA 3QW4B 3Q58A 2TSYA 3W83A 4JTJA 3TCEA 4GFSA 4JD4A 4I7WA 4WX2A 2WJZA 3A24A 2VKZG 1OYAA 1YDNA 3C56A 1F6PA 3DFOA 1LBFA 1SZNA 2QCNA 2V30A 2J9ZA 2DP3A 2B4GA 1L9WA 1M7PA 1F6KA 1XBVA 4WXYA 1KV8A 4MY9A 1H60A 3KOFA 3O6CA 4HSNA 2ZBTA 4K7VA 4L4MA 1OHLA 2I14A 4Z1DA 3QQ0A 1R2TA 3P5YA 1W56A 5LHEA 3S5YA 4CNOA 2DZVA 1XXXA 3IIXA 4ZL1A 3Q94A 2VENA 3IV3A 3WJSA 4O17A 5LSMA 4BI7A 3O07A 4O50A 3MO7A 5I3KA 4JTHA 4E2BA 1ICQA 1UBSA 6TIMA 2YFNA 3KVLA 1H7RA 4AHQA 2TPSA 3HO8A 4X3ZA 5KITA 4ZMGA 1K8YA 3RLUA 1JULA 3DFTA 3M6YA 1G4PA 1A5CA 5MHBA 3P60A 4K37A 3S1XA 1QMLA 2ZRYA 5D2XA 3W7GA 1KV5A 2Q8ZA 1J5TA 4WXZA 4H4IA 4HIBA 2Y62A 4JTKA 4E38A 2JKAA 2BSLA 4E0CA 2NUWA 1XBZA 1LM1A 1VCGA 1K7FA 5D32A 3EXSA 3NQ7A 3ELFA 5D04C 5KZMA 3DFNA 3DBPA 1JCXA 3TIMA 1QNVA 4K7YA 2X16A 4L4LA 5HJLA 5J5DA 5DY3A 4UTIA 2CW6A 3PB2A 4Z1BA 3W2UA 4PFMA 2JGQA 4UXDA 4IPJA 1G4SA 2GQ9A 3EWXA 4EF9A 4TR9A 1N55A 1TPC1 3HQ1A 4WUIA 3PS7A 4XWUA 4CQ9A 3QPYA 2VOMA 1EP3A 5BMXA 2D73A 1JCYA 4DELA 4N9CA 3QW3A 5F2GA 1ZNNA 3W7CA 3W1RA 4O53A 3TSBA 3QYQA 3A9IA 3W76A 4CQ8A 3QF0A 1UUOA 3O6DA 1P1XA 3G18A 4S1FA 2QR6A 5HMSA 2EPHA 2GUUA 2H6RA 5DCBA 1CW2A 2V5LA 3CWOX 2ZRVA 1NVMA 3NYZA 3R12A 1OK6A 4RK8A 1H7XA 1K8ZA 1FQ0A 3QMSA 3B4UA 2ZZ6A 3BW4A 1D3GA 1H63A 1MEIA 2Q8LA 5HR7A 1UCWA 1A50A 4ZVJA 4NQ1A 4RXFA 3NNTA 4XKYA 3W74A 3G8EA 5G2WA 2WSQA 2HTMA 3LCFA 1A5BA 1LROA 4GUHA 5HNRA 3EWUA 3TC6A 5HUOA 1AL7A 2NX9A 4PH6A 2VFHA 4GWEA 1LBMA 4X2RA 1LZOA 3LCWA 4YL2A 5KINA 3QJAA 4MYAA 4K36A 1GZGA 3NOEA 5G5IA 2H8XA 3BGJA 2CLMA 5TIMA 4H6KA 1S5VA 3KRSA 3M44A 4ORMA 4LT9A 1UASA 2A6NA 5DCEA 3I7SA 2TMDA 5DXXA 3MYOA 4JDYA 4LVAA 4R53A 2VFDA 3NGJA 5D2WA 4BR1A 2VEIA 3DHFA 2Z6JA 1I45A 3G1VA 3W1PA 3UWQA 2G97A 3T44A 3MWAA 3LHTA 4UTUA 3PULA 1W8SA 3TDFA 2YSWA 2C6QA 4O16A 7TIMA 4K8HA 1JQVA 1KBIA 5LGZA 4JTTA 1TSIA 1AW1A 3MYPA 3F03K 3LCGA 3IIOA 3EWBX 4HN4A 4GUIA 1GTHA 1N8FA 1SO6A 3BLEA 3HGJA 3LLFA 1TPDA 1M5WA 1P0NA 1GG1A 3FFSA 1TREA 5J5RA 2E6YA 1IIHA 3S1VA 5FF0A 3KHJA 4D2JA 1XI3A 2ABAA 3T78A 3L21A 3R13A 3STCA 5BOOA 2E68A 3LHYA 1X8FA 2WOQA 4FEZA 1RV8A 1TV8A 3TJXA 1QPQA 1LDCA 3FYOA 1NFBA 3M5ZA 4N4PA 2TYSA 3G0UA 1EUNA 1CX9A 3TROA 4YMZA 3W86A 1KLYA 3IIZA 1DL3A 4OV9A 1KTNA 1RQBA 1QR7A 4XZ9A 5L9FA 3B0VC 5EL1A 3OEXA 1VHNA 3EWWA 3C3NA 4LW7A 4JTEA 3INPA 3CHVA 3TU9A 3PY2A 3TR2A 3O6YX 1G6CA 3CLMA 3PBWA 4O8RA 3MJYA 1MO0A 2ZYFA 1MZHA 4NUWA 4ZQNA 3WJZA 1VLWA 2Z2UA 4GRSA 5G2HA 1C29A 1YDOA 5CPNA 1ZHAA 3P8JA 3MP3A 4M5PA 4DQWA 1EA0A 1VH7A 3HG3A 2B7OA 4TO8A 1F76A 4LV9A 1HO1A 2PE4A 1TPWA 3NM1A 3QH2A 1EUAA 4O52A 5D37A 2C18A 3O63A 3LHWA 2ZZ2A 3NAVA 1F74A 2FFCA 1EIXA 1W37A 3PBUA 1WYIA 5F4XA 3N34A 1AG1O 1I2RA 5G4EA 1GVFA 1FWNA 1KM1A 1RZMA 2NWRA 2YZRA 3LB0A 1F73A 1OJXA 2A7PA 2ZZ5A 3CEPA 5CKSA 3C2EA 3FEMA 3LOTA 4BFAA 4FF7A 4MY8A 3MHGA 2QJGA 1LORA 1OFDA 4YWIA 1QOQA 3HMJG 3FIGA 1J2WA 2J27A 3P80A 5DN1A 3G22A 1AMKA 2JK2A 5K9DA 4HT3A 4JIQA 4OT7A 2VEKA 3A21A 2V2HA 1ML1A 4Z1CA 4IPIA 1G4TA 3LHUA 3W9ZA 4X9SA 4M6PA 3HJZA 3GNDA 1HUVA 3E02A 1RVGA 2BZNA 4DBDA 3TW6A 3IVTA 1JUEA 3P74A 3H54A 4QNWA 4WY0A 3M5XA 3MBFA 3OHIA 3C6CA 1FDYA 4PL2A 5F1UA 5GVJA 3UWYA 4AWTA 3CIXA 4N2YA 3K30A 3C0JA 1TB3A 1SUXA 4XQ6A 3OG3A 3L66A 1XUUA 3NL5A 4JTSA 1OYCA 4AF0A 4NNBA 5KZEA 3LCIA 1I2QA 4O11A 2P10A 1KA9F 2OX1A 2R91A 4FXRA 3ZWSA 1R2SA 4MLRA 1FCBA 4LUJA 3PF3A 2WSRA 4O54A 3SY5A 3BO9A 4AAJA 1AW5A 1GPWA 3FS2A 3W75A 3G3MA 2BTMA 2VELA 4M7SA 4MZYA 1FCQA 4AEOA 1LTDA 2Z1BA 3DXIA 4FX8A 1LLWA 3O1NA 3GDKA 4TMBA 3UZ5A 2YR1A 3W07A 4CCCA 4IWWA 2NXIA 1W1ZA 1GYLA 4ADSA 1P5BA 3W7QA 3TSDA 4UUIA 1H7PA 3TX9A 2NXGA 3W7MA 3RK8A 1T0OA 3NQAA 2NLIA 5CSSA 5BW6A 2ZCGA 5FF7A 3W7EA 5G1TA 1V5XA 3O16A 4FX6M 1ZY9A 1NEYA 4NX0A 4J9JA 5C55A 2RHGA 4ZQPA 3UYCA 4YCPA 1FCVA 2CLHA 1T96A 1H5YA 1IXOA 3QQ1A 3QMRA 1SO5A 1SPQA 3NQ8A 3LTSA 3AJXA 3NQMA 3C2VA 3RU6A 1G69A 4BI5A 5BRBA 2WO5A 1U5JA 1K03A 2XN1A 4JYEA 3PSWA 2QCDA 4O4VA 3W7OA 3W87A 2QDGA 1KTCA 3EXTA 1SZFA 3LHZA 4RJEA 5HR6A 4RKAA 5HUPA 4O10A 1OABA 1BTMA 1GVQA 4MKNA 3W1MA 3GAKA 3W7NA 3NR0A 1B57A 5F2LA 3RMJA 3FKRA 3GYEA 1P0KA 5I3FA 1PS9A 3NQFA 4K8EA 3L9CA 1G7VA 2CLEA 3MW7A 2C16A 1L6YA 1WDWA 3SIZA 2O7SA 4IMFA 2H3DA 4B5NA 3LRKA
chains in the Genus database with same CATH superfamily
4ERAA 2Y8VA 2G3NA 1YDVA 2A6LA 4M1BA 1XUZA 3A12A 4AZHA 2XIJA 3GW0A 1ZFJA 3G8RA 3FV9A 4JQ3A 1XDLA 2ZUMA 1PX8A 4B3LA 3GXTA 3KXQA 2OFJA 4A8RA 3UJFA 3L2MA 4IFRA 1JPDX 4Q3MA 2YA2A 3KCLA 1XG3A 4C7DA 1JDFA 2OCZA 3WUBA 2F7FA 3G1DA 3GXPA 3TWBA 4J3WA 1ZP3A 3QPZA 2XPKA 4JIRA 2QJIA 3UR7A 4S3GA 4S38A 3EZ4A 3H2NA 4LV4A 3AMKA 4J40A 1R47A 1XCFA 4FHAA 2RAGA 1LL7A 1MW2A 2FLIA 3AYVA 2POZA 1YYAA 4UTTA 2VP8A 1QATA 1HL9A 4L9ZA 3BK0A 5KZDA 5TD4A 4AB4A 3L4UA 4Q4OA 2JIEA 2XIMA 3IGUA 2Y8UA 1CGXA 3N73A 4JX6A 2GUBA 4QP0A 1ZAIA 1LQ2A 2WMHA 1YE6A 3CHEA 2X41A 1NELA 1KWKA 1SW3A 3CUIA 3LQLA 3TTSA 1A5OC 1GVRA 4DWSA 4K6AA 4I3GA 1WBHA 4XKYB 1M68A 5DQPA 3PBVA 3W7LA 4Y8FA 4GKTA 3H8AA 1OZMA 4HJWA 5LIWX 2XH4A 2G95A 2J7FA 4JY8A 3A5FA 4QG8A 3ZJ6A 2YW3A 2AKMA 1Q2SA 4DAFA 3LTPA 3G1RA 1BXCA 2WKJA 4Q7IA 1TQJA 4HMEA 1JGMA 4CNPA 2R8WA 4WOZA 3AYRA 1YLVA 1PO9A 5C0QA 1CDGA 2Y70A 5BNKA 3WJXA 5E5CA 1QO2A 5CG7A 1VBGA 1AW2A 2O9RA 1TV3A 4EAYA 3GIYA 4BK9A 1US3A 1QDSA 4PCPA 1WDPA 4N6EA 4K68A 2EBNA 4S23A 3J7HA 3BCFA 3REQA 2CWXA 3KZSA 3N19B 3WBEA 1ECEA 1NU5A 2VC5A 1JRCA 2DZAA 1O5RA 3HB9A 3CUZA 4JYDA 1ZBVA 4IIGA 2ZXDA 3G1HA 3LGDA 3E38A 3SRKA 3ZIZA 2FGZA 3AHVA 4WEVX 1DJZA 1EEPA 2WVVB 2Y5EA 1Z42A 4B91A 2UY4A 4RW5A 4AVFA 1OFQA 2WBGA 5K3VA 4NP7A 3CUGA 4H41A 2BVYA 2QPUA 1ZUAX 3WLHA 3MCNA 2DVTA 4QJ3B 7PTDA 2WZEA 1GW1A 4N02A 5G2IA 3TTYA 3OIXA 4GCAA 1MQPA 1XRSA 1HVXA 2C71A 3CYVA 5DEZA 1DWGM 3KRZA 3IJ9A 3TN3A 4JTDA 1XG4A 3N2XA 3WLNA 3A6OA 4GIAA 2Q71A 2VZTA 2VURA 1H51A 2MNRA 4FB7A 1XLBA 4KS0A 3N2MA 2HPMA 4V27A 4C1LA 4L6OA 5EKYA 3VKBA 3HGSA 1QPKA 1CXKA 1R9ZA 1UR2A 4PUWA 5BWAA 1BVZA 5BZAA 1QTWA 5A8OA 1NF7A 4AXKA 1HG3A 1YTKA 3CAKA 1BFNA 4H7ZA 1SSDA 3WFAA 5BMWA 3QLLA 3ERPA 4GVGA 4LRTA 3WH6A 3AAMA 4GUGA 4KETA 1A0EA 3CHCA 1LOLA 2WMGA 1Z44A 2PDMA 2DUAA 4N4QA 4H6QA 3ZT6A 4FNSA 3BARA 3B9OA 1O1ZA 1XIBA 1R7AA 4YNGA 1KBBA 3PG9A 3MUAA 1JNEA 2F84A 3WYZA 3FGCA 2G3IA 1IZKA 4OWGA 4Q7NA 3FN9A 1DXIA 1HZYA 1H09A 3H4WA 4P7LA 5I09A 1JF5A 2ACQA 1HJQA 3PUOA 1UP0A 4XG1A 4AZGA 2V2CA 4G5DA 3ITYA 3WX7A 4IXHA 2AQWA 2E8ZA 1F3WA 2W4XA 4HA1A 3LBOA 1CPUA 1TYGA 1ZBCA 1RD5A 3OPSA 5LGXA 1JR1A 3GKFA 1E3XA 4PMXA 3H12A 4YCOA 3LHVA 3HPAA 3F5JA 5U4NA 3WQ8A 2PWFA 1XR2A 1JF6A 4D1IA 3ZFHA 3SUSA 2CZEA 5CGMA 1K9FA 2FQIA 2JKEA 1HKJA 3H4GA 4MY1A 3QBUA 1QK0A 1JQXA 1PWMA 4W8AA 3CIVA 3W24A 3GX9A 3CZKA 2RGMA 4LUTA 4JYFA 2XM2A 3RFAA 4RNHA 3R0UA 1JCTA 5DMYA 3L4ZA 1I8JA 5REQB 5FSEC 2ISDA 2WCSA 3GG7A 1EQPA 1UZDA 3L5AA 3CV2A 2XM1A 3IGXA 2VZUA 2VEPA 5ABHA 4YVPA 3KP1A 5K4XA 2OX4A 2DFAA 7TAAA 3PNZA 3WQOA 4CEUC 3RHGA 1WZLA 3ABSA 5CPLA 3AJ7A 1OQFA 1DJWA 2X1RA 3BOLA 4MAZA 1XDJA 3SGGA 4C65A 1FWSA 4DB7A 1J9YA 1IIGA 1GOQA 3LY0A 3LS9A 2GK1A 1TUFA 4CN4A 1V6VA 3T2OA 1NP0A 2WYSA 4NJGA 1T8XA 2DIJA 3O05A 4FNRA 1E1FA 1L2UA 3B0PA 4L9XA 3W84A 1GOKA 4RV3A 3E2QA 1RSCA 1YNYA 1Z48A 4A3RA 5CC6A 4BHYA 4CN6A 4O1CA 2YGYA 3S9YA 1JDAA 5D38A 2HZGA 3A4JA 3HG5A 4F0HA 2G3MA 4JTIA 4KT2A 3THDA 1PZ3A 1NDYA 5A5WA 3W22A 1H7WA 3C2RA 4JCLA 5A2CA 3MVTA 1B9BA 3HFTA 1JDEA 5M5DA 1TPB1 4A3UA 4IF2A 1K6AA 2XU2A 5CZ0A 3DYOA 3UY8A 4IMCA 5E6YA 3IJQA 4CQBA 1XIMA 1TG7A 3EWYA 3VM5A 1VFFA 1XLDA 2WMFA 2ACSA 2NUXA 4WIWA 2JF6A 3BLFA 2QCLA 1XYAA 3QHNA 2L5HA 2ABBA 2DH2A 2GDUA 3CV6A 1D2KA 5C9XA 4JQ1A 1ISVA 1JZ4A 4HPJA 3LMYA 1GTEA 3SJNA 4X22A 2OSXA 4ICCX 3URAA 4YU1A 4Q4KA 5FKYA 4J3ZA 3NM3A 4B2DD 3ECQA 3TMQA 4KEUA 2QMKA 3ARZA 4S3AA 1E1EA 3EB4A 2CLIA 3W73A 1VBRA 2Q8XA 2PP0A 3TJLA 3BV7A 5DELA 4S3FA 1H3GA 4Z0JA 3WLLA 1DEDA 3NZ1A 1TCMA 3H2OA 4BQ3A 4US5D 2QUUA 2ZX8A 5F4SA 4CNSA 1BYDA 5HA7A 3UWVA 1XKJA 4I5UA 3U5YA 4DI8A 1J0HA 1VJIA 2D0GA 2ZUTA 3RF9A 4FR1A 2QAFA 1P7TB 1EJTC 1MZRA 2O55A 1VLIA 4TIMA 4UFJA 1DJIA 3KUMA 3U2OA 4QEEA 1SW0A 4M7TA 4MWAD 4KPLA 4AD1A 4GG9A 3S9IA 1U22A 3P0XA 2XSBA 4OVXA 4AMAA 1Q3NA 2ZIDA 4LBUA 3UERA 2A7RA 1TKKA 1V3KA 4GNJA 3WDHA 1C8XA 1VYSX 1PYFA 4ADTA 1EX5A 1PUDA 1VYRA 3QHMA 1ZJHA 3HF3A 4O12A 1R6WA 3VC6A 4IG2A 2BS9A 4C6IA 5JBEA 1FWAC 2ZRWA 4YHEA 1VENA 1UB3A 1TJPA 1GOMA 2VCAA 4LAZA 1BRLA 3LENA 3NURA 1EJXC 1VFTA 1RA5A 1F3XA 2PS2A 1U33A 4GCXA 2OZ0A 4FOUA 1W5PA 3BZJA 1QNPA 1KM5A 3LZ3A 2P0OA 2XH7A 4F8XA 2GOUA 1TTPA 3KOWA 1DXEA 3MMDA 5HOSA 3ZT5A 3FYPA 1ECQA 5EFFA 2ZADA 2HMCA 4Q32A 4C1KA 5MKGB 1XLLA 3GC4A 1XRFA 3QZAA 1ZPTA 4MJMA 3H4XA 2PTYA 1C90A 4FSAA 1LRTA 3LSBA 3DAQA 2AL2A 1A3WA 1F9CA 3JW7A 3LPOA 4MVAA 1A80A 1W9UA 4FPSA 5AYXA 5C54A 3W2LA 4FMVA 4HP5A 4H9ZA 4UIOA 3H2FA 1M65A 1PX4A 3B40A 1V3LA 1CXLA 4LVFA 3W7RA 3RNDA 3RXZA 2Y7EA 4GIRA 3HG2A 4M81A 4DJFC 5HNNA 5DBTA 4RW3A 2JBMA 2NLYA 3DCPA 4LUSB 5AC4A 3BMXA 1TVPA 1M3UA 4PRWA 1OVDA 1UYQA 4KRUA 5DMLA 2CIPA 2VWTA 1FWRA 4Y9OA 4QIUA 1W1IE 1IWBA 2QCEA 3NYDA 5D33A 2ZZ7A 5C5YA 2OKOA 1VEOA 4ZCWA 5AYIA 1E0WA 3EB2A 3BAXA 3WK1A 7REQA 2CFFA 5JUVA 4IIFA 4P2VA 4B2DA 5TBOA 1EDQA 4GZ7A 1LBLA 3L5LA 3W00A 3NPUA 3WMCA 3UETA 1YMYA 3I4KA 3NQEA 1K70A 5I3HA 4AY1A 1TQXA 2JE8A 2ZZ1A 1CXIA 1BWKA 1QI3A 2OO6A 2OEJA 3QEZA 1QT1A 2ZZ3A 3EX4A 4US5A 2OQHA 2PUZA 4OU1A 1B4KA 2D20A 4PMOA 4D8AA 1GT8A 1O5XA 3OBKA 4ZR8A 4G7EA 4TVUA 3DI0A 4AY7A 3IVUA 3TYUA 2HBVA 2HS6A 4UTWC 2JF7A 2QDEA 3LGEA 1O66A 2PWGA 4BF9A 4GYPA 2QNEA 3C4UA 2DZWA 2YLAA 1UWSA 4MF4A 1SYTA 3B3DA 3E2RA 4WKHA 4URIA 3S1UA 3WLOA 5AECA 4AH7A 5JIWA 3W25A 2W67A 4FK9A 2CNCA 3AO0A 1TVLA 1LOQA 2D24A 2A3AA 4AQLA 2PLCA 3M41A 1S1PA 5DF0A 3RR4A 3U2EA 1TIWA 3E12A 3T08A 3V75A 3I4EA 4QXIA 1QXLA 5IHSA 4Q22A 3W2JA 5BCAA 5JH2A 3DKLA 2P76A 3NQCA 1E3ZA 3OYZA 3K4DA 1V3HA 1XCWA 2YJQA 3I3EA 3Q45A 1X7FA 2VZSA 3T81A 3ARXA 1Y0EA 2HVNA 3KTSA 3C52A 4LCSA 3S1WA 3LRMA 5KETA 1U2YA 3A22A 1TPEA 2UV8G 1KC7A 4MHBA 1FWIC 4A2RA 1EHNA 2EG8A 5FF2A 3QC3A 4MWAE 1ZS2A 4LYKA 3IEBA 1JUKA 4CNTA 3KRUA 1L6WA 4YIWA 3B9EA 3QFEA 1UPPA 5AC7A 2YYTA 1OD0A 2FKPA 3ONBA 1X6NA 1NM9A 3SY1A 3FAXA 1RQHA 2ADAA 4OTKA 4QLLA 2A2IA 4D8LA 3KBNA 3ORWA 1KM4A 1S3HA 3W27A 4GBUA 4KRZA 1V03A 1ME9A 5FCZA 2A85A 4XAZA 3JUGA 3TONA 4BZYA 1GHSA 4P61A 2X0HA 1HKKA 4PA8A 5BROA 1R86A 3N18A 5DANA 3BDKA 1PKMA 1WOAA 3STGA 3QC0A 2SFPA 2J79A 1OG6A 2CCRA 4LB4A 3QHOA 3SSJA 1EPVA 3M47A 4BEQA 7ODCA 3IRDA 1FFRA 2Z6IA 1K7XA 4OQVA 1JL8A 2E5DA 3GZ3A 1OWQA 2AOSA 3VCCA 4NZFA 1YBQB 2QJHA 3UYIA 2XHYA 7XIMA 2QVHA 3CU2A 1PZ2A 1HQTA 4W5UA 4JY9A 5DRIA 5GQBA 4KESA 4AZIA 1TV2A 4HNVA 3LNPA 1ONEA 4WKFA 3O6AA 2QUNA 4U5IA 1BTCA 1YXYA 4ZSTA 3NDZA 2FTWA 1SO4A 3P61A 4H2CA 3PB0A 3A3XA 1DWAM 4DJED 1XBYA 2WKGA 1FXPA 3BPWA 4PUNA 3AHXA 1B3OA 2WC7A 1BGAA 1OCBA 3A4WA 3NQVA 3W2MA 1MW0A 2FHCA 1PCWA 1UKPA 4L5ZA 1NAL1 2A0NA 1KM6A 4F3HA 1PCKA 3UPBA 3WZ0E 1E6RA 8RUCA 3OLDA 1GKRA 1M1BA 5LZLA 1KCXA 4RPPA 5I5RA 4HU4A 4LANA 2HE8A 3IJLA 5H8MA 1HW6A 1I6NA 4V1XA 5FEZA 1THFD 1QOPA 3RUBL 1FWDC 1DV7A 2P3EA 2E6AA 1B4EA 1XYBA 4DUWA 5DXYA 5G4WA 1TPVA 3UVAA 3CEUA 3VIGA 2Y7FA 2VWSA 1UZHA 2Z1WA 4H2HA 1W3HA 3SECA 1WAWA 4PE8A 3BL3A 1FWGC 2R9RA 4C7GA 4Z42C 3I65A 3L2IA 4CCEA 2CPUA 2C19A 2BVTA 1CWYA 4PCSA 4B90A 2DQWA 4UMBA 1EXBA 2ESCA 4TUFA 1EP1A 4AVOA 2NT0A 2FZ8A 3BAKA 2YKKA 2F38A 3IGSA 4LBSA 1A5MC 4MLJA 3MKVA 3AXXA 4XTDA 4H83A 2VHLA 1E6XM 1UH2A 3GBDA 4NHVA 2ZDRA 1UUMA 4JX4A 3IUHA 4O4WA 4DPPA 3M0KA 3GUWA 3FA5A 2C3ZA 1V77A 5AYBA 3CL6A 3UU0A 2R24A 4G56A 2P5NA 2JFEX 3M4HA 1VGAA 1KWGA 3VIOA 2WC3A 1CBGA 3M07A 3K2GA 3A4XA 3CMGA 1DWFM 5M3WA 4A3YA 4DO4A 3TYDA 1F07A 1JRBA 2G5WA 1SJDA 1TX0A 1H7NA 3WG6A 2V38A 4ZQOA 3FHAA 3UA4A 1OX4B 1XH0A 5I03A 3SAZA 2NZLA 3CZEA 1REQB 1R87A 1WOBA 3TC7A 3WNLA 1IGWA 2NQLA 4HQVA 3NVDA 1F3EA 1Q13A 3XINA 4DBEA 3GHRA 4B92A 2PC4A 1TE1A 3QGKC 4XAFA 4S3EA 1W0MA 1F6YA 1O1HA 4U3CA 1R8LA 1V6TA 1HJWA 5I3IA 3LUTA 4D6EA 4RE0A 4JX5A 5K9XA 4UCGA 2X0SA 2A3LA 4QCFA 3HU7A 2EPMX 2Y4SA 4OHQA 4JR5A 1J96A 1OIFA 3BSMA 2BGSA 4RDVA 2V3DA 1CGYA 2WANA 4F0SA 1E9YB 5D9OA 5GJPA 4ADUA 2PLMA 4DJEA 5CGTA 2W79A 2DVXA 5GNXA 2RUSA 3BAWA 3BJSA 4GFSA 3N4EA 4JD4A 4WX2A 3EMZA 3WQCA 3C56A 6A3HA 4ES4A 4W85A 2YL8A 1LBFA 2V30A 3R8HA 3VOHA 4LYPA 2B4GA 1L9WA 1YX1A 4GPNA 3KOFA 4KWUA 5DMMA 2ZBTA 4IUGA 4B3ZA 5LYRA 3RM9A 3IIXA 4ZL1A 3Q94A 1OGSA 2VENA 1XP3A 3ZJ8A 4O17A 2YBTA 3O07A 1JPIA 1FH9A 3UP8A 4GIYA 4JTHA 3L7RA 5E9AA 4C5ZA 3SY8A 3KVLA 1H7RA 5RUBA 3HO8A 4ZB2A 1G4PA 1A5CA 1RPKA 4XD6A 4MNJA 3P0WA 5D2XA 3DHPA 3W7GA 4DYJA 2PWEA 4H4IA 1S2CA 1NOUA 4JTKA 1O7AA 1I75A 3PZUA 3EXSA 4QCEA 3ELFA 3DBPA 1JCXA 1J12A 4GJIA 1JPKA 1UG6A 2D69A 1KCZA 5EMKA 3DYPA 2CW6A 3PB2A 1FHVA 3W2UA 4Z1YA 2JGQA 4UXDA 4IPJA 1XLFA 3EWXA 4EF9A 3WDPP 1TR9A 4KBXA 1TPC1 3GBEA 3HQ1A 1CGUA 4WUIA 3PS7A 1K8CA 4HTBA 2VOMA 3ZVIA 5CC3A 1KXVA 4UOJA 2CESA 2WVSA 3K4WA 3RIKA 1E72M 2E40A 1X1NA 1DIOA 6TAAA 4FF5A 1NQ6A 1TVNA 3TSBA 2BY2A 3EA2A 4CQ8A 1P1XA 3G18A 4S1FA 5HMSA 1AJ0A 1PZ1A 3WNMA 4BY3A 1W1TA 2GUUA 2XINA 3WELA 2ZWZA 1CW2A 2DW6A 4DJDA 3AMLA 3K1GA 3CWOX 4UQ9A 1NVMA 2WJEA 1DE6A 4EACA 4HOWA 3NYZA 1PXGA 4YTUA 1J79A 3MY9A 2PPGA 1V7AA 1UH3A 4ZVJA 1XH2A 2VM8A 1A5KC 1TA3B 3W74A 4MAVA 3WEMA 3LCFA 2QGHA 1LROA 1IYXA 5HNRA 1PBGA 4XISA 5HUOA 2NX9A 4EK7A 3OW1A 1GW9A 4X2RA 1H41A 2DT1A 2VC9A 4MYAA 4K36A 3UT0A 2H8XA 1J6PA 2DSUA 2DH3A 2VO5A 3MYOA 1E6QM 4R53A 3LLXA 5D2WA 3UWQA 4ZO8A 4UTUA 3PULA 2Z29A 3RM8A 3F2BA 7TIMA 1JQVA 3MDWA 1Q7QA 4ZE4A 5M1TA 2XGIA 3WF4A 4HN4A 1N8FA 1D7KA 3BLEA 3HGJA 3LLFA 1P0NA 5CQ1A 5J5RA 2E6YA 3S1VA 4CQDA 3KHJA 4FA3A 3ZJ7A 3STCA 1Q6DA 4F9DA 5DT7A 2FMNA 4NILA 4L61A 3ZSSA 4CEXC 2EQDA 3WFZA 4UBPC 1LT8A 1QPQA 2PCEA 3DX5A 4WSKA 3M5ZA 4N4PA 3G0UA 4YMZA 3TROA 3ARVA 2PD5A 4HHHA 1JPMA 5EL1A 1PZ0A 2GWGA 4PMUA 3II1A 1WZMA 3OLEA 2IW0A 3TR2A 5I23A 1E9ZB 3O6YX 1IZCA 4XZBA 5T9CE 1MZHA 4QSFA 3AOFA 2ZKMX 2R1PA 4Q4MA 1UHVA 1C29A 5AC5A 2WK2A 4QDMA 4AZ6A 1ZHAA 3P8JA 5A94A 3AZRA 2YXOA 1VB9A 3HG3A 3CHDA 1F76A 4JIIX 4LV9A 4GX8A 2PE4A 1PDZA 3WKZA 2DT2A 4JHOA 1W32A 3UCCA 3O63A 3V5CA 3NAVA 1F74A 4B4HA 3PBUA 5FJTA 1WYIA 5LIYX 1CB7B 1I2RA 2E7FA 1AODA 4X0NA 1MQQA 3SCWA 1RZMA 4MNKA 3LB0A 3ZMRA 1KGWA 2WZHA 1ITQA 3C2EA 1PX3A 3OVGA 3FEMA 3M0HA 1AQ0A 3F4DA 3WMLA 4UZSA 4ACZB 1LORA 1OFDA 2OG9A 5I00A 3P80A 5CBBA 4HT3A 5K9DA 3T6CA 4JIQA 5I78A 2V2HA 1MI3A 1ML1A 1VPQA 4Z1CA 3CQHA 3W9ZA 3T09A 3WUFA 3WQGA 3HJZA 5FJPA 3GNDA 1T41A 1XIIA 1B2YA 4PL2A 2NV9A 4X9YA 4R85A 3C0JA 4ASTA 1YNQA 3UFYA 4O1FA 3IJDA 4Y9MA 4JTSA 4JNYA 4MNLA 2CC0A 1E6NA 1CXEA 3KBVA 4C6KA 4ZFCA 1UC4A 1UR4A 1I2QA 5IXEA 1KA9F 4FXRA 3ZWSA 3AROA 3PF3A 2WSRA 4O54A 2ZVRA 1IEWA 3WSUA 3QTGA 3E5BA 1U1HA 3FS2A 1GPWA 4AAJA 3K13A 9XIAA 2X40A 2XJ7A 4QTGA 4B3KA 3LN3A 3UW6A 2P3ZA 2BY3A 3KLKA 1KKRA 3EOUA 4UQCA 4K8GA 3VM7A 1DXFA 1GYLA 4B16A 4JAWA 3TZNA 1LUCA 4UUIA 3V0TA 4E3TA 3TX9A 1SFTA 1GKQA 3KCOA 3FJNA 3NQAA 2YCIX 2HNHA 1BYAA 3WQFA 4B9YA 1KBKA 3W7EA 1V08A 4CCZA 4PUMA 4W93A 4NX0A 5C55A 5EMMA 1AH3A 3MU7A 3IAPA 2CLHA 1B90A 1S3TC 1U30A 1JI2A 3N6HA 4H00A 3R10A 3NQMA 3VOGA 1G69A 4H04A 1HIZA 1UUQA 1ZBKA 4HU0A 4IZGA 3PSWA 1JYXA 3W87A 2PDHA 2F6UA 3TOYA 4KWSA 2X7WA 1KTCA 4RJEA 2G37A 5FSDC 3HA1A 1NDVA 2QULA 1DJYA 2I57A 1GVQA 3GAKA 2AKZA 4LF2A 1RK5A 3NR0A 1B57A 1RP8A 4RPQA 4Q8MA 1LWHA 1JZ5A 1P0KA 1PS9A 4DZAA 2J77A 5HJYA 3L9CA 2CLEA 1KGUA 2ISFA 2C7FA 1L6YA 2XGZA 3N2CA 4IMFA 3WN6A 2H3DA 2CBJA 2WCAA 5FA5A 2BG5A 3O7UA 3KBWA 1LL6A 3LK6A 1GJPA 3CJPA 3V1HA 5CJMA 1ZCOA 4F2BA 3E0WA 1ODUA 2GFTA 2B31A 2WV8A 2PDQA 3UXIA 5I02A 3KBSA 3KM8A 4J3UA 1A47A 3HGOA 5EYWA 2QUTA 3BW3A 1KXTA 1W3TA 1QPRA 2DU2A 1F8IA 4EPEC 1JCLA 1ZU8A 4K39A 4R7JA 3UEQA 4HPHA 4P8UA 3H55A 4XUGA 2WSYA 3GZAA 1BQCA 1HFBA 1OBAA 4L56A 3A9BA 5H8UA 3IUDA 4UR7A 3W1QA 1RJQA 3TQKA 3VIKA 2E5CA 4P8WA 3NVTA 4O13A 2ON3A 2QW5A 1E40A 4GMEA 1OFBA 5HINA 3C2FA 2V69A 2QDHA 4U2ZA 4AIUA 5HQEA 4CN1A 3QV9A 3BW2A 3DHUA 1PHQA 3FAWA 4IPNB 1OFRA 1TIMA 1Q45A 2ZUUA 2XTKA 3GVRA 4EIVA 1PKLA 4KFPA 2FH8A 1F8MA 2ZC8A 1UH4A 1EB3A 2ZZ4A 1RK6A 3TXZA 4PODA 5ABTA 2KX9A 2ACRA 4MWAB 2RKXA 1I2PA 1KCKA 4MFEA 3QMTA 2RDWA 2DVUA 3SQSA 3KOYA 1XL9A 5I6SA 1FUYA 3K8KA 3LNMA 4HK6A 1K9DA 4HHLA 1SW7A 2QF7A 4CQAA 4LC8A 3UCDA 4ATWA 1BPLB 3VNMA 1EP2A 2EF9A 2BWGA 4PEKA 2J7GA 4GJ1A 4O0QA 3CBWA 3TUUA 3OVRA 2VFGA 2W27A 2ZOXA 2C0HA 4DAIA 1V02E 1MQRA 4EXBA 5C9RA 4L1GA 3G6LA 1Q6LA 5C6MA 3ITTA 3E49A 4JXCA 3F4CA 3RX4A 1WX0A 3P93A 4PYSA 3WNPA 5FL1A 3SO7A 3AU2A 2OODA 3LV6A 1W17A 1IR2A 1SMDA 2YCLB 4IHCA 4I9MA 3B03A 5E0CA 1QHPA 1EXPA 4QBXA 2OB3A 2DSWA 2PDWA 3QV8A 2WHKA 4C6QA 2Z2AA 3BGAA 4ZO9A 2XIBA 4DWDA 2FVMA 1RR2A 4ERGA 4GNKB 1XM3A 3B05A 4IXXA 3H6OA 3S5SA 4JZ5A 6XIMA 3AS1A 3STFA 2DT0A 3HBLA 3WQVA 2Y0FA 4IMAA 2J13A 3V36A 1ENUA 3DC0A 2RH9A 5CBJA 3BJTA 2PSNA 2CWNA 2OXNA 3DIPA 4AUBA 1BF2A 2Y63A 2V5DA 4YHGA 3WLRA 2FYMA 2J24A 4PUDA 1LL4A 3FEQA 3SUTA 1QNSA 4LS2A 3I7QA 1S2UA 1YTEA 3KP0A 4RNIA 2VR2A 1UD5A 4Q6XA 1J2BA 3EX2A 1POKA 4YTTA 3IANA 5D30A 2VNCA 1V7YA 2E25A 3D3FA 1XLEA 4V2XA 2EJ1A 3W6YA 2R1MA 1L2QA 2EHHA 2J8TA 3MUIA 3NDOA 1BAGA 3NQGA 5BXSA 2VEMA 3CIWA 1E6ZA 1DQXA 3LV5A 2BHUA 4F0LA 4C6PA 3BOXA 2Z7GA 3LTYA 4CD6A 3UWWA 4FALA 4GJJA 2W62A 4JFSA 5LIUX 4B5XA 4GI8A 3E1F1 3S42A 2XN0A 3I6RA 2INEA 1VAHA 3MP5A 5AOUA 3L4YA 3WL0A 1YEYA 3A5VA 1WKDA 3KVKA 2ZA1A 1E4LA 3BH4A 3MB9A 1A5LC 3UF9A 2HWGA 1XIDA 1M9HA 4REQA 4BJHA 3O06A 2I5IA 3WK2A 1W5OA 4ICMA 1JD9A 2CLLA 3UJ2A 2XUCA 2BLEA 4NYUA 1B0IA 1IT0A 2WMJA 4GKLA 4U31A 1FWTA 1HL2A 4B5SA 1TTIA 4Q7BA 2XFRA 4KRTA 5JBDA 2GGJA 2W6RA 4PTDA 1DYSA 1OIMA 4AEFA 3FA3A 4E4PA 1B3VA 1IXQA 2Y2WA 3KS5A 2X1IA 3IGHX 1F5ZA 1JAKA 5E0KA 5FD0A 1V0NA 1TV4A 5CZTA 3W4RA 4I7VA 2QCMA 4PMZA 1TPH1 3HN3A 4Q4RA 3TSMA 1KM3A 2J88A 2FGBA 4HPXA 1MRQA 1DE5A 4JNMA 3VMOA 3ALGA 5F2IA 1S5NA 3AXKA 3GW3A 1E9LA 4LU0A 3M9YA 4BKNA 5FAGA 1WDSA 4HA0A 4A29A 4H3DA 4ZTXA 2EG6A 2DY3A 1FX6A 5D8ZA 3I6TA 3NQDA 1OD8A 2CBUA 2O9TA 3TN4A 3CMJA 1TFVA 5LHFA 2Z0IA 3MVIA 3AISA 4GY0A 3GDMA 3VDGA 4V28A 3GTHA 4A8NA 4FX7A 4AZCB 5I07A 1VHCA 2CBVA 2IPFA 4ZB5A 2UY3A 3SUVA 3W38A 3P8IA 3WLTA 2YCEA 3OB8A 1IT8A 3R79A 3TA9A 5CPMA 1ZL1A 5FEXA 4IQLA 4W7UA 3A3WA 5KTLA 1YQ2A 4DUXA 1NFGA 4GVIA 3HPZA 3HPSA 4UC5A 4FI4A 1D7FA 3DOPA 1XLGA 4JPGA 5SWUA 3VFLA 3W1AA 3KAOA 4F4RA 3DEQA 3W1XA 3E6EA 1ZJIA 3JZEA 2CLFA 2EO7A 1A4MA 1OY0A 5JVLA 1M41A 1TJ1A 4C1NA 3IUIA 4LTSA 3MKCA 3QM3A 3N11A 4OJYA 4N9EA 4ZQRA 3NQ2A 1UD6A 2VJXA 3VKDA 1Q4NX 2ZX5A 1E73M 3AHTA 4W86A 4AFYA 2VYOA 1U83A 1C3FA 2WJFA 3WLIA 1UKSA 4HB7A 5EMUA 4DNHA 1I0BA 1ZQ5A 2RDTA 4MUZA 4AHPA 3WUEA 3OZPA 1GEQA 1MYRA 2ZA2A 3FY1A 3ITXA 2WBKA 2D0FA 3URQA 4DJFD 1OEPA 1QCWA 2A3EA 3WD3A 4M0XA 1H1YA 2ANUA 2OLAA 2FDSA 4AZ5A 5CEWA 4KCTA 2J6XA 1M7JA 4NAFA 4WGXA 3FXGA 4G7FA 4AWSA 3IPWA 2RFGA 4DBSA 1ALDA 5KMYA 3E9AA 2VFIA 5KSWA 2ZTJA 1RY8A 2FZ9A 3MMWA 5FIPA 3SZ8A 2D22A 3W7DA 4WVXA 3M7WA 4EF8A 4JTUA 1DJGA 4RZBA 1T99A 3TLQA 1VCVA 1UROA 4HNLA 2OSYA 3S5OA 3L0GA 4HKPA 1FKXA 4GVHA 4KGJA 1T40A 1TJ2A 4OV4A 1SMAA 5BOFA 3IIVA 3THQA 1WXJA 1W1B1 2NXHA 1K7EA 9RUBA 2CHOA 1G7UA 1X1OA 1OINA 4M6QA 4DX3A 3CTLA 3MMTA 2NQJA 3VCNA 2QCCA 3ZVHB 3N3MA 2VD9A 1S5TA 1Q6RA 3CUHA 1FHDA 4J27A 4TMCA 1D3HA 5F1VA 2ZQ0A 1VZWA 3EEGA 1TX2A 1AL8A 3VIIA 4ZA0A 1XGZA 3RPTA 3W88A 2TODA 3CUXA 4CD4A 1WQ5A 1X1ZA 1AJ2A 4WRHA 4I8YA 3CTTA 2C14A 3GAYA 1CXHA 5CLTA 4PTXA 3G24A 4IJBA 1XSJA 3PUGA 2PLJA 4GK8A 1LLZA 4NAEB 3VD9A 4A22A 2DUXA 2AQOA 1SO3A 1GJWA 2Y7GA 2AAMA 1G5AA 5T8GA 1CENA 4DIAA 3NPVA 1XWYA 3VA8A 3PM6A 3DFSA 5E9XA 2V3FA 5HAOA 4MFDA 4MPKA 2E6DA 4Q8WA 1EO5A 1YW1A 3HMCA 2JALA 2WNWA 1TJRA 3R0KA 3W70A 1YPIA 4A2SA 2OTDA 4IQDA 1W3IA 2O4MA 3TYBA 1K8XA 2W91A 2CKSA 2Y61A 3S6DA 3UNDA 5D2TA 1V3JA 2FB3A 3GWQA 1ESWA 4PB4A 4R34A 1WKYA 2QPXA 4B5VA 1PHWA 4F48A 4E4FA 1N8IA 1ONRA 1QNOA 4X63A 1XGEA 3PZGA 1WDDA 3GNXA 2WZTA 3VMNA 1UR1A 3CB8A 1TELA 5D02A 3P82A 4J3VA 4WZHA 4CCDA 2OEMA 4XD4A 4LVDA 3NXFA 1I1XA 2WC4A 1LRQA 3CWNA 5IBXC 3R5EA 4DJFA 2VFEA 1R3SA 5TF0A 1JZ3A 2OELA 3DN5A 4NZJA 4QM1A 5CAHA 5C9ZA 3DFQA 4ZSUA 4DF0A 1KBJA 4O1AA 2H3BA 4MB3A 4FOKA 1QBBA 2V6AA 5BRPA 1GYNA 3KWXA 3D0CA 2P53A 1YPFA 4Q4SA 1FWJC 5AHLA 3NZGA 1MEWA 4KWWA 3B06A 4IH3A 4HYRA 3M16A 4AX7A 3AHZA 5I3JA 2FTYA 4R5EA 3TOPA 2C1IA 2OPJA 4E2OA 3U8GA 1AUSL 5JH1A 3S0CA 1MUCA 1K6WA 1VR6A 4H8NA 4Y9PA 3MC5A 1AFSA 3AIQA 5LNWA 4WKAA 5HWMA 2EKCA 3R6IA 4TQTA 1CGWA 3EBVA 4UTWA 1RJPA 1F4HA 4G2DA 3TK7A 4U33A 1RCQA 1J93A 2F2KA 5TQLA 1TR1A 1EBHA 3CHFA 3EXRA 2BOEX 1BVNP 3DFHA 1ICPA 1N82A 2X1UA 1VCFA 2R82A 1XX1A 4XVDA 2FGLA 1GZJA 2E6FA 3L67A 4YS1A 3AUOA 4ZO7A 3S8HA 2O7QA 3LA4A 4CNNA 3M64A 1UJPA 3KE0A 2QJNA 3V18A 4N9BA 2FHFA 3CL8A 1CCWB 1YIXA 3AS2A 3WDJA 4AIOA 5ABGA 2OMAA 1W1PA 5EBUA 2OSWA 1SR9A 3WCZA 3B8DA 3R94A 3T55A 3XIMA 3S2NA 3VINA 3BG3A 1JD7A 3E0VA 2YBVA 1YXCA 3GHTA 4L6DA 2I1OA 2ISSA 3VD4A 5CC7A 1ICSA 2J7BA 2QIIA 2HISA 2IQDA 3CYJA 5CJNA 3PFMA 3CL7A 3TQVA 3MMUA 1OX6A 4UQBA 4H9YA 5A95A 4ZQMA 2DSVA 3T9PA 3PTQA 4KFOA 4GQ0A 4D6HA 4M19A 3MTWA 1PYMA 4JFWA 4M51A 3IIPA 3NFUA 1OF6A 3JS3A 3XISA 4FNPA 2H9AA 3BLOA 1NF0A 3T05A 2PBGA 3T8LA 1YDYA 1NDWA 4HYVA 3KW3A 2FPYA 1E1CA 1RBAA 4Y6GA 4GABA 1Q8AA 4WSJA 3R89A 2DT3A 3A47A 4G1NA 4O0ZA 1BF6A 1TZZA 3VC5A 4F79A 3TAOA 3V35A 3M1ZA 4OUEA 3VD5A 5E93A 3SR7A 2PEVA 5FF3A 4I7UA 1C7TA 2J8GA 2FDMA 1V6WA 5GJNA 4ORIA 2C8NA 2DZXA 1ZJAA 1E9IA 4IP7A 1YXDA 1SZGA 4GBDA 1W91A 3L0KA 1Q6OA 1RBLA 3H2CA 4DNMA 4Q8TA 1TE6A 4GZEA 2YYUA 4Q8QA 3TJIA 3SCNA 4JL1A 3RM4A 3VKJA 2UY5A 5A2AA 1KTBA 5EMYA 1PEZA 2OKTA 1ITXA 3VNLA 5AHEA 2WMIA 5CZKA 4EPBC 3LCLA 2XZ9A 2VC6A 3AS3A 2YA1A 3E3HA 2GJNA 1JCNA 4MSSA 3W23A 3QSTA 4O19A 1Q6GA 1I4NA 3LRLA 2X8RA 2GL5A 4J5NA 1CIUA 1VEMA 2ZRXA 4NRRA 1SR0A 4FLOA 3VGBA 3UBPC 5A8GA 4AD3A 5FACA 3OZYA 3NPXA 1R2RA 4TX6A 4UMCA 3FA4A 4KGLA 4Q8UA 3QOMA 2J9XA 2DPEA 1GQLA 3ZSTA 1NARA 4GZJA 3MUCA 1BYCA 3W37A 1GCYA 3BC9A 1AD1A 1XCXA 1F3TA 5AHMA 1Q6FA 2YB4A 3WENA 3GTFA 1NFPA 1W31A 4NVTA 1XYFA 2WHLA 4MPQA 3PZMA 4UFLA 1GQJA 2ZX6A 1J0YA 2AL1A 1TWZA 2I16A 2CLOA 2WSPA 4UZUA 3NZQA 3F4WA 5A8NA 4LBRA 3EDDA 2CU0A 8XIAA 2EEXA 3EMCA 1DJQA 3QRHA 3TNOA 4KF1A 3HURA 4GXMA 1WUEA 3RILA 2I56A 2R1KA 2FPTA 4PMDA 5AB3A 4Q8NA 1JFHA 1JJKA 4YJ5A 1WV2A 4WHBA 1HKIA 2EKGA 3ZM8A 3G2GA 4HZMA 2VFFA 3GHUA 4UTKA 1V3IA 2PF0A 5GPRA 1LG1A 5CPQA 4PCNA 3P5ZA 3MCOA 5AC6A 1OFEA 1MUMA 4K38A 1GVSA 1SJBA 4Z2GA 3PZVA 3UPWA 2ZRUA 1GKPA 3TAKA 2B81A 2PDPA 4TV6A 4ZBCA 1VQTA 4W4QA 2GUYA 2I5GA 4G6CA 5C9WA 3PBYA 4LPCA 4D6GA 3VVGA 4UWMA 1EBGA 4GH3A 4HNNA 1FWWA 4GO9A 1IWAA 1UJQA 1FTXA 2EG7A 1S5WA 2ATMA 2I5QA 1EJ7L 4UNIA 3GXFA 1HX0A 1RPXA 1BQGA 3SFKA 2Q3RA 4R9XA 3RPDA 1DWIM 4IGMA 5CSYA 4WY0F 3N25A 4IX0A 4QROA 5CSUA 3GK0A 1QWKA 4UFMA 3N3TA 3W7PA 2JKPA 2JIWA 2BDQA 2BVWA 3QGAC 2OT1A 5CCZA 2O9PA 5K2ZA 4TX9A 4QEHA 2Y7DA 4AU0A 4JDBA 1MDLA 3AIRA 5I24A 4FXFA 4K1WA 1OB0A 4BWLC 5AZ1A 5LNVA 2INFA 4DXXA 1ISYA 1ADSA 3G0SA 1IXNA 1PE1A 3EDFA 1FFQA 2VGFA 3KEHA 1FXQA 3W02A 4A35A 1ONXA 3GC5A 1W6TA 4NT0A 4QJ4B 4WDTA 1DHKA 1I2NA 3O2LA 3WD4A 3UXAA 2PLKA 1AJZA 1SFJA 1EPXA 3THCA 1W5QA 5FJOA 2PDXA 2J25A 5HWJA 4NG3A 3LLDA 3VGHA 6REQB 1GZ1A 2WNNA 3PG8A 3RO8A 3ZR5A 1KFKA 4JTLA 3K8MA 3OZMA 3Q58A 3QW4B 4QE4A 3BAYA 1L6FA 3Q67A 2WJZA 3A24A 1OYAA 5ABFB 2I17A 3OU8A 5AZ0A 4HPNA 3O0KA 4GLEA 2QCNA 2NVAA 2IKHA 4H9MA 3KOXA 3H70A 4IPLA 4WXYA 2D1ZA 1KV8A 2HVMA 3O6CA 1QI0A 4IIHA 4L4MA 2MUCA 1OHLA 1J11A 1B30A 1R2TA 4FLQA 4LCRA 3KWSA 5LHEA 3WLSA 3KCJA 2DZVA 1J0JA 4HU3A 3TQPA 3VGDA 4C6OA 2C1GA 1X8CA 4U3AA 5LSMA 4HZ6A 4NYYA 3MO7A 8A3HA 4DHGA 4E2BA 4UOZA 4PZVA 3CGTA 1QHZA 2YFNA 1XD0A 2TPSA 2XVNA 1PTGA 5KITA 1K8YA 4M8UA 2GJPA 1GQIA 3CUJA 4Q6JA 3T0BA 4XAYA 3U48A 3K4AA 4CUCA 3D6NA 3S1XA 1LQ0A 3KDOA 4NZCA 2YDRA 1KV5A 1UR8A 3B0XA 2VRKA 4E0CA 2NUWA 2GJXB 3FHQA 4HOZA 4XAGA 1UWAA 3WMSA 5D04C 4IP4A 5BOEA 3AIEA 4L64A 1OZQA 5E09A 1KO0A 3BSHA 2BGQA 2X16A 5HJLA 4Z1BA 1J01A 4PFMA 3GVQA 2REQB 3T0TA 1G4SA 2GQ9A 5C70A 3R25A 5HPCA 3RCNA 3TTOA 3QOKA 4O8AA 5FJIA 3VO0A 2Q6ZA 2G3FA 2PGWA 2MANA 3R58A 4DELA 2ZUWA 4LY4A 3W7CA 2OWWA 3W1RA 2ZXBA 3CXOA 3QKEA 4O53A 4CGTA 1UUOA 3O6DA 1S1RA 3LSCA 4WLCA 4PUEA 4MGGA 5DCBA 6ENLA 3S83A 1F4AA 2ZRVA 4ZODA 3ITLA 1V0LA 5A3HA 4GQQA 4P8VA 1K8ZA 1FQ0A 3B4UA 3BW4A 3OJGA 1B3YA 2Q8LA 5HR7A 3S6TA 3GE7A 4PR4A 4NQ1A 4RXFA 5TAOA 3NNTA 1NWTA 4XKYA 4E8DA 2P0IA 3G8EA 5G2WA 3APGA 4I9JA 3V0SA 3QPEA 1IV8A 2PP3A 4J3SA 2VFHA 4GWEA 1B5TA 3LCWA 1P48A 3DYMA 5G5IA 4H8HA 2CLMA 5TIMA 4H6KA 3AZTA 3M44A 3KRSA 2D0HA 3U4FA 3NCOA 4UQAA 4XBJA 1B3WA 1UASA 3SRHA 2A6NA 2ACUA 1BXBA 4JDYA 3DHFA 2WQDA 3G1VA 2CXGA 4MWAC 3MWAA 3NWRA 5B7ZA 3PWGA 3GTIA 3UA3A 2R1NA 1V8EA 2C6QA 4O16A 4GHRA 3RX3A 4NY2A 4JTTA 4MKVA 3MYPA 3F03K 3IIOA 3SFWA 3EWBX 3PTMA 1GTHA 1SO6A 1Z3NA 1TPDA 1GG1A 1A4LA 3FFSA 1IIHA 5CLWA 4D2JA 1XI3A 4NIRA 3L21A 5BOOA 2Q01A 1X8FA 1NTHA 3CV7A 1P6WA 3TJXA 3SQLA 3LEPA 4AD5A 1NFBA 3DBNA 3OQ8A 1OGBA 4KH2A 1CX9A 3F5KA 5LIXX 3W86A 1KLYA 3TYEA 3GIQA 5EFDA 2DDXA 1KTNA 3B0VC 1R3WA 4MM1A 1Q6CA 3EWWA 4BA0A 4JTEA 1RUSA 3CHVA 3TU9A 1KKOA 1Z89A 2WVVA 3PZOA 4WSHA 4ZQNA 4NUWA 3F4VA 1NJJA 5C9UA 2A3CA 1EOKA 2PWHA 2WZIA 4GRSA 1YDOA 2QJJA 4QDPA 4DQWA 3MP3A 2WZMA 1EC7A 3RPMA 1VH7A 4ZOAA 1TPWA 3PZ9A 3AU6A 4P7OA 4DXKA 3S46A 3H2EA 5BXPA 1EUAA 4J3XA 4EWJA 4IFKB 1BSIA 1IHIA 3LHWA 5D9NA 3WQWA 2FFCA 4PUKA 1EIXA 1DTUA 1Z32X 2FZNA 5IHRA 3N12A 1GVFA 4I6KA 1KM1A 1NWSA 3KTXA 5E6ZA 4IM4A 3SB0A 2ZZ5A 3AIWA 5HXMA 4S3CA 5CG0A 5BYWA 1VEPA 1W1VA 4FF7A 3MHGA 3N4AA 1JZ6A 1BYBA 3G77A 1GVIA 5A6AA 3HMJG 1HGYA 3AC0A 3TZFA 4TV5A 4HSHA 1POJA 1JG9A 1CNVA 2IXVA 3WDIA 3ARRA 4S39A 3IVTA 1JUEA 4CVWA 3P74A 4WY0A 3MBFA 4GI9A 4HCLA 3VTRA 1E0UA 4CVUA 3AMCA 2YL6A 1TB3A 4N7QA 2QV5A 4HK5A 4DI9A 3IJ7A 3NL5A 4XZHA 1CLVA 3TYZA 1OYCA 2VCCA 4HMDA 5A2BA 5KZEA 2XSAA 2OX1A 2R91A 1QNRA 1R2SA 1XLCA 1HJVA 3AZSA 1EC8A 1AW5A 3W75A 3S9ZA 4KCUA 2OZ3A 4H8UA 5F7UA 1FCQA 4MADA 1X98A 2HCVA 1LLWA 1XYZA 1U5HA 3W07A 4BCEA 2NXIA 1UPMB 5H8PA 1XIFA 3H2AA 1GJUA 3W7QA 2W92A 4LH8A 4K2SA 3RK8A 2NLIA 1EGVA 3GH5A 5CSSA 5C7HA 5FF7A 2G41A 1V5XA 4XKMA 2PP1A 5AY7A 1V6XA 1VFHA 1ZY9A 2DEPA 2V5KA 4ZQPA 4DUOA 4QG9A 3PK7A 5LA2A 5REQA 1IXOA 1SPQA 3N17A 2E28A 1LJYA 3C2VA 1GEHA 2D3NA 4IL0A 1J10A 1K03A 4O4VA 3S2JA 2QDGA 2IPWA 5HR6A 2W66A 4RE2A 3W81A 2HK0A 2W63A 1ELSA 1TMLA 1OABA 3VNZA 1BTMA 5DRCA 1IE7C 1GVEA 3W7NA 1ZP4A 2QPSA 4IICA 5F2LA 3FKRA 3PP7A 2NQ5A 3MSGA 4LSBA 1W8GA 4W88A 1HJUA 5A6SA 1XLAA 5DT5A 4B5NA 1Z6KA 2H90A 4AD0A 4NJKA 1KGXA 3VX0A 3UZYA 3BMVA 3WJWA 3P84A 4KCWA 1S5MA 1SJAA 2VDGA 3MA8A 5G1YA 1TWDA 5D05A 4NSBA 4LJ3A 2X42A 4WDUA 4Z0SA 3VD3A 4QG6A 3F4NA 4K1GA 4YTRA 2CLKA 1VFLA 3A3HA 2O92A 2FPVA 3IS4A 3MV11 3B04A 4WD0A 3PTDA 5HNTA 3FLUA 3MUY1 1QO5A 3QXBA 3LM3A 4NNCA 3RDKA 1G4EA 4A21A 3CT2A 2Z00A 3E96A 1JI1A 4W84A 4C6BA 4XO6A 4RDWA 1Z9AA 2E77A 4O28A 3GH4A 3E0IA 2QJMA 1WE5A 3WF1A 2PDBA 3RMEA 1EX1A 3FSTA 3G5EA 1XYMA 5C71A 3UZXA 3EX3A 1BEUA 1SQ7A 4L1XA 3UY7A 3WK0A 3VYLA 2GYIA 3VNIA 2OLHA 2BXYA 4UTJA 3TMLA 2ASHA 2GQ3A 3QQWA 1PKNA 1KXQA 4QJ1A 3FYYA 1W9BM 5HBFA 4HK7A 1UWIA 4L6HA 3VZXA 1S46A 3IK2A 4HNTA 2WMKA 5LXXA 1UBPC 4HU8A 4IGNA 3BLDA 3EB3A 4U2YA 5D9PA 3PWAA 3ATYA 4QGCA 4AWEA 4NKCA 4JBRA 2CZDA 4M56A 3ZJKA 1UC5A 2E3ZA 2FJKA 4NF7A 2A4AA 1E4NA 4GA8A 4RXGA 2X7VA 2WLZA 2YCKX 2OYKA 1VPYA 3B4YA 4M80A 2AMXA 4D6JA 3D47A 3PPFA 4I90A 4J3TA 4EXQA 4CKQA 2X2GA 1C7SA 1B1YA 4W9TA 1P7TA 1E0TA 4KQNA 3UGVA 1M7OA 2Y5JA 3NO3A 4BQ4A 3W1TA 3EDKA 1E1CB 1VIZA 3PJUA 5LNSA 1VKFA 3TQ0A 3M0IA 3UWZA 3E5PA 4RV8A 1IXPA 2B0MA 4LFYA 3BCDA 3KLLA 2PD9A 1ZALA 3CC1A 4I6VA 5AYYA 4NASA 1E15A 1QFEA 2PC8A 4W7VA 2YX0A 3CZ8A 3SCPA 1LYXA 5JMUA 5E0FA 1EDTA 1ZBWA 3BLIA 1P6BA 3UZJA 3PPHA 3UJSA 1S2TA 2E1WA 4RDYA 5HQMA 3L68A 4GH1A 4WK9A 1CYGA 4U5KA 1MRAA 3O15A 2V0TA 2V3GA 4GYFA 5CH9A 4H9XA 4DF1A 4NJHA 4EANA 3CH0A 4C90A 1EWEA 1K3UA 4KWVA 2QYGA 1Q6EA 1EEXA 3L0NA 2ZX9A 4HOXA 4HNCA 3D46A 3VKCA 2GGGA 3W7IA 3R11A 3NL6A 4PTMA 4AY8A 1SGJA 2YB1A 4IQJA 2NSOA 1GQKA 1JEZA 4IIBA 5MKGA 3WH7A 3GR8A 3DZ1A 3LGGA 3QFWA 3RRAA 1MUWA 5AFDA 4JN6A 5XIAA 5HULA 3EKZA 3FOKA 4OIFA 4OE7A 3RITA 3A13A 3L65A 3GXDA 4XZNX 3N2OA 3W0KA 4AHOA 2PU0A 2F9RA 2GVYA 2TAAA 2J9YA 3LG3A 3HIJA 3GNPA 3WMBA 2DZTA 4LUSA 3PC0A 3VNJA 1DJXA 1VYPX 3UCQA 3RJXA 2Y88A 4Q33A 2QCHA 4UR8A 2BVDA 1JDDA 5FEPA 2WVUA 1GVYA 3MBDA 3SCVA 4JTQA 5BRQA 1X6UA 2QV4A 3L5MA 3B0UX 3RU8X 1X6LA 1PL9A 5BXTA 1H5VA 1XDMA 4DXVA 1TWSA 2ZA3A 1IEIA 2A1YA 2AQVA 4OUIA 4AF0B 1AH0A 4GQGA 3Q65A 2BGNE 4ZZ9A 1JXKA 4KEMA 2V81A 1GG0A 3V0UA 2P88A 1JXJA 2Z25A 1MXDA 3HQNA 1OT2A 3F7JA 1RAKA 1LRNA 3LZ5A 3R1ZA 3ANVA 3DI1A 5A6TC 3VGEA 1E4IA 3Q2DA 5G4HC 2C13A 3KS6A 4U28A 1FWHC 2WPBA 2Y89A 1GNXA 3W7KA 5E70A 4R88A 4O1BA 1BWVA 3L4TA 4NU7A 4IT1A 4IP5A 1H62A 2F61A 4F2TA 2E5BA 2ATSA 5EGRA 3FNDA 1EJWC 3ALFA 1R46A 3GDLA 1KFJA 1T7LA 3TTQA 3FK4A 1EZ2A 4FO4A 4DEFA 3UG8A 1PV8A 2PDYA 4HCHA 5I3DA 2V8ZA 4RE4A 3NA8A 3ZLHA 2QCDB 3RLVA 2HXUA 4JTAA 1I0DA 4A4AA 3GB6A 4J1OA 2Z4GA 2HQAA 4W5ZA 2NT1A 3NQ6A 4WDWA 1FVPA 3NZPA 4I8DA 4D6DA 4O57A 2QCGA 2RDXA 3GR7A 5JXQA 3P14A 4M1RA 1L6SA 4WOQA 4NZ4A 3ANYA 1Z7AA 2Z27A 3MANA 1TTQA 4R3UA 5FESA 2FZMA 1VC4A 1JYWA 1VRDA 2DZSA 4B4FA 2OOGA 3KVMA 4JN7A 3SCSA 3LDVA 4Y9NA 4JFUA 2DJLA 1NWRA 3ATZA 3B8VA 1DKWA 5H6HA 3DGBA 4FS9A 4A3HA 7CGTA 2QT3A 2CHNA 1M01A 1M6JA 2HV5A 1VP5A 4DF2A 4C6FA 4MKSA 2Y85A 3W2NA 1A53A 3PFRA 3LI1A 3V1PA 4MNMA 4JQAA 1DPMA 2J7CA 1G0CA 4ECLA 1KCLA 1O60A 4CD5A 4FAMA 4JQ2A 4OBTA 1K9TA 4GXWA 4AWUA 4F9JA 3K5XA 1EYEA 8XIMA 3NXLA 1YBQA 4C6MA 1A3XA 1P1MA 3RO6A 1RVKA 4DZ5A 3S4TA 3BAJA 1ZSXA 2CYGA 4GFIA 4P8XA 3W1UA 1KQYA 4RUBA 5J04A 3LCHA 3FKKA 2J7EA 2QZRA 4P7QA 3N29A 2PDIA 2R14A 2NX3A 1SM9A 4CLMA 1HJXA 4YYCA 4DWSB 4KIRA 4M24A 2B7QA 5EMLA 3PAJA 3L12A 4ZFMA 3H26A 1R3TA 5C2XA 4R33A 2BHZA 3DENA 1UW9A 4ERIA 3WBXA 3THUA 1K4HA 2PRMA 1GONA 4KFNA 3EYPA 3HFYA 4D8ZA 4H7VA 3RG6A 3QR3A 1TZ7A 4RR4A 1O12A 4N0RA 4P7RA 1TPUA 5AN7A 5CZJA 4P7NA 3LI0A 4NX5A 1FDZA 1LWIA 3BG5A 5FOOA 1IEVA 2V68A 1W5MA 3W85A 4DJDD 5IDZA 1XIHA 5GNYA 1SSGA 1UOKA 5DY2A 5DO8A 5FF4A 3TW7A 3B9AA 3GUGA 2GOKA 2GZXA 1AQMA 4IMDA 2W5FA 4XK2A 4YTSA 3MQTA 2CZ5A 3OA3A 1G67A 1XF0A 3REQB 1E0XA 4EP8C 3HPFA 5LA0A 1Z8AA 5F2MA 3DGRA 3MI2A 2PTZA 3LPPA 1M03A 4B5TA 1AQHA 1FOBA 4NXSA 4EOUA 2A7NA 3M43A 4KKXA 1UMYA 1EQCA 4HNUA 1ISXA 4ZENA 5LNRA 3LXCA 1SZEA 3E74A 3V4BA 1GORA 2Y6ZA 3LBCA 3UZZA 1U5VA 2F6XA 5T26A 1E70M 2Z2BA 2DUZA 4MB5A 4J2MA 3EAUA 1E5NA 4PSPA 3PUDA 1O95A 1TO3A 1Q8JA 3W71A 3LM7A 5IBXA 3UESA 4Y2WA 2FHBA 5LKYA 3LBMA 5A6BD 4FNUA 2A3HA 4P5UA 2Z1KA 1OX4A 1H4PA 5HDRA 1REQA 4WJEA 1VPXA 3MHFA 2POTA 4UCFA 1G1YA 5AHNA 5BXRA 4GUJA 2PGRA 1NH6A 4HYWA 3TN5A 3ABZA 4JEJA 4YLWA 1GUVA 4UQEA 1UD8A 4UTHA 4Y96A 3SGZA 3IARA 2HNEA 3RR1A 3C2OA 4IGHA 4KEZA 1Q65A 1GGOA 4QX4A 4FIQA 1WCGA 3C61A 2V5BA 2OZTA 4Z2LA 1CTNA 1G94A 2VTFA 3NO5A 3T40A 5AC8A 3FCPA 2NQZA 4HMCA 3G1AA 4IQEA 4WGHA 3DDMA 4YXGA 4H7CA 1ZB5A 1E5JA 2PURA 2VEFA 1JVNA 1O5KA 1XJBA 4U10A 1KBLA 2VUNA 1OCNA 3AIVA 1D8CA 2BXVA 2EPOA 2VZVA 1X96A 1DORA 1EF2A 3DG6A 2QS8A 3FGCB 2BX7A 3IVSA 5K7JA 4V33A 3O0FA 3KX6A 1RP9A 3B9NA 2NV1A 1FBAA 4JHZA 1WPCA 2QXWA 4LS1A 1LG2A 1OFOA 4A05A 1EOMA 3FVMA 3CQIA 2DV0A 2FH6A 1DIEA 4J7RA 3U7BA 4NRSA 3UXLA 2X1TA 1E56A 1KFBA 3ARSA 2FIQA 2GVGA 1EGZA 2H8ZA 2PWVA 3SI9A 1MSSA 2VXNA 4B5UA 4DM1A 1DTNA 1N2VA 1XFBA 4E8CA 3NEVA