3W2WB

Crystal structure of the cmr2dhd-cmr3 subcomplex bound to atp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
322
structure length
308
Chain Sequence
MIEVTFTPYDVLLFRESRPFDAGSESVARSIIPLPQTVAGAIRTLLKGLKNCVGVGEEEPEFTLVGIAIGTEKGRIYPLPFNIIKSFYKVVNPGRFLGKLILPPKGKYKSGYVTESILEKYLKGELKEVEENKVIRIEKEKRIGIKLMLYTVEFLRIEKIYAWIEDPGCGIKDILSSYEFLTLGGESRVAFVEVDDKTPDIFNRELGSTKKALFYFSTPTIGKVGEIVQELEKRLNAKIDDYLLVSSRPTAISGWDMHEKKPKGTKFAIPPGSVLFVEFKEEVEVPPYIKLGKLKKLGYGLALGGIWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Cmr2-Cmr3 Subcomplex in the CRISPR-Cas RNA Silencing Effector Complex.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Immune system
molecule keywords CRISPR system Cmr subunit Cmr2
total genus 60
structure length 308
sequence length 322
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09700 Cas_Cmr3 CRISPR-associated protein (Cas_Cmr3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.80 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Ribosomal Protein L25; Chain P 3w2wB02
3.30.70.2950 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3w2wB03
3W2WB 3W2VB 4H4KA 3X1LB
chains in the Genus database with same CATH superfamily
3NP5A 2CUYA 1UKUA 4OX7A 5F9NA 2BRKA 4DR3J 3LGNA 2QGFB 3O3LA 2RD2A 4G65A 1IBKJ 4ECZA 1WHXA 2OD4A 4R8UA 5A8WA 2ZHOA 4DQIA 3J80U 1RYRA 2GQ2A 2ZJQQ 3AB4B 3FCVA 4WIIA 3QJLA 4CLYA 3K17A 3TI0A 4NZ7A 2FJEB 2ASYA 4KO0A 1NSPA 1W2BR 4FKYA 3BH6B 3ISZA 2MKSA 3MMAA 4DV3F 1R31A 4ANEA 5J2MB 3Q8SB 4GRSA 1MMNA 2PFDA 1A7GE 4L75A 5L1LA 4NLVA 3UO0A 4GVLA 1GMWA 1WKKA 2ZZNA 4P7VA 2UUBF 2AYGA 4TU9A 2UU9F 4LSNA 2W8KA 2R42A 2UUCF 3R2DJ 2CPFA 2K8GA 2OSQA 1UZHA 3CD6S 5E3PA 1HNZJ 4CLZA 4LF7F 2VPXB 5LSRA 1LW2A 3DOMA 1RT3B 5KAKA 3BJYA 4OJGA 1JLEB 3U27A 1S9FA 2OFHX 5J1NA 5KFIA 2V4RA 1RT5B 3VTIA 4F25A 1DTTB 5CCLA 4YEAA 1YHQS 4X4UA 3BEGB 4UTGA 4NZ0A 3KLVA 2FVQA 4G1PA 1H72C 2EBEA 2OEMA 4A48A 4QU6A 1AW0A 3CCJS 1EB0A 3O1LA 1XMOJ 4QOTA 2JEFA 3JSBA 1F5BA 1VRQC 3PEHA 4DS4A 1NH8A 2DPIA 3P5TL 2CZ9A 2OGUA 3CCRS 2EBGA 4PQUA 1WHVA 2HGNA 3QWPA 3PHTA 3SCIE 3ILLA 1WSRA 2KM8B 5KFRA 4JI6J 1S1XB 3AJDA 1SH2A 3OQ2A 5H9FK 5HI7A 5CXTA 2OLWA 3VVUA 3HHEA 1NKBA 2ZE2A 4IG0A 3K5LA 3Q23A 1VHKA 5KFWA 4M95A 5CZVA 3PO5A 1KTVA 3CULA 3MCMA 1TQLA 2DYAA 4QQBA 2VF3A 3Q24A 4DV2F 4DS5A 4CO2A 4JV0A 4LFBF 3J81j 5JXSA 4UQTA 2HK2A 3V6DB 2CZ4A 4ZKAA 5GAHI 2RDJA 1HYSB 1DQ9A 2FB0A 3MMAB 1TAUA 3S7RA 3DLEA 4YR3A 4F4ZA 3MPUB 3ZO7A 1QDUB 2HBZB 4DBQA 1N0VC 4PXEA 1D0EA 3I82A 1W2IA 4PRFA 4Q0BA 3SDEB 3N6LA 3TAPA 5KFZA 2Q1LA 1FRHA 2CJBA 2FJBB 2QL9B 3M30B 3M6VA 2Y1LB 2ZH6A 1HR0F 1LWCB 1RJJA 4CH7A 4DFKA 3NBPA 1D8YA 4LF5F 4LSZB 4OZ2A 1WWHA 5C5JA 2A3JA 4CO1A 5B0BA 5J1EA 2VFRA 3KOAA 3R5BA 4LSLB 4ZS6A 4LF4J 1MWZA 2YX4A 4NX9A 1UWBA 5B0DA 2HBYB 2YH1A 2OEJA 2YWFA 1EXDA 1I1GA 3U1NA 1TR0A 1RSCA 3HHDA 2ZD1A 2NXEA 3DYAB 5D4PA 3UN5A 1NRKA 3R7NB 3UW1A 4AQYF 2AD9A 2CVEA 5IOLA 3CTRA 3DMJB 1S1VB 4CO4A 3G87A 1TKTA 1M0SA 3QSIA 1HWIA 5A2QY 3D3CJ 4EGLA 2VG6B 2CKWA 2J0XA 2XWYA 2IVMA 1JLFA 3PYDA 3DHWC 3M6WA 4L74A 1VQLS 4ZVEA 1NDPA 5JVGS 1KLMB 3MCSA 1SJ3P 1NU4A 2YNFA 3TX8A 2AZ1A 3F56A 3ZTOA 2AE0X 1U25A 2LXIA 4N7TA 3BR8A 3BZQA 4KKOA 3PJXA 4ID5B 4NLTA 1OY8A 2PMZD 1YBUA 2HRYA 4FNHA 2MHNA 4WPAA 4ZPAA 3OJUA 1UVKA 2DNRA 3I55S 1SUQA 2KI2A 3DHXA 3FMWA 4F50A 2HVIA 2EFVA 2Y0BB 4ZK7M 3CWJA 4Q43A 2CJQA 4RNOA 3VV2B 2RD5C 4QW8A 2BOAA 4DR5J 1RWWB 1XC9A 4KB7A 4WE1A 2RDIA 1TKDA 4DMZA 3GJTB 3PFEA 1UDXA 1HQ2A 4M1KA 1FKOB 1PILA 4PAAA 1X9WA 1MWYA 3V2UC 1WC0A 2Z2ZA 4KFBB 1IKYB 2CWXA 2V4JB 4DR7F 3QO9B 5DDRC 3NNHA 3WDOA 3HHNB 4HT7A 4LIWA 4OQJA 2ZNYA 3T5HA 4B3MF 4JI6F 2FPHX 4YB6A 5KFDA 3W66A 1LQ9A 3KK1B 2QL5B 4ELVA 3ETMA 3TUPA 4DR5F 3M7VA 3CDBA 2CQHA 2HFUA 5DM7Q 2KRRA 1YKWA 5D6GA 1WC4A 2YNGB 5CH7B 2L9NA 3HVRA 2DD8S 2DHGA 1ITPA 2H54B 4WXWA 3KG1A 1QJHA 3KLFA 4LR9A 2QTWA 4TXSA 4F2SA 4IO9S 3JTOA 1TTHB 5AXMA 2XULA 2DNOA 3I5CA 2MGZB 3MUMP 3CCUS 2YXLA 4DV7J 3DU5A 1V9OA 3NMAA 1GMWD 2PSZA 2M8DB 1ZM3A 4WKRA 2E5JA 3MDFA 1NK4A 2KHDA 3O8WA 2MLZA 3JSYA 1AXQA 4OYPA 4IKAA 1HQUA 2FHJA 1DFUP 1EETA 1FI4A 2WVCA 2BANA 1KTQA 2XBPA 4A46A 4YS2A 3EGNA 3IRWP 1VBXA 1VHFA 1Y10A 1FNMA 2D41A 4I2PB 4DFPA 3IG1B 1SC6A 3PR4A 4JI3J 4AQYJ 2JZ5A 1MN7A 1WDTA 4IH7A 4OX9F 4LUBA 4J9RA 2HK3A 1NJWA 1GTHA 1JK9B 3CD7A 3T3FA 2PI4A 1PAEX 4F4WA 2ABYA 2WB1D 4F3QA 3E01B 3MFHA 2HWHA 1VGYA 2E9TA 1RE1B 1RBLA 4DX7A 1GT8A 3MECA 4RW9B 1S49A 4DSIA 1AFIA 3VAMA 2LXFA 3UFCX 3MTKA 4IDKA 4WF9Q 2BJ3A 4P2BA 2PDAA 3DOKB 1FWPA 5RUBA 2YNIB 2W2PP 2KO1A 2KFYA 1QSLA 2QJ3A 3AQPA 1QD1A 4EK2A 2VFTA 4RNNA 3J7YU 2HS3A 2HLTA 2IFXA 3AA9A 4Q2MA 2B4VA 2EKYA 2WRMA 2P9GA 4M5DB 4U8YA 3V6JA 2AYEA 2G1HA 2LQ8A 4J91A 4CP5A 3QLHA 5HQLA 5JVGQ 1JLGA 2CNKB 2HWTA 3FUYA 3HD2A 2VV5A 4JB8B 4USVA 1C0TA 4LREA 2RT3A 2DITA 2DY1A 2DHHA 1IR1A 4I2QA 2DGUA 4Q8EA 1M1HA 1KOOA 5LMNJ 2H5EA 2OUGA 2G4BA 1CJTA 2VPWB 1XMQF 5DJBA 4V194 1J5EF 4C98A 1FRJA 2HQCA 3SZ2A 4U96A 3MM8B 3UDVA 2QZ8A 2B4PA 2KDOA 4H4KC 1XWLA 2E66A 1M5VC 1N52B 3I9V9 1GX6A 2UXBJ 4RW7A 3VWSA 4KGKA 4HHUA 2BZ2A 2FLLA 4DCPB 3G8QA 3BBFA 2FDNA 1S7HA 4HLBA 4NZ6A 4K4SA 4ED7A 5GMDA 4WFBQ 3KHRA 3OW2R 1XMQJ 4ZHRB 1X8DA 3FRYA 4KT0C 2ZHAA 1YJUA 1TKXA 4DR1F 3W61A 1FERA 4M94A 1FJGF 1C0UB 1RADB 2D3ZA 2VPZB 4WFAS 3PYEA 4RW6A 2R8KA 2F40A 2VD3A 2HFVA 4DLEA 2HKEA 3DKDA 2PICA 2E7VA 4HACB 3MUTP 5U47A 4DCOB 1YZ7A 2ACMA 3TA2A 4ZHRA 3K57A 4DG1B 3KLGB 1UA0A 2ZNZA 1RHMB 1ZZNA 2ZC4A 4P73A 4HDHA 2F4FA 3QPIA 4MMOA 1TV6A 1VRUB 2VA2A 1TL3B 4IRDA 1IBCB 3EVWA 1NDKA 4RNHA 4XPEA 1S97A 4IFYB 3FRZA 4RLEA 2OH2A 3U7JA 4ZJQA 1RK8A 1NH7A 1EX8A 3NOCA 5E5NA 1DARA 2YBVA 3OSPA 4JV5F 5IT0A 2Z0GA 3GU0A 4URSA 1WI6A 3UQSA 2CJKA 3C6UB 4EBEA 1Q53A 4DR3F 2RKIB 2EKNA 2Z56B 1FD2A 2LU2A 3OTEA 1QSYA 3HVAA 4DX8H 2MQOA 3QLHB 3NS7B 3MM6A 2FHKA 1UEKA 3ZTRA 3FVYA 3H20A 1RT2B 4K4UA 1X5OA 1X7VA 4ECTA 1R8PA 3R9LA 4C11B 2HFNA 5KG3A 2RF2A 2JL9A 3R7SB 5FJ4A 4HTIA 5DETA 4TU7A 3CCVS 1PO6A 3CD5A 1FKAF 5HVGA 5J1PA 3LP2A 2R7RA 3JS9A 2NXCA 3W2WA 1I94J 4PUOA 1AROP 2BE2A 3BN7A 4ZIVA 2E9ZA 3MECB 3QRRA 2LA6A 1U8SA 4NMLA 2W9CB 2B8PA 1ZH5A 3MZIA 3TARA 3CJ3A 4K59A 4H54A 4PQAA 3RAXA 4OZ3A 3QJPA 2XS7A 1D1UA 2Q66A 1T3NA 2OP5A 2CRLA 4OJHA 1QAYA 4NMXA 3T5LA 1HD1A 5HAOA 1Y5NB 3SFUA 1W25A 5HLFA 2B7BB 5AJ3J 2FJXA 2C2RA 3GPAA 2MY7A 1Q5VA 1VJWA 4EEYA 1A6LA 3OTCA 1D6KA 4Y2CA 3M8QA 3TQ1A 4RNFA 1XR6A 4RUCA 4KV8A 3GLJA 4JYAF 3OL7A 2QMWA 3QNWB 1FJGJ 5B0EA 3FJ2A 4F02A 2R2TA 3HFKA 1UA1A 1C2PA 2R7UA 2H3EB 3IAM9 1XIQA 2RUGA 4OMFG 2L08A 3G71S 3RRGA 2XTJP 3FDSA 5J2NA 5F41A 2IVFB 2KM8C 3G2XA 1NKEA 2V8VA 2AX1A 1UJ5A 3C6TB 4ELUA 1TKZB 4PWWA 3TWZA 1FA0A 3G6VA 5J2NB 3KJVA 1WC3A 2RE1A 2ZOGA 3PJWA 1REGX 1FFWB 2MKKA 3OFGA 1C4AA 1SC1B 2PA3A 3QAEA 3IR6B 4I6YA 4Y28C 4DUZJ 3UD3P 2CDQA 2D1CA 2IRYA 3MR3A 2D9PA 1QUPA 2YTCA 1IQTA 3GJQB 3W65A 1FDDA 4DUYF 3I96A 2J0WA 2AMCB 2DRDA 1RZMA 1ZZFA 4YQWA 3BN4A 3OLAA 4IOAQ 2B43A 4DL7A 2ZJRQ 3M6XA 3KJFB 4URGA 2F63A 2Z8QA 3E8OA 3OL8A 2VG5B 3FKBA 4GKKF 2CQGA 3KLEA 3L3CA 1RDRA 5HMYA 2DH9A 3QT5A 2AEJA 1JLCA 1S6UA 2HQ3A 1EETB 4J9VA 4OV6A 4JXZA 4DFJA 2X1GA 2R7SA 4LF4F 2ZEJA 1FK9A 2G9OA 3PW7A 1KVJA 2VH7A 3KG0A 3ITHA 3LALA 1BXNA 3TVYA 4RU9A 3TW0A 2DCUB 2DKOB 4Q5VA 1HIYA 4ZLPA 5H1SV 2EG2A 4N56A 1ICEB 1RUSA 4KTQA 3G6YA 1VQ9S 3G6XA 3BQ0A 1FVSA 3FC9A 3PM9A 1CBKA 3RBZA 4XTTA 3MR5A 4ETXA 4DV6F 2NR0A 2B6AA 2V2ZA 3IO1A 1SKSA 2CVIA 2H4WB 2QFIA 1K73T 4ES3A 2DR8A 2VJUA 3HHLB 4UOFA 4W98A 1MMDA 2AX0A 2VG5A 5K5MA 2BX6A 2ZD1B 2XEXA 3DYAA 4DV4F 1MU2B 1IQZA 2NYHA 1RQ0A 3AQOA 1HQEB 2HHSA 3MCOA 1EP4A 1KVKA 3A4TA 3FK4A 3GCWP 4OLPA 2XGPA 1PYTA 2E5GA 1HL6A 4URQU 4CO3A 1G4CA 3ENQA 1CJUB 1SC4B 1KBRA 1XBWA 3OTDA 4UY88 2FHJD 2QMUB 1U45A 3H42A 5F8GA 2XY7A 1BC6A 2E5HA 3OT9A 4QCLA 2RQKA 4DV4J 2XMJA 2I6WA 2N3OA 3PYFA 1FFSB 4RPFA 4A47A 3D5MA 2EK1A 2AJ4A 1YIJS 3UVJA 1N5TA 1N4LA 3A3NB 2DT9A 1XJWB 1BQMB 4QPTA 3H7HB 3Q89A 3MR6A 4ECVA 2Y1JA 3NS6A 3QBCA 4TY8A 4YB1P 4FXDA 1KN6A 5T14A 4UY85 5B0CA 4JI7J 4KR0B 1IKWA 1QAJA 1S57A 1E6YA 1Y5LB 1H0HB 3OFHA 4A4JA 4C8LA 5EDWA 3B4DA 2J0QD 3FBBA 2UUAF 4U9RA 1MROA 2FJVA 2DGOA 2Z30B 4OZNA 3Q8RB 2R8IA 3CDWA 2AF6A 5IV4A 5LXYA 3PW4A 3P8BB 2N82B 4P72A 3JYTB 3C14A 3FQLA 3PX6A 2XMMA 3D28A 2Y1RI 2OPPA 2W2OP 4DQPA 4N8NA 5HROA 2UUBJ 2HBQB 3BR9A 2VODA 3ZZOA 4ZPVR 2K3KA 1U24A 1KDNA 3GE9A 3T6BA 3A1YG 1DLOB 3H4BA 2WBRA 3ET6B 1UWBB 3SQGB 1VQKS 1RWUA 1ZM2A 2CPEA 2QO3A 4L76A 4LRAA 5H9EK 1HQUB 1TL1A 4GKJF 3T1YJ 1OMSA 4DU7A 2ZWOA 3POTA 1AT1B 1UVLA 2YWEA 3QT6A 3J7ZV 3CCWA 1O5JA 1KR4A 1HWJA 3EXYA 4NEYA 3BPSP 4NLSA 2WBMA 4OFZA 3SDEA 1UEVA 3LF0A 4UZBA 1TMMA 3J81Y 1N33F 4I2QB 2C42A 2L9DA 3A8EA 3TZYA 2D9OA 1K44A 3LP0A 1CJVB 1YJRA 2DEIA 4CM0A 5KTQA 3B6BA 1G3OA 3FZ2A 4RX6A 1WOPA 1BUXA 3IRXB 3MPWA 3EXCX 4K2JA 5CYMA 4NXNF 2QYGA 3HT0A 2O66A 5DZ7A 4F0KA 2XI2A 3DLKB 3Q83A 4CT8A 2IJFA 1SJFA 2J6UA 2L48A 1N0UA 4U6PA 3JSMA 3OXGA 4CO5A 2RAQA 1KQFB 4LF5J 1TK0A 2QC3A 4WXOA 3D0GE 4MTPA 5IFMA 1O0BA 3MCNA 1VQMS 1VC6A 2GVDB 1VCTA 4M5NA 5KFJA 1VRTB 2E5LJ 1YBAA 3M2UA 3MD1A 3NG8A 4E8BA 3DGVA 2GQQA 4ZPCA 2QRRA 1S72S 1TL1B 1FE4A 1U1KA 3CEDA 1M90T 1IM4A 1FEUA 5G0RA 3GR0A 3GZ7A 3H5UA 5KFCA 2VQFJ 3W8PA 3DNCA 1Q7YT 1NEEA 3BREA 1O0CA 2UZAA 4F7VA 1G1XA 4AXJA 3LWMA 2PI5A 3RB0A 5HROB 2APOA 2BQRA 1FEEA 1T7PA 1EKSA 2M9KA 2UXCF 3C14B 3DDNA 4HACA 3F0NA 4ZPDA 3K5NA 4B3OA 1DBDA 1RT1A 4QIWD 1H7WA 3GFYA 4LR8A 4U7UK 5KG5A 2EC2A 1VIXA 1CG2A 3TNVA 2KT2A 3M4XA 4C3KA 3DMJA 2CQ4A 1U02A 4J9UE 4G6VB 1UFWA 4O44A 1RT6B 4ZA1A 4DV5J 1KWMA 2VKRA 3WHIA 3CT9A 1FXRA 4LRBA 4JV1A 4NYOA 4BWJA 2E1MC 3MM7B 4DR2J 3HSGA 4NXNJ 2C2NA 2HFZA 4OLOA 2G6GA 1G7CB 2AKWB 4MIAA 4P2FA 2J6SA 4AL7A 2XHCA 1S6QB 4RJVA 4NA2A 4USKA 1S6OA 2I5JB 2NWAA 3WBZA 4ZN1A 4ECQA 3M30A 1N33J 4KSEB 3HULA 3R6GB 4ECRA 4LF7J 3K5MA 1YITS 4AT1B 1F1BB 1WKLA 2OAUA 4W92B 1HNVA 3FZBA 1S6QA 3ZTQA 2VG7B 3GFXA 3GIMA 1PJ7A 1TL3A 2FZCB 1RBOB 5JJBA 3JSMB 3DLBA 3GTYX 2NQPA 3CC4S 4EWTA 1XN9A 4ZLLA 2BM1A 2BW2A 4O0NA 4FF2A 2OMLA 2HHUA 5A0YA 4UUWA 5ETSA 2MQNA 1P1TA 2E1AA 4EUVA 5CYMB 4S0MA 4GVBA 4PG5A 1OY9A 4RW8A 4ZPWR 5DQGA 3QRPA 2MKJA 3THTA 3MGJA 2KT5A 2VB6A 3M8PA 1N5SA 1TMJA 2Z58B 3RRKA 4IG3B 4A8OA 4Y34A 4BCAA 3Q86A 1RA7A 3KLIA 5FDLA 1AZSB 5KFFA 4X62F 2Z4PA 4CIOA 2CADA 3FEXB 8ATCB 4DR1J 4QWCA 1OPIA 1IKWB 2IHR1 2BQUA 3H4DA 3IN5A 1R8BA 2YNHB 1MN9A 3HFVA 3V4IA 4YP3A 4Q8FA 4ZVHA 3TZWA 1F2HA 1REVA 3BB5A 1FO1A 3CJSA 4P52A 3M9OB 2W2QP 4OX9J 2K3IA 2PN6A 2M3DA 5BYRA 2B9XA 4NA1A 3ZZUA 4EFAC 3MM8A 1JNRB 1NJYA 2CPYA 1U09A 2O3DA 5ETKA 5HO4A 2BJDA 4DQQA 2FYXA 4R5PA 1HNWJ 1K0TA 1RA6A 5EX0A 4EO8A 4FP9A 3L95X 5AE1A 3HSDA 2NXNA 4DHVA 4C7QA 5HBMB 4U7CA 1TL7A 3BGLA 3M9MB 4JI8F 2VDIA 1AUDA 1VOMA 4ED0A 1JLQA 4JI8J 5KFLA 2Z2LA 4C8NA 4B3SF 3AA8A 2MZTA 5H9EJ 2RDDA 3PCOB 3TR5A 2YKMB 1NBEB 4KAIA 2CG8A 1VHYA 2VZ9A 4ECUA 1X4CA 1TKZA 4P71A 5A8KB 5KFHA 2FVRA 1NPKA 1HI0P 3ICLA 2EFOA 1PJ6A 4MK7A 2IA0A 2QYCA 1T94A 3GQCA 1CJKA 1IJFB 1N54B 2ROPA 4J9KA 5SUHA 1HBUA 4QWAA 3LOUA 5CD4H 2HHWA 4M5GA 1RTDB 2NREA 4GMKA 3OHAA 1HBNB 2R9LA 4AD6A 4RO0A 2R7TA 1OO0B 4X4NA 4F26A 2B4UA 2XB2D 5DLFA 3X1LB 1U1OA 2E5IA 4WFAQ 4B9VA 1PKUA 3US5A 4C8MA 3LAMA 3HXMA 5GAEI 1NB7A 2P6SA 1DLOA 2Q3PA 3GYNA 1O8BA 4FYYB 1L3TA 5I4MA 2DBBA 1B0VA 3H5SA 4XIUA 4RBUA 2NXUA 2DXDA 1NK0A 4TQSA 5D8HB 2FHOB 1YJTA 2HQIA 1JLAA 2NXJA 1YX2A 3PVXA 3PW0A 3RW7A 3JTNA 2X1BA 4C2MA 1HA1A 2JC0A 2RH3A 3IGVA 3N5FA 1LWEB 3MUVP 2YNHA 2I0XA 1RTDA 2UUWA 3AOCA 1LFWA 5D0EA 2IA6A 4B08A 4K4ZA 3BDEA 1YRUA 4A8KA 5EWFA 4ZVFA 1FNXH 5HANA 2XZTB 3DXSX 3CZBA 3KLIB 2MXYA 2W8LA 2XSJB 1BQMA 1VQ7S 1SIZA 1B7YB 1TKTB 3W7BA 4BLGA 3J7ZT 2YNGA 4K2XA 1E6VA 3TA1A 1X4HA 1UP1A 2CJ9A 4F0MA 1KHWA 3LANA 4FZVA 4LQ3A 5LT5A 3SCLE 1WF2A 3ISND 1OSDA 1T9XA 3H8YA 3D7SB 2W25A 3RAQA 2NUUG 1QVGR 1OQ3A 1HKAA 1T9UA 2HZAA 1D3WA 4NLDA 4OYWA 4C3MA 4CLWA 2ZH9A 5LMUJ 5JVHS 2LDYA 3ILIA 2V4JA 1Q78A 1EHWA 2ERRA 4OYZA 1WOOA 4UUXA 4D3GA 4IRKA 1U47A 3CMQA 3NOGA 2BVZA 3OVBA 4JYAJ 4ZP6A 4BC7A 1ZM4A 2F65A 3BO3A 4QWEA 4W90B 2POKA 2BABA 1P6TA 3SV3A 2DNHA 2P8IA 1WC5A 1X4DA 4WCES 1X4EA 2IC3A 2KJVA 1XQIA 2K7KA 1BWEA 2CQCA 3GYXB 2DO4A 1JQGA 3S8SA 1CPZA 1Q4RA 4Y2AA 1IWGA 4QYRA 5CAAA 5FLXY 3QFWA 5KFXA 4DL4A 4E0DA 6FD1A 4KGXB 2G2YA 4LRCA 2HRTA 4MT1A 3I0RB 4G1QA 2NCKL 4PWUA 5LJ3Y 1VI7A 4YHHJ 2RHSB 4J9OA 2GHWA 1HD0A 3FQKA 2UV8G 2VBYA 4IYQA 2BE2B 1S6PB 3MEDA 1QTNB 1UCNA 3G82A 1RKIA 2RS2A 1N88A 2WAQD 3JSRA 1S1WB 3UDEA 2EFGA 3EVMA 1K1SA 3ZZTA 3EJMA 2OELA 1YTYA 4JI4F 1RT7A 2HSEB 3QATA 3V81A 2CZVC 1HNIB 1NZ8A 4ED2A 2LU1A 2MB0B 1FJ7A 3CCES 2OPQA 2XG8A 4H4OA 2ZH3A 2RMLA 4DLGA 4PQUB 1HBMA 4WZQA 2HS4A 1R0BG 3R8YA 4X66J 4X84A 2KZZA 1VFJA 1W26A 2DGVA 4Z7YA 3ZXWA 1LW0B 4LSLA 4B3RJ 3BO2A 2HBRB 3M8RA 2P9EA 1N56A 5DDQC 1WACA 3H5XA 2Z0YA 1JX4A 1ZAXA 2VBZA 1R6VA 5GAEW 4FPIA 2GIQA 1ZJWA 4YFUA 3VAIA 2DTJA 2K1RA 3AD7C 2VASA 3NGDA 3OJSA 1R7IA 4CZCA 5HK4A 1LFPA 2RILA 5IQQA 2KH9A 4G3IA 2KFNA 2ZZMA 3C66A 1MWQA 2CXEA 2DCLA 2WONA 5C25B 2D7SA 2MZSA 2ZFHA 2KXNB 3V6DA 1HBMB 1PSDA 1FD8A 4C11A 1IBMF 1H3DA 1UAWA 1VBYA 2BRLA 2BJ7A 4WFBS 1WSVA 2MSSA 3SMZA 2W7OA 1NK7A 1EKRA 2LVWA 2MQ8A 5E3QA 1HBOB 4M5HA 4DPOA 2B9YA 1QRSA 2JDJA 3AJ2A 3D4JA 1WC1A 2JHEA 2HIYA 5KFUA 2EPIA 1MMLA 4MK8A 5T7LB 3KJVB 3R1HA 4QIVA 4FDFA 2MQQA 1TKXB 4J9PA 1NK9A 8AT1B 1QRTA 2HHXA 2UUAJ 1F5AA 5GAGU 4K4VA 3BYPA 3ZZZA 2LEAA 2LCWA 1YI2S 3ZTPA 3QJJA 4DSLA 4DR6F 5DDOC 1RT4A 3QIDA 3MPDA 1N6QB 1SKWA 4B3TJ 4NYPA 4DQRA 2OPSA 1EIYB 4LJMA 1SXLA 2CPZA 3MM5B 3D3BJ 1T9VA 1U6FA 1FRKA 1FRMA 2F9DA 2PMWA 4RR5A 5GADW 5KFQA 4X66F 1NHVA 1PYSB 2I9SA 3A3PB 1DQ8A 2FC9A 2GHVC 3UE2A 3TZZA 3DGPA 1BLUA 4I67A 4L73A 1BE4A 4WZMA 1OWXA 4CLLA 5KFTA 1LWXA 2MTLA 2ZJPQ 1HWLA 1WEZA 5LMNF 1HNZF 1JWWA 2JFDA 1FDBA 1U8WA 2GCFA 3IFEA 3HKWA 2UXDJ 2UVVA 1LXNA 3AFGA 3VGVA 3N9UC 3TJAA 1R8CA 3EGVA 1HHQA 3W5XA 1S79A 3G86A 1ZTTA 2A10A 1RB0A 4F4KA 2KB2A 2ZJQS 3LTOA 3PDNA 4OJ1A 2DGTA 1HARA 2QLWA 4WYWA 2V67A 3AD8C 4FKXA 1M5OC 2RS8A 1M5PC 1IR2A 4DR6J 4KH0B 3FGVA 2W4PA 4L3KA 2B3TB 4L72B 2WSFC 3DRRB 1B75A 4I68A 5K8OA 2ATLA 2N7YA 5E7OB 1DAXA 1EARA 2GMHA 1X31C 2JLFA 1UZDA 4WK3A 3PYGA 3S6EA 4YDDB 4BC9A 4HYKA 2XY5A 2J9EA 3BPDA 3EWGA 4MKVA 1HW8A 4RKUC 1S1UB 4TKTA 3T5KA 2GAEA 2XLKA 5LMUF 4H4KA 3MXHP 1NZAA 3JTPA 2HW3A 2CJAA 2ZITA 2PEBA 3SI8A 1FRIA 1HWKA 2XMVA 1RWPB 3KFWX 4HHJA 4AFFA 3C3LA 3HHLD 2COLA 1T03B 2CQDA 2B9WA 4DPUA 4OHWA 5DG8A 2W9BB 4B17A 2V5HG 3MHYA 4USTA 5LXRA 3TRGA 3MEKA 3JAMU 3KYLA 3KHGA 4FVMA 3ZZRA 4F36A 2HPUA 3PG9A 3I87A 4DUYJ 1FWLA 4HH0A 3JAMY 2OTLS 2LKZA 3DXBA 1FNOA 2V69A 2ZC3A 4O4RA 1I5OB 1UW4A 3G8TA 1NK6A 2J9CA 4F04B 3I31A 2HHPA 2IM2A 2NSCA 3B82A 4M5JA 5C7PA 3NWRA 2HURA 1SPBP 3MM9A 3NGUA 2W9CA 3SFGA 3V6KA 3BSAA 4DV7F 2WW4A 3A8JA 3J7YI 4OHZA 2KKHA 3KLFB 4IUFA 1O51A 2AEFA 3J81U 3DFEA 5BR8F 2XCPA 3LQVA 4J37A 4DQSA 3VZIA 3KK2A 4F4XA 5MLCV 5DM6Q 2BJ8A 4ED4A 2OO4A 2HNDB 4WFYA 3KK1A 3RRHA 3ZTSA 2FY1A 4ZITA 2QLFB 5BNZA 4C8KA 2K06A 4EBDA 1A9NB 2ILYA 1MG7A 2LMIA 3OTOF 1WTBA 1WEYA 4PEOA 1B70B 4LF1A 5G4DA 2DISA 4KFBA 5EGYA 2N4DA 4HH1A 2HZ7A 2DNGA 4J9NA 2ZBIA 4DR7J 4QR0A 1T0TV 2XHWA 4TN2A 4QBUA 2ASJA 2GGPB 1RAJA 3DU6A 4DPTA 3R5JB 5IZNA 5LSLA 2QLBB 4L69A 2JC1A 2BA9A 3LPEA 5F3ZA 4YY3F 3BGOP 2IM3A 2W2NP 1JJ2R 2Y3YA 4FNIA 5L39A 2MQLA 3GG1A 1QY7A 2YWKA 2R2UA 1BQNA 4B02A 1GEHA 1TELA 4OHYA 2HLUA 1TAQA 3MEEB 4RWXA 2QA4S 3MM7A 2KN4A 4DR4J 3DLHA 2CPHA 3HHLC 1Q8BA 2CNOB 2JRSA 2FLOA 1HNIA 3W2WB 4OYMA 2BXJA 5GAEU 1SJRA 4DXLA 1P9QC 3P4UB 3BO4A 1VQ8S 1OIAA 1TL5A 3C16B 3NAHA 2H51B 5GAGI 1SJQA 3M9NB 4B3OB 2W1BA 4Z7CA 1FESA 3L4BC 4ES1A 5KFOA 1FKOA 2DGWA 2RF2B 1JLAB 1X5SA 3EZOA 3W63A 3GB0A 1UVNA 2G13A 3KNAA 3Q2TC 3DGPB 2MHEA 4QJVA 3TUIC 2WSEC 4DSFA 1NK5A 4U67S 1ZS6A 2FQQB 4FBTA 1WD6A 4IFVA 2RKIA 3ZZ0A 1Q8LA 1N8RT 2XWXA 3RR8A 5B0GA 4N47A 3D6HB 4JOUA 4CLTA 3TZXA 2PT0A 3OVSA 4Y2MA 3QFHA 3RB4A 3QMQA 2I2YA 1WJ9A 2PNWA 2AHOB 2GVZB 3IBCB 4OJ3A 4C48A 1UFKA 5MAOA 3UCZP 5EWGA 2Y9HA 3J7AN 4RBVA 4ILLA 4TLQA 1B99A 3LP2B 2IYGA 1C0TB 2V8HA 2O67A 3WC0A 5IT4A 2XGQA 1X0FA 3K0JA 4GKJJ 3LPYA 2FHMA 4DL2A 2MMYA 4OZJA 3E3XA 5KFEA 4ZLNA 1S9EB 4OHXA 3PX0A 1O0PA 5IWAF 3PR5B 2MY8A 4PPDA 1R0AA 3KTQA 1PCAA 1TVRB 1C4CA 4Z37A 3PFOA 4DL0C 1LK5A 1NHKL 1P9YA 2F8MA 5KT2A 2XSJA 4AE5A 4Y0FA 2IYIA 3EYZA 1U1RA 4OL8A 3D6TB 4OYOA 3M32B 2GZOA 1ZETA 4U7UD 1U4BA 2FTRA 3CIMA 4NLPA 3I4PA 1S6PA 3MEDB 1UPPA 3R6LB 2XMWA 2O01C 2MKHA 2YKOA 2A2CA 2M2BA 2A1BA 4KRWA 5L8RC 4BBYA 4UOGA 2EFPA 3N28A 1F60B 2LEBA 1DJ0A 3LAKA 3E01A 1HHSA 2I5JA 3PX4A 2JEJA 4A8XA 3CC2S 2QX0A 1DRZA 1CVJA 1WHYA 4IOCS 5G0RB 2V4QA 4B3RF 1OPZA 3MM5A 5DDPC 3IMQJ 1GNKA 1RWVB 3NNCA 2QLXA 1UW9A 2WK4A 4PR6A 5C42B 4JI1J 2E9RX 3QAUA 2JEGA 3AOAA 2MJUA 1FT8A 4MKBA 2MKIA 2VOOA 2BEFA 2IY5B 5C2GA 2J9DE 4MFBA 2G0IA 1QAIA 3MOZA 5KG1A 4IQXA 5LM7E 1T05A 3HCXA 5ETPA 3V81B 4DSKA 1VQNS 3TUJC 2VFUA 1KFSA 2QG9B 1ZAVA 4P75A 4RWWA 2D3O1 1JMTA 1R6YA 1CC8A 2UVWA 4KGMA 3HVTB 2IJRA 2LECA 2ROGA 4PXDA 4ZP9A 4FF3A 3T6JA 1VR6A 5M2PA 1GFWB 1VYAA 2MLYA 2VBXA 3HI9A 3MAAB 3A3OB 1Q82T 3IRXA 4IO9Q 3CCZA 1WI8A 1NPRA 3C15B 3JQKA 1CJVA 1UTAA 4AL6A 4KJIA 1X4BA 3NXZA 1R8HA 1NXZA 4ETZA 3NGRA 1HNXJ 1WELA 3IS9A 2BUNA 4YOEA 4I64A 2K7JA 1PAUB 2FGCA 2HNZA 4ZVPB 4EU0A 4NWBA 3BGRB 2ZH5A 2B51A 4R8UB 4GO5X 4GC6A 1WNEA 4B9TA 3WC2A 1LWEA 4OYXA 1ZPVA 4Y3CA 4O3NA 3QGPA 3U02A 4DL5A 4LFCF 2XYHB 1WUUA 1ZM9A 1GTEA 1HWUA 1VQOS 4LSNB 3CJKA 5HBMA 1UFLA 2F5GA 1F3VA 2NYIA 4PPZA 3THVA 1RU1A 3DLKA 3QGIA 4C0BA 1J5OA 1QSSA 3TJ8A 3GFZA 3CCQS 5L1JA 3AD9C 5HMZA 4N41A 3MFIA 1HW9A 2YX1A 3W64A 1AFJA 4X64J 3W9HA 1VQ6S 2ADCA 1IKVB 4ATNA 1FF2A 2IJNA 4L3NA 1SL1A 2DXEA 3RJMB 3CJ4A 2DNLA 1NK8A 3G8SA 1HR0J 3KW2A 4CWBA 5KFKA 3B78A 2J8SA 4E8UA 2R7WA 1U6BA 3DCAA 4L6V3 1S9GB 3MM9B 4LRFA 4DUZF 4DL3A 2HG4A 1ZTWA 3OL6A 1IBLJ 3EUNA 2KL8A 3QZ7A 2DHXA 4ZJOA 3B4MA 3ITHB 1CJKB 1CSJA 1NB2A 2QIFA 1J27A 3CJ8A 1MLAA 4JBCA 3IGNA 5HQMA 2DJWA 3QZ8A 2M5YA 3FSIA 4UY8T 3L9ZA 1G2EA 1LXJA 3EZ5A 3M2RA 4K4TA 4RUHA 4LVOP 4PG6A 4UZCA 5E2QA 1H38A 4YY3J 3HP6A 3T19A 1Q86T 5A0YB 4QU7A 2LQ9A 4WFNS 2B8QA 2G1DA 3JQMA 4B3MJ 1FKPB 3BBBA 2C2EA 3DI6B 1LV5A 2L41A 2N7CA 2G5DA 1HFEL 4ECWA 1JB0C 5IV3A 4F0HA 5EWEA 2JWNA 3F41A 1YQHA 1JJHA 2WCXA 4X4TA 4KGVB 3OSNA 2G0JA 3QYYA 4ZVTB 5B7WA 1UJ4A 4R5PB 2KVIA 2AZ3A 2VFSA 3K89A 2UV8A 2MDAA 4O23A 4DZ6A 1F9HA 2E29A 3MAQA 4K0KF 1B0PA 1RACB 2XCAA 2HHHF 2LQJA 2P6TA 2IDLA 3WIVA 5B09A 3M8WA 1APSA 4C8ZA 4CYUB 3FNNA 3BV8A 4LT6A 1F0XA 4GC7A 4FYVB 1J2VA 2ZDPA 1RHUB 1LK7A 2G0CA 4HT5A 4O44B 1Z1ZA 3MMCA 4LFAJ 2XZWA 4QIGA 2HEKA 1FEHA 1V5VA 4OIXA 4DU8A 5HP1A 1VQ5S 4IR9A 3OV7A 4WTYA 3I9ZA 3TP2A 2VC0A 4EMDA 4KYZA 3UI3A 4NL5A 3KLHB 1IVZA 3HD1A 2ALZA 2UVUA 1HQEA 3MAHA 3DDIA 1M5HA 1VJQA 2QV6A 4NCBA 2FZGB 2RNEA 2P2CB 1NM2A 1UWAA 5GMKa 3CF5Q 2C3OA 3RR7A 4ED5A 3KK3B 1XEZA 3CJ2A 3Q8VA 1S1UA 1CLFA 3H0PA 1NAQA 2VC1A 2VG7A 1MROB 3N4WA 5DG9A 3BKTA 3R5GA 3TO8A 4WFNQ 3LGHA 4NLWA 1NNDA 1U26A 2RB7A 2HYIB 3MMCB 7FDRA 1AA1B 1NSKL 4MAKA 1JLEA 1T9WA 3D68A 4KQZA 1ZOTA 4NLUA 4UW2A 3K8VA 5D4OA 5IXUA 5IM0B 3EGZA 1UVJA 2CAJA 1QM9A 1KFDA 2AQ4A 2PFFB 3EM1A 3GP9A 5K8PA 4PG7A 2VICA 4Y2IA 4WTOB 1V5IB 1CQMA 3C6TA 1U1PA 1LNQA 2R8JA 1QVFR 2KU7A 3NEKA 4IO1A 2JNJA 4MKAA 4HR2A 2DRAA 4ANCA 1NO8A 1N32J 3AOBA 3OVAA 1S76D 2QA1A 4ZVGA 5LOQA 4J9LA 2YKAA 2HMIA 2QL7B 4LF2A 1SVDA 4DV2J 3NCRA 1SKUB 3PTWA 2B7CB 4I1TA 2XM3A 2JVRA 2OI2A 3BSCA 3HM9A 5ETVA 4IG0B 5ETNA 2E5LF 1QRUA 4OYBA 2RQMA 1ZA2B 2AJ1A 4WP8A 5EN1A 3P3DA 1GXTA 5AT1B 1XNQJ 3VALA 2IBOA 4HTJA 1R3NA 2GMJA 3LP1A 4DPXA 4LF6J 2V9WA 4AL5A 2OSRA 2ZDOA 5IS2A 4M5IA 1S5ZA 1D09B 3QRQA 3VZHA 3W8GA 3VAJA 2R4FA 1Y5IB 2ALYB 3VQTA 2LP4A 1Z2LA 2HHHJ 1LEOA 4IFVB 4YMEA 3EGWB 3V4IB 1FCAA 1N36J 3PXGa 1IN0A 1GMVA 2IRXA 2I38A 4KC5A 4UF4A 5BXIA 4A8QA 1KC8T 2M7SA 2QSWA 2OIHA 1B0TA 3JXOA 3DLGB 2R7QA 2CJYB 3W1YC 5F8MA 4USUA 2JX2A 4ZDNA 1VIOA 3GJRB 4PKDB 5DQHA 2X1FA 4YDXA 3CXCR 1V3RA 2UUCJ 2IM0A 2OFGX 2UXCJ 1D9AA 3M8QB 4ER8A 1Q81T 1T02A 5GAHU 4MYTA 4H4MB 2DHSA 2X7IA 4NLQA 5HVHA 1OS5A 3K58A 4J9MA 2F4VF 1KVIA 5AJ3F 2CQPA 4B9LA 3SCKE 3H90A 1IBMJ 2IVYA 2DGQA 2Y8WA 4OI1A 5C24B 3EMTA 5C25A 2HNYA 3KMSA 3NNAA 2XI3A 1Y11A 3LP0B 5KFSA 3RBEA 2ZM6F 3Q22A 1VISA 1WG5A 2BKNA 3T1AA 3GSDA 4ZMMA 3HJFA 2QT7A 3W9IA 1VQSA 2V0NA 3M2UB 2K1RB 3IR5B 4ELTA 4C3LA 2VA3A 4O3RA 2CQBA 1TUVA 5E41A 1RT3A 3NGTA 1IJEB 3OR1A 3UD4P 2KHCA 4WP9A 3K5PA 1SL0A 3VCDA 4MYUA 2OEKA 2H5IB 4OI4A 1KONA 2KZMA 5H9FJ 2YPZA 2DR5A 3ELHA 3MEGA 1JLGB 1R27B 3SQGA 4EYIB 1S10A 4HHHA 3PHEA 2VL1A 3OHBA 2VHGA 2XS2A 1Y3KA 2MKYA 4PZVA 4ERDA 2GJ2A 2CPDA 4ZP7A 1OSCA 1Q7LB 1XK8A 5C2CA 3F44A 1VC0A 4JI2J 3H2LA 3KK2B 2LFVA 4CM2A 1U1QA 1RAEB 4LBPA 3QGHA 4RW4A 1WORA 2G2OA 2MEWA 3NCQA 1KRPA 2AGQA 2AGOA 2VU5A 4N76A 1RP5A 3G82B 4U67Q 1ZA1B 1FTRA 3P96A 3PY8A 1S0VA 2W4DA 4ANDA 1JNZB 4ZN3A 5IM0A 1YBTA 3L7OA 1GX5A 2V63A 1XR5A 2XZDB 4I0WA 3CCLS 2YPYA 5K8NA 4DF4A 2DO0A 4UT4A 2GA7A 5C42A 1HPZA 1BQNB 1N5QA 2RSQA 2GC8A 4KGZB 2OD6A 1M5SA 1T9TA 2CQ2A 2I1RA 4X4PA 5F8NA 4PG4A 4PCQA 1UL3A 4I2PA 2R8GA 3TVZA 2AYMA 4F4YA 2MZQA 2V50A 1I6JA 3HK2A 4DFMA 4PUOB 1DZ5A 2J8AA 3H59A 3SCJE 3MURP 3E51A 4F4AA 2HS0A 2W9AA 3NWGA 4XDDA 1N5YA 4N77A 1SIWB 2IRUA 3MF5A 5HP1B 4LVNP 1EP4B 1HBOA 2GAHC 3IP0A 2GIRA 2ZVIA 4NCAA 3LO3A 5LJ5Y 1E6YB 1XERA 5DLGA 2ASDA 3LW5C 1X9MA 2CFXA 3DC2A 5KT5A 3DRSB 3QWUA 2UP1A 4J3CA 2ILZA 4KHMA 5E0OA 4GO7X 2YNIA 1JJCB 1FX4A 1Z85A 4NPOA 5JUMA 1K9MT 3VAHA 2EC0A 1S12A 3IR7B 1YZ6A 2AP6A 2NPIA 3BYRA 1Q8KA 3KJQB 5A2QU 1J5EJ 3IC1A 5HVFA 1TP7A 4B9NA 1H98A 1FE0A 4QWDA 5KT7A 1XNQF 3EPGA 3IWNC 3KUGA 2JJ4D 4UQGA 1N36F 5DO2A 1LKZA 2AJ0A 1AB8A 3GV5B 4BS2A 1VLOA 3O2IA 3P5BP 4UOCA 4DZDA 1JLQB 3SYZA 4ILRA 3C19A 3D6FB 2HVDA 2OJ3A 1B4SA 4OZLA 4ED1A 3GCXP 4DI6A 1RI7A 4NASA 2XO7A 1LW0A 4PWDA 2JOQA 1BWVA 2BACA 3GV8B 1FJCA 1GXUA 3BQ2A 1G6BA 3TAMB 1T03A 4JI2F 1MU2A 1NDLA 3DLLS 1ZPWX 3NAIA 4KH1B 3M6UA 3WQPA 1R0CB 1H2TZ 3HZEA 3KHHA 2GX8A 3F73A 2E1CA 3UN2A 2I8EA 1SQFA 2U2FA 2D74B 4ECYA 1X4FA 2BKPA 5A76A 4AXIA 2DR7A 4IDKB 1GAOA 3SQOP 2KG0A 3TANA 4IRCA 2HAFA 1VQ4S 3O5TB 4OX6A 4FBUA 2HQFA 3PKMA 1RCXB 2DPJA 2UUTA 1U6ZA 4WKYA 1Y4ZB 1P8GA 2IM1A 3LGMA 5KFAA 1YJ9S 2MLXA 2XC9A 3CE8A 4FYDA 2XLIA 4MIBA 3EPIA 2LDIA 4NRUA 1C1BB 3U1LA 3RAMA 2ZM6J 4ALZA 3OXLA 3AXKA 4CH1A 3NL0A 5I42B 3CDAA 2FC8A 3Q0AA 4GKKJ 2XMUA 1DURA 2EK6A 4QIFA 1FX2A 1X9SA 1Q16B 2ZKUA 3D0IE 3K8WA 4AYBD 4DEZA 1J5OB 4OI3A 2HZCA 4NYZA 5L9XA 2C3PA 2H9ZA 2R2SA 5KOWA 4CI0B 4NI2A 2RU3A 2D3OR 2IMOA 5THWA 4CTAA 1KSPA 3D1HA 1S1TA 2GO9A 2OPRB 4ZVUB 2F8EX 1U0HB 5I3UA 4ITSA 3HMJG 2QA4G 2LQBA 4M63A 2ADBA 4O3QA 1URRA 4FS1A 3PRDA 4WIQA 2CPIA 3CD0A 4Q0BB 3FEZA 3CO9A 3QQCD 1YLXA 2PMHA 1S0OA 2UVRA 2BJ1A 4I7FA 5M2RA 3TUZC 5HMWA 5I42A 4USWA 4WF9S 3BF4A 2V8DA 3NGSA 4FXWA 4DX6A 1KEKA 3V4MA 1XMOF 4C8YA 1LOUA 3C8YA 3HKZD 2OPSB 4X65F 4NXMJ 1NJZA 4R0EA 4WU3A 3PZPA 4EZ9A 3R3TA 3MOJB 2DR6A 4H4OB 4HDGA 2HGMA 3UR0A 1NJXA 3CC7S 4BDPA 3HO1A 2Q6BA 2HHTA 2AW0A 3ZZPA 3AB2B 2YNFB 2BBEA 4CRJA 4DN9A 5B08A 2X1AA 4OV1A 2W01A 1VC5A 1AZSA 2ZOMA 2FVPA 2FLNA 5KG2A 4RW4B 5ETRA 5DM7S 1JLCB 2W24A 2HHVA 3SSSA 2J9DA 1YRXA 4NRTA 2UU9J 4O3PA 1PBAA 3DLGA 3RZAA 1BD6A 3R1LA 3HT3A 3BH7B 1SBRA 3HX9A 4OHVA 3GIKA 2Y1IA 2BQ3A 2RUSA 5HN0A 5DS7A 5HL7Q 4NLGA 3J80Y 1QLNA 2CA9A 4PWDB 1JKHA 2YVSA 1PJ5A 2ZH4A 2AJ2A 3UPFA 4PABA 4DL6A 2YWGA 1IUJA 3MMJA 4O3OA 4ID5A 1NJIT 3BDPA 3Q8QB 1FXLA 2GHPA 5KG6A 2PO4A 1WC6A 2HNZB 1CJTB 1RWNB 3CIZA 5I3PA 5A6PA 4J9SA 1EQMA 3GILA 4ZOSA 1UVIA 1GQEA 5D3GB 1EUQA 3M32A 4ZPBA 1UJ6A 2GJFA 2HWIA 1JLBA 1S1TB 4QR2A 3N79A 4IH6A 3GYGA 4TYAA 1LWFA 3K5OA 4UOHA 1YJWS 4LQ9A 4A8WA 2YWHA 4MIWA 1FFGB 1GTRA 1DQAA 1R0AB 2B0GA 4NCGB 2H1YA 1KKHA 3PIPS 1F2GA 4DG1A 3M8ZA 1NSQA 4DPYA 1X4GA 4USMA 1TL4A 2ZH8A 2R7VA 1RT7B 2OTJS 2PGCA 3UCGA 4ZP8A 5D77A 1CULB 1RTHB 4O4GA 2DNYA 2KFZA 4MFBB 1S1XA 4HVZA 4RW9A 5K14B 3VQSA 1WG4A 4K4YA 2MJNA 3IWLA 2XLJA 3GFHA 1V6ZA 2VPYB 3M2VB 5KG7A 5BJRA 4YHHF 3TAQA 3KKFA 3G9CA 2KVQE 2V8GA 2H65B 3T1YF 2X51A 1AYEA 1YGYA 5GADI 2MZJA 3HSJA 5GAGW 1Q1KA 3R27A 2HNYB 1TV6B 1VRUA 2JLEA 3CF5S 3LA0A 3O44A 3D66A 3IAS9 2V2QA 2FVCA 2IAJB 3B8HA 4I4BA 3X3UA 3QSYB 1SL2A 1U49A 1XNRF 4YN3B 2F4VJ 4K0KJ 4QR1A 3LP1B 3FEYB 2WSCC 1RCOB 2XNRA 2JSXA 2RVJA 4A8MP 3AH6A 3B54A 2LEPA 3CJQA 4CT9A 2C2DA 4F2RA 2KRBA 2BANB 5KG0A 4CLFA 3KLHA 5FDLB 5KFVA 3HPOA 3H98A 1S1WA 3OLBA 4MJKA 1H6KX 1KS2A 1NPPA 4DJBA 3G96A 4QYZJ 4Y00A 2WVFA 2XS5A 3AIIA 1TVRA 2GO8A 1YJNS 5IT9U 1N34J 1U2CA 4ILMA 2XMTA 2AJFE 4PYAA 1YWXA 2QLJB 4X65J 3CMES 4NXMF 2UXBF 4WFZA 3IM9A 2CQIA 1RHRB 3GWCA 4TVAB 1JLBB 3UD5A 5KG4A 4ZCIA 3IA0A 5KFNA 1NXIA 2Y0SD 4JI4J 1OY6A 8RUCA 3PW5A 2IPOB 4IOBA 2H5JB 1ZBTA 2DIUA 2Z57B 4EYHB 2O1PA 2R7OA 1UPMB 4IFYA 4V19X 4OI6A 1A0OB 1VDHA 4C97A 3HZGA 1Y7PA 3N0VA 1WHWA 4CTAB 3I0SA 2J0SD 1FKPA 5E3AA 3ZNJ1 4WCEQ 3NS5A 1H7XA 1HMVB 1N32F 1T9YA 3IG1A 2HHQA 1VS3A 1KQGB 3UR3C 2HFOA 7AT1B 1YDLA 2KG1A 2RQ4A 4P2XA 1VBKA 4HEA9 3HHLA 2RRBA 3RB3A 1OJ4A 2XNQA 3M2RB 1SUQB 4NLOA 5J2MA 2B56A 2GFFA 4OI2A 4NLYA 3M8YA 3TQEA 2ZBRA 4OZ0A 2A2DA 1QTMA 4LFCJ 3AAWB 4KPCA 2PC6A 4QWBA 1ULRA 3R5AA 1OQ6A 1GXLA 2DB1A 2BE9B 4JI0F 9RUBA 3VHQA 2BKOA 3MPYA 3T41A 3MR7A 4PXBA 4K50A 3DRPA 1L3UA 2DNNA 4PG8A 1FK9B 4V1Ak 1HNXF 5L38A 3A13A 1S0NA 2ZBPA 1RWMB 2FZKB 1BGXT 4I7FB 2B4OA 3TYTA 3ISNC 1RT5A 1PIEA 2F9JA 3H2VE 4HI2A 1ACMB 4F3MA 1S0MA 3J7Z5 1SQEA 2VQEF 1BHNA 2DNQA 2PE8A 2XSFA 3TAMA 4ZPTR 2RQCA 3KXDA 3UCUP 2BOPA 3CJKB 1HLWA 1Y00A 2ZVSA 4B3SJ 1CJUA 3JQJA 5L9NA 1PC4A 4DV0F 2OPRA 3UNYA 3SSQA 1TL7B 4NLRA 2HVHA 2PI8A 5L1IA 1U1LA 4ED8A 1RAGB 3NBPB 5J2QB 2DNKA 2WVEA 3VAGA 5F3TA 2ZWPA 5FLXU 1RGVA 2E7XA 1I51B 2Z2MA 1HBUB 4DF8A 3W9JA 2PA8D 4Y6IA 5KT4A 3HF5A 3ZFVA 4XAKA 3QGGA 3PACA 2JLGA 2C22A 1REVB 2ZBCA 5BYSA 1AUSL 1S48A 2B6AB 2O5DA 3R5CA 3NLCA 1C1BA 2M8HA 3ILJA 4M8LA 5A8KA 1ZAWA 2HIQA 5F9LA 2XQCA 2HVEA 4U8VA 4JI5J 1Z4UA 3J7A1 2CIMA 1UVMA 4USIA 4HKQA 3MWBA 2KYXA 3DOLA 1KLMA 3POTB 3AJ1A 1DTQA 1NUEA 2MZRA 5KFPA 3MI7X 4O0IA 4DDFA 4TY9A 2ZE2B 2MQPA 5HJYA 2QEXS 3P6YC 5FD1A 1FRLA 5L46A 3PV8A 1C1CA 1UEUA 3PNIA 4LF9F 1HI1A 1RAHB 2WW8A 3OTBA 3FMBA 4ZVOB 3CPWR 3ZC4A 3GIIA 1MSWD 1T3OA 2BJEA 3CDUA 3FBCA 3RB6A 1HHTP 2IMWP 5HSPA 3I0SB 5HJXA 2ASLA 2EW9A 4YR0A 2ZUGA 1WKJA 4JUZA 2C3UA 1U0SA 1CS4B 1WTFA 2C2MB 2EXUA 3Q8UA 4NE9C 4H3SA 2RE8A 3HDSA 3D54A 4ZVQB 1IKXA 1N5VA 2CQ3A 3BS9A 1U7LA 2PIIA 1YRTA 4I69A 4RBTA 5D0RA 2DNMA 4M5LA 3TA0A 3W5YA 1CC7A 1D9DA 3ONQA 1CULA 1H73A 2ZBQA 3TJ9A 4CYUA 3VAFA 2YKQA 1Q95G 3L7PA 2MSTA 3JB9k 2V2KA 4CLPA 2FIUA 4QZVB 3T9NA 2QN6B 1IKVA 5BYQA 1DHMA 1EQ0A 1NMEB 3DLJA 4K7QA 4TNOA 4D3HA 3T1HJ 3D9BA 1TK8A 3FCHA 2WOMA 4PYDA 5K9FA 4ZVRB 4NLXA 1RLCL 2KXFA 1WOSA 3L09A 1KHVA 4K8RA 1WEXA 3U1MA 3ZNUA 1N48A 3HVTA 1WF0A 3OTOJ 3FSXA 4P2SA 5ETMA 1RWKB 3W2VB 2J7WA 1RT1B 1S99A 1F5CA 2IIHA 4KO0B 2V68A 4I6WA 1KQKA 2CQ0A 3D67A 3VR1A 1SH3A 4LBHA 1LWCA 2WZ1A 3AY0A 1WG1A 4P74A 5DQIA 4F8RA 4WE1B 5DGBA 3G6ES 4USJC 1PC5A 2G2ZA 2U1AA 2V2VA 4B9MA 4WYLA 5IT9Y 1Y9OA 2CWKA 2IAJA 4ZIWA 4LMZA 2ZZTA 5EUHA 4JYZA 3DLEB 2EGVA 2LXUA 5A6WA 5KFGA 3FSYA 3I32A 1IM6A 4Z2XA 3D2WA 5A8RA 3KK3A 2VFVA 3K59A 5J2PB 1N6QA 4BHQA 2ZUAA 2FJWA 3M2VA 4LFBJ 1Q5YA 2M88A 5D78A 1Q8IA 2GNKA 1GH8A 5M2UA 3FFIA 4TU8A 2Q43A 1FTCA 3N01A 4CNYA 2WHOA 2C2KB 2C28A 5JMNA 1L3SA 5F8JA 2DK2A 2FUG9 1RTJB 3UWTA 2OKQA 3R2CJ 3C16A 3D1OA 4RNMA 2HAIA 2J7UA 3ENAA 1S1VA 5KOXA 1NKCA 2EWHA 5FIIA 2V6AA 2VBWA 1QUVA 2WVDA 3KLEB 1SC3B 2QMXA 2CJXB 4IQMA 4JP8A 2BM0A 4FVCA 5GADU 1IXKA 1R89A 3AT1B 3QIPA 3SEOA 3EX7B 4X2BA 5CYQB 4F3OA 1F9EB 3DDKA 3DM2A 3MTJA 3OUYA 2CNNB 2QE5A 2DIVA 3SSRA 1W7WA 1SJ4P 4KPYA 1VHIA 4X4VA 4Q7AA 4N5SA 5DG7A 3OR1B 3HFZB 2KJWA 2H4YB 5K14A 1RAAB 2GVDA 5GVQA 3NMRA 5E3CA 1P1LA 4DV1J 1CEZA 1Y3JA 4CLSA 1GK8A 2VUGA 1CS4A 3PEJA 4M5MA 4MK9A 3RG6A 4G1IA 5KT6A 1VK8A 2AJQA 3W2VA 1FDAA 3C15A 2H48B 1HYSA 3T9ZA 3UN3A 1V3ZA 4FF1A 5LL6d 3SBMA 3MAAA 3VGTA 4X4OA 2DGXA 1TK5A 2YQ3A 2OPQB 4YR2A 2PD1A 4KBIA 1S9EA 1RT6A 4H4MA 3KWMA 4IH5A 3G4SS 1RXOB 4JXXA 4J9QA 3E2EA 2BYCA 1U2FA 3I5BA 3H25A 4DWIA 3CNQP 3PW2A 1U2RA 2M4MA 5ADZA 1RHQB 2AU0A 2P5VA 4KV8B 4DV1F 2M52A 1PG5B 2YX7A 5ETOA 5IQ6A 3C2PA 3BSNA 1Y0HA 1VLYA 2KYZA 3Q2SC 2F7VA 3NGKA 1BY9A 2XO6A 3DRYA 2DH7A 5EHHA 2LA4A 3I0RA 3EICA 3RUBL 5F8IA 1B3TA 2AWZA 5J2PA 3OFEA 3R7BB 2J6TA 1EJ7L 1PGZA 4E2FB 4BWMA 1KNZA 3N5BA 5T41A 4DR2F 4OX8A 1KQSR 4ES2A 2WB4A 1JXEA 5F8LA 1FJEB 1VRTA 3CJTA 5ETTA 3CSKA 4CH0S 2OPPB 2SXLA 4P2MA 2WTFA 3CCMS 1HMVA 4LF6F 3CCTA 5J2QA 3JYTA 1RHKB 3ILOA 4MKYA 9ATCB 4USHA 1RABB 3CW2C 5CZXA 2VOPA 1SV5A 3KJNB 4RUAA 4XDCA 5CHCB 1P27B 2B5JA 4ICLA 1HBNA 4DUTA 4ENOA 2KT3A 3WIUA 2C3YA 5ETQA 2WOMB 2VQEJ 1D9FA 3LH2S 2N3LA 1FDNA 1K8AT 1PYOB 3MEEA 3MM6B 2R3VA 3GONA 1SJ1A 2VQFF 3W3SA 1T95A 4KHPF 1H2UX 4Q44A 3ULHA 4B9UA 4WJBA 2RRAA 3RBXA 1VQYA 3BBCA 4C4WA 1X5TA 4LFAF 3DRPB 4R25A 2DRBA 5D3GA 3W5ZA 2FLPA 3BQ1A 1QAXA 2J76E 4DV6J 4B3TF 2GV1A 1GMUA 2YKMA 3IWXA 2RRNA 5DGAA 4JV2A 1H2VZ 4ED3A 4RL1A 2RU9A 5HMXA 2HGLA 5LSOA 2Y8YA 2EFQA 1L5UA 4Y65A 4X62J 3CJ5A 1QE1B 1T05B 4I56A 1UETA 2NZCA 2BW7A 3PO4A 5B0AA 4CQ1A 3PIPQ 4EBCA 1DFDA 2RHQB 3OR2A 3KLGA 4U95A 3HHKA 1TZ0A 2IDEA 1TUGB 1QE1A 4Q45A 4DX5A 2F3JA 3BKUA 3LUYA 2W7PA 4IOCQ 3AODA 5K20B 3RTVA 4K5RA 1K47A 1D8ZA 4RW6B 4RU2A 2AYBA 2C1EB 5I3QA 3GJSB 2W4CA 3N6MA 2EGWA 4EI2A 4C8OA 2ZJRS 3RW6A 1DY3A 2CQ1A 4X4SA 1RTIA 1YG0A 1S9GA 2X3GA 2YQ1A 3AHPA 1IWAA 3OD2A 4R0JA 4FYXB 3S1TA 1TU0B 4DSJA 3MMBA 5F0UA 3PIOQ 2BR0A 4RW7B 3PIOS 2KXHA 1EUYA 4IG3A 4KIAA 1OYDA 1SKRA 3UVJB 5CABA 2ZJPS 1RISA 2YWWA 2A18A 3KUHA 3RYLA 5AE2A 5CA5A 2W9BA 3KNGA 2E44A 3ADAC 3W62A 4AUKA 4NCGA 1K0VA 2GGPA 2RIJA 1N34F 5CQGA 3WX8A 2JVOA 2P9CA 2R7XA 4PXCA 1RAIB 2F8HA 2WONB 3DRXA 1U0HA 2WVBA 3FBEA 2OHDA 3OPKA 5D15A 1T8EA 1N5YB 3ETOA 3C6UA 3HLUA 1WF1A 3W60A 2W2MP 3V6HA 2GJIA 4C9DA 2EI5A 4P9SA 1RU2A 1ZYQA 3BGRA 2GVZA 3I5AA 2CDRB 2V9KA 1IR0A 2C2ZB 2EEYA 4Q2LA 4JI5F 5AXNA 3P45B 4J5OA 2XYPB 2YY3A 4DPWA 3CMAS 4FF4A 3H2UB 1Q79A 2HZVA 1SCJB 5AXLA 1RLDA 2J5AA 1EZZB 1RAOA 2DY9A 2ZOFA 1HPZB 1Z2ZA 4ID8A 2ZHBA 1VBZA 1XR7A 2DR9A 1RAFB 4QPXA 5HL7S 2EVZA 2F1FA 2E1PA 4KKOB 1RT4B 2ZH1A 2QA2A 3M1VB 5HATA 4X4QA 1B7FA 2CG4A 1RTIB 2KTQA 4DSEA 1SB6A 2GIFA 2BMBA 5D4NA 1IBLF 1NCLA 2GW8A 1RTHA 2GMLA 2YH0A 4O4GB 4F67A 3UDLA 4K4XA 1JLFB 2DXFA 2FJAB 3CJ0A 5D0GA 4DV0J 3T5JA 3LWLA 4C0HA 2OMOA 1RWOB 1SH0A 2A6MA 2YKNB 4W4MA 1C0UA 5ETLA 3S01A 3OBIA 4CNZA 2X3DA 7FD1A 1MNEA 1NDCA 1YJ7A 4GVBB 4RW8B 2EFNA 3BGUA 3IM8A 1RBAA 3FFIB 2MYFA 4WK1A 5K8MA 5I3UB 1HNWF 3KHLA 1F3FA 2DNPA 4OZ5A 2FVSA 4KE5A 4JI1F 5IC6B 1V3SA 1JIHA 1ROFA 3D6MB 5CD4A 5HLFB 4OYIA 3EZUA 1S7IA 1LWFB 1RTZA 3ENWA 3T1HF 2CPXA 4WFXA 4NOHA 5B0FA 5J1EB 2DH8A 5L1KA 2W7AA 1R8AA 1I3OB 1WDDA 2N4CA 1DTTA 4WP3A 3GMGA 4OZ1A 3RGIA 3AXMA 4ED6A 3QT8A 5AE3A 4N8OA 5GAHW 1F9FA 1TUWA 1XMBA 3CDEA 3GG0A 4FYWB 4P6QA 2BJ9A 3DN9A 2A0FB 2JH3A 3DM2B 4KY3A 2YQ0A 4EZ6A 3P49B 2E7WA 1FRXA 1BMQB 3RU0A 5KFYA 5C24A 3H40A 2CPJA 4C0OC 4RUBA 2V34A 1FVQA 2M0GB 3DRSA 3A8IA 2ROEA 4M5KA 1YK9A 2NS1B 3R97A 3VF0B 3HJVA 2GQCA 2Q79A 3HSZA 1RT2A 5CYJA 3PRVA 3ENVA 2FD2A 1E6VB 5HQ8A 1ELOA 2D3UA 4LF9J 3SV4A 2HQDA 2FGOA 2YKNA 3GSIA 3Q8PB 4LR7A 4XPCA 3CUNA 5KFBA 3OL9A 4E98A 1L3KA 1S4FA 1VK3A 3CGIA 4KHRA 1QTQA 2XYGB 4OI0A 3N6NA 1FXDA 1XTZA 1K1QA 5EX3A 5KT3A 4J7CA 2CX8A 2CYYA 4TLRA 4YB5A 1RWXB 4DOZA 2XMAA 1F6TA 1BQXA 3VGSA 3WX4A 3BSOA 2MKCA 4JI7F 1NLKL 5D0HA 2FJDB 1S59A 5CYQA 4ZCLA 1S77D 3KG4A 5IC4B 4DN0A 3ET6A 2IC3B 5JVHQ 2DHAA 1L3VA 4ZCKA 4DV5F 3KUEA 3C46A 2AT1B 2DEJA 5E3RA 4LIRA 5GMEA 2PJJA 3PKYA 4O3SA 3FBFA 2LLZA 3L7UA 4CLUA 5DM6S 2AGPA 1PBUA 4FN5A 2L9WA 2B9EA 1VMBA 5ITHA 2D69A 2AIRB 1U1NA 2DVIA 3QT7A 4HI1A 4QW9A 1U48A 4A8SA 4DR4F 5IWAJ 1XNRJ 3DRRA 1X5PA 5F0WA 2VONA 1KOHA 3I6PA 4QYZK 4ZCMA 4CDIA 4CO0A 2AV5A 2BV3A 3CJRA 4WWSA 2HFSA 3EDQB 1RHJB 1X4AA 3V5RA 4A8FA 2AEMA 5E33A 4P7TA 3THPA 3WZ0A 3VVTA 4DV3J 4TYBA 1TFYA 4HL9A 1M5KC 1V6HA 3M8SA 1NSAA 1O6XA 2DNZA 2MQMA 3O6QA 4LBIA 4JI0J 3EVOA 4Y2KA 3K2YA 4P10A 1I94F 4IR1A 3KDOA 4CCHA 3M05A 4ZJLA 1IBKF 3ZZYA 1R43A 2JFKA 3BKFA 3CVKA 3PJ9A 3QO9A 4MH8A 1URNA 1M1GA 2Z2YB 1JKHB 3UNGC 4XO0A 2ZKTA 1X60A 2HRUA 3VAKA 1HI8A 3OR2B 1GTSA 4M5DA 2HNDA 4JI3F 2HVZA 3D1QA 3VGUA 3I56S 3H5YA 1H74A 4LF8F 2MPUA 4K5SA 4NEZA 5BR8J 1KLNA 3BGFA 1U1MA 5KFMA 2K2PA 1KD1T 3A8KA 3DOKA 4TQRA 2ATCB 4JV5J 3D0HE 4C6AA 1DTQB 3K7RA 2E1RA 3IXQA 3RBDA 2BDPA 4LRDA 3OXFA 3CB4A 1MW7A 3TEGA 1IKXB 1OYEA 3M1VA 3MPVA 4G1QB 3MD3A 4ECSA 2GS8A 1SI9A 1YSJA 2EG1A 2PEHA 2VJVA 4IOAS 3MR2A 1NYLA 2RJZA 1EAYC 1NHUA 3OFFA 5A8RB 4TY8B 3GR1A 1Q0NA 2XMKA 2V8PA 5T7LA 3M8PB 3FCWA 1KP6A 3IBFB 2CNLB 2LYVA 4K4WA 4RZRA 3KDNA 1JXLA 5DRKA 1JJ4A 2IBKA 3CCSS 1LW2B 3DOMB 4CLKA 2ZH7A 1C1CB 4OYAA 2HQGA 2B5JB 2BE7D 2NSBA 4ICLB 5F8HA 2QSFA 3MEGB 1TFWA 1JXVA 4DCJB 1IKYA 1FHTA 1S4EA 3EE3A 2R2RA 3DI6A 4FXVA 4NI2B 1RYSA 1HNVB 1FWKA 2HMIB 1T11A 1CQNA 2Q6CA 4I6AA 1SQGA 2NLWA 3DOLB 5AXKA 2NPFA 5IZHA 1YVFA 2MZ1A 4FS2A 3DLLQ 4V19J 3EDRB 1YJVA 3Q8YA 4ZLJA 2MGZA 3IS9B 2C2OB 3R5DA 3GV7B 3I4HX 4J90A 6AT1B 1B64A 2DGSA 1RKJA 5D4LA 2NZ4A 4WBFA 3OUYB 2QFJA 5DZ6A 4KHPJ 1VQPS 2XY6A 3PRBA 3MMBB 3NCPA 1X0PA 3BM7A 2L3MA 3QIPB 3UDCA 4X4RA 4QIEA 5CCMA 3GIJA 2J7KA 3TX0A 3SIPB 2A6OA 2ACYA 2VDHA 4FPRA 2NUHA 5A8WB 3KMQA 3IBWA 2M70A 3TVKA 1M1KT 2UXDF 5SZTA 3NRBA 3TOQA 2VG6A 2GAGC 2LQ5A 1SV5B 3CO0P 3TEHB 1RTJA 3HVWA 4ZVSB 4ECXA 4NA3A 3GIRA 4EO6A 2C3MA 6FDRA 4YB7A 4X64F 3SXLA 4B9SA 1UMJA 3A12A 4LF8J 2ZH2A 2YKPA 4WU2A 2V94A 2VKZG 2R8HA 2FY8A 4XK8C 4YUDA 3NKYA 4A8YA 2VIHA 3NY0A 2JEIA
chains in the Genus database with same CATH topology
3NP5A 4OX7A 1UKUA 5F9NA 2BRKA 3LGNA 3O3LA 2RD2A 4ECZA 1WHXA 2OD4A 4R8UA 5A8WA 2ZHOA 4DQIA 1RYRA 2GQ2A 2ZJQQ 3AB4B 4WIIA 3TI0A 4NZ7A 2FJEB 2ASYA 4KO0A 1W2BR 3ISZA 2MKSA 3MMAA 4DV3F 1R31A 5J2MB 3Q8SB 1MMNA 1A7GE 5L1LA 4NLVA 2ZZNA 4P7VA 2UUBF 2AYGA 4TU9A 2UU9F 4LSNA 2W8KA 2UUCF 2CPFA 2K8GA 2OSQA 3CD6S 5E3PA 4LF7F 2VPXB 5LSRA 1LW2A 3DOMA 1RT3B 5KAKA 3BJYA 4OJGA 1JLEB 3U27A 1S9FA 2OFHX 5J1NA 5KFIA 2V4RA 1RT5B 3VTIA 4F25A 1DTTB 5CCLA 4YEAA 1YHQS 4X4UA 3BEGB 4NZ0A 3KLVA 2FVQA 4G1PA 4QU6A 2EBEA 4A48A 1AW0A 3CCJS 3O1LA 4QOTA 2JEFA 3JSBA 1F5BA 3PEHA 4DS4A 1NH8A 2DPIA 3P5TL 3CCRS 2EBGA 4PQUA 1WHVA 2HGNA 3QWPA 3SCIE 2KM8B 5KFRA 1S1XB 1SH2A 3OQ2A 5HI7A 5CXTA 2OLWA 1NKBA 3HHEA 3BDPA 2ZE2A 4IG0A 3K5LA 3Q23A 5KFWA 4M95A 5CZVA 3PO5A 1KTVA 3CULA 1TQLA 4QQBA 3Q24A 4DV2F 4DS5A 4CO2A 4JV0A 4LFBF 5JXSA 4UQTA 3V6DB 2CZ4A 4ZKAA 5GAHI 2RDJA 1HYSB 1DQ9A 2FB0A 3MMAB 1TAUA 3S7RA 3DLEA 4YR3A 4F4ZA 4DBQA 1N0VC 4PXEA 1D0EA 3I82A 1W2IA 4PRFA 4Q0BA 3SDEB 3N6LA 3TAPA 5KFZA 2Q1LA 1FRHA 2CJBA 2FJBB 3M30B 2HVHA 3M6VA 1HR0F 2ZH6A 1LWCB 1RJJA 4CH7A 4DFKA 3NBPA 1D8YA 4LF5F 1WWHA 5C5JA 2A3JA 4CO1A 5B0BA 5J1EA 2VFRA 3KOAA 3R5BA 4LSLB 4ZS6A 1MWZA 2YX4A 4NX9A 1UWBA 5B0DA 2YH1A 2YWFA 1EXDA 1I1GA 3U1NA 1TR0A 3HHDA 5D4PA 2ZD1A 3DYAB 3UW1A 4AQYF 2AD9A 1NRKA 2CVEA 3CTRA 3DMJB 1S1VB 4CO4A 1TKTA 1M0SA 1HWIA 5A2QY 4EGLA 2VG6B 2CKWA 2J0XA 2XWYA 2IVMA 1JLFA 1VQLS 3DHWC 3M6WA 4ZVEA 5JVGS 1KLMB 3MCSA 1SJ3P 1NU4A 2YNFA 3TX8A 3F56A 1U25A 2LXIA 3BR8A 3BZQA 4KKOA 3PJXA 4ID5B 4NLTA 2PMZD 2HRYA 4FNHA 2MHNA 4ZPAA 3OJUA 1UVKA 2DNRA 3I55S 1SUQA 2KI2A 3DHXA 3FMWA 4F50A 2HVIA 2EFVA 4RNOA 4ZK7M 3CWJA 4Q43A 2CJQA 2RD5C 4QW8A 1XC9A 4KB7A 4WE1A 2RDIA 1TKDA 4DMZA 3PFEA 1X9WA 1UDXA 4M1KA 1FKOB 1PILA 1MWYA 3V2UC 4KFBB 1IKYB 4DR7F 2V4JB 3QO9B 5DDRC 3NNHA 3WDOA 3HHNB 4HT7A 4LIWA 4OQJA 2ZNYA 3T5HA 4B3MF 4JI6F 2FPHX 4YB6A 5KFDA 3KK1B 1LQ9A 4ELVA 4DR5F 3CDBA 2CQHA 5DM7Q 2KRRA 5D6GA 2YNGB 5CH7B 2L9NA 3HVRA 2DD8S 2DHGA 4WXWA 3KG1A 1QJHA 3KLFA 4TXSA 4F2SA 4IO9S 3JTOA 5AXMA 2XULA 2DNOA 3I5CA 2MGZB 3MUMP 3CCUS 3DU5A 1V9OA 3NMAA 2PSZA 2M8DB 1ZM3A 4WKRA 2E5JA 3MDFA 1NK4A 2KHDA 3O8WA 3JSYA 1AXQA 4IKAA 1HQUA 2FHJA 1DFUP 1EETA 2BANA 1KTQA 2XBPA 4A46A 3EGNA 3IRWP 1VBXA 1VHFA 1FNMA 2D41A 4I2PB 4DFPA 3IG1B 1SC6A 3PR4A 2JZ5A 4IH7A 4OX9F 4LUBA 4J9RA 1NJWA 1GTHA 1JK9B 3CD7A 3T3FA 2PI4A 4F4WA 2ABYA 2WB1D 4F3QA 3E01B 3MFHA 2HWHA 1VGYA 2E9TA 1GT8A 3MECA 4RW9B 1S49A 4DSIA 1AFIA 3VAMA 2LXFA 3UFCX 3MTKA 4IDKA 4WF9Q 4P2BA 2PDAA 3DOKB 2YNIB 1QSLA 2KO1A 2KFYA 3AQPA 2VFTA 4RNNA 3J7YU 2HS3A 2HLTA 2IFXA 3AA9A 4Q2MA 2B4VA 2EKYA 2WRMA 2P9GA 4M5DB 3V6JA 2AYEA 5JVGQ 3QLHA 1JLGA 2HWTA 2VV5A 1C0TA 2RT3A 2DITA 4I2QA 2DGUA 4Q8EA 1KOOA 2G4BA 2H5EA 2VPWB 1XMQF 5DJBA 4V194 1J5EF 4C98A 1FRJA 3SZ2A 3MM8B 2QZ8A 2B4PA 2KDOA 4H4KC 1XWLA 2E66A 1M5VC 1N52B 3I9V9 1GX6A 4RW7A 3VWSA 4KGKA 2FLLA 2BZ2A 3G8QA 4HLBA 2FDNA 1S7HA 4NZ6A 4K4SA 4ED7A 3OW2R 4WFBQ 3KHRA 4ZHRB 1X8DA 3FRYA 4KT0C 2ZHAA 1YJUA 1TKXA 4DR1F 4M94A 1FERA 1FJGF 1C0UB 2D3ZA 4RW6A 2VPZB 4WFAS 2R8KA 2F40A 2VD3A 4DLEA 3MUTP 5U47A 4ZHRA 3K57A 3TA2A 4DG1B 3KLGB 1UA0A 2ZNZA 1ZZNA 2ZC4A 4HDHA 3QPIA 4MMOA 1TV6A 1VRUB 2VA2A 1TL3B 4IRDA 4RNHA 4XPEA 1S97A 4IFYB 3FRZA 4RLEA 2OH2A 3U7JA 1RK8A 1NH7A 5E5NA 1DARA 3OSPA 4JV5F 5IT0A 2Z0GA 4URSA 1WI6A 3UQSA 2CJKA 3C6UB 4EBEA 1Q53A 4DR3F 2RKIB 3OTEA 1FD2A 2LU2A 1QSYA 3HVAA 4DX8H 2MQOA 3QLHB 1L3VA 3MM6A 2FHKA 3FVYA 3H20A 1RT2B 4K4UA 1X5OA 1X7VA 4ECTA 1R8PA 4C11B 2HFNA 5KG3A 2RF2A 2JL9A 5FJ4A 4HTIA 5DETA 4TU7A 3CCVS 1PO6A 3CD5A 1FKAF 5J1PA 3LP2A 2R7RA 3W2WA 4PUOA 1AROP 2BE2A 3BN7A 2E9ZA 3MECB 2LA6A 1U8SA 4NMLA 2W9CB 1ZH5A 3MZIA 3TARA 3CJ3A 4K59A 4H54A 4PQAA 3RAXA 3QJPA 2XS7A 1D1UA 2Q66A 1T3NA 2OP5A 2CRLA 4OJHA 1QAYA 3T5LA 1HD1A 1Y5NB 3SFUA 1W25A 5HLFA 2B7BB 2FJXA 2C2RA 4EEYA 2MY7A 1VJWA 1A6LA 3OTCA 1D6KA 4Y2CA 3M8QA 3TQ1A 4RNFA 1XR6A 4RUCA 4KV8A 4JYAF 3OL7A 2QMWA 5B0EA 3FJ2A 4F02A 2R2TA 3HFKA 1UA1A 1C2PA 2R7UA 3IAM9 2RUGA 4OMFG 2L08A 3G71S 3RRGA 3FDSA 5J2NA 5F41A 2IVFB 2KM8C 1NKEA 2V8VA 2AX1A 1UJ5A 3C6TB 4ELUA 1TKZB 1FA0A 3G6VA 5J2NB 2RE1A 3PJWA 2ZOGA 2MKKA 3OFGA 1C4AA 2PA3A 3QAEA 4Y28C 3IR6B 4I6YA 3UD3P 2CDQA 2D1CA 2IRYA 3MR3A 2D9PA 1QUPA 2YTCA 1IQTA 1FDDA 4DUYF 3I96A 2J0WA 1ZZFA 4YQWA 3BN4A 3OLAA 4IOAQ 2B43A 4DL7A 2ZJRQ 3M6XA 4URGA 3E8OA 2Z8QA 3OL8A 2VG5B 4GKKF 2CQGA 3KLEA 3L3CA 1RDRA 5HMYA 2DH9A 1JLCA 1S6UA 2HQ3A 1EETB 4DFJA 4JXZA 2X1GA 2R7SA 4LF4F 1FK9A 2G9OA 3PW7A 2VH7A 3KG0A 3ITHA 3LALA 3TVYA 4RU9A 3TW0A 2DCUB 4Q5VA 4ZLPA 5H1SV 4N56A 2EG2A 4KTQA 3G6YA 1VQ9S 3G6XA 3BQ0A 1FVSA 3PM9A 4DV6F 3MR5A 4ETXA 2NR0A 2B6AA 3IO1A 1SKSA 1K73T 2CVIA 2DR8A 4ES3A 3HHLB 2VG5A 1MMDA 2AX0A 5K5MA 2ZD1B 2XEXA 3DYAA 4DV4F 1MU2B 1IQZA 3AQOA 1RQ0A 2HHSA 1HQEB 1EP4A 4OLPA 2XGPA 2E5GA 1HL6A 4URQU 4CO3A 3ENQA 1XBWA 3OTDA 4UY88 2FHJD 1U45A 1BC6A 5F8GA 2XY7A 2E5HA 4QCLA 2RQKA 2XMJA 2N3OA 4A47A 3D5MA 2EK1A 2AJ4A 1YIJS 1N4LA 1N5TA 2DT9A 1BQMB 4QPTA 4ECVA 3MR6A 2Y1JA 3NS6A 4TY8A 4FXDA 4YB1P 1KN6A 5T14A 4UY85 5B0CA 4KR0B 1IKWA 1QAJA 1E6YA 1Y5LB 1H0HB 3OFHA 4A4JA 4C8LA 5EDWA 3B4DA 2J0QD 2UUAF 4U9RA 1MROA 2FJVA 2DGOA 4OZNA 3Q8RB 2R8IA 3CDWA 2AF6A 5LXYA 3PW4A 2N82B 3JYTB 3FQLA 3PX6A 2XMMA 3D28A 2Y1RI 2OPPA 4DQPA 2VODA 4N8NA 5HROA 3BR9A 3ZZOA 4ZPVR 2K3KA 1U24A 3GE9A 3T6BA 1KSPA 3A1YG 1DLOB 3H4BA 2WBRA 1UWBB 3SQGB 1VQKS 1RWUA 1ZM2A 2CPEA 2QO3A 2JEJA 1HQUB 1TL1A 4GKJF 3POTA 1UVLA 2YWEA 3J7ZV 3CCWA 1O5JA 1KR4A 1HWJA 3EXYA 4NLSA 4OFZA 3SDEA 2WBMA 1UEVA 3LF0A 3J81Y 1N33F 4I2QB 2C42A 2L9DA 3A8EA 2D9OA 3LP0A 1YJRA 5KTQA 1G3OA 3FZ2A 4RX6A 3IRXB 3MPWA 3EXCX 5CYMA 4NXNF 2O66A 2XI2A 3DLKB 4CT8A 2IJFA 1SJFA 2J6UA 2L48A 1N0UA 4U6PA 3JSMA 3OXGA 4CO5A 1KQFB 1TK0A 4WXOA 5IFMA 3D0GE 4MTPA 1VQMS 1O0BA 1VC6A 1VRTB 1YBAA 3M2UA 3MD1A 3NG8A 2GQQA 4ZPCA 2QRRA 1S72S 1TL1B 1FE4A 1U1KA 3CEDA 1M90T 1IM4A 1FEUA 5G0RA 3GR0A 3GZ7A 3H5UA 5KFCA 3DNCA 1Q7YT 1NEEA 3BREA 1O0CA 2UZAA 1G1XA 4AXJA 3LWMA 2PI5A 3RB0A 5HROB 2APOA 2BQRA 1FEEA 1T7PA 2UXCF 2M9KA 3DDNA 4ZPDA 3K5NA 4B3OA 1DBDA 1RT1A 4QIWD 1H7WA 3GFYA 4U7UK 5KG5A 1VIXA 1CG2A 3TNVA 2KT2A 3M4XA 4C3KA 3DMJA 2CQ4A 4ZA1A 4G6VB 1UFWA 4O44A 1RT6B 2VKRA 3CT9A 1FXRA 4JV1A 4NYOA 4BWJA 2E1MC 3MM7B 2HFZA 4OLOA 4MIAA 1G7CB 2J6SA 4AL7A 1S6QB 4NA2A 3WBZA 1S6OA 2I5JB 4ECQA 3M30A 4KSEB 4ECRA 3K5MA 2OAUA 4W92B 1HNVA 3FZBA 1S6QA 2VG7B 3GFXA 3GIMA 3DLBA 1TL3A 5JJBA 4NCAA 3JSMB 2NQPA 3CC4S 4EWTA 1XN9A 2BM1A 2BW2A 4FF2A 2OMLA 2HHUA 5A0YA 4UUWA 2MQNA 1P1TA 2E1AA 4EUVA 5CYMB 4PG5A 4RW8A 4ZPWR 5DQGA 2MKJA 3THTA 3MGJA 2KT5A 2VB6A 3M8PA 1N5SA 3RRKA 4IG3B 4A8OA 4Y34A 4BCAA 5FDLA 1RA7A 3KLIA 4X62F 3MUVP 5KFFA 2Z4PA 4CIOA 3FEXB 4QWCA 1OPIA 1IKWB 2IHR1 2BQUA 3H4DA 3IN5A 1R8BA 2YNHB 3V4IA 4YP3A 4Q8FA 4ZVHA 1REVA 3BB5A 3M9OB 1FO1A 2K3IA 2PN6A 2M3DA 5BYRA 2B9XA 4NA1A 3ZZUA 4EFAC 3MM8A 1JNRB 1NJYA 2CPYA 1U09A 2O3DA 5HO4A 4DQQA 2BJDA 1X9MA 4R5PA 1K0TA 1RA6A 5EX0A 4EO8A 4FP9A 3L95X 5AE1A 4DHVA 4C7QA 5HBMB 4U7CA 3BGLA 3M9MB 4JI8F 1AUDA 1VOMA 4ED0A 1JLQA 5KFLA 2Z2LA 4C8NA 4B3SF 3AA8A 2MZTA 5H9EJ 3TR5A 2YKMB 4KAIA 2VZ9A 4ECUA 1X4CA 1TKZA 5A8KB 5KFHA 2FVRA 1HI0P 3ICLA 2EFOA 4MK7A 2IA0A 2QYCA 1T94A 3GQCA 4J9KA 1IJFB 1N54B 2ROPA 5SUHA 1HBUA 4QWAA 3LOUA 5CD4H 2HHWA 1RTDB 2NREA 4GMKA 3OHAA 1HBNB 2R9LA 2R7TA 4X4NA 1OO0B 4F26A 2B4UA 2XB2D 5DLFA 3X1LB 1U1OA 2E5IA 4WFAQ 4B9VA 3US5A 4C8MA 3LAMA 3HXMA 5GAEI 1NB7A 2P6SA 1DLOA 2Q3PA 3GYNA 1O8BA 5I4MA 2DBBA 1B0VA 3H5SA 4XIUA 4RBUA 2NXUA 1NK0A 4TQSA 5D8HB 2FHOB 1YJTA 2HQIA 1JLAA 3PVXA 3PW0A 3RW7A 3JTNA 2X1BA 4C2MA 1HA1A 2JC0A 2RH3A 3IGVA 3N5FA 1LWEB 2YNHA 2I0XA 1RTDA 2UUWA 1LFWA 2IA6A 4B08A 4K4ZA 3BDEA 1YRUA 4A8KA 5EWFA 4ZVFA 1FNXH 3DXSX 3KLIB 2MXYA 2W8LA 2XSJB 1BQMA 1VQ7S 1SIZA 1TKTB 3W7BA 3J7ZT 2YNGA 4K2XA 1E6VA 3TA1A 1X4HA 1UP1A 2CJ9A 1KHWA 3LANA 4FZVA 4LQ3A 5LT5A 3SCLE 1WF2A 3ISND 1OSDA 3H8YA 2W25A 3RAQA 2NUUG 1QVGR 1OQ3A 4NLDA 4C3MA 1D3WA 2ZH9A 5JVHS 2LDYA 2V4JA 1Q78A 2ERRA 4UUXA 4D3GA 4IRKA 1U47A 2BVZA 3OVBA 4ZP6A 4BC7A 1ZM4A 3BO3A 4QWEA 4W90B 2POKA 2BABA 1P6TA 3SV3A 2DNHA 1X4DA 4WCES 1X4EA 2IC3A 2KJVA 2K7KA 1BWEA 2CQCA 3GYXB 2DO4A 3S8SA 1CPZA 1Q4RA 4Y2AA 5FLXY 4QYRA 4DL4A 4E0DA 5KFXA 3HO1A 6FD1A 3I0RB 4G1QA 4PWUA 5LJ3Y 1VI7A