3W2NA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-3-185
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-185
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 107
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w2nA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w2nA01
2B0MA 3G1AA 4GBUA 4MZ8A 1Z42A 2YW4A 3W7PA 5FF0A 2QJHA 3SSJA 2A7RA 4UTWC 3LB0A 2QDGA 4O4VA 2H3BA 2A1YA 2C0AA 3W72A 1GZGA 3W7GA 2X16A 1WOBA 4X3ZA 2CLMA 1SO6A 3WJWA 2BZNA 5CZ0A 3FJLA 3W7NA 3HGSA 3LGEA 3ANYA 3HBLA 1YDOA 1B4KA 2DU2A 3W83A 2OT0A 2HS6A 1OK4A 3IIOA 2GVJA 2JGYA 3W1TA 1QPQA 2E6FA 5AOUA 3HQ1A 5DCBA 5KTLA 4KFPA 4WUIA 4LW7A 1KFKA 2JKPA 2NZLA 4LVGA 3DXIA 1NSJA 3B04A 3LCIA 4P61A 1XXXA 2C15A 3QJAA 3TNOA 3SZ8A 3U6WA 5D05A 1KM5A 2H8ZA 1EX5A 1KV8A 4NQ1A 3FIGA 4DBEA 3CWOX 1X7FA 1UJPA 3L0GA 2H90A 5J5RA 3CM4A 1H61A 4JTTA 1OHLA 3UWZA 2Z6IA 3S8HA 2QF7A 2ATSA 4FXRA 4WXZA 1WA3A 5HQEA 4AXKA 3DBPA 4JY9A 1MEIA 3G0XA 3PULA 1LM1A 2Y70A 3T7VA 4UXDA 2NV2A 2VENA 3NYZA 1EB3A 5LNWA 5G4EA 4LVAA 3LBMA 3LTSA 3TC6A 3SIZA 4FX7A 3CU2A 1TMHA 3GXTA 3LCGA 3CPRA 2VEPA 1F6PA 3LV5A 4DEFA 1SQ7A 1LROA 3HGJA 3IVTA 2H8XA 3G8EA 3M5ZA 5D37A 3VFLA 3ELFA 3R2GA 5L6UA 3HGOA 3ABQA 3QW3A 1K8YA 4HNVA 2FFCA 4HNTA 1VLIA 1VPXA 3V75A 3Q94A 4XBSA 1FCQA 3CHVA 5DXYA 1B57A 1H7OA 1KLZA 1VCGA 5DXXA 4RR4A 4UFKA 2GQ8A 3PBYA 1YLVA 5HWJA 3W75A 1F76A 1TPDA 4LVBA 4OT7A 3STGA 1AW5A 5EBUA 6TIMA 1VRDA 4UCGA 2ZRZA 1IXPA 3N19B 4IJBA 1WAUA 3TSDA 1XBZA 2V5LA 3QPZA 1KLYA 2QCNA 1IIHA 3HIJA 1YTKA 5DN1A 3MW7A 1KFCA 4I7VA 1UB3A 4O28A 3SR7A 3ZWTA 2J9XA 2Z6JA 3A5FA 3S1UA 1TTIA 2O7SA 3TU9A 1KFBA 5LNVA 4FNQA 4JNMA 1F7BA 4Z08A 3B4UA 3MO7A 5G2HA 3LLFA 1TPUA 2I14A 3S42A 5FEZA 5K2ZA 1VCVA 1OFRA 4PCFA 1G4PA 4MLRA 4QIUA 1SW7A 1WXJA 4R53A 2RFGA 2ZZ5A 2A6LA 1IXNA 1SZGA 3O15A 1Y0EA 1PE1A 2G95A 3M43A 3CEPA 1C29A 1ZAHA 3F03K 3GIYA 4UMAA 3OVQA 5F4WA 1BWLA 1FCUA 3I7SA 4IX0A 2V9DA 3LOTA 1TPWA 1OVDA 4O0ZA 2FPTA 2B7PA 5C6MA 4WZHA 2J24A 4GUIA 2W0UA 3S6DA 3TJLA 2FPYA 1SO3A 5BNKA 3S5YA 2RDUA 4QNWA 3NQ8A 7TIMA 5F1VA 3TXZA 2B7NA 2J6XA 2VXNA 2QJGA 2WKJA 2R94A 2CZ5A 3T78A 4A3UA 4XWUA 5LHFA 2Y7FA 1DVJA 4M7SA 1GJPA 1Q45A 3HG2A 2DORA 3A21A 4RJEA 5C2XA 2V5BA 3F4NA 5HUOA 4UTLA 2P10A 2A7NA 2X2GA 2ZZ3A 1RR2A 3W7EA 1KM3A 1WBJA 3TIMA 4MUZA 3G1XA 5ABTA 3PC0A 1W1ZA 4Y96A 4ONVA 1SR9A 4UFIA 3C2RA 1GVQA 2E09A 5AC7A 3PSWA 1H7WA 2CU0A 3TV8A 1GVRA 1SPQA 5AHIA 4FXSA 2NUYA 1SUXA 3DFPA 3MUXA 2NX1A 1M5WA 4PEKA 1FWWA 1RQHA 3PG9A 2VFDA 3E49A 2AAMA 4DF1A 4O15A 4LNYA 5DCDA 4X22A 4Z1BA 3TXVA 1C9DA 1L6SA 4ZQOA 1PCWA 1OFDA 5H2ZA 5D02A 1H60A 5KZEA 3QSTA 1N8FA 5K3VA 4QQ3A 4IMGA 2QJIA 3NAVA 3LHTA 3SFKA 3LHZA 3B05A 5C54A 1K7XA 3NL3A 4ADTA 2CLIA 3A24A 1V7YA 4CQ9A 3NM3A 4LRSA 1L6WA 3L5MA 4MY9A 4AAJA 4HSOA 3E9AA 1V5XA 4HIBA 4WX2A 1W31A 4JTEA 1HL2A 3KRZA 5AYZA 1GOXA 2PRMA 4M6PA 4E0CA 1FQ0A 1VC4A 2QR6A 3DZ1A 2V82A 2J9ZA 3U2OA 5LGXA 2G96A 5FF4A 4LRTA 3S5ZA 1TPB1 4QAIA 1LLZA 2QKFA 4N2YA 4PL1A 2E6AA 3G3MA 2Y88A 1MXSA 1QCWA 2V81A 3BLEA 2VFGA 1TYGA 2WQPA 3IVUA 4BFAA 4JN6A 8TIMA 2PC4A 4K38A 1F73A 3AJXA 3QC3A 3DFTA 3N3MA 4WOQA 1VH7A 2Y85A 2G97A 3BLFA 5D2WA 4MJMA 3ZS4A 3MI2A 3P8JA 3HJZA 1JCYA 4N9DA 4LUJA 4RKAA 3Q58A 2OMAA 5TQLA 1HO1A 4HPXA 3C2VA 1YTDA 2QUVA 4Z1DA 4UTHA 4AVFA 1MZHA 3O6YX 3TMLA 4C1KA 4JTJA 3C6CA 3BGGA 1TJRA 1Q3NA 3H53A 4O1BA 4QITA 4DXVA 1L9WA 1TPC1 2JBMA 4KFOA 1SO5A 1QPOA 4O10A 1EA0A 5G1TA 1U83A 1BWKA 3BGJA 3W2KA 1DV7A 3K30A 3P5ZA 5U4NA 4XZ9A 3IGSA 4KFNA 5F4XA 1OX4B 3LHUA 4AMAA 3L9CA 4DF0A 4BK9A 1H62A 4O11A 3PSVA 4FEZA 3HGRA 1OF8A 1ZALA 3W85A 4WD0A 1LORA 1BEUA 5KSWA 1C8VA 1SSDA 4KKXA 1KM0A 1VQTA 4O1AA 2ZYFA 5BMXA 5FESA 2CZEA 5CZJA 3T44A 4W9TA 1LZOA 3CTLA 2ZDRA 2ZZ1A 4JD4A 1LLWA 4ZMGA 5J5DA 3UWYA 3C4UA 4PTNA 1OFEA 1H5YA 4NVTA 1TV8A 2QAPA 1WOAA 3L5LA 3THQA 1S5VA 4O1DA 3C3NA 2FQIA 4BWLA 5EPDA 4DF2A 1Q6LA 2B7OA 2TPSA 2XFWA 3TROA 3MBDA 1P0KA 2WSQA 4GRSA 3TMQA 3VNDA 4TMBA 4N9BA 1K03A 2ZTJA 5F2IA 3HF3A 5LSMA 1W5OA 2E5BA 2RHGA 3M44A 3B03A 1J4EA 3S1VA 3PBVA 3PBUA 5HWNA 1G6CA 1A5SA 1PVNA 4NJJA 3TH6A 2DP3A 2ZRVA 2C14A 1ADOA 3GXNA 1LTDA 5HMSA 3C56A 5BRBA 4AEOA 4DPQA 1OYAA 2Z0IA 3HB9A 3P74A 4JTLA 3W1LA 4JGDA 3BW4A 3SGZA 4KWWA 3BV4A 2FJKA 3DHFA 3M6YA 4U4MA 2YXGA 3LM7A 3LRMA 1OX5A 3DU0A 3GR8A 5E1QA 4YL2A 4O14A 2ALDA 3NQMA 4O57A 1YADA 3H54A 3PBWA 3YPIA 2I9EA 3TAKA 2ATMA 3I6RA 1LCOA 4EOUA 4OWGA 2E68A 2A6NA 4XTIA 1WX0A 3LV6A 4JICA 1WQ5A 5AN7A 1S5TA 2OT1A 2NUXA 4XQ6A 1Z41A 4WY0F 1NF0A 5G2IA 2C13A 1SW0A 2OCZA 3E0IA 2BX7A 3TA6A 4UC5A 2QCDA 2EHHA 3S9YA 4HPJA 4Q32A 1NFBA 5EKYA 5K4ZA 2NWRA 4IWWA 5AC6A 4EIVA 3W70A 4IPIA 3PS7A 2ZRWA 2GPTA 3TSBA 5T26A 1KM4A 1W5MA 1R47A 1XUUA 2YCEA 3LX9A 2CLEA 2J9YA 5F2MA 2J27A 3M9YA 1GWJA 3C52A 1VYRA 2GVLA 4JDBA 1WV2A 1SFJA 3UD6A 2E5DA 3TUUA 5AB3A 1LRNA 3WK2A 3USBA 1G7UA 3H55A 3W6YA 3I7RA 1VZWA 5FEPA 1PS9A 3MMTA 4QISA 1LOQA 5K9CA 3EX4A 4OBTA 3NR0A 4OE7A 3C61A 4CQAA 4UNLA 3W7HA 1YDVA 3EX3A 4JX4A 2GQAA 4NXKA 2WJZA 1G4EA 3R5EA 2P0OA 4JTGA 4WY0B 4PL2A 1FBAA 1H7XA 2B7QA 4BWLC 2KZHA 3MHGA 4HT3A 3OVRA 4FF7A 3RK8A 4Y90A 3TJXA 2YFOA 3PM6A 2B4GA 5BW6A 1DQWA 1K3UA 4R7JA 1ICQA 1VS1A 3NQEA 3HG3A 3MI3A 3TE9A 4L4MA 1G4SA 2C1HA 1QFEA 3FYOA 4G1KA 4MOZA 1ZENA 4QSHA 4ZL1A 1LOSA 2NLIA 3VI2A 1ICPA 1W5NA 1FXQA 3S5OA 3GNDA 1DOSA 4JTSA 3MP5A 2ISWA 1I2NA 3W2MA 3SW6A 4UFJA 1O5XA 1KW1A 3W76A 3N14A 2JKEA 4BF9A 4IXHA 4GNJA 1JRBA 4S2CA 3NL2A 4U28A 1F74A 4IMCA 3W87A 2V30A 3G18A 2PRHA 4JTHA 3N9RA 3N9SA 1DBTA 5CZTA 2EF9A 2FB3A 3QQ1A 1MEWA 5EL1A 4O54A 4RX0A 2CLKA 4CNOA 3WK1A 3TQKA 4QM1A 3GAKA 5D09A 1HUVA 2AQWA 3QQ0A 3E96A 4RXFA 3HO8A 1YYAA 3BG9A 3NO5A 2BXVA 1J2WA 1KBIA 3W2LA 3W84A 5HULA 3SGUA 2GUUA 3O05A 2QCHA 5DBTA 3B0UX 3N73A 3LHWA 2NUWA 4N4PA 1AW1A 5A5WA 1XL9A 4WQ6A 3G24A 2H3DA 3O8AA 2TSYA 3G8RA 4M19A 3P82A 5C5YA 1XBVA 2NXGA 1B3OA 4ZQCA 3W1MA 2Q8LA 3BARA 1ME8A 2CLHA 2NXIA 4UTWA 1O5KA 4S2BA 4ML9A 1DL3A 4MLJA 2NWSA 3W7DA 2C3ZA 3EWWA 4WOZA 3AO0A 3B8DA 2ZA1A 1I8JA 5HNRA 3EKLA 1GG0A 2X1TA 2R14A 2GVGA 3UWWA 4MIMA 5AHFA 5DBUA 3O6DA 3W7QA 3EWYA 3VE7A 3G0SA 4FNTA 2E77A 1OJXA 1XUZA 3PAJA 5K9XA 3LLDA 2DZPA 2VEMA 3A9IA 4MFEA 4H4IA 1TV7A 3FFSA 3TK7A 4O4WA 4MYAA 1VJIA 4YWIA 2BTMA 3S5NA 4JIPA 3OEXA 2IQTA 5EYWA 5A8GA 3QSRA 4AHQA 3W7CA 1JCXA 1FDZA 2QCEA 1Q6RA 1H50A 3EXTA 4X9SA 2WSRA 3ZFHA 2YDAA 4N02A 3FA5A 1R2TA 4H6KA 2DZWA 3LI0A 1W37A 3F1QA 3O1NA 2QUTA 3ZWSA 5I3HA 1OFAA 4O19A 4K6AA 3ATZA 1ZAIA 1EPXA 1ZHAA 3LRLA 1QO5A 3QMTA 4UTMA 1NEYA 2DZUA 4JDYA 4JTIA 4A22A 1H51A 2Q3RA 2R8WA 1TIMA 1W5PA 3P62A 4K39A 5BMWA 3BG3A 1TRDA 2CW6A 2A4AA 1K7EA 4RK8A 1H1ZA 5E93A 5DCEA 3G1YA 1A5CA 1TTJA 3W2NA 4GUGA 5MHBA 4C1LA 3TDFA 1YXYA 1LYXA 4O16A 1H1YA 1W3NA 3LTYA 4NXSA 2ZZ4A 1ONRA 2V2CA 1RV8A 3NDOA 3QYQA 2GOUA 3A23A 1JRCA 3W7KA 1RQEA 1KFLA 2Z2UA 4IX2A 1KM1A 1EUAA 4MKNA 1FDJA 3W7MA 2C18A 3G1SA 3P61A 4FIQA 3IVSA 1I45A 1DHPA 2A0NA 3RU6A 1EP2A 3NXFA 4DPPA 4Q33A 1GVOA 1CX9A 3IGUA 5TBOA 4LU0A 3UYCA 1KBJA 4E38A 1OF6A 2V8ZA 4GFSA 3NQ2A 4Z0JA 3CLMA 1YDNA 4Z1CA 1S5WA 1JCJA 4BI5A 3QEZA 1Q6OA 3I65A 4IUOA 4TX9A 3W2UA 2OX1A 4N9CA 3IGXA 4CCDA 2E6DA 1QWGA 1KM2A 2TMDA 3R13A 5I3IA 2QEZA 3EX2A 2CWNA 1E51A 1K8XA 1GVSA 1P0NA 3DKLA 3NL5A 4A2RA 4AHPA 2BSLA 5D30A 4LUIA 1RZMA 2OZ0A 2Y62A 4R34A 1N7KA 4IMEA 2BLEA 1X1ZA 3NL6A 4NJGA 1TSIA 3Q2DA 2CFFA 3O06A 1FWRA 3NQDA 5DY3A 5H91A 3W1PA 4M7TA 2NXHA 4O13A 2Y6ZA 1VCFA 2EPHA 2WNQA 2Y89A 1SZEA 4UFHA 3EWUA 3W3OA 1X1OA 3P81A 1TREA 1PV8A 5G1YA 2A7PA 1D3GA 1TPEA 3PB0A 2VC6A 1O94A 3LERA 3M7WA 3PY2A 3INPA 2CLFA 4JYFA 3UWUA 3VE9A 4NZFA 3QH2A 2NX9A 5IBXA 4P2VA 4UTTC 4AWTA 3NGJA 4AWSA 1FX6A 2CZDA 3QRHA 3CWNA 5C55A 1JULA 4GUJA 1H7PA 1JJKA 4MY1A 3UWVA 4JTUA 3STFA 2QCGA 4N4QA 2DJXA 1RPXA 1XM3A 3RLVA 4LOCA 4NNCA 2HMCA 1GEQA 3KX6A 4JYEA 4QNEA 4ZQNA 3GR7A 1KFEA 3ABOA 5DLCA 3W1NA 4Y6GA 6ALDA 3DHDA 3QMRA 1ZJIA 5GVJA 4ADSA 4NJIA 1OFOA 3DI1A 3LDVA 4DO5A 3HMJG 2AGKA 1MEHA 3W7IA 4Z0SA 5HJLA 5EMUA 3ABSA 3DAQA 1FWTA 4FNPA 4UNKA 3STCA 3GXPA 4NUWA 1R2SA 4GUHA 3LTPA 3MI6A 4OU1A 1L6YA 4EF8A 3IV3A 3TW6A 3NQVA 1SZNA 2ZRYA 5IBXC 1DQXA 3S0CA 2QCMA 4IMFA 3WFAA 1KM6A 4UTKA 1QOQA 2Z1BA 3O63A 4CNPA 4JX5A 1UCWA 2ZTKA 3HPXA 5D32A 3OBKA 4GJ1A 2ZZ2A 1P4CA 1K02A 3M5YA 5D03A 1EP3A 3U8GA 3W7RA 1JUEA 3GYEA 3IIZA 3KVLA 4O52A 3PF3A 3W7LA 1JQVA 1EWDA 3DI0A 5EY5A 1FCVA 3GDRA 3FJ6A 1UUMA 4K37A 2E1DA 2NX3A 3P84A 1D9EA 3NG3A 3NEVA 4LV4A 3NVTA 1QAPA 4UMCA 2DZTA 2WV8A 2YX0A 3OIXA 4N6FA 1JCLA 4AB4A 5AHMA 5F2GA 1JR1A 2ZZ7A 4UFLA 3C8FA 4LS0A 2FIQA 3IIPA 3NQ7A 3OHIA 4AHOA 3GKFA 4JY8A 5DELA 2ZBTA 1OFBA 3MYOA 1HTIA 5LNRA 4JYDA 1ME7A 4IGHA 4ICNA 2F84A 1ALDA 3CB8A 1QO2A 2QUUA 2FTPA 3BO9A 2QAFA 1F6KA 3P80A 4XTDA 3IEBA 3DFNA 4MYXA 4LWWA 4O8RA 1UBSA 3W88A 4RZ6A 4ZQPA 1GTHA 2VEIA 4NT0A 4EWND 5G4WA 3EEGA 3L5AA 1SU5A 3GB6A 1EIXA 1H63A 1LRQA 3CQ0A 2R91A 1TTPA 3UY8A 3C2EA 1YXDA 3FYPA 3ABRA 5CKSA 1M7PA 3NPVA 4HN4A 5CG7A 3W1AA 1DJQA 3LI1A 3N2XA 1ME9A 3RLUA 3GLCA 5CPNA 3GVGA 4OGZA 3WK0A 1VGAA 3UXAA 1LRTA 1HG3A 4CCEA 4NNBA 1O95A 3WJYA 4IXXA 1XKYA 4N6EA 2FB2A 3BG5A 4RXGA 1IGSA 3UZ5A 3DGRA 1O60A 1G4TA 5F4SA 1T8XA 3LCXA 3RNDA 1NAL1 3LHYA 3G1FA 4LTSA 4RV8A 4YXGA 3EXSA 1GQNA 3I7QA 1I4NA 4ZVJA 3G1HA 3PUEA 1FUYA 2V2HA 3TX9A 3BK0A 3PWAA 1N55A 3EWZA 3UQNA 1MSSA 3WJSA 4ALDA 1TPVA 1W5QA 2ISSA 2A21A 3M5XA 5AHNA 3S1WA 4FB7A 1TCDA 1DORA 3FS2A 1A50A 5LHEA 3UPWA 3O16A 3OA3A 1G7VA 4EF9A 1I2RA 4LC8A 1FXPA 4ZQRA 1PHWA 1T0OA 4M6QA 3KFTA 3R8RA 4XKYB 4A29A 2V0TA 1NVMA 1OFPA 1SW3A 1LBLA 1OABA 4I9AA 5D38A 3RF9A 3W86A 1M7OA 3W7OA 4RCXA 1IXQA 3UWQA 4DBDA 2J88A 1JUBA 2RDWA 4UTTA 5FEWA 3NM1A 3QW4B 5I3FA 1T99A 4NX0A 5FF3A 4O50A 1QPNA 1I2OA 4R33A 1W8SA 1GYLA 1JVNA 4OV4A 2Y63A 3CIWA 4TMCA 2QCLA 2Y7EA 4K36A 3W7JA 1I2PA 2VFIA 2Q3OA 5D2VA 3NQGA 3PVFA 1AL8A 2DZXA 3F4WA 4O18A 3NZ1A 2X1SA 1K7FA 1G69A 5AHLA 1IIGA 3EX6A 2QDHA 2YR1A 2W79A 1PCKA 1QPRA 1AMKA 3GZ3A 1DJNA 2HSAA 4DO4A 3TQ0A 1TPH1 4UTIA 3MJYA 2GQ9A 1F05A 3LXCA 5I3KA 2TRSA 4A21A 3EB2A 2JK2A 3BW3A 1JCMP 3GX9A 1SSGA 5F2LA 5CPOA 3NNTA 1TQXA 2WO5A 3NPXA 5FF2A 1TV5A 3CEUA 1WBHA 4ZQMA 5LNSA 4NZJA 3WJZA 1EEPA 4HKPA 3T40A 3L65A 4DELA 1HFBA 5KMYA 4O0KA 4XBKA 4BR1A 1CW2A 2ISVA 1YPIA 4GC4A 4HSNA 1XBYA 3GKAA 1ZY9A 4GUFA 3T4CA 1QOPA 2P1FA 4O12A 4IOTA 3MBFA 3LRKA 4LVDA 4B5NA 3UXDA 5AC8A 2C19A 4PH6A 4LC6A 1AK5A 1P5BA 1XCFA 4O17A 3W1UA 2W6RA 1G67A 5D2TA 1UUOA 2V2DA 3LBCA 4K7VA 3SECA 1F5ZA 3OG3A 3KXQA 2Y61A 5SWUA 1TJPA 1ML1A 2XN1A 4PODA 3GNNA 3MHUA 3G3DA 4IMDA 4BI6A 4WXYA 3G1DA 3LCFA 1KFJA 3C2FA 4NJHA 3O6CA 4K7YA 1ZAJA 4LS2A 1RVGA 4K8HA 3KVJA 4XKYA 4A2SA 3KHJA 1OYBA 5FI8A 3CIXA 3TW7A 5LGZA 2VKZG 2JKAA 1OYCA 2RH9A 4FNSA 4YMZA 3S1XA 3IIXA 1GVFA 3NQCA 3DFSA 4TO8A 2DZVA 4TU1A 4O53A 3TFXA 2XN0A 4AF0A 1U5JA 3I68A 3FKKA 5U7SA 3M0ZA 3OVPA 5K4XA 2DZSA 4BI7A 2X1UA 1R46A 2QCFA 4YLWA 4MJZA 1Z44A 5HR6A 1T96A 3T55A 4Z1AA 1FWSA 3IRDA 1KTCA 4IQLA 4LY8A 2PRLA 5AYXA 2F7FA 1QDSA 3KRSA 3QF0A 4N9EA 1THFD 2A5HA 4AF0B 2O7QA 3GK0A 3UNDA 2ABAA 1GPWA 1YPFA 4GE8A 1EWEA 1XBXA 1YTEA 1TPFA 2WNNA 3TKFA 1FDYA 3R12A 1AG1O 1W0MA 1X6UA 3C0JA 5F1UA 3B06A 3GDMA 3L0NA 2TYSA 3B0VC 5CGQA 1J5TA 1VR6A 5CPMA 4YCPA 3EKZA 4JX6A 1KV5A 4YCOA 2RKXA 4FIRA 4Y8FA 2PCQA 1B4EA 4Y9AA 2H6RA 3NPWA 4CLMA 4MY8A 4TR9A 4M6VA 3E02A 1B9BA 1HO4A 1I2QA 3LCLA 2YGYA 1W3IA 4PC8A 4TIMA 5I3JA 1H7NA 2YW3A 4MZYA 3TQVA 1OK6A 4RZ5A 2ZRUA 3BLIA 1TQJA 4AWUA 4H3DA 1H7RA 2E5CA 2FDSA 3QZEA 3C2OA 1LP6A 3N34A 4J9JA 2FLIA 2VFEA 4E2BA 2YPIA 3THAA 1QMLA 3QMSA 4LS1A 3KRUA 1PIIA 4LVFA 1OG0A 1D3HA 1Q6QA 4OQVA 3GDKA 4EVZA 3M1ZA 2C16A 3BW2A 3P5YA 1OFQA 2ABBA 3G22A 3KOFA 4D2JA 2ZA3A 5LNUA 3B0PA 1R30A 4JTFA 3DENA 3W74A 1A5BA 4FO4A 4QJ1A 4FHAA 4LV9A 4WY0A 4UMBA 3PR2A 3KVKA 1CI1A 1VYPX 4IPJA 5KZMA 4XUGA 4JIQA 3HOJA 3W1XA 2BWGA 4UFMA 3VKJA 1BKSA 1LBFA 2VFFA 5CZSA 1GT8A 3NQAA 2YFNA 1X8FA 3P8IA 3DH7A 1XI3A 1W3TA 1LOLA 4POCA 1ICSA 3WK3A 4OV9A 5K9DA 1SZFA 4UIOA 2YZRA 2WPBA 4E2DA 1LBMA 1M6JA 3G1VA 3M5VA 5EA9A 3HG5A 3E12A 3W71A 3L66A 2EGZA 2PE4A 3DFOA 4FNRA 2E6YA 3LCWA 3JR2A 1XFBA 3DKJA 4KWVA 3NOEA 2JGQA 4L4LA 2QCDB 1W56A 1GYNA 3SY5A 4CNNA 3LCHA 4UR7A 4NU7A 1Z48A 3ZR4A 3PG8A 4ORIA 3W07A 3EWXA 1RQBA 3O07A 2UV8G 3WJXA 2GJNA 5G2WA 1YXCA 3PUDA 2ZFAA 5BOOA 3MWAA 1DKWA 1AW2A 1TB3A 3RFAA 3LXAA 5AHEA 4PFMA 3TFCA 1KTNA 4NJKA 1KTBA 1ZFJA 2I1OA 3SI9A 3TSMA 3JRKA 5D04C 3UY7A 2VFHA 1TTQA 5HINA 1FY6A 3G0UA 3M16A 4CQ8A 2CLLA 4S1FA 1ZNNA 1L2UA 4HHPA 4ORMA 4UUIA 3PB2A 2X30A 2ZZ6A 3N2MA 3PUOA 4RLIA 1VHNA 4MVAA 1ZCOA 2ZQ0A 3NPUA 3L21A 2OJPA 5LKYA 2X1RA 1BTMA 3GDTA 1KA9F 3MP3A 3NZRA 4NNAA 3HPZA 4DO6A 4AH7A 5AYYA 1VHCA 2ZA2A 3Q37A 3TR2A 4MZ1A 2C6QA 3FKRA 1UASA 3HG4A 5I3GA 4UR8A 3QPYA 1GTEA 3SJ3A 1QR7A 2Y7DA 1PL9A 1K8ZA 5G5IA 5TIMA 2VEKA 4FX8A 3FOKA 3TC7A 2YSWA 2DJLA 3MYPA 3BPWA 1QNVA 1JCNA 3STEA 1AL7A 3L0KA 3W23A 4FX6M 3GDLA 3KAOA 2XN2A 5KITA 5FEXA 4JS3A 5KZDA 1VYSX 3TCEA 1XC4A 1XDMA 5D2XA 4CCCA 1S3HA 1GG1A 4RZ4A 5L9FA 3EX1A 4GXMA 4X2RA 3DFQA 1PHQA 5LZLA 3D0CA 2WSYA 3QFEA 1R2RA 1RD5A 5CSSA 2FPVA 5CSRA 2A85A 5CPLA 3W1QA 3EWBX 3L68A 2HS8A 4ADUA 2PURA 3L67A 1O4UA 1FCBA 2YYUA 4GWEA 4Q4KA 3QM3A 3P60A 3EXRA 3W9ZA 3BVJA 1WDWA 1OX6A 4FNUA 3M47A 3M41A 4JTKA 3HPSA 1P1XA 3A5VA 1WYIA 4UTUA 2NV1A 5KINA 1A53A 3MP4A 1SO4A 3NA8A 4JEQA 2Y7GA 3P7YA 3NQ6A 2ZCGA 1XDLA 3R89A 1OX4A 2QCCA 4NX5A 3W2JA 2YYTA 3A22A 4K8EA 4HNNA 5HWMA 2HTMA 3L2IA 2WNZA 1TO3A 3JS3A 3UZJA 3V1PA 3FEMA 5K7JA 3ATYA 4O1CA 5E0KA 4JR5A 4MFDA 5DY2A 3CC1A 3P67A 4I7WA 5D33A 2VOMA 2ZRXA 2EKCA 3LHVA 3LXBA 3GAYA 1VLWA 5FF7A 2LLEA 2D73A 1LDCA 3VCRA 4UTJA 5HUPA 3W1RA 1JQXA 2A2IA 5D2YA 3TAOA 4OHQA 4ZZ9A 3KVMA 1F2JA 5IM51 1EUNA 4JXCA 3FLUA 3W73A 2CLOA 4LT9A 1W54A 2Q8ZA 3CT7A 4MPQA 4WJEA 3W22A 1SFLA 4PA8A 3NQFA 1IF2A 5AFDA 2RDTA 3RMJA 2CZFA 4M5PA 1IXOA 2WOQA 1JUKA 2VELA 1EP1A 1A5AA 4I7UA 2EAWA 1NF7A 1TRIA 1MO0A 2GJLA 3IIVA 4HNUA 5HR7A 1FWNA 4DQWA 3UPBA 3MHFA 2G5WA
chains in the Genus database with same CATH superfamily
1DXIA 3HPAA 1Z42A 4D6HA 1EA9C 3LB0A 2PUZA 4O1FA 2QDGA 2VC5A 2RGMA 2A1YA 4P5UA 2F6KA 4M82A 3ARVA 2Z1WA 1WOBA 1DJWA 2Z7KA 2HVNA 3T4WA 5CZ0A 2CBJA 3W7NA 3HGSA 3LGEA 3N6QA 2Q09A 2DU2A 1NY1A 4N7QA 3IIOA 2JGYA 1UWRA 3W1TA 3RHGA 7REQA 4KFPA 2WMJA 1I9CB 3FAWA 4WUIA 1KFKA 5BXSA 1KXQA 4LSBA 1OGSA 1PDYA 1Q6DA 1TX2A 4LVGA 1EXPA 2OSWA 2PFHA 3CL7A 1W9VA 3MPGA 2I5IA 4HSHA 3SZ8A 4FMVA 4QHRA 1EX1A 2H8ZA 4GXWA 3LNPA 2XSXA 4RE3A 1REQB 3FIGA 3RLHA 6CGTA 1X7FA 2YL6A 3L0GA 2H90A 4AG0A 4HZ7A 1LG1A 3S8HA 2QF7A 7ENLA 1FOBA 2VL4A 2P3EA 1MEIA 2Y5EA 1A5LC 4PRRA 2A3EA 1WXYA 3T7VA 3AIUA 2NV2A 1S2VA 2PDLA 4L9YA 3CTTA 5C7VA 1ESWA 4GYJA 3GFXA 3TC6A 3CU2A 3RYSA 3CPRA 1ZBVA 1XYFA 4XO7A 1E15A 5JH2A 3CXOA 1CGUA 1FWAC 1IEIA 3AZSA 1EJVC 5D37A 1UPPA 5PTDA 3ELFA 1Z32X 2WMHA 1JYXA 2FFCA 1JGIA 1ODZA 2REQA 3CHVA 5DXYA 3RR1A 2CERA 1KLZA 1F07A 4PTVA 3PBYA 1XPGA 3ZVHB 2DFAA 1UKTA 1F76A 4ZODA 4EAYA 2ZUNA 4Q8TA 3N19B 1BLIA 3WBWA 3WF1A 3TSDA 3QPZA 1UW9A 1UWSA 1HVQA 1S1RA 4BF5A 1X8CA 3ITGA 3UZWA 1TV4A 3C8NA 2V68A 1A4MA 1XD0A 5DANA 1OADA 4C6PA 1QHZA 2GK1A 1KFCA 1TJ2A 1EL3A 2GYIA 1UB3A 4O28A 4F2TA 1OIMA 2J9XA 2Z6JA 3S1UA 4HMEA 1TTIA 2XH4A 3TU9A 2PDPA 5LNVA 4QE4A 2WC3A 3H7RA 4FNQA 4JNMA 3WDHA 1E40A 3QV6A 4AU0A 1MI3A 3VPLA 3B4UA 3P0XA 1K6WA 2OLAA 2VX6A 3BWWA 5FEZA 3MS8A 4K1WA 3TYCA 4MLRA 4QIUA 2RJHA 3PTQA 1Y0EA 2G95A 3CEPA 1ZAHA 2VM8A 3QBUA 2QIIA 3OVQA 1FCUA 3I7SA 2V9DA 3I3EA 4O0ZA 2PI6A 1K70A 3EBVA 4B3LA 1QNRA 1YNPA 1HQTA 2GGIA 1SO3A 1LF1A 1Q4WA 3NQ8A 7TIMA 5CBJA 2DVXA 3GVRA 1WPCA 3GVWA 2QJGA 2YBTA 4XWUA 4GD0A 4NZ4A 9CGTA 1GJPA 2AOSA 1S2TA 1DQUA 3UESA 4RJEA 5C2XA 5HUOA 4UTLA 2P50A 3EA2A 2Z28A 2P10A 1JPKA 1RR2A 3T05A 1UOZA 1KM3A 1GCYA 1WBJA 4MUZA 3ENLA 1W1ZA 4ZCWA 4Y96A 4ONVA 3C2RA 4X63A 5AC7A 3GXMA 3BLKA 2CU0A 3OB8A 3TV8A 2NUYA 2VRKA 3AYRA 1GZ1A 3MUXA 4LYRA 4K3ZA 3M0VA 5A2CA 4PEKA 2PD5A 2W4XA 3PZOA 1XV8A 1OCNA 2HPMA 3AYVA 3IUDA 4ZO9A 3I6EA 4DF1A 1L6SA 1KKOA 4KETA 1UH3A 3EWCA 4ZQOA 5ABHA 3TR9A 5ECVA 2OWXA 5D02A 1QASA 3AXHA 3GH4A 1Q5MA 5DFAA 1KR0A 2HBXA 1BHGA 3BOLA 5KZEA 2Z00A 4TV5A 2G41A 3QSTA 3GDBA 5DQPA 2BASA 3CZ8A 4RPQA 3BMXA 1E9IA 3LHTA 3SFKA 3LHZA 3PFRA 1JNDA 5J04A 4HK7A 4LUTA 2QT3A 4HSOA 3E9AA 3AU6A 3LMZA 2C71A 1TJ0A 1OG6A 2PZ0A 4JTEA 4EWJA 5AYZA 1W8GA 2PRMA 4M6PA 1AH3A 4HMCA 5CPQA 1FQ0A 1VC4A 2QR6A 3DZ1A 3GNPA 1H0GA 2X09A 4TVCA 2EJ1A 3CGTA 2FH6A 1MXSA 3PZIA 2YCLB 1BSIA 2VFGA 2OR2A 2O9OA 4BFAA 1PZ3A 2D3LA 2PEVA 2Z1KA 3KBJA 1HJXA 3N3MA 4OBSA 2VCBA 4WOQA 4QLKA 4HTBA 5ABGA 2G97A 1RALA 3H26A 4MJMA 2W66A 3P8JA 3ISIX 5E6ZA 2OMAA 1HO1A 3U0HA 5EMJA 3RMEA 1IEVA 1SVDA 3THUA 3PUGA 3V0UA 3EA1A 3H4WA 2W3ZA 1IT7A 3BGGA 4O1BA 3H53A 4OECA 5FJUA 4DXVA 1L9WA 1UR9A 1TPC1 1CWYA 4KFOA 3VILA 4ZE5A 3HQPA 1EGVA 2ACQA 3N6JA 3VVGA 3REQA 2VX4A 5U4NA 1PYFA 4XZ9A 3A4AA 4AMAA 3LHUA 4BK9A 1UKOA 4O11A 1B31A 4FEZA 1OF8A 1E4IA 1ZALA 1CGVA 1WZMA 4F0LA 4LXFA 3ZLFA 2XG9A 5FESA 2CZEA 1NARA 3AICA 1C92A 2ZDRA 2ZZ1A 3RX2A 4ASTA 4ZMGA 2NQJA 5J5DA 5LA1A 3UWYA 2YXOA 4NAFB 3VDGA 1S5VA 3VGFA 3SBFA 2FQIA 3UZXA 5AC5A 3N25A 5EPDA 3TLQA 1AJ2A 3MBDA 3VNDA 4TMBA 4WSKA 1K03A 4JCLA 2PLJA 3HF3A 1H11A 1O12A 1J4EA 3TTSA 3GHSA 4GH3A 3PBUA 4GMEA 2H9AA 2C14A 1LTDA 3RM8A 4AEOA 3HPFA 1GOMA 1J01A 4G9PA 1VIZA 1ZTVA 2VQUA 4KWWA 5FAJA 1HJWA 2YXGA 3LM7A 3WH8A 3GR8A 3U9IA 5E1QA 4JTCA 4O14A 1UD8A 8XIMA 4O57A 1E6PA 4NIRA 1K77A 1XSJA 1ONXA 1OGBA 3ORWA 1R3YA 4MTVA 2I9EA 3FY1A 3I6RA 2IXUA 4EOUA 4DJDA 3VGHA 4DJDD 5AN7A 2NUXA 1LWJA 4XQ6A 2C13A 3TA9A 5FACA 4S38A 2QCDA 2PLMA 1OINA 4Q32A 3C0LA 5HANA 4TTGA 4H6QA 4IWWA 4B2DA 5AC6A 4EIVA 2J7DA 1NDVA 2GPTA 1W5MA 5BU9A 3VIFA 3GG1A 2CLEA 2J9YA 5IOBA 4JN7A 3C52A 1TMQA 3DG6A 1X6LA 3GWQA 3UD6A 3TP4A 4IG2A 3WK2A 3CH9A 4MNMA 1G7UA 4PCSA 1OQFA 1PS9A 4AFYA 3BOFA 4CQAA 2GQAA 4Y9OA 1G4EA 3R5EA 1HZYA 2XPKA 5EMYA 4HU0A 2BG5A 4WY0B 3B9OA 4R7OA 4DM2A 1AJ0A 3HQOA 3OVRA 4FF7A 3NSNA 4Y90A 4AEFA 4MNJA 2B4GA 4H8VA 2XWEA 4LJ3A 2DSVA 3CS2A 4H9MA 1VS1A 3HG3A 4L4MA 1C93A 5A95A 1QI0A 3SB0A 2VO5A 5FCZA 2TAAA 1PO9A 1XIGA 4E2VA 1ENUA 3L2MA 2NLIA 3VI2A 4F0HA 3S5OA 3GNDA 4CNSA 2ISWA 1E9YB 2WM1A 1UWAA 3GU9A 4R9OA 4PMOA 4LY4A 4BF9A 1OZQA 1PAMA 3N9KA 1GVEA 1JRBA 3KOYA 4S2CA 4PYSA 5A6AA 4AYGA 3LQGA 4KEZA 2V30A 4C6NA 3PBGA 3WQPA 1HL8A 1P1MA 1MEWA 3OGVA 4O54A 4LEFA 4AZIA 2QJJA 4CNOA 1ZLPA 3EOLA 3C2YA 4HBKA 4B15A 3HO8A 2I7GA 1YYAA 3BG9A 3NO5A 3RN6A 3LLXA 3W2LA 1Q6GA 1QBBA 4GI8A 3O05A 3FNDA 2P5NA 1AW1A 5A5WA 1XL9A 1XF0A 3G24A 3P82A 2HK0A 1XBVA 2NXGA 4ZQCA 2Q8LA 1ME8A 2CLHA 2J6VA 2VRQA 4R85A 2C3ZA 3B8DA 1I8JA 5HNRA 1B30A 2R14A 3R0DA 2UY5A 4GG9A 3MY9A 2J25A 3DHUA 1J96A 1E1CA 3W37A 4JBRA 4C6EA 2ZKMX 4S39A 3O6DA 4LAKA 3H70A 4FNTA 1YBQB 2IKGA 4L65A 3IJ7A 4IJRA 3PAJA 2WZTA 3A9IA 3MU7A 3OLGA 4MFEA 2WHJA 4H4IA 4XAYA 4HHLA 3FFSA 3TK7A 3M0JA 3L4TA 4DLFA 1XCWA 4FP1A 3MUCA 1NELA 4I9TA 5EYWA 4LYPA 5A8GA 1E73M 3HMCA 1CXKA 5LIYX 3IJIA 3LN3A 3B8WA 5M17A 2A3HA 2NSXA 5LXXA 4DHGA 2OWWA 4EPKA 1V02A 2DDXA 4XIMA 1EOMA 3H24A 4N02A 5CG0A 1OT1A 1R2TA 4KGLA 1BXNA 3LI0A 3F1QA 4E8CA 5I3HA 1CNVA 4K6AA 3VK5A 1EPXA 2PGWA 1CIUA 2DZUA 3GUGA 4JTIA 5TD4A 3WBAA 2R8WA 3P62A 2PTDA 3AHZA 3QY7A 1JZ2A 2VP8A 1EHNA 2A4AA 3RILA 1L8NA 1H1ZA 5E93A 2R82A 3G1YA 5C9UA 4HCDA 3HJEA 2PS2A 3HU7A 1A3HA 1LYXA 3GC4A 4Y9PA 1W3NA 2CITA 4IG2B 4Y2WA 1UUQA 3M0MA 2PTWA 4IIHA 3NDOA 3VD4A 2GOUA 5CLTA 1YE4A 2YDQA 4Q8WA 4IX2A 1KM1A 1RJRA 3G1SA 4YN5A 3H4GA 1I45A 1DHPA 2A0NA 3BJFA 3CH0A 4A3YA 1S1PA 4W7VA 2QPUA 1W3KA 1NDYA 2QF8A 3PZVA 4GC3A 1UR4A 1KRCC 1RPKA 2ZWYA 4DYEA 4QX4A 3TN5A 4Z0JA 1TUFA 3JW7A 4S3CA 3VD3A 3M0IA 4H7ZA 1HGWA 2XSBA 4DUXA 1S5WA 2PWHA 3I65A 3RG6A 1KB3A 1MQRA 7ODCA 4N9CA 4GI9A 2FMNA 3GTFA 4CCDA 1HP4A 1EDTA 4U5KA 2R9RA 4BQ4A 3NZGA 3W25A 2DPEA 3EX2A 1E51A 3KHDA 4H6RA 2PDXA 3SCNA 5CCZA 3OG2A 4NY2A 5BROA 3Q2DA 4DZHA 2CFFA 1E0TA 1EJ7L 1FWRA 2HJPA 1R85A 2NXHA 2XIBA 3FW6A 2WNQA 1B9ZA 3WBYA 1X1OA 1TPEA 1VFFA 1UG6A 3INPA 4GQGA 4UTFA 2CLFA 3PZGA 3VNYA 4W8BA 5IBXA 4UTTC 4AWTA 4Q8QA 2R1MA 3KBVA 4AD4A 1H7PA 4QCFA 5HATA 1JJKA 3UWVA 3AXIA 5LYRA 4N4QA 3LEPA 3WDPP 4NNCA 5CC6A 5C8BB 4MB1A 1GKPA 3SCVA 3BLOA 2WM0A 3A13A 2ZC8A 3W1NA 4Y6GA 3RU8X 4JHZA 4ADSA 4DXXA 4P8XA 1LG2A 3KP0A 4KEUA 1D8CA 3LDVA 4DO5A 4XZMX 1VF8A 2FHCA 5HJLA 3H2OA 3STCA 3ARWA 4ECLA 3AROA 3WD0A 1ZBCA 1KCZA 3MSRA 3VOHA 2VGIA 3WQ8A 1I60A 3WFZA 4PBFA 3CASA 4OU1A 1JG9A 4EF8A 3IV3A 2WHKA 5IBXC 3S0CA 2EPKX 4IMFA 2HNHA 3WFAA 4UTKA 4M8UA 4H19A 4RDYA 5D32A 4F4RA 2ZZ2A 1U5HA 5CC3A 4NRSA 3E74A 3BANA 3U8GA 4UR9A 2OYLA 3PF3A 1JQVA 3AUJA 1F8MA 1FCVA 2BXZA 1F8IA 4D71A 4XO6A 3QPEA 2WV8A 3AS3A 4AB4A 3BCJA 1E0VA 3O9NA 3MWCA 4D72A 2D1ZA 2FIQA 3NQ7A 4JY8A 1OFBA 1XLLA 1F6YA 3AIQA 5LNRA 1K9DA 1ME7A 3TQPA 4ICNA 4I5UA 3KUMA 1VIWA 4MGGA 1QO2A 1YEYA 4HNOA 4XTDA 3HFTA 3UG5A 4DBUA 1GTHA 4GIYA 3C86A 3MANA 3EEGA 3L5AA 4G6CA 3GB6A 1EIXA 2J75A 3CQ0A 4J35A 1CXIA 4OVXA 2PD9A 4A8NA 3UW6A 1SFSA 3NPVA 4HN4A 1M7PA 2Z1VA 3GY1A 3N2XA 1ME9A 3TTQA 1P0EA 3B0YA 1N2VA 4OGZA 3SGGA 5A6SA 1D3CA 6REQB 4DJDC 2IXVA 1LRTA 4CCEA 3SUTA 1O95A 4DYJA 1DXFA 3VOFA 1IGSA 3DGRA 5F4SA 1X38A 3RNDA 4DJEA 1OY0A 1XCXA 5B80A 1GQNA 1BSLA 2EG8A 1E9ZB 3FN9A 3PUEA 1PZ1A 4W86A 3EWZA 2JALA 3WJSA 4UBPC 5JBFA 1W17A 5AHNA 3S1WA 1A50A 3WN6A 4C6BA 2DT2A 3O16A 3POCA 3TEVA 4EF9A 2A79A 1FXPA 4S3GA 2E8YA 3R8RA 2IS7A 3T07A 4DAIA 1QW7A 1E6QM 2PC8A 1OFPA 1MW2A 5GNYA 4I9AA 4V27A 3W86A 1E72M 3W7OA 1M7OA 1UR8A 2VVSA 2WLZA 4DBDA 2YB1A 2J88A 2RDWA 4JTAA 3B3DA 4ZA0A 3WLSA 5FEWA 3NM1A 1E0XA 1P0BA 1BQGA 3CZKA 4M81A 5DMNA 1DIDA 4O50A 3LZ3A 5F7UA 4DM1A 2O4QA 4CEXC 1H2JA 4R33A 1W8SA 2A3LA 1GYLA 2E25A 1EKOA 2GFTA 1Z69A 4FAMA 4U3CA 1I2PA 2Q3OA 3NIYA 3IANA 1TX0A 3PVFA 5FJJA 1EPVA 2DZXA 3F4WA 3NZ1A 2VR2A 2HQAA 1G69A 4AZCA 2RAGA 3EX6A 2QDHA 1UH2A 1AMKA 3LZ5A 1DJNA 2HSAA 5I3KA 1F05A 2TRSA 2PP1A 4XAGA 3UU0A 5CPOA 1TQXA 4IIBA 4ZTXA 4ZQMA 5LNSA 1AQMA 3WJZA 4AX7A 1IEXA 2NQ9A 3T2QA 3A47A 1HFBA 3AMLA 5FL1A 4B5SA 4BR1A 1XBYA 2D24A 3GKAA 1BG4A 1W2VA 2CBUA 3T4CA 2DSUA 3ABXA 3MBFA 3LRKA 4PSPA 2UY4A 2J7BA 3UXDA 4PH6A 3TC3A 3ARYA 4LC6A 1P5BA 1XCFA 3N13A 1PKYA 4C7DA 4WGHA 2REQB 2FZNA 4DJFD 1UUOA 1MNZA 5XIAA 4CVWA 3KXQA 2CZVA 1QNSA 2V6AA 1NFPA 1UA3A 3G3DA 2QV4A 3IPWA 1J9YA 3KM8A 3AHTA 1KFJA 4V28A 3O6CA 4K7YA 1ZAJA 4AXNA 1Z89A 3SRKA 2OOFA 3F4VA 4IQDA 3S2NA 2HRWA 4FNSA 3S1XA 1R5YA 3NYDA 2BHYA 1OIFA 3DFSA 5A2BA 4TO8A 2DZVA 3WQ5A 4XAZA 1U5JA 3OVPA 4B4FA 1Q6FA 4NHVA 2X1UA 1EBGA 1UMLA 2VHLA 2IPJA 3FJNA 3HQNA 3MJMA 1E6RA 2I56A 1RBLA 2B81A 1Q63A 3ZSTA 5AYXA 2J79A 1MZRA 3SJNA 3KRSA 4CGTA 2E9LA 3WLKX 3KLLA 2A5HA 4AF0B 1PIFA 1QVBA 3UNDA 1GPWA 1YTEA 4WKHA 4WLCA 2WNNA 4Q4MA 1XG3A 1AG1O 4F9DA 1X6UA 2BVDA 4B9ZA 5F1UA 3B06A 1AJZA 1AH4A 3G6LA 2HE5A 1XQLA 1J5TA 1XSKA 3EKZA 4JX6A 4YCOA 4Q6XA 4YHEA 2PCQA 3R7MA 5I00A 1DJHA 1NQKA 5AY7A 2PDCA 2PWVA 4MY8A 5A8QA 1UC5A 1XR2A 4JTDA 4TIMA 5JXQA 1H7NA 3N3TA 3K13A 3GG0A 4MNLA 2ZRUA 3BLIA 4Q4QA 4F0MA 3C2OA 1LP6A 3N34A 4LEQA 2VFEA 3EPMA 5GQBA 4MB3A 4GCXA 3PANA 4HB7A 4MNKA 3KRUA 3IJ8A 4HPGA 4LBUA 3BW2A 3TN3A 5FJIA 1W2PA 1OFQA 2XFRA 2ZA3A 3E2VA 1JYWA 3W74A 2G50A 4PMJA 3N29A 3ZT7A 1NDWA 4BEUA 5H8UA 2NSOA 1PTAA 2XDFA 1XIBA 3PR2A 2WWDA 3SN1A 4JIQA 3HOJA 3E1F1 3CUJA 3I6TA 3WLJA 2BWGA 3PAOA 3VKJA 4NP7A 2BBFA 1TVLA 4HP5A 3AUOA 2P88A 3NQAA 4KH2A 2YFNA 3ZT6A 5JU6A 3WQWA 3GS6A 3BJSA 4PMYA 4TVUA 4UIOA 4DZIA 1PUDA 4QG9A 3STPA 3M5VA 3T0DA 3HG5A 1CDGA 1VFLA 2XGZA 2JEQA 2QDEA 2G3NA 3N2BA 4BS0A 3LCWA 1G1YA 1BKHA 1W1B1 3UA3A 3CMGA 4AZCB 4KWVA 4US5A 3NOEA 1VFTA 4YJ5A 3VDHA 4UQAA 4NU7A 1Z48A 3ZR4A 3W07A 3EWXA 1RQBA 3O07A 3WDQA 5G2WA 1ITXA 1YXCA 1RY8A 5XIMA 5BOOA 2POTA 2Q01A 4JQ1A 1CCWB 2WW5A 5KEZA 3DOPA 4PFMA 2VDHA 7XIMA 2I1OA 2WANA 3JRKA 4H83A 3OVGA 5CJMA 3GNXA 3TOYA 3G0UA 3GU1A 3EMCA 4ORMA 3NDYA 5JIPA 4WK9A 2X30A 2UY2A 3N2MA 3ZLGA 2WMIA 1GVIA 3M0YA 3UEQA 3CUHA 3PTDA 2ZQ0A 4IICA 5JQ9A 2X1RA 1KA9F 4LH8A 4NNAA 4DO6A 4AH7A 1EGZA 4I8DA 5AYYA 4F66A 4EPBC 4ZEPA 2QYGA 3TR2A 4TVDA 4GBDA 2YCIX 4NASA 1V0MA 3FKRA 1C8QA 3SCWA 3KZPA 1GVYA 4FR6A 3QPYA 1QRQA 4L6HA 4ZE4A 5G5IA 5TIMA 2VEKA 5C9ZA 1WDPA 1L6FA 4C7GA 1KFWA 4Y9MA 3E2QA 4FX6M 3LGGA 1HIZA 3G6MA 3VUPA 2XN2A 1GQKA 3Q67A 5KZDA 3Q4DA 2YJQA 5D2XA 4CCCA 4B5TA 1S3HA 2ZIDA 4GXMA 1U5VA 4HA4A 1PHQA 2UY3A 3BE7A 5IRPA 2CYGA 2FPVA 2ZXQA 1DWHM 3EEZA 3WD1A 4L9XA 2JQXA 3IACA 2PURA 2SFPA 1R6WA 2VZTA 1BRLA 2BB0A 1E55A 3IARA 4QEEA 4HYWA 3W38A 4HMDA 1RAKA 1OX6A 4W5ZA 1HN1A 1P1XA 3W00A 4LYQA 3CHCA 3QXBA 2NV1A 4JKKA 1CXEA 2C0HA 5KINA 1WDQA 2Y7GA 7CGTA 3NQ6A 4CU7A 2ZCGA 4XZWA 5J8LA 1EJUC 4O0QA 1RA5A 4GVHA 2CBVA 4NX5A 3FAXA 3A22A 1EXBA 1ZUAX 1XICA 4HNNA 1V6XA 5HWMA 2OLHA 4KT2A 4IMAA 4BQ5A 3ANUA 3L2IA 3P93A 3UZJA 2X7WA 1FWJC 3UETA 3ATYA 2O55A 5AKQA 4JR5A 3PNZA 2RJGA 1EH9A 3KCOA 2YA2A 4MFDA 3UG4A 3U5YA 3UG8A 2V3EA 1UD4A 4B9YA 3OP2A 3H2AA 3QR3A 4S3FA 4GZEA 1VLWA 4EANA 3LUTA 5ENLA 1LDCA 4ZOBA 2QVHA 5I03A 4WDTA 5D2YA 3TAOA 4OHQA 4DN1A 3KVMA 4LUSB 1ZJBA 2YOCA 1EEXA 1CGXA 5CBIA 3W73A 6PTDA 3GYCA 2Q8ZA 4MPQA 1S2WA 4IIDA 2GL5A 3WEMA 4PA8A 1IF2A 4HGXA 1JFHA 2RDTA 3QGAC 4IFRA 2V5CA 2O9TA 4EP8C 1NH6A 4PR4A 4XAPA 3W24A 2VELA 2INEA 3T0TA 3URAA 1HP5A 4PGLA 3WUBA 4XISA 1GJUA 2WSPA 4DXKA 3UPBA 3G1AA 1F3WA 1JZ8A 3DEQA 2GQ3A 2YW4A 3W7PA 2A7RA 3P2VA 1OCJA 3A9BA 2C91A 3TWAA 5E70A 1WNOA 3W72A 2X16A 3W7GA 3KE0A 4X3ZA 2CLMA 3AS2A 4JQ3A 1ZPTA 3WNLA 3ITXA 3KEHA 1B4KA 2OT0A 3W83A 2HS6A 1OK4A 3FHQA 1N8WA 3MC5A 5AOUA 1SJDA 2ON3A 3WUEA 1NSJA 2WZEA 2VX7A 1KR1A 1UH4A 3UT0A 3QJAA 3SCTA 2FTYA 4IP7A 3U6WA 1M1BA 2PBOA 1CB2A 1KM5A 4CN4A 1VP5A 1FWCC 3S9ZA 4PEEA 1JZ3A 3CWOX 2AL1A 3GQYA 3CM4A 1OHLA 3APYA 3T8LA 3UWZA 4LPCA 2C1GA 3E38A 4B3KA 1WA3A 2ZX7A 3ARSA 3I3BA 5HQEA 3DBPA 3G0XA 1LM1A 2VENA 5IXEA 5G4EA 3LBMA 2ACUA 1AQFA 1M41A 3QHNA 2JF6A 5HPCA 1P48A 3SN0A 3HGJA 2H8XA 1UWUA 3VFLA 4XZNX 4GINA 5L6UA 1MQPA 3MZ2A 1QNOA 2DZBA 4HNTA 2D0GA 1VBRA 1VPXA 4XBSA 1FWIC 1FCQA 3SY1A 1G0CA 1J0IA 1GOIA 1ECEA 3BAJA 5MF5A 1G9HA 1S5MA 1TPDA 4LVBA 4OT7A 1VEMA 2CIPA 1UP3A 2V5JA 1AW5A 4FLRA 4UCGA 4GK8A 1Q65A 1V8EA 2BY1A 3WLOA 2V5LA 4D6EA 2VURA 1F9CA 1JZ6A 1W6TA 3A4XA 4PMZA 3CQKA 4LBSA 3SIMA 2ZADA 3MQTA 2O7SA 4LUYA 3WNPA 1KFBA 4RV3A 4G56A 3WQ4A 3CPUA 4E4FA 4D8AA 1S3TC 4DLMA 4FPSA 2DIKA 1OFRA 4PCFA 5I7GA 4R53A 1R86A 2ZZ5A 3O15A 5A8NA 1E71M 2ZOXA 3ALGA 3SSZA 3F03K 1BWLA 3LOTA 4IQJA 2XVNA 3HA1A 3EPNA 4WZHA 2W0UA 3TJLA 3HFYA 3QR0A 4RNIA 3AOFA 1CXHA 2RDUA 3O0KA 5F1VA 4B90A 2B7NA 2VXNA 3WLQA 2CZ5A 4BKNA 5LHFA 1EBHA 1EC8A 2IUZA 3KL5A 3HG2A 2QVNA 2IPGA 2VYOA 3HM7A 3VOGA 2I17A 1REQA 3G1XA 3V5OA 3KLKA 4PMNA 1SR9A 2E09A 3GXDA 3H21A 3VKCA 1H7WA 3GVVA 5RUBA 1GVRA 4NZ5A 3FK4A 1NP0A 1SUXA 1ZB5A 2PDGA 1J0JA 3URBA 4GKTA 1FWWA 2J7GA 2FFIA 1XYMA 2HV5A 5D4YA 5A8MA 4HMNA 4Z1BA 2NT1A 3JVAA 2GVYA 1TWDA 1OFDA 4X0NA 1CXLA 1XIFA 2I5QA 4H01A 4NAFA 3UJ2A 5KETA 5K3VA 2WHMA 1KGWA 4IMGA 3LD5A 3NAVA 5BOFA 2NVCA 1K7XA 4ADTA 2CLIA 2INFA 4PCPA 1ONEA 5EFDA 4LRSA 3MCNA 1L6WA 4MY9A 3VGEA 4AZBA 3C0QA 3K46A 4WX2A 2OYKA 3JU2A 2E9BA 3A3WA 3H6OA 4JTQA 4TXEA 2J9ZA 5LGXA 3CUXA 3GNRA 3T42A 3GNOA 2PP3A 5HQMA 3CK5A 2E6AA 2XYLA 1I1WA 3PZNA 5DT5A 5A6LA 2PC4A 4WEVX 3OOQA 3UERA 2WPGA 3ARZA 3BLFA 1A5UA 5CLWA 4US5D 4ROPA 3OA5A 3N04A 4DNMA 3HJZA 4XIAA 4CNUA 1JCYA 4N9DA 4RKAA 4ACYA 1YQ2A 1Q2RA 4AVFA 1MZHA 3O6YX 2PGFA 2EG7A 3DX5A 4H2HA 3AIEA 3OLEA 1QPOA 4H8HA 2YCJA 5C70A 4QE1A 5G1TA 1U83A 2Z25A 3W2KA 1DV7A 3K30A 4FI4A 3HV9A 4E3TA 4KFNA 5F4XA 4C6IA 3L9CA 2R1KA 1XISA 1BRLB 3VFCA 1Q8JA 2PTYA 3HGRA 1XLGA 1BEUA 5KSWA 3VIOA 1VQTA 4O1AA 2HISA 5AVNA 2FZDA 3FV9A 3AZRA 3CYVA 1WUFA 2V3DA 4Q8PA 3MMDA 3C4UA 1YPXA 5C9WA 3SUSA 2QAPA 4RNFA 2VUNA 5E9AA 5DMMA 3E0VA 3UP8A 2WMKA 4DF2A 3QY6A 3TN4A 4ZO7A 3TROA 3NUKA 3TMQA 1FP8A 2ZE3A 4N9BA 2ZTJA 5F2IA 4URIA 2WVUA 1XP3A 3WMSA 2RHGA 4C7FA 4GNVA 3HTWA 2GWGA 3EDJA 2BVYA 5M2FX 4U5IA 4NJJA 1PVNA 2DP3A 2ZRVA 1ADOA 4E8DA 1XLHA 1LT7A 3VIMA 3C56A 4WDXA 3GO2A 3QLDA 4JGDA 3BW4A 2FJKA 3DHFA 3M6YA 3BMVA 4Q6JA 3KZSA 4YL2A 2ALDA 1EF2A 2XIJA 4OJYA 2V5KA 4PMRA 1K9TA 1YADA 2FDMA 1FWDC 1W3JA 2OQLA 5EBAA 3VYLA 1TJ1A 2E68A 2ACSA 4XUYA 3UNTA 1GOQA 1WQ5A 3AMCA 5C0QA 1QJWA 4WY0F 3WQFA 4F2BA 4HYRA 1UBPC 2ZUTA 3E0IA 3ARQA 3HV8A 4PMVA 1VBJA 2YA1A 4AD2A 1C7SA 1F4HA 2EHHA 4KGJA 4N0RA 4ZB0A 1A3WA 1NFBA 4L6DA 2XVLA 1QI4A 3LY0A 4IPIA 3TSBA 4IGSA 3GVQA 1FA2A 2YCEA 3N2TA 3TN6A 2J27A 3M9YA 3MA8A 4JDBA 3HZ3A 1WV2A 1XLIA 1KWKA 1E4NA 1V93A 1VEOA 2OLSA 4W8LA 2GK1B 3AIBA 3EOEA 3H55A 3W6YA 3LPGA 1UR3M 4QISA 3R94A 1DIEA 4IIEA 3NR0A 4OZOA 1UWQA 3W7HA 1YDVA 4B5VA 2PTXA 3CT2A 1XRVA 4NXKA 1PX4A 2WJZA 4JTGA 4C6MA 1H7XA 2B7QA 4B92A 3R11A 2KZHA 3MHGA 2R1LA 4WGXA 2XJ7A 4S23A 3TJXA 5BXRA 1FH8A 3WD2A 1DQWA 3SCPA 1TWWA 1EOKA 1HKMA 3KS5A 1QFEA 4IL2A 4Z2JA 1B5TA 4G1KA 3N18A 4MOZA 4QSHA 4GFIA 2PU1A 1W5NA 4JTSA 3SCOA 1RP8A 1CGTA 2Q02A 1I2NA 2W61A 4UFJA 2GOKA 2VT0A 1O5XA 3NURA 4S3EA 1KW1A 1X96A 2YZ5A 5GNZA 4MF4A 1KRAC 2JKEA 1PPIA 2CESA 4IXHA 4MMWA 1YBQA 1JZ5A 4V33A 1F3XA 3CL8A 2PRHA 3L4WA 1SJCA 1DBTA 1J11A 2EF9A 2VGBA 3RO6A 3ITTA 3HN3A 2FB3A 3OZOA 4LF1A 2CLKA 3WK1A 2PDNA 3TQKA 3QOKA 1R7AA 2AQWA 3GG8A 3R6IA 4IM4A 3E96A 4GY0A 5G4HC 3WQDA 2BXVA 3S6TA 3SGUA 1SFTA 1RJPA 2NUWA 3MKVA 4WQ6A 4C6DA 2H3DA 3CQIA 5CGMA 2TSYA 3G8RA 4M19A 5C5YA 1A5MC 4RE4A 3W1MA 3UVIA 2VDIA 1O5KA 4S2BA 1DL3A 4MLJA 1LQ2A 5E9XA 6A3HA 3W7DA 3AO0A 3ES8A 4UQBA 4LALA 3OJGA 2GVGA 5I06A 2HXTA 5BCAA 3H7VA 3UWWA 4MIMA 4Z2HA 5AHFA 2OYMA 1NJJA 3CAQA 5DBUA 1IZCA 1XIEA 5D9PA 1B2YA 5HMEA 1XUZA 3VDAA 2E0PA 4F3HA 5K9XA 3VX1A 3LLDA 2QS8A 3K1GA 5M03A 3WF0A 4MYAA 2NQHA 2O92A 1B3YA 1VJIA 5FAGA 3ZLHA 2XU2A 1NIUA 4PUJA 1KKRA 2BTMA 3S5NA 5CEWA 1W9BM 3QSRA 3VNJA 2A3BA 3UR5A 3W7CA 2YL8A 1Z6KA 1Q6RA 3DFYA 3EXTA 3NCOA 4MG4A 4X9SA 1FWEC 2WNWA 2A3CA 4DI9A 3QGVA 3AFBA 4IISA 2XIQA 3D46A 3ZFHA 2YDAA 3SRHA 5CC5A 3FXGA 2VC7A 4H6KA 2ADAA 4LAOA 4JQ2A 3O1NA 3ZWSA 2PCEA 1JZ4A 4UQCA 2OFJA 1BXBA 6XIMA 3LRLA 3A3XA 4ZOCA 2IQ0A 3W26A 4QS6A 2Q3RA 1W5PA 2OEKA 4K39A 5BMWA 3L4XA 1VPYA 4P8VA 3VNIA 4FXJA 2WQDA 2PDBA 1GK8A 3WQEA 2GUBA 4DB7A 1AUSL 1EYEA 3W2NA 1MFUA 2E67A 3GW3A 3TDFA 1QOXA 3RGTA 2ZX9A 4O16A 3WLLA 1UOKA 3EDEA 1ONRA 4UQEA 1RV8A 2HVOA 3QYQA 2PDKA 4DAFA 4HZ8A 2OTDA 3W7KA 4QXIA 2Z2UA 3PPGA 4J4KA 3P61A 4DPPA 5BZAA 2Y1HA 4XD4A 4L1WA 2BVWA 3T2OA 1CX9A 4F0RA 5TBOA 4GH1A 1KBJA 4GX9A 5TNVA 4JAWA 3BUVA 1C91A 1QU4A 4YTRA 1JCJA 3BAWA 1HW6A 2BOGX 4A4AA 1C8YA 2OZ3A 1Q85A 4TX9A 2XFYA 3GC2A 4J2PA 3R13A 1EFZA 5HPOA 1P0NA 3NL5A 5HNUA 5D30A 4FLSA 1RZMA 1VBUA 2Y62A 4R34A 4GZIA 5JBEA 4H9YA 3WF3A 5BOEA 3NL6A 1WZLA 1BYAA 3ITOA 3O06A 3IJDA 5H91A 4WIWA 2E8ZA 4M7TA 2Y6ZA 4XG1A 1SZEA 7REQB 3EWUA 3IAQA 2PBGA 4FS9A 3CZEA 3F5LA 1H3GA 2VC6A 3LERA 4WHBA 3UCCA 3UWUA 1MRQA 5FIPA 3QH2A 3S2JA 3PJXA 4P2VA 1Y7VA 3NGJA 3RUBL 4AWSA 1FX6A 2CZDA 4KWUA 1JULA 3USZA 1KD0A 2VD9A 4ML4A 2DJXA 4KBXA 1RPXA 2VNCA 1E4MM 4H1ZA 1WO2A 4JYEA 1XHGA 3GR7A 3DHDA 4ZOAA 5A3HA 1MVYA 1EJWC 3DN5A 4NJIA 2BOFX 4AZ5A 4NYUA 2Y0FA 3HMJG 4YTSA 3W7IA 1V51A 3ABSA 3CUIA 3REQB 3DAQA 3FVDA 4I6KA 3VNZA 4UNKA 3HURA 3S4TA 3CJPA 1KBKA 3MUAA 3E6EA 4NUWA 2HWGA 1R2SA 3MI6A 1MNSA 3MZNA 1MDLA 2VJXA 1N82A 2WLYA 1L6YA 4B91A 2ZRYA 4AY7A 4UOJA 1QOQA 4D6IA 2Z1BA 3O63A 1LWIA 1YKWA 1B3VA 3AXMA 1K02A 1U30A 3RLGA 3W7RA 4M24A 4O52A 1K6AA 3GRIA 3I4EA 2C8NA 4AD3A 3GDRA 1XH2A 2V5DA 1P6CA 3ITLA 3P84A 4EPDC 3NG3A 4LV4A 2DZTA 3ME3A 1JGMA 4RUBA 2FYMA 4I9MA 5F2GA 1JR1A 2ZZ7A 4UFLA 4XBJA 4CVUA 4H8NA 3IIPA 3OHIA 4AHOA 3GKFA 3QKZA 3M64A 1C9WA 3CB8A 2CKSA 1KCLA 1ZCCA 1J6OA 1F6KA 2QXWA 3PZ9A 2AGTA 4MYXA 1UBSA 4J1OA 1XLCA 5JIWA 4NT0A 3OZPA 5G4WA 3R0UA 4CD8A 3B4YA 3NGFA 1LRQA 3UY8A 3ABRA 3TYUA 3O3RA 2PWGA 1W3LA 4HZ6A 4IGMA 4Q7BA 5CPNA 5I79A 1DWFM 1JPHA 2R24A 4QDMA 1EZ2A 3PPHA 4J2MA 3N2OA 4ILSA 1XKYA 4N6EA 3WQOA 3BG5A 3LCXA 1ISYA 3G1FA 4LTSA 4RV8A 4ES4A 3EXSA 4PN2A 2X05A 3G1HA 1FUYA 4YVPA 2V2HA 3BK0A 3U4AA 3PWAA 3UQNA 2WMIB 3ALFA 4DBSA 2H9AB 2ISSA 2A21A 3SCQA 4H9ZA 2BFGA 3V3WA 1TCDA 1DORA 3FS2A 5LHEA 1JDEA 2X40A 3OA3A 3PJUA 3K2GA 4ZQRA 1PHWA 2DUXA 3KFTA 1RH9A 4XKYB 3EDDA 3WELA 2NV9A 3GXFA 3GD6A 4WVXA 4E6MA 5FOOA 3T0BA 3BLDA 4GA8A 1TKKA 1SW3A 4XSMA 4PUWA 5D38A 1XDJA 5T9CE 1WDRA 3WDRA 5LA2A 4CQDA 3GHRA 1IXQA 1OCQA 2P3ZA 3VNMA 3UWQA 3ZVIA 1JUBA 4UTTA 5I3FA 3KBWA 3AWOA 4NX0A 3WF2A 5A6BD 5FF3A 3V16A 5DO8A 5A6BA 1AQHA 1XJBA 1V3KA 1JVNA 2Y63A 3CIWA 4TMCA 2QCLA 4Z42C 3SEPA 3CPGA 5D2VA 3NQGA 2YKKA 1AL8A 3PNUA 4O18A 4GI6A 3WH7A 5AHLA 3WBXA 2YR1A 2W79A 3QZAA 3R58A 4JFWA 1DEDA 1TPH1 5FSDC 4CKQA 2Z27A 4S3KA 2VUYA 2JK2A 3B97A 3VZYA 1H09A 1JCMP 1SSGA 5D8WA 2WO5A 1OCBA 3VXGA 2CCRA 3CEUA 1WBHA 3KWSA 2IPFA 3ITYA 2AQOA 2PDWA 4NZJA 1EEPA 2IPWA 1E56A 3L65A 4M0XA 5CJ5A 4XBKA 4HSNA 1CXFA 2R6OA 3TCSA 2G3JA 1IWPA 4GUFA 1NTHA 1XLDA 5I0DA 2P1FA 5GJPA 4L80A 4LVDA 2D2OA 4B5NA 4Z2IA 4GYPC 1WB0A 3UZYA 1SJAA 5HQLA 2PLCA 3LYEA 3W1UA 3C3UA 2PTZA 1J8VA 1IWBA 2HK1A 3CZLA 2ISDA 1GEHA 1F5ZA 2Y61A 1M9HA 4KESA 4LAMA 4JL2A 1X1NA 3G1DA 1AVAA 3C2FA 4NJHA 4NI3A 4FZIA 4LS2A 1UP2A 1RVGA 1TR9A 3B9NA 4U10A 3KVJA 4Q8UA 3EGJA 3CIXA 3TW7A 4FF5A 1V3MA 1GYMA 1E1CB 4S3DA 1AQ0A 3KOWA 2I5GA 1GVFA 2WSKA 4D6JA 4HPNA 2WBKA 3OBAA 3BDKA 1GGOA 3IJ9A 4TU1A 4O53A 3TFXA 2XN0A 4AF0A 1EJRC 2VD8A 2DSKA 3FKKA 3M0ZA 5K4XA 2VI0A 2DZSA 4YLWA 2WWCA 3UJFA 2O9PA 5HR6A 3H2CA 1T96A 1OGGA 1R9YA 4Z1AA 1KTCA 2BGSA 1ISXA 4QSFA 5HNNA 5JH1A 3UZZA 4ZFMA 1QDSA 2DGAA 3AXKA 2VR5A 1R8LA 4EXAA 4N9EA 1THFD 2DIEA 4TUFA 4L61A 2YLAA 5G1MA 2PF0A 3GK0A 2ABAA 4C65A 3BMWA 2XH7A 2EPNA 3GSMA 3FA3A 3M4HA 1FDYA 2OZTA 5D9OA 3A12A 4MPKA 1E5JA 2JFEX 3B0VC 3VKAA 5BYWA 1TV2A 1VR6A 2A3AA 3MSDA 3D5HA 3CL6A 1KV5A 3APGA 2RKXA 4Y8FA 1H4PA 1B4EA 1CLXA 1CEOA 3RXZA 4ACZB 4CLMA 4TR9A 1HO4A 3LCLA 1W3IA 3WCZA 5I3JA 4MZYA 4R5EA 1C7TA 4GIRA 1S2UA 4H3DA 1H7RA 3WLRA 1B1YA 4Q3MA 3T09A 2FDSA 4AZGA 3KBMA 3GXIA 1QI3A 1BF2A 4QQUA 3MMWA 4LS1A 2BGQA 2MNRA 1AA1B 1D3HA 1UZ4A 4OQVA 1C3FA 4UWMA 5TF0A 1GKRA 2CXEA 5HBFA 3AI0A 1OSEA 3F5JA 3KOFA 3F5KA 4MWAE 1IV8A 4FO4A 3V36A 4WY0A 1UWTA 1FTXA 4UMBA 3KVKA 1VYPX 4IPJA 3W1XA 2OQHA 1L0PA 1DTUA 2VC9A 1KXTA 4JEJA 4Z2GA 1U1UA 3QC0A 1I6NA 3DH7A 1P6WA 4D6DA 1W3TA 1PKLA 1HKWA 3WK3A 3VDCA 3RPDA 2WPBA 4E2DA 3WG6A 3G1VA 3D6NA 3W71A 3L66A 4FR1A 3DFOA 3EB3A 2E6YA 4I9JA 1J12A 3JR2A 2IKJA 1XFBA 3V18A 4WJ8A 2KX9A 5EMMA 2JGQA 5AC4A 4KWOA 4UB9A 3V1HA 2QCDB 3OQEA 4JQAA 3H22A 2ZX8A 3PG8A 4Y7EA 2UV8G 5ABEA 4MWAB 4CN6A 3WJXA 3M46A 1XIIA 4HJFA 3MDWA 2EPMX 1G5AA 4GOAA 4LB4A 5FJTA 4NJKA 3WL1A 4LCSA 2G3IA 3BURA 3TSMA 4ZSUA 3S1GA 3UY7A 1RUSA 1D7KA 1XPYA 2VFHA 3V0SA 1MYRA 4LNCA 1FY6A 4JTRA 4S1FA 1QW9A 4HHPA 2HCVA 4UUIA 4B2DD 2HZGA 3MB9A 3VM5A 3OODA 1U33A 5AYBA 4A8IA 3L21A 2OJPA 3MMUA 2HE8A 2W63A 3E0WA 2WCSA 3VOCA 3PJTA 1KC7A 1JPDX 2PGEA 3CAWA 5T8GA 1XLKA 3N4AA 1UASA 8CGTA 3HG4A 5I3GA 6REQA 1DIOA 1GTEA 1YDYA 3SJ3A 4KWSA 1CECA 3WH6A 1ZJAA 2CETA 2IKHA 1E3XA 3MYPA 1BG9A 3W23A 3VZXA 2OPJA 3WENA 3KAOA 1JXKA 5ABFB 4X60A 1VYSX 2VWTA 2Q71A 4AZHA 3TNBA 3DFQA 1FHVA 5IFPA 2XH0A 5A1AA 2WSYA 3QFEA 2FGLA 4ENLA 1R2RA 1V6UA 1BYDA 2D2GA 5CSSA 2ONEA 4F79A 1GQJA 2HS8A 4ADUA 3OQ8A 4BF7A 3L67A 3S46A 5IFTA 3G1RA 1A5OC 4IPNB 2DT1A 4Q4KA 1H41A 2BMBA 1XIHA 1WE5A 1PWLA 3M47A 4FNUA 2W67A 2VX5A 4PBGA 1WKFA 1TWZA 1OM0A 1SO4A 1NP2A 4QGCA 4JEQA 3WF4A 4S3BA 5HAOA 1VAHA 4PTMA 1F3EA 3R89A 1OX4A 2QCCA 3UXIA 3QTGA 2Z1XA 2YIHA 2HTMA 1W1PA 2DQXA 1TO3A 3JS3A 3V1PA 4G7EA 4IJCA 4CU8A 4O1CA 4DJFA 2ANUA 1QHOA 2FMOA 5E0KA 2GGHA 1FHUA 5DY2A 3MVIA 4OOUA 1VJSA 4KW2A 3N1AA 3LXBA 4LAUA 1BQCA 2BHUA 3EZ4A 4W7WA 8A3HA 5HUPA 1JQXA 4W5UA 1W1TA 5DMYA 4ZZ9A 3SDOA 1EUNA 1Y5WA 1I1XA 4JXCA 4P8WA 2HROA 3ZT5A 3W22A 6XIAA 2GDUA 3KRBA 3NQFA 5CSUA 5AFDA 3C5QA 4G8TA 4QCEA 4U31A 4EX4A 4M5PA 3CMJA 3R10A 1EP1A 4I7UA 2UBPC 3NJ3A 2EAWA 1NF7A 3F4CA 4YS1A 1JF6A 4ZO8A 5HR7A 2GJPA 4LRTA 3MHFA 2G5WA 3VIGA 1J18A 4MZ8A 1QPKA 2PP0A 2QJHA 1O1HA 4UTWC 4UZUA 2OVLA 2H3BA 2F2HA 4LF2A 1SO6A 3WJWA 2BZNA 3PZUA 2YDSA 4Z17A 4QE5A 1EGMA 4RW3A 1RP9A 3ANYA 3HBLA 1YDOA 3QV9A 2CWXA 4H7CA 2E6FA 5DCBA 5KTLA 4MKVA 1XINA 4GIAA 4LW7A 3ZQ9A 2JKPA 2FZMA 4DUOA 4IFKB 3L12A 3B04A 1VFHA 3LCIA 2J8FA 5A6TC 5FSEC 3JZEA 5CH9A 4P61A 1XXXA 2C15A 1M03A 1GQIA 5D05A 3EMZA 4Z2KA 2X8RA 4J3UA 4DBEA 1UJPA 1JDCA 3EYPA 4JTTA 4TOQA 2Z6IA 2NT0A 3CMFA 2ATSA 4FXRA 4WXZA 3H8AA 1CTNA 4AXKA 1DJGA 4JY9A 2QMKA 3AQUA 4IT1A 2Y70A 1T8QA 4M1RA 1EB3A 4NKCA 3L4ZA 5M1TA 5LNWA 3B8UA 4MJ2A 3CV2A 2ZVIA 3GXTA 3LCGA 1T40A 3RM4A 2CHNA 4L4OA 1ZSXA 2WMGA 2VEPA 2XVGA 5I07A 3AC0A 1F6PA 3LV5A 1SQ7A 3VIPA 1LROA 4XX6A 3GHUA 3R79A 3G8EA 1MXGA 1LL4A 2E3ZA 3M5ZA 2WZHA 2VEFA 3HGOA 1XQKA 3P3BA 1MW1A 3QW3A 4BEQA 1OD8A 1M65A 3B9DA 4KCVA 1TA3A 1GW9A 1VLIA 3V75A 3IJ6A 3N4FA 3Q94A 1J2BA 4AVNA 4REQA 3VGDA 5DXXA 4CD4A 4RR4A 4UFKA 4DJFC 1YLVA 3WNOA 3OYZA 4UOZA 3W75A 1E6ZA 3T8QA 3STGA 5EBUA 6TIMA 1DE6A 1VRDA 3BZJA 1FH7A 1IXPA 4IJBA 2I9UA 2WVSA 1XBZA 5BXPA 2QCNA 5B7ZA 3UJEA 3ZJ6A 3HIJA 1YTKA 5DN1A 3UBPC 3ZVHA 3BGAA 3LSBA 4I7VA 3SR7A 3KW3A 2Z26A 1W9UA 3UGVA 1ZP4A 1F7BA 3MO7A 3FSTA 4C6CA 2F38A 1R9ZA 1G4PA 2V3FA 2A6LA 1IXNA 1SZGA 1EQCA 2W9MA 3EB4A 1V03A 2AL2B 3M43A 1TZZA 3OO2A 4UMAA 5F4WA 4NZ3A 1E3ZA 2VTFA 1TPWA 4YNGA 3ID7A 1GQLA 2FPTA 5C6MA 2J24A 4GUIA 1NM9A 3UA4A 2VEGA 3S5YA 1GOWA 1V7AA 4QNWA 3H2NA 3TXZA 1UD2A 3WLHA 2P53A 2R94A 1TWIA 4US6A 4A3UA 2WC4A 2Y7FA 2X2YA 4M7SA 4PCTA 2BY3A 5A8OA 3A21A 2V5BA 3EOSA 4AX6A 4B4HA 3WH5A 2OODA 2A7NA 2X2GA 1DYSA 2ZZ3A 1XRTA 3W7EA 1GHSA 3TIMA 1XLMA 1ZJHA 4CD7A 3OBEA 1KXHA 4UFIA 1A3XA 1GVQA 3PSWA 2GGEA 1Q7MA 1YHTA 4EAMA 3PHAA 1SMDA 1EF3A 1CBGA 2ZX6A 1E5NA 4FXSA 4HA3A 3DFPA 2NX1A 4JFVA 3DC0A 1J0ZA 2PLKA 4YHGA 1UR2A 4C6KA 3PG9A 2VFDA 2ICSA 1DTNA 3JZUA 3MSGA 3KTCA 3W4RA 4O15A 1XYCA 3GW0A 1PCWA 5H2ZA 4WDUA 3U4FA 1J6PA 1EDQA 1P43A 1GOOA 5C7HA 2DQWA 1ISVA 3T81A 3B05A 5C54A 2YCKX 3A24A 4CQ9A 3NM3A 4BQ2A 4LX4A 4AAJA 3L5MA 3PPFA 1T7LA 3UPMA 1HL2A 2IMRA 3KRZA 1GOXA 3U2CA 4R7WA 4PB3A 2WMFA 2V82A 2G96A 4AC7C 5FF4A 1GNXA 3S5ZA 4QAIA 1LLZA 2QKFA 2Y88A 3NQBA 3TJIA 3A6OA 4G2DA 2V81A 1O66A 2Y4SA 3W6MA 5KZ6A 3MSYA 4AVOA 2WQPA 1XGDA 4M80A 1OC7A 8TIMA 4K38A 1F73A 2PDQA 3AJXA 2XH2A 3QC3A 3PWIA 3GFYA 1VH7A 3V5FA 1HKVA 5D2WA 3ZS4A 3NSMA 3ECQA 3H23A 4LUJA 4DI8A 5TQLA 1Q13A 1GKQA 1YMYA 2Z4GA 1IGWA 2X0HA 4Z1DA 2GJXA 1JZ7A 4UTHA 4W7UA 5TAOA 2X42A 3AHVA 4ZO6A 1W91A 4JTJA 3C6CA 5H8MA 1P7TA 1TJRA 2BNJA 4PB5A 1JPIA 2F2KA 2Z1SA 1SO5A 5FJRA 1EA0A 1K8CA 4JPGA 3THDA 5HDRA 1BWKA 3MV01 4R27A 4HK5A 3IGSA 2OO0A 4LBRA 4DF0A 4B5XA 1US3A 2J66A 3NSXA 3PSVA 1VBHA 2MUCA 2D69A 1LORA 4C5YA 3LQLA 4IUGA 1KM0A 2ZYFA 3UR7A 4W9TA 2ODOA 1LZOA 1NQ6A 3CTLA 3AIRA 2XM1A 1NWRA 4JD4A 2PDIA 4NYYA 4PTNA 1OFEA 4NG3A 1H5YA 3IWPA 3WL0A 1WOAA 2P8BA 4O1DA 2PDUA 1TVPA 3VZZA 4BWLA 4OKDA 1HJQA 1Q6LA 2TPSA 5IDIA 2F8QA 2XFWA 2O0TA 1D2KA 2WSQA 4GRSA 1VFMA 5LSMA 2E5BA 3M44A 3B03A 3VIKA 3PBVA 4PRTA 1LT8A 3WLPA 4HJWA 3VA8A 3UVAA 3GXNA 4PMQA 5HMSA 3T08A 4JKLA 5BRBA 3VO0A 3VKKA 4DPQA 2EJAA 1OYAA 2Z0IA 2GSEA 4JTLA 3W1LA 3R0KA 3MUZ1 3BV4A 3OZMA 1S39A 4GQBA 3DU0A 3CIVA 2BY2A 4A8RA 3NQMA 1W9DM 4KRUA 3H54A 3H2EA 3S2LA 3YPIA 1QI5A 1RK5A 2WZMA 3TYZA 1LCOA 3SAZA 4WSHA 4OWGA 4UNIA 3CO8A 5HA7A 4XTIA 1R38A 1WX0A 4JICA 1EJSC 1S5TA 2OT1A 2W5FA 1FRBA 4K8GA 4MM1A 5G2IA 4A3HA 4P7QA 1DWJM 3TA6A 3S9YA 3OYXA 4HPJA 3PZQA 1DJZA 5EKYA 4AC1X 5K4ZA 4JFSA 4U3AA 3WLIA 3PS7A 1PXGA 4ATWA 2CBIA 1KM4A 1Q66A 4R3UA 1R47A 2ZE0A 3LX9A 1UIOA 4PMUA 2VDGA 4PUKA 4WCJA 3G5EA 4ERAA 1VYRA 2XUCA 2OEMA 1JL8A 1YNQA 1SFJA 5AB3A 1HXJA 1LRNA 3USBA 1VZWA 5FEPA 1TWSA 1QHPA 3EX4A 4OE7A 3ARTA 3WH9A 2J62A 4UNLA 3WDJA 4JX4A 1SYTA 4GKLA 2VOTA 1PIGA 3ABZA 1Q8AA 2P0OA 1UKQA 1FBAA 1J93A 4BWLC 2XGIA 3DHPA 4JIEA 5EMLA 3RK8A 2YFOA 4W4QA 2YCLA 2GSHA 1DJIA 5BW6A 1K3UA 4R7JA 4D8LA 4AY1A 4JHOA 1JYVA 3MI3A 3TE9A 3XINA 5FKYA 2C1HA 3TJ4A 4IPLA 4Q4RA 1QXLA 3FYOA 3S2CA 4DRSA 4ZL1A 5CPTA 1ICPA 2QZRA 1FXQA 3VIIA 4JOMA 3MP5A 4F40A 1JIBA 1R3QA 3W2MA 5ECUA 1GORA 3W76A 1MW3A 4QRNA 4LUTB 3R8HA 3ARRA 4GNJA 4U28A 2XTKA 3W87A 1UR0A 4DJED 3G18A 2EBNA 1IR2A 4JTHA 1LJYA 5CZTA 2OXNA 4KCTA 3UCDA 3QQ1A 4UQ9A 3KDNA 4EXBA 5EL1A 1BF6A 1BGAA 3ZSSA 3OLDA 1TZ7A 2GVEA 4E8GA 4UQDA 3GAKA 1L6GA 1HUVA 3QQ0A 2BVTA 5XINA 2F6UA 3FJ4A 1WZKA 1J2WA 1KBIA 2PWDA 5HULA 2QCHA 3B0UX 3N73A 4EE9A 3I4KA 3WQCA 4HZMA 4QLLA 4M6UA 1Q2SA 1B3OA 3BICA 3BARA 2HNEA 2EKGA 1XLJA 2NXIA 3G77A 3WFLA 4ML9A 3U48A 1GZJA 1RLDA 3EWWA 4WOZA 2ZA1A 1D8WA 2ZUMA 1H0IA 1GG0A 2X1TA 1MDRA 1PBGA 2CHOA 2Y8KA 3WEZA 1GPFA 5LIKX 3FGCB 4HVXA 1N8IA 4H2CA 2V3GA 1HF6A 2WBGA 3W7QA 3EWYA 3VE7A 3G0SA 3DYOA 2E77A 1CT5A 3QVQA 4BZYA 5FL0A 2DZPA 2ZVRA 4ZSTA 1M53A 3GM8A 1MRAA 5C9XA 3V7PA 5IDZA 2YA0A 4YWIA 2XM2A 4J40A 3KCJA 3WNNA 4AHQA 2G8ZA 4C6FA 1U1HA 4NRRA 3OZYA 3V4BA 1QUMA 4H7VA 1HX0A 1FDZA 2QCEA 1AD4A 3SFWA 2WSRA 3WNKA 1PTGA 2V67A 1NWSA 3P6LA 2DZWA 2YL5A 4F8XA 1TG7A 3PZMA 4V1YA 1T6MA 4O19A 1YX1A 1ZAIA 3ZR6A 1KGXA 1QO5A 3QMTA 4UTMA 1NEYA 1JDFA 3AS0A 3RDKA 4JDYA 3LPOA 4A22A 2OZ8A 4JL1A 3MUY1 1M7XA 3BG3A 1W9XA 4RK8A 1EIBA 3K5XA 4LB3A 4GGHA 4L56A