3W2WB

Crystal structure of the cmr2dhd-cmr3 subcomplex bound to atp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
322
structure length
308
Chain Sequence
b'MIEVTFTPYDVLLFRESRPFDAGSESVARSIIPLPQTVAGAIRTLLKGLKNCVGVGEEEPEFTLVGIAIGTEKGRIYPLPFNIIKSFYKVVNPGRFLGKLILPPKGKYKSGYVTESILEKYLKGELKEVEENKVIRIEKEKRIGIKLMLYTVEFLRIEKIYAWIEDPGCGIKDILSSYEFLTLGGESRVAFVEVDDKTPDIFNRELGSTKKALFYFSTPTIGKVGEIVQELEKRLNAKIDDYLLVSSRPTAISGWDMHEKKPKGTKFAIPPGSVLFVEFKEEVEVPPYIKLGKLKKLGYGLALGGIWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR system Cmr subunit Cmr2
publication title Crystal Structure of the Cmr2-Cmr3 Subcomplex in the CRISPR-Cas RNA Silencing Effector Complex.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Immune system
total genus 60
structure length 308
sequence length 322
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09700 Cas_Cmr3 CRISPR-associated protein (Cas_Cmr3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.80 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 3w2wB02
3.30.70.2950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3w2wB03
4H4KA 3W2WB 3W2VB 3X1LB
chains in the Genus database with same CATH superfamily
5LMNJ 1LWXA 2IDLA 3M4XA 2R8KA 2QG9B 4H4KA 4CLWA 4WF9Q 3TJ8A 2LXUA 4ZLLA 4ZVSB 4ZDNA 2M7SA 5CYMB 5EWGA 1QAIA 3D6MB 3E8OA 2MZJA 2GAEA 2BANA 3C14A 1N0UA 4LFCJ 1GTSA 1Y5IB 2H4YB 2KXNB 3DRPA 4O0NA 4XO0A 1U6ZA 2DEIA 3PZPA 4WFZA 1VJQA 2EFVA 2ROEA 2ZHOA 4IRKA 2IC3A 2GIFA 1RQ0A 1E6YA 2RMLA 3FNNA 3MMCA 1FEEA 4L75A 2IM2A 3BGOP 2FC8A 2QL5B 2JHEA 5JVHQ 4NLRA 4OV1A 1NDPA 2XSJB 5HBMB 2EBGA 3AFGA 2ATLA 1NEEA 4AXIA 2QLWA 3OXFA 1X4CA 4JI5F 1CS4B 3W7BA 3P8BB 5D4OA 4U8YA 4I0WA 5HMWA 2ZH1A 2ZBPA 5KFMA 1X9SA 1R8HA 3HJFA 2UVRA 1URRA 2GVZB 4DV5F 3IGNA 1D9FA 1ZM3A 4BS2A 5KFPA 5KG2A 5IV4A 1WG1A 2W01A 3DRSA 3B4MA 3M9MB 3TEHB 3MR7A 2RHSB 3SQGB 4UZBA 2LFVA 4IYQA 3DU5A 1S9EB 1S6QA 4NRTA 1RWPB 2CPIA 1NPKA 1Q7LB 3TRGA 4KFBA 2QA4S 1NZ8A 2JZ5A 4B3MF 2ZBQA 3C3LA 4E8UA 4ECRA 3D6FB 1RBAA 3LP0A 5EGYA 1S0MA 2P8IA 3R97A 3DMJA 1SC6A 1RT3A 1X60A 2HMIB 2RH3A 5GAEU 3H0PA 2DPJA 1TL1B 5D4PA 3OQ2A 4OL8A 3IFEA 2WBRA 1WKJA 5HVFA 2CFXA 2OPPB 1MW7A 4OLPA 4DV6J 1W2BR 5D77A 4V19J 1EB0A 4JV1A 3MEEB 4K7QA 1VDHA 1VQKS 2C3YA 3Q8RB 3CJQA 1Q79A 1PC5A 4I7FB 1FVQA 2Z8QA 4X4QA 3C19A 3U02A 3EE3A 3B6BA 1UWAA 1XNQF 4M5DB 4KGMA 4MK9A 3Q2SC 2V4RA 3FUYA 3IP0A 3P3DA 2ZDOA 1GK8A 1TV6A 3MMAB 9ATCB 1K8AT 2Y8YA 3FRYA 1UVLA 4OLOA 2EG1A 3BSAA 3F56A 4ILMA 1TUWA 4F2RA 4C11A 3CCUS 4DV7J 4FBTA 2IA6A 3ISND 2ROGA 4MYTA 4IDKB 5KFYA 4K4XA 2HIYA 3HHKA 2C22A 3D54A 4CH0S 2D3OR 2E9ZA 2BE2B 2CDRB 3FFIB 1RT7B 1NB2A 4C11B 4DR5F 5ETRA 4DPOA 4P2MA 2OPRB 3B82A 2D9OA 1AB8A 4ED6A 2ZZNA 3CVKA 3US5A 2XI2A 4RBVA 1HBNA 2J9CA 4Y2AA 1WSVA 4MH8A 3J81Y 2FUG9 2CQ1A 4G1IA 2B4OA 5D0EA 1NO8A 3UDCA 1SUQA 1V5IB 2CAJA 3CGIA 1EQMA 4TQSA 3GP9A 2XG8A 3E3XA 4NEZA 3D1HA 1VIOA 4CLFA 2EFNA 3HHLD 1IBMJ 3GONA 2DXDA 4LBPA 1B3TA 1RAAB 3G96A 3JAMU 3EGZA 3HHLB 4NX9A 2UUWA 1NXIA 2ASDA 4IFVA 3C15B 3OHBA 2FHOB 4M8LA 4O3SA 2BKPA 3W2WA 5K8PA 2ZUAA 4DZDA 4LF9F 3KJNB 3I56S 2N7CA 1K0TA 2FZGB 2XNRA 1XMBA 1JJHA 4H4OB 4EZ9A 2XS2A 3CCQS 1VGYA 5HMYA 2L48A 1M5OC 4ID5B 5DS7A 2BJEA 2KVQE 2F8EX 3CW2C 2EK6A 4U67S 1WNEA 3CC7S 1E6VA 3HDSA 1KTVA 1NM2A 1VRTA 1F2GA 2HWTA 4LRCA 1BY9A 1Q16B 1TL5A 3UD5A 2DNLA 2OLWA 4WP8A 4ECVA 2M88A 4KBIA 2UUBJ 3MUVP 3W62A 3DFEA 2AGQA 2E7WA 1H7WA 3NAIA 1M5KC 2RQMA 5EX3A 4DR6F 3C6TB 1BC6A 2FZKB 1X4FA 4ELVA 1VLOA 2OFGX 1Q7YT 4NEYA 4TN2A 3QJPA 2NCKL 4NYZA 3MR5A 4PCQA 4DR2F 4ED8A 4ES2A 1KKHA 5IM0A 2MKYA 4GKKJ 1WF1A 4I2QA 1TK5A 2VD3A 2G0IA 2MKHA 1R3NA 2DGWA 1VQMS 1AXQA 2P2CB 1VI7A 2DR6A 4OYIA 3SCIE 3IM8A 1YJWS 3ISZA 1LWFA 1OQ3A 3MGJA 2L41A 2JC0A 2I8EA 4DSEA 3HSZA 2HFNA 3M32B 3R2CJ 3DXSX 2CPXA 4LBIA 4X2BA 3TZWA 3PW0A 3KNGA 1UW9A 3FJ2A 2R2RA 2WTFA 1C4AA 3AXMA 1TVRB 4KKOB 1O8BA 2B5JB 2BDPA 3MDFA 2ZUGA 1PC4A 4IH5A 2AZ1A 3R5AA 3ET6A 2CPJA 3MEDA 1S10A 4B08A 3IR5B 1MWYA 4FNIA 2A6MA 1R89A 4AFFA 4RJVA 4ZVUB 1MU2A 3P5BP 4WIIA 3AODA 1R8BA 3MUTP 3U27A 1S49A 3P4UB 1U1OA 2HHHF 3O3LA 1SH0A 1TL7B 3VALA 2GHPA 2FQQB 3G6VA 1EQ0A 2F3JA 3J7YI 5B0BA 2DB1A 3OHAA 4CLTA 3T5LA 3W60A 2DISA 2CQDA 1X4GA 4JYAF 3SFUA 5B0CA 1Y11A 4FNHA 1RWUA 1H73A 2WVFA 4DV1J 3OLBA 4QWCA 5BJRA 3DNCA 4CNYA 2ZC4A 1Q78A 3UW1A 4L73A 3KLGB 3G9CA 2HGNA 2KFNA 4PUOA 4YDXA 5M2UA 1SQGA 2RHQB 4OI3A 2CNNB 3JSMA 4FN5A 3NBPB 1YGYA 2HZ7A 4P2XA 1RTJB 3OT9A 1CJTB 3LQVA 1RT5B 3CO9A 2AEJA 2VFVA 1SI9A 2A1BA 2GO8A 4Q2MA 5D6GA 1NJYA 5K8MA 5K5MA 2DIUA 2R7WA 4G1QA 4HHUA 1X7VA 2W1BA 5J1EA 1MN9A 3A8JA 4JI0J 4LMZA 2CIMA 1LWEA 1NDLA 2B8QA 1K0VA 4C97A 1HBOB 5HMXA 4F3MA 2B43A 3H59A 2B9WA 4B3TJ 4WE1B 4K4TA 3SYZA 2MTLA 3T5HA 4HTIA 2FGCA 3TZZA 2VQFF 4HVZA 2E5LF 2HNYA 2PGCA 5J1EB 2E7XA 3MPWA 3Q89A 3BN4A 3LF0A 2AX0A 3QSYB 3J7Z5 1C0UB 1LWEB 5KFIA 3PIPS 1GMWA 2HKEA 1AW0A 1Q8BA 2DR7A 1KQFB 3EVOA 4QR0A 3BH7B 4LJMA 2CRLA 1XNRF 2Q66A 1HHSA 3CCTA 2W9CA 4CT9A 3CULA 4YN3B 3VF0B 4NI2A 2DHXA 1OS5A 1HMVB 3HT0A 5J2QB 4MYUA 1Y3JA 3M2VB 3FC9A 3BZQA 4JI8F 4NE9C 1H72C 4CM2A 4TY9A 4CO4A 1F6TA 1ZZNA 2W9BB 1RAJA 4ER8A 3J7ZV 1VIXA 4I56A 3THTA 1XQIA 1G3OA 4E98A 2ZJRQ 4RW9B 1RT1A 5HMZA 2AYMA 3KLEA 3VGUA 1DQ9A 4TYBA 1T05B 4A48A 2ZH4A 5B0GA 2JSXA 1N5TA 1SV5A 3GIMA 2MLZA 2ZH6A 2MPUA 3M7VA 4W4MA 4IG0A 2NUUG 1D6KA 3BGUA 1Y3KA 2VPWB 1XMOJ 3MMBA 5DDQC 5GADU 3FBFA 3Q8YA 1BUXA 3CD7A 3HSJA 5A2QY 1WC1A 1HWJA 1FDBA 4G65A 3T3FA 3SQOP 4TXSA 2F9DA 1WELA 2QV6A 1Z85A 2V0NA 3CC4S 5JVGQ 1PBUA 3FDSA 2Q3PA 1C4CA 5F0WA 2IFXA 3BV8A 3W1YC 2FJAB 1QSYA 2WOMA 3HVTA 3QWUA 2YKQA 5AXKA 4DOZA 3AJ1A 3B78A 5FLXY 1OPIA 4PXEA 1U6FA 3KMSA 4YR3A 4CO1A 3CCJS 4WKRA 4AL6A 1T3NA 1UVNA 2CQ4A 3GFZA 4OZNA 2EXUA 4IRDA 3D3CJ 1CQMA 1KP6A 2V2ZA 3T9NA 3KLHA 3ZTSA 5B0FA 5JXSA 4JI7J 3MM6A 2G0CA 2ZNZA 1JJ4A 2CPEA 3D3BJ 4MKAA 5BYQA 2KT5A 1C1BA 2X3DA 1HNWJ 2MB0B 2ZC3A 1U1MA 1VOMA 2GJFA 3PM9A 2DGXA 1WOOA 2BKOA 2IJNA 5HSPA 3N6LA 3J81U 1D8YA 3GFHA 5D0GA 2HVDA 2R7QA 1UWBB 2OAUA 4F8RA 4K0KJ 1JLCB 3D1OA 4OZ5A 2YNHA 1XJWB 3ZZZA 3DLGA 1C1CA 5BR8J 2F7VA 3QRRA 2YH0A 4Y65A 2P6SA 5J2MA 4Q45A 4YB1P 1EJ7L 2XZDB 2H5IB 3G71S 5KFSA 1IKXB 2H4WB 2GCFA 4B9MA 2V8DA 2KFZA 3UDVA 1TELA 3HP6A 2GMHA 3EXCX 4ZJLA 5KG4A 4LF4F 3QO9A 4YHHF 4ITSA 3PW5A 2CKWA 5RUBA 2G2ZA 3EDRB 1N34J 3MOZA 4IR1A 3M6WA 4CIOA 5LL6d 1KHVA 1R31A 1CJKB 4K8RA 3CXCR 5DG8A 2GS8A 3LANA 5D15A 3H40A 2QEXS 4X64J 1YZ7A 3DI6A 2HQGA 3H90A 2JEIA 2XYHB 2MHEA 3E01A 1JK9B 3GCXP 5EDWA 5DM7S 2IAJA 1VISA 5C2GA 1PCAA 2V69A 2JLGA 4AQYF 4DR1F 4USVA 3MECA 5F3ZA 2CZ4A 1TL3A 3W64A 4PXBA 3LWLA 1NSPA 4C4WA 2VC0A 2VFSA 2RSQA 3N9UC 3C2PA 3PX4A 3TUJC 1B0TA 1UA1A 3I9V9 4OX7A 4DR4F 3RUBL 1PSDA 4F67A 4DN9A 2KM8B 2FVQA 1TL3B 5JMNA 4TU9A 1Z2LA 4WFBS 3CCZA 5ETTA 4W92B 3RRGA 1KQSR 2MQNA 2OUGA 3I4PA 4WFNS 2RILA 1HI1A 1QE1A 1RK8A 3TI0A 4FF2A 4HH1A 1VHKA 2NPFA 2KN4A 4LSNA 5IV3A 3SSSA 2N3OA 5GAHU 3MFHA 4FKYA 4DF8A 3K7RA 2CNOB 3VVTA 5K9FA 5HL7Q 4O3PA 4B9VA 5CA5A 3A3NB 4USKA 5MAOA 2FIUA 1HD1A 2GIRA 1ELOA 4LR7A 2QMWA 3THVA 3SEOA 1YQHA 4KHPJ 5T14A 1T11A 4O44A 4EWTA 1QVGR 4RUHA 2V50A 2YKAA 4UT4A 2JOQA 5DGBA 4M5KA 4E2FB 4PYDA 3N6NA 2UZAA 1X0FA 3GFYA 2CPDA 2YX1A 1NSQA 3DRRA 4H4KC 2UVVA 3M8ZA 3MM9A 3WX4A 4ES3A 2G2YA 1XR6A 5F8GA 2FY1A 1NU4A 2AJ1A 3RRKA 3ITHA 1SL0A 2E5IA 3EVMA 1U0HA 4HR2A 4LRDA 3DLKB 1PJ5A 1IBCB 1B7FA 4ED1A 2BBEA 2BEFA 3EZOA 2W9AA 5F41A 1T03B 1O51A 1WJ9A 3R9LA 3TAMA 4A46A 2XM3A 1VHIA 3EVWA 1ZA1B 3SV3A 4IOAQ 1U0SA 4B3OA 1CJUA 1K1QA 3MAAA 4GC6A 2Z2LA 4P73A 4OI1A 1UEVA 1OO0B 3EZ5A 2HVZA 3G82A 1WEYA 4FF1A 2W2NP 4DEZA 4Q44A 4H4MA 3FEZA 2QTWA 1N5YB 2P5VA 4RW8A 3MAAB 4KT0C 1FJ7A 4DL6A 2CJYB 5KFEA 2OPQA 2VPYB 2DD8S 4M5GA 4PG6A 4DQRA 1PYSB 4WK1A 1EP4B 5I3UB 4IG3A 5JUMA 1KEKA 2FHMA 4O4RA 5A76A 4EK2A 3L3CA 2QSFA 2WW4A 2HGLA 1JLAA 3BGFA 4F50A 4IR9A 3RB3A 5AJ3J 2AIRB 3ZTPA 4B9TA 1S4FA 3KWMA 1S1WA 3FGVA 3TWZA 4RNHA 3TARA 1S0NA 1RACB 4DUZF 3HM9A 2UV8A 1GTEA 2FC9A 2VU5A 2Q79A 3BR9A 2YKPA 1IR2A 4J90A 3QZ7A 3L09A 2HLUA 3H5YA 2V9WA 3CDUA 3KK2B 4WCES 1Q86T 5T7LA 1R43A 2DH7A 3PW4A 4Q43A 3BGRA 4MIBA 3RB6A 3X3UA 4HEA9 4KR0B 1HL6A 2HG4A 2GAGC 3IRXA 2JFDA 3GR0A 2MKCA 2LDYA 1V6HA 3BM7A 2ZM6F 2VG6A 2VZ9A 5DM7Q 4HDHA 1LWCA 2E1RA 4UY85 5CH7B 3M9OB 3GFXA 5J1NA 5A8RB 5KFXA 3BKFA 1LV5A 3DLLS 1YDLA 2UUAJ 2J0WA 2ZBRA 1VQ9S 3M6VA 4Q5VA 5C42A 2DBBA 2KL8A 5A2QU 2QGFB 1Q4RA 4I6AA 1AUSL 4YR2A 2B51A 3RTVA 1IJFB 3CF5S 4JXXA 2G2OA 2ZWPA 1N6QB 4LFAJ 3GCWP 4NXNJ 1UJ6A 4CLUA 4TNOA 2V34A 2QN6B 2XZWA 5G0RA 2AT1B 4TVAB 5FLXU 1N8RT 1QTQA 4LRBA 4KHRA 2LP4A 2MQPA 2ZJQQ 4QU6A 4TYAA 4UY88 1VRUB 3ZZUA 4LFBJ 4J5OA 1SKSA 3EUNA 2HRYA 3CJ3A 1YJ9S 3X1LB 1A9NB 3CMAS 4DV2J 2HQCA 1I6JA 3PVXA 2ALZA 2OHDA 4H3SA 1IKYB 1RHQB 2CQHA 2GO9A 4DV4J 1LKZA 5AXLA 4A8OA 1AZSA 3MPVA 3OSPA 5KOWA 3G4SS 3DGVA 4MJKA 3DRXA 3EYZA 4YY3F 2EG2A 1ZA2B 1RAHB 3QT8A 2AJFE 2VFTA 2XLKA 1NH8A 2UU9J 4DSLA 3R2DJ 1WHXA 2BJ7A 3S7RA 2XB2D 2EVZA 4ZK7M 1J27A 3CCSS 2AGPA 1QVFR 2KJVA 1JJ2R 3R7BB 3J81j 2CQGA 5C25A 3DYAB 1U45A 1R0AB 1SC1B 1JLFB 5J1PA 3OUYB 2V6AA 3JYTA 5DG7A 2M8HA 1RTDB 4HACA 5GMKa 1JNRB 2GC8A 2C2EA 4OJ1A 3QQCD 2IRYA 2X7IA 2VG7B 2FTRA 3HJVA 4UQGA 2C28A 4DQPA 1AT1B 2AZ3A 4ZPAA 2E9RX 5E41A 1WOPA 4P2BA 2RUGA 3G2XA 5F3TA 2J6UA 1WKKA 1R27B 3PFOA 3UO0A 1VQ6S 1SH3A 3CCLS 1VK3A 3IN5A 4DX7A 4CH1A 2WONA 1TR0A 3HSDA 4A8WA 2C2OB 4MFBB 1WF2A 2XHWA 3FEYB 1HLWA 3OR2B 2LXIA 5D4NA 3FK4A 2I2YA 3QMQA 2LVWA 4KGZB 1F3VA 2AW0A 4OX8A 2BXJA 1VRQC 2MHNA 3PCOB 3W66A 4BWMA 3JSYA 1U2FA 2GJ2A 3FSIA 1A7GE 1KBRA 4WFAS 1P9QC 4RLEA 1GXUA 4A8QA 4K4WA 2LQBA 3MR2A 4UOCA 2ASLA 1YRXA 2DEJA 3A8IA 4EBEA 1RDRA 4ZPWR 5DQGA 1G2EA 2FY8A 2VB6A 3LGHA 1HBUA 1WC6A 2A3JA 4UTGA 2ZVSA 2DXEA 1ZYQA 3MUMP 4RR5A 5EN1A 4DL3A 4AT1B 1RSCA 1U2CA 3ENVA 1RT6B 1JLEB 4ES1A 4USTA 1LK5A 2GVDA 4R0JA 5DQIA 1JQGA 3GJQB 2BOPA 1U1NA 3KG4A 3NL0A 3M8WA 2ZZMA 2J9DA 1RTHB 4LF5J 2H9ZA 4ELUA 4OJGA 1HNIA 4U95A 1KSPA 3BO3A 2MY8A 3MXHP 3NEKA 2MQMA 2XWXA 5HROB 3C8YA 3OD2A 1Y4ZB 2HS4A 2RE1A 2VHGA 2ADBA 2ZH7A 2XCAA 4QWDA 3E2EA 3DOMA 5BYRA 1JKHA 3PFEA 4K59A 5IT4A 3VGVA 2B4VA 1S1VA 5L1IA 3HVAA 3MM7A 1U8WA 4RW6B 1F5CA 3RBXA 5KFWA 3KFWX 4F36A 4OI4A 3LP2B 2DYAA 4CYUB 3K57A 3J7ZT 3M30A 2XCPA 3DRYA 4FBUA 2FJBB 3D28A 1RAFB 1T95A 2R8JA 1T0TV 2CZVC 4EFAC 1C2PA 1N5QA 2YNFB 1HWIA 1ZOTA 2EC0A 2JLEA 1B99A 1D09B 3O8WA 3TA0A 4OZ1A 1GXLA 5DGAA 2LU2A 3J7YU 4LF2A 3IA0A 1HNWF 3CEDA 2NUHA 4I1TA 2G4BA 1WD6A 1IKVA 3M8PA 4JI5J 1LW2A 3KDOA 2V9KA 5FDLB 4WJBA 3UQSA 2BYCA 3QRQA 5U47A 3PW2A 3KHHA 2DHSA 5AXMA 1F5BA 3U1NA 3GIKA 3ZC4A 4DV5J 4WU2A 1HYSA 1FI4A 4NZ0A 5L39A 3EMTA 2V4JB 2ZH2A 2BM1A 2PJJA 1RTIB 2RRAA 5KT5A 4DUYF 3OLAA 2VUGA 4NPOA 2OI2A 4USMA 1L3VA 4QW8A 2QLJB 2LA6A 4B3MJ 2OPSB 4GO7X 2BW2A 1BQNA 5KFKA 5J2PB 1KQKA 1YJ7A 1FX4A 1FDNA 2F1FA 4ED2A 2HK3A 4F0HA 4DJBA 1SIWB 4O3QA 1VR6A 3K5MA 2E5GA 4ETZA 5H9FK 5LSRA 4IOCS 2WVEA 1BHNA 1DTTA 1BE4A 4BHQA 1D8ZA 4ZLPA 3OSNA 4CDIA 3SSRA 3HSGA 4ZHRB 3KK1B 3O5TB 2FLLA 1LEOA 2BV3A 1Q8IA 4PWDB 1PAEX 2DGSA 3BN7A 2UUTA 4E0DA 3MWBA 1S97A 3MFIA 1RP5A 2R8GA 3M2UB 3LPEA 4EU0A 3CCES 4ANDA 4IQXA 5HK4A 2BQUA 1XNQJ 2FYXA 2GMLA 5F8NA 2KB2A 2H48B 5A6PA 5M2RA 3QIPA 1QSSA 3VWSA 2KU7A 1ZAVA 1G4CA 1VQSA 2WAQD 4ZN1A 4UQTA 1FRJA 2BM0A 2HQDA 4JI6F 2ZNYA 3TA1A 3K8VA 3GG1A 3VAIA 1CULB 2N82B 1S7HA 2G9OA 1FNXH 3GU0A 1DLOA 3L7PA 4DCOB 1WDDA 1DQ8A 1N4LA 1PYOB 1RJJA 3SIPB 3PIOS 1PG5B 2PT0A 1CEZA 1SCJB 1IKWA 2DNNA 1OWXA 3AQPA 4XTTA 2YWKA 4RL1A 3DOLA 4X4UA 4DN0A 1B75A 3R5DA 1DLOB 4WFAQ 1J5OA 2VICA 5IFMA 5A0YB 2BJ3A 4C98A 3CCRS 4ANEA 2FJWA 3KHRA 3MPDA 3N4WA 3V81A 3PHEA 4CO2A 1REGX 3VAGA 3NAHA 1V3SA 4EYHB 2PN6A 3TQEA 1SJQA 3T5JA 1NAQA 4EEYA 3CNQP 4ECYA 2GQ2A 2JDJA 4Y34A 5HATA 1ACMB 2CQCA 2E29A 3D4JA 3TZXA 7FDRA 1TP7A 1Z2ZA 1MROA 4DPYA 8ATCB 4UW2A 3EGVA 3KUEA 2HAFA 2LEPA 1TAQA 1FJCA 3VAFA 5K14B 2BQ3A 4OZ2A 2K7JA 1I94J 1UEKA 3UVJA 1D1UA 4LF9J 3NGTA 3ELHA 4KO0A 2M9KA 2RQCA 3MM5A 4XK8C 4O4GA 4HH0A 1LXNA 3D66A 4I6WA 3DXBA 3W2VA 1X4AA 3GIIA 3KDNA 2HHSA 1CJVA 3CO0P 1T9VA 3CCMS 2OD6A 2MZSA 1TMMA 3THPA 3NLCA 2Y1JA 3QT6A 1S0OA 4JI4F 3VAMA 2FVSA 3HHEA 4RBUA 3CJKB 1RHMB 2YNGB 4ECUA 4DR6J 2FZCB 3ILJA 3ZNUA 3M8QB 3ENWA 2CDQA 2KJWA 3M2RB 2KT3A 2AYEA 3LOUA 4DR2J 4QZVB 4RW7B 4OI6A 4MK7A 1KTQA 2B4PA 5CYQB 3RU0A 4AYBD 5KFDA 4DF4A 1U8SA 5LXYA 3SBMA 2ZFHA 3IAS9 1S1XB 2K8GA 3ZZRA 2V4QA 1T3OA 2G1DA 1FO1A 1HNVA 4KH1B 2DH8A 3AY0A 1VFJA 1LFWA 3VGSA 2Z56B 3PR5B 2K1RA 1UPMB 2YKNB 2FHJA 2ASJA 3P45B 2C3MA 3L4BC 2XBPA 1VMBA 1TKXA 3GIRA 2D74B 2WCXA 3BH6B 1PO6A 4LT6A 4N7TA 5LMUF 4EMDA 3LUYA 1CC8A 1RT2A 1YRTA 2HHUA 2ZH8A 4IOCQ 3W8PA 1N52B 5IQ6A 2JVOA 2W2MP 2W2QP 4NASA 2B6AA 3V4MA 1WWHA 4RWXA 2HHHJ 2YWGA 3CD6S 1UFKA 2DK2A 5DO2A 1JLQA 5L38A 3FMBA 2B7CB 3Q83A 3H7HB 5LSOA 3NGUA 3H5SA 4HKQA 2L9WA 2V2VA 3BBFA 3ZTRA 2DGQA 4DCJB 3OXLA 1SJ3P 1UTAA 4NZ6A 2CXEA 3HLUA 1P1LA 1Y9OA 2WB4A 1QAYA 4JI1F 1QRTA 3M8SA 3PO5A 2EGVA 2HQIA 1F9FA 3B54A 2AQ4A 3EZUA 2B9XA 4JYAJ 3GTYX 4WF9S 2CJAA 4MAKA 3TUIC 2ZHAA 4YEAA 3H2VE 1ZAWA 2J8AA 3AJDA 4OJHA 2VG5B 2XHCA 1IBLF 4UOHA 2HS3A 5GMEA 2QSWA 1M5SA 1YJRA 4Q0BB 3N79A 3M8YA 3G8SA 5KFBA 3PIOQ 3DLHA 2J7KA 1P27B 3R6GB 3NXZA 4NRUA 3D0HE 1X4DA 2BX6A 1UKUA 1UJ4A 4WWSA 1YKWA 1C0TA 4ZVRB 3BYPA 1VQ7S 5HJYA 5JVHS 4LFAF 1H38A 4NXNF 3TX0A 2AMCB 4D3GA 3BQ0A 4NCGB 4NA2A 4P7VA 4Z7YA 5KOXA 5HI7A 5DLGA 2LLZA 3QJLA 3D2WA 2VPXB 3R6LB 1P6TA 2PE8A 3GG0A 1OYDA 4QYZJ 4RW4A 3P49B 1SH2A 3K2YA 3WQPA 2VQFJ 1RKJA 1X8DA 2JEGA 3M6XA 4QIEA 2XO7A 4L6V3 3C16B 5DDPC 5EWEA 4G1PA 3NCRA 1CPZA 2Y1RI 2MQOA 3KKFA 1YZ6A 5F9LA 4R8UB 2MQLA 2BACA 3ZXWA 5F0UA 3QZ8A 2UU9F 2K3KA 3WIVA 1UVIA 3MR6A 3Q2TC 3I82A 4OV6A 5L9NA 2A6OA 2E44A 2ZE2B 4ZPTR 1XMQF 4PQUB 2NREA 3IMQJ 2W7OA 4U7UK 4JI8J 2KG1A 4R25A 2HBRB 3AB4B 4DSJA 2Z57B 4DU7A 1TK8A 1SC4B 2PIIA 4UY8T 4DSFA 1R6VA 4CLZA 6AT1B 1EETA 5KT3A 4ZOSA 2HURA 4USUA 1P8GA 4DL7A 2V8PA 2AGOA 4OX6A 2HNDB 1ZM2A 2FB0A 1U48A 1WUUA 3CIMA 1KLNA 4TY8B 2VFUA 2QA4G 1NDKA 5HN0A 3LPYA 2MLYA 1H98A 3KJVA 1SJ4P 2AU0A 3DCAA 2N4CA 4ED5A 1YG0A 3F0NA 5IT9Y 4O3NA 4L3KA 2QE5A 4LSLB 4CLKA 4ED4A 1S6UA 2EW9A 4G3IA 1HFEL 1NK7A 3PV8A 1HQEA 2HFUA 1I51B 5HVHA 1XERA 2H54B 4R5PB 1VBYA 3T9ZA 2UXBF 1TKZA 5GAEI 4O0IA 2J5AA 5CYJA 1KR4A 1FVSA 5EHHA 3WHIA 1S4EA 3AA9A 5IXUA 4S0MA 3N5FA 2RF2A 1APSA 4KV8A 4PWWA 2M52A 3I4HX 4E8BA 3DLEB 4DV0F 2ZZTA 2F40A 5GVQA 4CH7A 2YKMA 4C8NA 3SZ2A 3ENQA 1X5TA 4FYXB 3G6XA 2RAQA 2HNZB 1XWLA 3HO1A 2VA2A 1H2UX 2YKOA 1JLBA 2CZ9A 2LDIA 4C7QA 2LQ8A 1RU1A 4GO5X 3PJWA 5LT5A 2XS5A 2CYYA 4NZ7A 4HHHA 2IM0A 4IFYA 1FK9A 3UCZP 3H25A 3TAQA 2BJ9A 2BRLA 4O3OA 3GJSB 3UN2A 1NLKL 1GXTA 4ID8A 2C2RA 2IRXA 1B0VA 5E2QA 2Z58B 2YQ3A 2M0GB 1S1UA 4RBTA 2CVEA 2FLPA 1GTHA 4KPYA 4FS1A 3CDEA 1LW0A 1VC6A 1UMJA 4DL0C 2IVYA 2DT9A 2FHKA 4ANCA 5L9XA 2CA9A 2HHWA 3NS6A 4FXVA 3SCJE 4ECZA 3DLJA 4IH6A 2PI4A 4LF4J 4YHHJ 4DR7F 2F63A 2NXNA 2NZCA 2BANB 3C14B 4W90B 3I0RA 3JQMA 3U7JA 4CP5A 4FXWA 2HBQB 4ZVHA 3KYLA 4N77A 1HPZA 2MZQA 3SDEA 2EKNA 3DRPB 4KIAA 1Z4UA 2IVMA 3GJTB 2CADA 4RO0A 4I4BA 4X66J 3A4TA 1PBAA 4J91A 2IC3B 4BC9A 2OO4A 3CCVS 3V5RA 3NNCA 4KGVB 1E6YB 3VVUA 2R7UA 3MMCB 4GVBA 1T9WA 2DHGA 2XC9A 3VAHA 1KFDA 2FDNA 1URNA 2D7SA 4K50A 2POKA 4AQYJ 3T1HF 1FCAA 4DR1J 2DXFA 2IA0A 1YHQS 4C2MA 2W8KA 4ZP9A 2M4MA 2NXEA 2C3UA 4YS2A 2VJVA 4Z7CA 2GZOA 4XPEA 1RCOB 1FF2A 1WC3A 4Y0FA 3DRSB 1Q53A 4ICLA 4B9NA 4DR4J 4B9SA 4DL2A 3D7SB 3MEGA 2XGQA 1S6QB 3I32A 2M70A 4NOHA 4ZS6A 4A8SA 1MMDA 3LGNA 2AJ2A 4KFBB 4NL5A 4BDPA 3R8YA 4O3RA 4C3KA 2QC3A 1FKOA 4BWJA 1WC5A 3LP0B 2RU3A 2AEFA 2JRSA 3DMJB 3KUGA 4URQU 2DH9A 1RT3B 2PI5A 1XBWA 2DY9A 2J9EA 3TA2A 1YBAA 4A8XA 1GEHA 1HD0A 1SIZA 5KT6A 2DGOA 2E66A 5KFVA 1NXZA 3F44A 4YB5A 2QL7B 3OW2R 1ZM4A 3JTOA 2V67A 3QIDA 3PY8A 2EI5A 5F9NA 1VC5A 2HHQA 1AYEA 4A47A 1U1QA 4QIGA 4AL5A 5FJ4A 4FVMA 4L76A 4N8OA 2DIVA 4L72B 5C24A 1NJWA 5DDOC 5GAGW 4DFJA 2LQ5A 2FJDB 2QMUB 5LOQA 4FF4A 4OQJA 3RBEA 1WF0A 1TV6B 1X9MA 2I1RA 3VHQA 2KHCA 4ILRA 3IS9A 4URSA 3NG8A 3TO8A 4L74A 3TQ1A 2F4VF 4ZVPB 4Y2MA 4DPUA 1XR5A 4JV0A 4X62J 2GFFA 4NLDA 3V6KA 1SL2A 1H0HB 1WC0A 3A8EA 4MMOA 4X4OA 1NRKA 2XZTB 1U09A 3WX8A 2RU9A 3I0SA 5THWA 5AXNA 5HJXA 4USJC 2XO6A 3MD3A 3LAMA 2LCWA 5D3GA 3HMJG 1UVJA 2CNLB 1VQOS 2B9EA 4OZ0A 3POTA 2G1HA 1HBNB 1QTNB 5A6WA 2J0SD 1SUQB 2I5JA 3HD1A 4QYRA 4UZCA 2WBMA 3NRBA 1I94F 2K7KA 2ZWOA 4ZVTB 2E1AA 1BQXA 1BLUA 1V3ZA 3VQTA 4I2PA 4JI3F 1NJXA 2FD2A 1ZETA 3IRWP 2CPYA 2VA3A 1U49A 1TUGB 2W25A 5B09A 4GKJF 2YQ0A 1NJIT 3TVKA 1I5OB 1Q81T 4IFVB 1X4EA 1MG7A 4LUBA 4K4UA 3QJJA 4Y28C 4C0HA 3HFZB 2OJ3A 2RKIA 2G6GA 2KTQA 3W2WB 3D6HB 5CD4H 3VZIA 3U1LA 1YJTA 1S1TA 1RABB 3R1LA 1N32F 5E33A 4WXOA 1F9HA 2RD2A 3W3SA 3T1AA 3NS5A 1NDCA 1WHWA 3W5ZA 2MLXA 4DUZJ 2ZJRS 1V6ZA 1U1LA 1NCLA 1RT4A 1S6PA 2Z0YA 1E6VB 2NLWA 1I3OB 1DJ0A 3GILA 2G5DA 3AHPA 5D8HB 1VRTB 4HT5A 4XDDA 3JB9k 2PEBA 4WYWA 2RD5C 2D9PA 1H6KX 3G6YA 1FERA 2V94A 2UXDF 2E1CA 1PYTA 3GJRB 1QY7A 5EX0A 4JI2F 2GIQA 4KB7A 3KLFA 4ECWA 4F4ZA 3RR7A 2NS1B 3BBBA 5KFFA 2EKYA 5JJBA 4RKUC 2Y8WA 1G1XA 2DJWA 5JVGS 3KJQB 5IOLA 8RUCA 4CLPA 3H2UB 2ZM6J 1EXDA 3NGDA 1IWGA 3DGPA 2WZ1A 1QLNA 2MKIA 4KHMA 4A8YA 4C8YA 3J80Y 2NR0A 5IM0B 4KAIA 1FEHA 3CUNA 4FPRA 5LXRA 4I2QB 5L1LA 4ZITA 3HFVA 1T9UA 4ED0A 3FSXA 2EEYA 1YSJA 2VQEF 2C3PA 1TKDA 1XIQA 1LWFB 2SXLA 3D68A 2BRKA 1Q95G 5HQLA 2WVCA 1RWVB 5E3QA 4ED3A 4F7VA 1NK6A 1S5ZA 3BPDA 5IT9U 1Q0NA 3MM8A 4ECXA 3WDOA 4X4SA 3QLHA 2JWNA 4WBFA 4GC7A 3OFFA 4KJIA 1S9FA 5DZ6A 1FWLA 1S9GA 1G6BA 2QLBB 1W7WA 2C2ZB 2EBEA 3KLVA 1T8EA 3ET6B 3MEDB 5FIIA 3M1VA 4OI0A 4M5JA 3CJTA 2L9NA 1JX4A 2QFJA 2L3MA 5F8MA 3A3OB 3IR7B 3QGIA 1MU2B 4DQQA 1MLAA 4KH0B 4NLVA 1VBXA 2C42A 1B4SA 5AT1B 2J8SA 3DHXA 5KG7A 4DHVA 2XMKA 3ZZPA 2VFRA 1JXLA 2EFOA 3TJAA 2DO4A 3GQCA 3PEJA 2HPUA 2NZ4A 2OKQA 2VIHA 2JC1A 3MURP 3H42A 4F3OA 4FYVB 4YY3J 5KT2A 1FTCA 3IG1A 2Y0SD 4ZIVA 2VKRA 5T41A 2AX1A 2YH1A 1MMLA 2E1PA 4FXDA 1SPBP 1FKPA 4CNZA 2MMYA 3K17A 1S76D 4F4YA 3A12A 2OELA 2DHHA 2GV1A 1J5EF 1RADB 3K5OA 2YWEA 5M2PA 4NCAA 1AFJA 4PUOB 2UUCJ 4YB6A 2Z30B 1FXLA 3A3PB 4J9OA 3JSMB 3JTNA 4JV2A 1HHQA 1NHKL 4LREA 3M6UA 1RXOB 3SV4A 4DWIA 3K89A 2VONA 3PX6A 5IZNA 2UV8G 1IBKF 4G1QB 2DTJA 3GYNA 1DFDA 3IO1A 3QAUA 5KFAA 3R5BA 1RKIA 2XYGB 2ZKUA 4MTPA 4MT1A 3KJFB 5KFUA 1X0PA 3NWRA 1MSWD 1KVJA 1S6OA 4Z2XA 4ED7A 2GGPA 1JNZB 4V194 2HNYB 2M8DB 1GMWD 2A10A 1OIAA 3OVBA 4NYPA 2UXCF 2MY7A 1QSLA 4NLSA 2YNIA 5CD4A 2R42A 3PRDA 5KG1A 5GAEW 4J9VA 3K8WA 2FVCA 3DLBA 2W9CB 3PHTA 1HQUA 4CLSA 5ETNA 4NI2B 4LF6F 2M5YA 3IXQA 4OJ3A 4V19X 5HL7S 1Q5YA 4DS5A 2NXJA 1WG4A 4TKTA 2MQQA 1YI2S 1EUYA 2KH9A 3M8RA 4B17A 4RX6A 1OY6A 3IAM9 1BWVA 2HWHA 1YBTA 4ZPDA 2HFZA 3V6DA 4RNOA 3OPKA 3ADAC 4QR2A 2YTCA 3EJMA 4CTAA 3VQSA 2Y1IA 2CQIA 1RYRA 1FX2A 2WVBA 2C2DA 1HR0F 2JH3A 1VJWA 1RT1B 2BUNA 4FS2A 3KLEB 2QT7A 4RU2A 3RGIA 4BCAA 4J9LA 1S0VA 1SV5B 3MZIA 2GNKA 2DRAA 1U1KA 4CLYA 4IG0B 3FRZA 1TTHB 2V8HA 1U4BA 3MMBB 2ERRA 2LKZA 3ILIA 4FYWB 2QA2A 2R8HA 3KNAA 3BF4A 3AAWB 4HLBA 1RHUB 4NLYA 2DNGA 1HNXF 1RU2A 2DCLA 2I6WA 1O0CA 3S6EA 1EAYC 4LF7F 4J9QA 4IOAS 3LGMA 3R7NB 3AXKA 3EDQB 2Q1LA 1U24A 1VBZA 9RUBA 1DTQA 5A8KA 4OYZA 1HBMA 4MKBA 2N3LA 4DG1A 4ZCKA 2WOMB 3HVTB 3ONQA 4FYDA 3DM2A 1RBLA 1OSDA 5IWAF 1NK0A 5GAHI 2MDAA 3GPAA 1H2TZ 1HWKA 2PICA 1RHKB 2V5HG 2AP6A 4UF4A 5SUHA 5I42A 2ZVIA 4MKYA 2H5JB 4A8FA 2OD4A 5D78A 3KLHB 2XNQA 4AL7A 3FQLA 2FVPA 2ZDPA 4ZVQB 1KC8T 2C2NA 3MM6B 4DPTA 4DU8A 3G6ES 1TK0A 4UUWA 1I1GA 2XMUA 2J9DE 4FPIA 3VAJA 1JJCB 1NKCA 3MPYA 5HLFA 1C1BB 1YX2A 1RB0A 1FJGF 4IUFA 1QDUB 1OYEA 2R2SA 4EBCA 4DUYJ 3R5GA 1GNKA 5LSLA 2W4DA 3KHGA 2EWHA 3DDNA 2B0GA 3QFHA 1KD1T 2HK2A 4M5LA 2YNHB 2VH7A 1PIEA 1JLGA 4D3HA 3DLGB 2EPIA 5ETSA 1C1CB 3QT5A 3MHYA 3MAHA 3VAKA 2KYXA 4J7CA 5J2MB 1IXKA 4Y2CA 2GW8A 4U9RA 2RIJA 3NY0A 3HHNB 3D0IE 3IBCB 4WPAA 2DGVA 5HP1A 4OYOA 2CJKA 1HA1A 1NBEB 4X66F 1RISA 1M5PC 5KFLA 4M5HA 1UZHA 1WSRA 1JLGB 1D9AA 1QRUA 2IJFA 3B4DA 2IYIA 3QO9B 4L69A 1R8CA 3LWMA 3DHWC 1UJ5A 1B0PA 3BREA 4GRSA 2RB7A 1SKRA 4HL9A 4U7UD 1H74A 3G87A 3RYLA 3KHLA 3QWPA 4F3QA 4ZP8A 4RNMA 4WIQA 4DZ6A 3QBCA 2RDDA 1ICEB 2PA3A 2C1EB 4JI6J 4CWBA 5KFCA 3DI6B 4Y3CA 3NGSA 3HKZD 4N47A 3E01B 2LEAA 3N0VA 4CZCA 4DQIA 2IAJB 2BJ8A 4NLXA 4CO0A 3HXMA 3MECB 1QAXA 3H4DA 3O6QA 2XSJA 5HBMA 3PX0A 1RE1B 3FVYA 4DR3F 1V9OA 3P6YC 1CS4A 1QD1A 4C8ZA 2OMOA 4YFUA 1VBKA 2GVZA 3J80U 2BABA 4M63A 1NKBA 3GYXB 4C6AA 3UR3C 7FD1A 4DV3F 2ZJQS 3SQGA 1ZPVA 2ASYA 2AJ0A 1S9EA 1KQGB 1TU0B 3R3TA 1QE1B 3Q8SB 4DS4A 1M1GA 3ILOA 1FRHA 1N54B 5E3CA 4LSNB 2WW8A 4OYBA 3DC2A 1K44A 1R0CB 1TL4A 2FJVA 3BKTA 4OYAA 1VQLS 3H5XA 4LR9A 1NMEB 4IO9Q 1U2RA 3TUPA 2HMIA 1S59A 2D1CA 1TL1A 3VCDA 1KN6A 3CJ0A 1KONA 4XIUA 2B3TB 4OZ3A 1QJHA 1YVFA 2RRNA 2OPPA 4O44B 2AE0X 2IM1A 1SJFA 2HVEA 1P1TA 3HKWA 1GT8A 2ABYA 4WP9A 5D0RA 3ZFVA 2KG0A 3MEEA 2B56A 3DRRB 4I7FA 3MM9B 1FRXA 4X62F 3GE9A 5C5JA 4AD6A 4B3RF 3PYFA 1FDDA 3RJMB 2DNOA 4R0EA 4M5DA 3ITHB 5CCLA 5ETVA 2RQ4A 2NSCA 1K9MT 1U0HB 3GZ7A 1NKEA 1MMNA 1EUQA 3CDWA 3Q23A 4JUZA 3MMAA 2C3OA 1PGZA 4JI4J 1FFWB 1Y5LB 2GQQA 4OYXA 1S79A 2LECA 1IJEB 2DNRA 3UCGA 1LQ9A 3TAMB 4F2SA 1GAOA 1YJNS 5L1KA 1Q82T 2JFKA 4EBDA 1ZTWA 4IDKA 4P74A 1L3TA 3Q22A 4B9LA 5KG5A 3LW5C 4NYOA 4B3OB 2PFFB 2LQJA 1CJUB 5L1JA 2CQ2A 1TUVA 2RJZA 3S1TA 4F26A 4PPDA 2BE2A 2B7BB 3FFIA 1RT7A 1U26A 2O5DA 2MZTA 2XS7A 5BXIA 2OPRA 1KOOA 5A8WA 3G82B 1EHWA 2CPHA 1GTRA 3R1HA 2DPIA 2LMIA 3TVZA 2NPIA 4H4MB 3PRVA 3AD8C 5DM6S 4RW8B 3K58A 4BBYA 2B8PA 2C2MB 2W8LA 2J6TA 4PG5A 2OPQB 2F4FA 3SI8A 1EKSA 3UN5A 2XYPB 2CX8A 2XLJA 3M9NB 2IBKA 2MJUA 1NH7A 4OYMA 5KAKA 1BMQB 5A8WB 2DRBA 2IRUA 1FRLA 2APOA 2EFGA 4IG3B 3W5XA 4RWWA 1O0PA 5LMUJ 1Q5VA 1NB7A 1NK4A 3HHLA 2COLA 1PJ6A 4PQAA 2MGZA 3C15A 3Q86A 5E0OA 2PEHA 1JLAB 4IO1A 2QA1A 5MLCV 1UZDA 4IQMA 1S1WB 3OL9A 2KHDA 4B3SF 4NLOA 4UUXA 2MZ1A 2FLNA 1O0BA 4H4OA 3I6PA 5DRKA 4P75A 3AH6A 4B9UA 4ID5A 2MGZB 5GADW 3BO4A 4L3NA 4JI1J 3CZBA 1R6YA 4KGXB 4XDCA 5T7LB 3IWNC 5KFNA 3BGRB 2QLFB 4RUBA 1A0OB 4I67A 3PACA 4QIVA 2PMHA 3IRXB 4CT8A 3CSKA 1IBLJ 1FFGB 1YLXA 2DHAA 3K0JA 2PC6A 1M90T 2KVIA 1WG5A 3I5AA 4X65F 4OYWA 1Q1KA 2VG6B 3T41A 1S12A 2GQCA 1LWCB 5H9EK 2HGMA 3C6TA 3R5JB 4CI0B 1ROFA 3MAQA 2A18A 3TX8A 3G8QA 3GSDA 3HZGA 4G6VB 1RAIB 3SMZA 1VHYA 4BC7A 2R7XA 3N5BA 5C42B 3WC0A 4DMZA 2V8GA 2BW7A 2YVSA 5ETPA 4DX8H 4Q2LA 1Q8KA 1SQFA 3NMAA 1WEXA 2R7OA 3M32A 1FWKA 2HSEB 4DCPB 4PYAA 4NLWA 2IHR1 1PKUA 4FKXA 2D3ZA 3NGRA 2V2KA 3EGWB 1LFPA 5D0HA 4IKAA 3UD4P 1TVRA 2BJ1A 4KKOA 2B5JA 2W2PP 2QX0A 4LRAA 3U1MA 4CO3A 1T02A 5G0RB 3OXGA 2HWIA 3IWLA 3FMWA 4OYPA 2KZZA 3ZNJ1 3BYRA 3MD1A 3CIZA 2DNZA 2LQ9A 1VLYA 1S77D 1BQMA 3BDEA 1D9DA 2ROPA 1D0EA 4Y2KA 5I4MA 1JB0C 3QGGA 3UCUP 1TL7A 1ITPA 3UI3A 1H7XA 1FXDA 1AZSB 1XMQJ 1FNMA 3I5BA 1RUSA 1CVJA 2XSFA 1VQ5S 2UUCF 5B08A 4F4XA 4DL4A 4F04B 1BQMB 4OHZA 3ENAA 2YWWA 2GJIA 2NXUA 3CT9A 1FXRA 7AT1B 1B64A 4J3CA 1NK5A 3UDEA 3MF5A 4C0OC 4U6PA 2HRTA 1FD8A 2D3O1 5C25B 4XAKA 4I64A 5KFQA 2DNHA 2J0XA 2CPZA 3JYTB 3KLGA 3PTWA 4NXMF 2EFPA 4HACB 2QRRA 4LF8F 1Z1ZA 2OEMA 4DFKA 5B0DA 5IS2A 1WHVA 1HWLA 2G0JA 4LQ9A 1A6LA 4ZVOB 2AKWB 2KDOA 2XY7A 3NBPA 2AJQA 1RTJA 3SXLA 1MNEA 1CJTA 2H3EB 1RT5A 2W7AA 4JB8B 4Q8FA 1CSJA 1L5UA 2G13A 4H54A 2HS0A 3PXGa 4MIWA 3A8KA 2VF3A 1DAXA 3IBFB 4KYZA 4ZJOA 2WONB 2HHXA 1RWXB 1SJ1A 5KFRA 1HBOA 1KRPA 5DM6Q 4LIWA 1KOHA 4WE1A 3Q8VA 1KNZA 3HPOA 2UXBJ 2DKOB 3BS9A 4P9SA 4IOBA 4OX9F 3L7UA 1EKRA 2XY5A 3PRBA 3KXDA 4J9RA 5CQGA 3QT7A 1XN9A 2OSRA 5GAHW 1QUVA 2MKSA 1C0UA 2E9TA 2PO4A 2ADCA 3QYYA 3L9ZA 4C8KA 4ZLNA 1HWUA 4ZJQA 4DV0J 2H51B 2IPOB 3CD0A 2ZEJA 2A2DA 5E3PA 2P9CA 3QGHA 2KRRA 1HBUB 1FD2A 1HMVA 2R9LA 4Q7AA 5J2QA 1HNZF 3M2VA 4HHJA 1U25A 2Z2YB 1F0XA 3MTJA 1NHUA 4DSIA 1T7PA 1SXLA 5C2CA 2OTLS 3D5MA 2GVDB 3TOQA 2W9BA 1VS3A 3W61A 3HFKA 1R7IA 1NUEA 2XTJP 3OL8A 5F8HA 1HNIB 1FRIA 5IQQA 1VHFA 4OHVA 3AQOA 1T9TA 2J76E 3HD2A 4HT7A 3OTOF 4RW9A 1MWQA 3RAXA 2KKHA 1T05A 1R8PA 4C48A 4U67Q 3JSBA 3DOMB 1KVKA 1JKHB 2ACMA 5ETMA 4V1Ak 2W2OP 1S1VB 1FNOA 4B02A 3MM7B 4X84A 3RR8A 4DR7J 2EFQA 2WRMA 2MJNA 4ILLA 1RCXB 3HI9A 1ZS6A 1KS2A 3KMQA 2XMMA 1Y0HA 5IT0A 3IM9A 3E51A 3M30B 4DFPA 1QRSA 4N56A 1B7YB 5AE2A 2H65B 2XGPA 2CG4A 3WC2A 2AYBA 4QJVA 1B70B 2YY3A 1NSKL 3EM1A 3H4BA 2D41A 3H8YA 2YWFA 1IM4A 1RTZA 3CJ2A 2L08A 2OEKA 1IKVB 2QLXA 3T1HJ 2HFSA 4M5IA 3M8PB 1LW2B 5DJBA 1RA6A 3HX9A 4A4JA 1S7IA 4LVNP 5ETOA 2X51A 1BGXT 1R0BG 2DGUA 1HYSB 3ZZOA 1JXVA 4J9SA 4HYKA 3PYGA 1N5SA 1N33F 2XI3A 2J0QD 3I55S 1XK8A 2Q6CA 5BNZA 3T1YF 4JXZA 3OBIA 3L7OA 3KG1A 3AOBA 2QIFA 3GV5B 1NPRA 2RS8A 1NJZA 2HBYB 1BQNB 4OZJA 2LEBA 1UWBA 3O2IA 1VQNS 4ZA1A 2CQ3A 1JLCA 2FGOA 4NLGA 2FVRA 4P7TA 5CZXA 1DTTB 2LXFA 3MOJB 1HW9A 2YPZA 3FBCA 2Q43A 4JV5F 1AROP 3UE2A 3RAQA 3LTOA 4QW9A 1OSCA 1IKXA 2XMWA 3GYGA 5LMNF 1S72S 2FJEB 4K4SA 3UNYA 2QZ8A 4QYZK 2E7VA 1OMSA 4AE5A 3QIPB 2BA9A 2HIQA 2YQ1A 3TEGA 4JYZA 4LFCF 4RNNA 4K2JA 3AT1B 2MSTA 1AUDA 1CJKA 5DZ7A 3H2LA 1RAEB 1WI6A 1VCTA 2VBYA 3LA0A 2F4VJ 1RA7A 3RAMA 1IKWB 5E5NA 3CJSA 3OL7A 2UVWA 4NCBA 2E5JA 3DOLB 2RUSA 2IVFB 3W8GA 1J5OB 3HHDA 3CD5A 4NLQA 1PILA 3OTDA 1RZMA 3V81B 2VPZB 5IZHA 1N56A 1SBRA 2AHOB 1S99A 3HVRA 3AJ2A 2UVUA 3UWTA 2XEXA 4QWEA 4CQ1A 3DN9A 1P9YA 3I87A 1U6BA 3PIPQ 2HQFA 5DDRC 1UL3A 4JI3J 2V2QA 4F4WA 3P5TL 4CLLA 5GAGI 1ZTTA 1WTBA 4NA1A 2ZJPS 3JSRA 3ZZTA 1NK8A 4GKJJ 2W7PA 4GVLA 1MROB 3TZYA 2LA4A 4QBUA 3FEXB 3Q24A 1FRKA 2HFOA 2GA7A 3RBZA 4CCHA 2ZITA 5K8OA 3AA8A 4WTYA 2HHTA 3QNWB 4JOUA 3UVJB 3RG6A 1N32J 1NYLA 2MYFA 3N6MA 4DV6F 1OY9A 4KO0B 1WACA 3F73A 4YQWA 2R7TA 3RBDA 3JS9A 1Q8LA 3MM5B 5KG6A 3TNVA 4O4GB 1F1BB 2NYIA 1X4BA 4NLTA 5HAOA 3W2VB 2CUYA 1SQEA 1CJVB 1RHJB 1FE0A 1RI7A 1X5OA 4YDDB 3V4IA 3PO4A 4DBQA 1OQ6A 3W65A 2Z2MA 2UXDJ 2YX4A 4C8OA 5E7OB 4JI2J 3V2UC 3DLKA 4JBCA 1UW4A 4DV7F 1PAUB 3G86A 4P2FA 1T03A 1QAJA 1IVZA 2MXYA 3V4IB 3NNAA 2L9DA 1OY8A 1JXEA 2RVJA 2Z0GA 3OJUA 2Y0BB 3AIIA 2VQEJ 1HNVB 1HI0P 3NNHA 4KGKA 4OZLA 3QSIA 2ZHBA 3PJXA 2KO1A 3UFCX 2RE8A 2DR9A 2FHJD 1DZ5A 2K1RB 2O01C 2JVRA 2R2UA 2K3IA 5IC6B 3BQ2A 1NK9A 4EGLA 3CJ5A 4C8LA 1N5YA 3T6BA 4NMXA 1EARA 1TKXB 4NWBA 3ETMA 1IBMF 4M5NA 3NOCA 1RT2B 4ZN3A 2CJQA 3FCVA 1UVMA 2KYZA 4ZKAA 2QJ3A 1EP4A 2VBXA 5I3UA 2B6AB 2OEJA 2PDAA 2ILZA 3KK3A 1RLDA 4X4TA 2OTJS 3FQKA 2R4FA 4OFZA 1JLQB 1L3KA 1FT8A 5LM7E 3TVYA 2QYGA 2A2CA 4ENOA 5L46A 1HARA 2MSSA 2R7VA 3KK3B 4TQRA 2PA8D 1RYSA 1GFWB 2B4UA 4TU8A 1UFLA 4RPFA 1LNQA 4CRJA 4WP3A 1ZAXA 3KK2A 1TFYA 1R8AA 4ZP7A 3R27A 2M3DA 1UCNA 2RT3A 3D9BA 3ICLA 1FRMA 5KTQA 2J6SA 4P6QA 4M5MA 2UUBF 1RGVA 3EGNA 2KZMA 1M0SA 1J5EJ 1RBOB 1U02A 2QYCA 4EUVA 4DX5A 3VV2B 1SB6A 4QIWD 2R8IA 3W9IA 3UN3A 1HHTP 3MR3A 5DLFA 4PAAA 2OIHA 3RZAA 2Q6BA 1C0TB 1T9YA 2EK1A 3TW0A 2WSCC 1QUPA 4GKKF 3ISNC 5A8RA 1JMTA 1IBKJ 4J9MA 5KT7A 5ETQA 3GR1A 4RZRA 1UFWA 3QATA 1RAOA 3K5NA 5KFGA 1GX6A 2CWXA 2IMOA 2ZKTA 1NPPA 4TLQA 4USWA 2X1FA 3AOAA 3GMGA 3NWGA 4DFMA 2C2KB 5CCMA 4RW4B 1ZM9A 3D0GE 1YIJS 2E5HA 1KFSA 2OP5A 4ECTA 4PABA 3W63A 4MIAA 3CMES 1OJ4A 1V5VA 3PYDA 3S8SA 3H20A 4LVOP 2ZJPQ 5HQ8A 3CPWR 4ELTA 5LJ3Y 1N6QA 2UXCJ 4OI2A 2PSZA 1X4HA 3A13A 1DURA 2I9SA 4K2XA 4LSZB 2AEMA 4A8KA 4P2SA 4N5SA 3SCKE 4OIXA 4QQBA 1F3FA 2IBOA 4WFBQ 4Q8EA 2VOPA 2P6TA 3HHLC 1UDXA 1VRUA 3SSQA 3BSOA 5DQHA 4LF6J 5DETA 5H1SV 2DNMA 3GWCA 2E1MC 3FZ2A 4WFNQ 4ETXA 4WFYA 4ZVGA 2MEWA 1IKYA 4P72A 2KI2A 4USIA 3FBBA 4ZCLA 3NS7B 4F02A 4C3MA 3QRPA 2JJ4D 2O1PA 3WBZA 3ZTOA 4ZVEA 4XPCA 4X4RA 1UPPA 4LRFA 4UOFA 1N88A 1T94A 1BWEA 1EETB 3EPGA 4DV1F 3PNIA 3MI7X 2CPFA 3WZ0A 1HR0J 1L3SA 4FYYB 2Y9HA 3PKMA 1UETA 1XR7A 2YPYA 4TLRA 1X5SA 4QCLA 2YXLA 3UR0A 3BKUA 5HVGA 2X1AA 2MKJA 3RW6A 3I31A 3QPIA 3BB5A 1ZH5A 2ILYA 3J7AN 2M2BA 3DYAA 2MZRA 1R0AA 1JLFA 4WYLA 3OUYA 3N01A 3P96A 4ATNA 1OPZA 1RTDA 2AWZA 3FKBA 2LU1A 1V3RA 1KWMA 3KJVB 2Y3YA 1IR0A 5D4LA 2VG7A 5F8IA 2FPHX 1HNXJ 1N36J 2P9EA 3CCWA 1FEUA 1U1PA 2FJXA 1F9EB 3PYEA 2VC1A 1VQYA 4LF7J 4JI0F 2H1YA 3KG0A 4P71A 4ALZA 4WZMA 2HHVA 3QFWA 1HQEB 5E3AA 2X1GA 4B3TF 4P52A 1NHVA 4EI2A 2AF6A 1TKZB 4WK3A 2F9JA 5KT4A 2XMJA 4MFBA 3TYTA 5IWAJ 4LR8A 5KFZA 2ZOMA 3EICA 3OR2A 3AD9C 4N76A 1GX5A 4NA3A 2RF2B 2XULA 4KV8B 4A8MP 5CZVA 1YJVA 2QMXA 4PG8A 1IN0A 2K2PA 3W9HA 1PJ7A 4RUCA 4F0KA 3PJ9A 3I96A 2HZAA 3K59A 2NSBA 1HIYA 2YKMB 4YUDA 5I3QA 2BJDA 4C3LA 2H5EA 3NGKA 1S57A 5KFOA 2V63A 1JLBB 1FJGJ 1JWWA 4FDFA 4N41A 1FDAA 3BGLA 3PEHA 4DL5A 1T9XA 5J2NA 2DVIA 2JL9A 2XMTA 3OVSA 1U1RA 4IFYB 1FK9B 4QOTA 5EWFA 5CABA 4ZPVR 3H5UA 4FP9A 2J7WA 4J37A 3W5YA 1RWNB 2XQCA 2HBZB 3SFGA 3UNGC 4RNFA 2RRBA 1RT6A 1JLEA 3MCSA 2YBVA 4OMFG 1S1UB 1FKAF 3HF5A 4ZIWA 3VR1A 2RDJA 3EWGA 5J2NB 2ZH9A 4N8NA 4PG4A 1RTHA 1LW0B 4I68A 1RWMB 4PXDA 3CTRA 1RWWB 3D1QA 5HROA 1YITS 1WORA 2DY1A 1YJUA 1YRUA 3QAEA 1XMOF 4KE5A 2NQPA 3I0RB 1D3WA 4WCEQ 2D69A 3O44A 2VODA 1HPZB 3SDEB 2I38A 4RW6A 3WIUA 4J9PA 2ZD1A 2IMWP 1CLFA 4ZMMA 2PMZD 1KLMA 1Y5NB 3OTCA 3LP2A 4QPTA 4CYUA 3CC2S 4U8VA 1X31C 3NOGA 4DX6A 4GVBB 4OHXA 4CM0A 3SCLE 2D3UA 4KTQA 3ZZ0A 2OMLA 2ZH5A 2YNFA 2KXHA 2ZD1B 3GSIA 1KLMB 1KHWA 3LAKA 3DLLQ 2ZOFA 3HULA 4LF1A 3EPIA 1AA1B 4M1KA 3GIJA 1LK7A 4DR3J 4C9DA 1H2VZ 4O23A 2VASA 1RLCL 5FDLA 4JI7F 4ICLB 1W2IA 1CBKA 4P10A 1DHMA 2ACYA 3MEGB 4AXJA 1FE4A 1TZ0A 1HI8A 5B0AA 3CF5Q 3ILLA 2V4JA 4DV3J 1RTIA 3I9ZA 3NKYA 4M94A 1NZAA 1YK9A 1FESA 3MEKA 2BE9B 1VYAA 1FKOB 3O1LA 1SKWA 3ZZYA 1EIYB 1TMJA 2GHVC 3AD7C 2HEKA 5L8RC 4F25A 3T19A 4K0KF 2OPSA 3F41A 2BVZA 5J2PA 1NNDA 4ECQA 3K5LA 2CJBA 5H9EJ 3CWJA 5BR8F 4MK8A 3IGVA 1NSAA 1RHRB 2VDHA 1GH8A 1EX8A 4HI1A 3CDAA 2X1BA 5I3PA 3JQJA 3FSYA 4QU7A 4IH7A 3D67A 4QWAA 2IIHA 4OHWA 4KQZA 3BBCA 2XMVA 3PW7A 2YWHA 1L3UA 3UD3P 4AUKA 2BOAA 1MN7A 3KLIA 5C24B 4ZHRA 3KK1A 2CVIA 4PWDA 3AB2B 2JEJA 5BYSA 5LJ5Y 3CB4A 5F8LA 2YX7A 2HVIA 2EGWA 2VBZA 3M2UA 2CJXB 4UOGA 1N34F 3V6HA 3R5CA 1GMUA 4B3RJ 2IM3A 2CQ0A 4PKDB 2NXCA 2B9YA 3IS9B 4LBHA 5ETKA 3NMRA 2R7SA 1XEZA 3J7A1 2QFIA 1N0VC 3KLIB 1YWXA 3PKYA 4PWUA 1RAGB 3PG9A 4X64F 1CULA 1VK8A 4X4NA 3FBEA 2XLIA 3OFGA 5HANA 4Y00A 4K4ZA 5HQMA 2NWAA 2ZBIA 3DKDA 2DGTA 2MQ8A 2V68A 1X9WA 4KSEB 3K5PA 3MCNA 2RNEA 1J2VA 3I0SB 3FCHA 4CO5A 1DQAA 2KT2A 4EO6A 2RDIA 5D3GB 4K4YA 3TUZC 2VDIA 8AT1B 2ZBCA 4DPXA 2HW3A 3POTB 2BMBA 3OR1A 5A0YA 1ULRA 3QGPA 3EX7B 2HRUA 4K5SA 3DDIA 2OH2A 2I5JB 3OFEA 5K20B 2QL9B 3HZEA 4IRCA 4HDGA 2BZ2A 4I2PB 2X3GA 2HZCA 1DFUP 3NCPA 4DR5J 2U2FA 2NYHA 3BEGB 3OR1B 2ALYB 2UP1A 2RKIB 3OTEA 4DPWA 5FD1A 1S1TB 1FHTA 1S48A 1VQPS 4DXLA 1M1KT 1DRZA 5EUHA 5K14A 2DRDA 3JQKA 3VTIA 4KHPF 4WKYA 2IDEA 1XTZA 4B3SJ 4ECSA 2KRBA 4X4VA 1RT4B 1S6PB 3RW7A 5DG9A 4PR6A 1QTMA 1CQNA 4Y2IA 5KFJA 3RB4A 1DY3A 2MKKA 3PR4A 4ZPCA 2PD1A 3DU6A 3BJYA 3TJ9A 1TQLA 5E3RA 3IC1A 1M5VC 1VQ4S 4DDFA 4YOEA 5CXTA 1WDTA 3BR8A 1HQ2A 2VV5A 3JXOA 3BSNA 3TAPA 3KLFB 5SZTA 3AOCA 1LXJA 1N5VA 3CE8A 3UDLA 4ZP6A 4WTOB 2DNYA 1IQZA 1IR1A 2ZH3A 2HZVA 2WK4A 3H98A 1RWOB 5B7WA 1TAUA 3DGPB 4X65J 3CJKA 4KC5A 2YNGA 2LYVA 4QIFA 4WXWA 3DOKA 3NCQA 1U7LA 3M8QA 5ETLA 3KOAA 3M2RA 4PRFA 1Y00A 4YB7A 4DQSA 3HT3A 4RW7A 4USHA 5CYQA 3ZTQA 3VGTA 1S1XA 4M95A 2F8MA 2Y1LB 3DOKB 3GLJA 4KPCA 3OL6A 1VC0A 3MM8B 3B8HA 1UAWA 5ADZA 4DUTA 3QLHB 4WFXA 2DNQA 5GADI 1S9GB 2N4DA 4YMEA 1Y10A 3C66A 3JTPA 2W4PA 2YKNA 2KM8C 4LIRA 5K8NA 4C0BA 4J9UE 3M1VB 4X4PA 2DR5A 2F65A 2PMWA 2VOOA 1VQ8S 2I0XA 2DITA 3G8TA 1UVKA 1WC4A 3BSCA 3GV8B 4ZLJA 1AFIA 4NMLA 1YTYA 2XMAA 1UP1A 4DSKA 5AJ3F 2AYGA 1UA0A 4ZCMA 5GMDA 2IY5B 4KRWA 3CDBA 4NLPA 1KDNA 3KW2A 4DLGA 4GMKA 2AJ4A 3TP2A 4C8MA 4EO8A 4RUAA 2FLOA 1H3DA 2GAHC 1WKLA 3LO3A 3HVWA 3IG1B 4U7CA 3MMJA 2JEFA 3LP1A 2HLTA 1FKPB 4FZVA 4QWBA 2PI8A 4PPZA 2KXFA 1ZPWX 3ULHA 4ZVFA 1M5HA 4EYIB 2HAIA 3M05A 3HK2A 4HI2A 2VG5A 1REVA 4F4KA 1GMVA 2CWKA 3OV7A 4NLUA 3T5KA 4Q0BA 3LP1B 3MPUB 4NXMJ 5AE3A 4LF8J 5HO4A 6FD1A 1FJEB 5H9FJ 2JLFA 3RB0A 3CMQA 5CAAA 5KG3A 5G4DA 5GAGU 5IC4B 1N48A 2BKNA 2UUAF 2VBWA 2O3DA 1REVB 1M1HA 2DR8A 2O67A 2R2TA 4KY3A 4TU7A 2ZOGA 2WSEC 4NCGA 2J7UA 1X5PA 4ZPBA 2BR0A 2F8HA 2JX2A 2HHPA 1XC9A 4MKVA 4WZQA 1FTRA 2GGPB 5KG0A 3TANA 2BE7D 3JAMY 2KFYA 2WHOA 2W24A 1K1SA 2VL1A 4OX9J 2GHWA 2YNIB 4YP3A 4U96A 1ZBTA 2QO3A 5KFHA 2CJ9A 2O66A 3Q0AA 4F4AA 3C16A 3D6TB 3KUHA 2VJUA 4DLEA 1HQUB 1KVIA 4LFBF 3LALA 1F5AA 3C6UA 4K4VA 3MTKA 4WU3A 4R8UA 3A1YG 4DV2F 3Q8UA 2DNPA 4IO9S 4ERDA 1BXNA 2CQBA 1W26A 3DDKA 3OVAA 4J9NA 2E5LJ 3N28A 4DV4F 1BD6A 3ETOA 3BDPA 1QM9A 2ZE2A 2XY6A 4PQUA 6FDRA 1HNZJ 3IBWA 3V6DB 2JNJA 3C6UB 1XNRJ 3MCOA 3OTBA 3HCXA 3PDNA 1SC3B 4CTAB 3BO2A 1SKUB 3RRHA 4F0MA 1IWAA 2GMJA 5B0EA 3UPFA 1LOUA 3OJSA 4BLGA 2RQKA 3NP5A 3T6JA 4YR0A 1N36F 1HKAA 2WSFC 2HQ3A 2BQRA 4RU9A 1FWPA 1U47A 1HW8A 2N7YA 3OTOJ 1F60B 4URGA 4J9KA 3L95X 4I69A 2HNDA 1SL1A 1CG2A 4Z37A 4TY8A 2PFDA 4ZCIA 3BPSP 2A0FB 1RWKB 4Y6IA 2V8VA 3Q8PB 4PG7A 2AV5A 3VZHA 3S01A 3LH2S 3W9JA 2OGUA 1DTQB 1WTFA 2Z4PA 3OFHA 5A8KB 1HBMB 1K47A 4LSLA 1EZZB 3FCWA 1G7CB 2WB1D 4DG1B 4PZVA 1ZZFA 2K06A 5KFTA 3DM2B 2ATCB 3ZO7A 2AD9A 3CJ8A 1FFSB 2DNKA 1IQTA 2DCUB 2IJRA 4R5PA 3KTQA 5I42B 2Z2ZA 2VKZG 3V6JA 4FVCA 2F5GA 5F8JA 2HFVA 4K5RA 3MCMA 5CHCB 1K73T 1WHYA 1TFWA 1W25A 4QPXA 1IM6A 1WI8A 3R7SB 2EC2A 3GB0A 3DLEA 5HLFB 1TKTA 2WVDA 2CG8A 1SVDA 2XWYA 3CJ4A 1SJRA 1ZJWA 2R3VA 2W4CA 1YBUA 1MWZA 1F2HA 1N33J 3TR5A 4LQ3A 2HNZA 2P9GA 3IR6B 5C7PA 2R7RA 3T1YJ 3GV7B 3FZBA 3BQ1A 1Y7PA 1IUJA 2CNKB 1WEZA 4HTJA 3I5CA 2HVHA 1JIHA 1DBDA 1TKTB 2HYIB 1O5JA 4OHYA 1GQEA 2IYGA 2PNWA 1FA0A 3EXYA 1WOSA 2GX8A 3CJRA 2CQPA 1CC7A 2DO0A 4W98A 4JP8A 4DI6A 4I6YA 4FF3A 4LF5F 5ITHA 5CYMA 1DARA 2U1AA 5HP1B 2OFHX 4JV5J 2RS2A 5AE1A 3Q8QB 1O6XA 4EZ6A 3IWXA 4PXCA 4QR1A 2OSQA 3C46A 1UEUA 4PEOA
chains in the Genus database with same CATH topology
4KJIA 1R27B 3PFOA 3M4XA 2R8KA 4WTYA 1S9FA 1VQ6S 2HHTA 4H4KA 1S9GA 1SH3A 1VK3A 3IN5A 3CCLS 1G6BA 4WF9Q 4JOUA 2LXUA 2EBEA 3KLVA 1T8EA 4CH1A 4ZDNA 2M7SA 2WONA 1TR0A 3MEDB 5FIIA 5CYMB 3M1VA 5EWGA 4A8WA 1QAIA 1NYLA 2MYFA 3E8OA 3N6MA 4DV6F 4OI0A 1AW0A 2MZJA 4MFBB 2BANA 4KO0B 1WF2A 1WACA 2L9NA 2XHWA 1JX4A 2QFJA 3FEYB 3F73A 4YQWA 2L3MA 3OR2B 5F8MA 3RBDA 2R7TA 1N0UA 2LXIA 5D4NA 3IR7B 3QGIA 1Q8LA 1MU2B 3MM5B 4DQQA 5KG6A 1GTSA 3TNVA 2I2YA 1Y5IB 4O4GB 3QMQA 4NLVA 2NYIA 2KXNB 3DRPA 1X4BA 2LVWA 1VBXA 4XO0A 1U6ZA 2C42A 4NLTA 3PZPA 3DHXA 2AW0A 4WFZA 4OX8A 2BXJA 2EFVA 2MHNA 4DHVA 3W2VB 5KG7A 2XMKA 2ROEA 2ZHOA 3ZZPA 4IRKA 2IC3A 4BWMA 1SQEA 2VFRA 1JXLA 3JSYA 2EFOA 2DO4A 1FE0A 1U2FA 1RI7A 1RQ0A 1X5OA 2GJ2A 3GQCA 1E6YA 3FSIA 1A7GE 4YDDB 4WFAS 2RMLA 3PEJA 3FNNA 3MMCA 1P9QC 4RLEA 1FEEA 3V4IA 2IM2A 2HPUA 3PO4A 1GXUA 4A8QA 4K4WA 4DBQA 1OQ6A 2FC8A 2LQBA 2JHEA 2Z2MA 4NLRA 3MR2A 5JVHQ 4UOCA 4OV1A 2XSJB 2YX4A 2ASLA 5HBMB 4C8OA 5E7OB 2EBGA 2OKQA 2NZ4A 1YRXA 2ATLA 2JC1A 1NEEA 3V2UC 3DLKA 3MURP 4EBEA 4JBCA 1RDRA 1UW4A 4AXIA 2QLWA 4ZPWR 5DQGA 3OXFA 4DV7F 4F3OA 1G2EA 1X4CA 4JI5F 3G86A 3W7BA 1FTCA 5KT2A 2VB6A 3IG1A 5D4OA 2Y0SD 4I0WA 5HMWA 2ZH1A 1HBUA 2VKRA 5T41A 2AX1A 2YH1A 5KFMA 1MMLA 1R8HA 2A3JA 1X9SA 3HJFA 1T03A 2UVRA 2ZVSA 4FXDA 1URRA 4DV5F 3IGNA 1QAJA 1D9FA 1ZM3A 1FKPA 1ZYQA 3MUMP 4BS2A 4CNZA 5EN1A 5KFPA 2MXYA 5KG2A 4DL3A 3V4IB 1WG1A 3NNAA 2MMYA 3DRSA 3B4MA 1S76D 2L9DA 3M9MB 4F4YA 1JXEA 3ENVA 2GV1A 3SQGB 1J5EF 3K5OA 2RVJA 4IYQA 1RT6B 1JLEB 2Z0GA 2YWEA 4ES1A 5M2PA 4NCAA 4PUOB 1AFJA 3DU5A 1LK5A 4YB6A 1S9EB 3OJUA 1S6QA 4NRTA 1FXLA 4R0JA 2CPIA 1Q7LB 4J9OA 3TRGA 5DQIA 3JSMB 3JTNA 4KFBA 1U1NA 2BOPA 3KG4A 4JV2A 2QA4S 3AIIA 3NL0A 2JZ5A 2ZZMA 1HNVB 1HI0P 4B3MF 2J9DA 4KGKA 1RTHB 3NNHA 2H9ZA 3M6UA 4ELUA 4OZLA 3C3LA 4E8UA 4OJGA 1HNIA 4ECRA 3SV4A 1KSPA 2ZHBA 3PJXA 2MY8A 3BO3A 4DWIA 3MXHP 2KO1A 2MQMA 3LP0A 3UFCX 5EGYA 1S0MA 2RE8A 2VONA 2XWXA 2DR9A 3DMJA 2FHJD 3PX6A 1DZ5A 5HROB 5IZNA 1SC6A 2K1RB 2UV8G 1IBKF 1RT3A 2O01C 2JVRA 3C8YA 4G1QB 2DTJA 2R2UA 3GYNA 2HMIB 2RH3A 1DFDA 2K3IA 5GAEU 1Y4ZB 3BQ2A 2HS4A 2RE1A 1NK9A 2DPJA 2ADBA 2ZH7A 3IO1A 4EGLA 1TL1B 3CJ5A 2XCAA 3QAUA 5D4PA 3OQ2A 5KFAA 3R5BA 4QWDA 1N5YA 4C8LA 3T6BA 3DOMA 5BYRA 3E2EA 1JKHA 3PFEA 4K59A 5IT4A 4OL8A 3IFEA 2WBRA 1TKXB 2B4VA 1S1VA 4NWBA 2CFXA 1RKIA 5L1IA 1IBMF 2OPPB 2ZKUA 4MTPA 3HVAA 3MM7A 1MW7A 1RT2B 1F5CA 2CJQA 4RW6B 5KFUA 4OLPA 5KFWA 1W2BR 5D77A 1X0PA 3KFWX 1UVMA 1MSWD 1KVJA 1S6OA 4V19J 2KYZA 4Z2XA 4ZKAA 4ED7A 4OI4A 2GGPA 3LP2B 1EP4A 1JNZB 2VBXA 3K57A 5I3UA 4V194 4JV1A 2B6AB 2HNYB 3J7ZT 3M30A 2PDAA 2ILZA 3MEEB 2XCPA 3KK3A 2M8DB 2A10A 3DRYA 4FBUA 1OIAA 2FJBB 3D28A 1VQKS 2C3YA 3Q8RB 3OVBA 1Q79A 1PC5A 4I7FB 1FVQA 3FQKA 4X4TA 2OTJS 2R4FA 2Z8QA 4NYPA 4X4QA 2UXCF 2MY7A 4OFZA 1JLQB 1T95A 1QSLA 4NLSA 1L3KA 2YNIA 3U02A 2R8JA 2CZVC 4EFAC 1FT8A 1XNQF 4M5DB 1C2PA 1N5QA 4KGMA 4MK9A 3TVYA 2YNFB 1HWIA 1ZOTA 3PRDA 3Q2SC 2V4RA 2EC0A 2JLEA 5KG1A 2A2CA 5GAEW 3P3DA 2ZDOA 3K8WA 3O8WA 1HARA 2FVCA 1GXLA 4OZ1A 3TA0A 5DGAA 2MSSA 3DLBA 1TV6A 3MMAB 2W9CB 2LU2A 2R7VA 1K8AT 3J7YU 1HQUA 3IA0A 3FRYA 1HNWF 1UVLA 3CEDA 4OLOA 2EG1A 3BSAA 3KK3B 4TQRA 3F56A 4LF6F 2PA8D 4ILMA 2NUHA 2M5YA 4I1TA 2G4BA 1WD6A 1RYSA 3IXQA 1IKVA 4OJ3A 4C11A 3CCUS 4F2RA 4V19X 5HL7S 2B4UA 4TU8A 4FBTA 1UFLA 3M8PA 4DS5A 1LW2A 2IA6A 1WG4A 2V9KA 3ISND 2ROGA 4TKTA 5FDLB 4MYTA 4WJBA 2MQQA 3UQSA 4IDKB 2BYCA 3J7A1 1YI2S 5KFYA 5U47A 3PW2A 3KHHA 2DHSA 1EUYA 2KH9A 3M8RA 1ZAXA 1F5BA 5AXMA 3U1NA 3KK2A 3GIKA 1TFYA 1R8AA 4B17A 3ZC4A 4ZP7A 4WU2A 4K4XA 3R27A 2M3DA 1HYSA 4NZ0A 5F3TA 2RT3A 4RX6A 5L39A 3IAM9 2HWHA 3HHKA 3ICLA 1FRMA 5KTQA 2C22A 4ZPDA 2V4JB 2HFZA 3V6DA 3D54A 2J6SA 2ZH2A 2BM1A 4P6QA 4RNOA 2UUBF 4CH0S 1RGVA 1RTIB 3EGNA 2RRAA 5KT5A 3T1YF 2KZMA 3OPKA 2D3OR 2E9ZA 1M0SA 4DUYF 2BE2B 2QYCA 4QR2A 2YTCA 4CTAA 3VQSA 4EUVA 3FFIB 1RT7B 2Y1IA 3OLAA 4C11B 2CQIA 4DR5F 2VUGA 1RYRA 4DPOA 1SB6A 4NPOA 4LF5F 2OPRB 4QIWD 2R8IA 2C2DA 1HR0F 3B82A 2D9OA 2JH3A 1HHTP 3MR3A 1VJWA 5DLFA 1L3VA 4QW8A 2OIHA 2LA6A 3RZAA 1RT1B 4ED6A 2ZZNA 3CVKA 2BUNA 4FS2A 3KLEB 2OPSB 4GO7X 2BW2A 2QT7A 2Q6BA 3US5A 1C0TB 2XI2A 1BQNA 4RU2A 4BCAA 4RBVA 5J2PB 5KFKA 1HBNA 3TW0A 2EK1A 4J9LA 2WSCC 2J9CA 4Y2AA 1QUPA 4MH8A 3J81Y 1SV5B 3MZIA 1S0VA 4GKKF 3ISNC 1KQKA 2FUG9 2CQ1A 2GNKA 4G1IA 2F1FA 1FDNA 2B4OA 5A8RA 4ED2A 2DRAA 1JMTA 1NO8A 1U1KA 3UDCA 4IG0B 4DJBA 1SUQA 1SIWB 4J9MA 4O3QA 3FRZA 5KT7A 3K5MA 2E5GA 4ETZA 3GR1A 5LSRA 3CGIA 4IOCS 2V8HA 4RZRA 1UFWA 1U4BA 3MMBB 3K5NA 2ERRA 1DTTA 5KFGA 4TQSA 2LKZA 1GX6A 2XG8A 2QA2A 3E3XA 2R8HA 2IMOA 2ZKTA 3D1HA 3KNAA 3BF4A 1VIOA 3AAWB 4TLQA 4HLBA 4BHQA 2EFNA 1D8ZA 3HHLD 2X1FA 4NLYA 3GMGA 3NWGA 4ZLPA 3OSNA 4DFMA 2DNGA 3SSRA 5CCMA 3G96A 1HNXF 3EGZA 3HHLB 4RW4B 1ZM9A 3D0GE 1YIJS 2E5HA 1KFSA 2OP5A 2DCLA 2UUWA 4NX9A 4ECTA 2ASDA 4IFVA 1O0CA 4ZHRB 3S6EA 3OHBA 3KK1B 4MIAA 3O5TB 2FHOB 2FLLA 4LF7F 3CMES 4J9QA 4IOAS 1Q8IA 2BV3A 3LGMA 4M8LA 4PWDB 2DGSA 3BN7A 2Q1LA 2UUTA 1U24A 1VBZA 4O3SA 4E0DA 1DTQA 3W2WA 3MWBA 5K8PA 1S97A 3MFIA 3S8SA 1RP5A 3H20A 4LVOP 2ZJPQ 5A8KA 2R8GA 3M2UB 1HBMA 5HQ8A 4EU0A 3CPWR 3CCES 4ELTA 5LJ3Y 4MKBA 1N6QA 4IQXA 2N3LA 4DG1A 4ZCKA 4LF9F 2WOMB 2BQUA 3HVTB 4OI2A 3I56S 2N7CA 3ONQA 1K0TA 4FYDA 3DM2A 2PSZA 1X4HA 2XNRA 1XMBA 1JJHA 1DURA 2GMLA 2I9SA 1OSDA 2KB2A 4H4OB 5IWAF 5GAHI 2MDAA 1NK0A 5F8NA 5A6PA 4EZ9A 4K2XA 5M2RA 2XS2A 3CCQS 1H2TZ 3QIPA 1QSSA 1HWKA 1VGYA 4A8KA 4P2SA 4N5SA 3SCKE 3VWSA 4OIXA 2L48A 5HMYA 1M5OC 2KU7A 4QQBA 4ID5B 1ZAVA 1VQSA 2IBOA 2WAQD 2V5HG 5DS7A 2AP6A 2BJEA 4UQTA 4WFBQ 4Q8EA 2VOPA 1FRJA 2F8EX 2BM0A 2P6TA 5I42A 5SUHA 4JI6F 3HHLC 1UDXA 1VRUA 2EK6A 2ZNYA 3SSQA 3TA1A 4U67S 3K8VA 3GG1A 3BSOA 5DQHA 3VAIA 4MKYA 1WNEA 2N82B 3CC7S 1E6VA 1S7HA 2G9OA 3HDSA 5DETA 5H1SV 1DLOA 1FNXH 3L7PA 2DNMA 1KTVA 2E1MC 2OD4A 3GWCA 5D78A 4A8FA 3FZ2A 1VRTA 3KLHB 4WFNQ 1F2GA 1DQ8A 2XNQA 1N4LA 4AL7A 3FQLA 4ETXA 4WFYA 2FVPA 2ZDPA 4ZVGA 2HWTA 1IKYA 1RJJA 3PIOS 2KI2A 1BY9A 1KC8T 1Q16B 1TL5A 4USIA 4ZCLA 4F02A 3MM6B 4C3MA 2PT0A 2DNLA 3G6ES 2OLWA 1TK0A 1CEZA 4UUWA 1I1GA 2JJ4D 2O1PA 2M88A 2XMUA 3WBZA 4ECVA 2J9DE 1IKWA 2DNNA 3VAJA 1NKCA 3MPYA 1OWXA 3AQPA 4KBIA 5HLFA 1C1BB 2YWKA 4ZVEA 1FJGF 4IUFA 4XPCA 3DOLA 4X4UA 3MUVP 4DN0A 4X4RA 1B75A 3DFEA 2AGQA 3R5DA 2E7WA 2R2SA 4EBCA 1DLOB 1H7WA 1N88A 3NAIA 1M5KC 1GNKA 1T94A 2RQMA 5EX3A 5LSLA 4WFAQ 1J5OA 4DR6F 3C6TB 2W4DA 1BC6A 1EETB 5IFMA 5A0YB 3KHGA 1X4FA 3EPGA 4DV1F 1BWEA 3PNIA 3MI7X 4ELVA 1Q7YT 2OFGX 2EWHA 3DDNA 4C98A 3CCRS 2FJWA 2CPFA 3WZ0A 3KHRA 2B0GA 1KD1T 4TN2A 1L3SA 3N4WA 3V81A 3QJPA 3PHEA 3PKMA 1UETA 4CO2A 1XR7A 4NYZA 3MR5A 4PCQA 4TLRA 3VAGA 4DR2F 4ED8A 4ES2A 1X5SA 3NAHA 1V3SA 2YNHB 4QCLA 2VH7A 1JLGA 3UR0A 4D3HA 5IM0A 3DLGB 4EYHB 2EPIA 2X1AA 2MKJA 1C1CB 3RW6A 2PN6A 3I31A 3MHYA 3MOJB 1SJQA 3QPIA 1WF1A 3T5JA 1NAQA 3BB5A 4I2QA 1TK5A 2ILYA 1ZH5A 2VD3A 3MAHA 3VAKA 2KYXA 4EEYA 5J2MB 1IXKA 2M2BA 1R3NA 2MKHA 2DGWA 4Y2CA 2GW8A 3DYAA 2MZRA 4ECYA 1VQMS 4U9RA 1AXQA 2RIJA 1R0AA 1JLFA 4WYLA 1VI7A 3N01A 3OUYA 2GQ2A 2JDJA 3P96A 4ATNA 3D0IE 3HHNB 4Y34A 3SCIE 1OPZA 1YJWS 3ISZA 1RTDA 2AWZA 1LWFA 2LU1A 1V3RA 1OQ3A 3MGJA 2L41A 2CQCA 2JC0A 2I8EA 3KJVB 2DGVA 2E29A 5HP1A 4DSEA 2CJKA 2HFNA 1IR0A 5D4LA 3M32B 7FDRA 1HA1A 2VG7A 5F8IA 1TP7A 2FPHX 3DXSX 4X66F 2CPXA 1RISA 1M5PC 1Z2ZA 5KFLA 1MROA 2P9EA 3CCWA 4X2BA 1FEUA 1U1PA 4UW2A 1JLGB 2FJXA 3PW0A 3KNGA 3FJ2A 2R2RA 1D9AA 2WTFA 1QRUA 1C4AA 2IJFA 2IYIA 2VC1A 3B4DA 3QO9B 1VQYA 4JI0F 2LEPA 1TAQA 1TVRB 4KKOB 1FJCA 3VAFA 3KG0A 1O8BA 5K14B 2B5JB 1R8CA 4ALZA 3MDFA 2BQ3A 2BDPA 4WZMA 4WKRA 3LWMA 3DHWC 2HHVA 1UJ5A 1PC4A 2ZUGA 1B0PA 2K7JA 3BREA 1HQEB 5E3AA 2X1GA 4IH5A 4B3TF 3R5AA 1NHVA 2RB7A 1D1UA 2CPJA 1SKRA 3MEDA 1S10A 4B08A 4HL9A 2AF6A 1TKZB 3IR5B 2F9JA 4WK3A 5KT4A 2XMJA 4MFBA 3RYLA 3TYTA 3KHLA 1MWYA 4KO0A 4FNIA 2M9KA 3QWPA 4F3QA 5KFZA 1R89A 2RQCA 2ZOMA 4AFFA 4ZP8A 3OR2A 4RNMA 1MU2A 3MM5A 4XK8C 4N76A 1GX5A 4WIIA 4O4GA 4HH0A 4NA3A 1R8BA 3MUTP 3U27A 1S49A 2PA3A 2RF2B 1U1OA 1LXNA 2XULA 4KV8B 2HHHF 3O3LA 5KFCA 3DI6B 4A8MP 1SH0A 4Y3CA 5CZVA 3VALA 4I6WA 2GHPA 1YJVA 3DXBA 2QMXA 3W2VA 4PG8A 1IN0A 2K2PA 3HKZD 4N47A 3G6VA 1X4AA 3GIIA 3E01B 2LEAA 2HHSA 3N0VA 2F3JA 4CZCA 4RUCA 4DQIA 2IAJB 4NLXA 4CO0A 3J7YI 3CCMS 3I96A