3W3ZB

Crystal structure of kap121p bound to rangtp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
171
structure length
171
Chain Sequence
b'EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Importin subunit beta-3
molecule tags Protein transport/nuclear protein
source organism Saccharomyces cerevisiae
publication title Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
pubmed doi rcsb
total genus 52
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w3zB00
4NONA 1IN6A 3CWZA 1VIYA 3N5CA 3ZH9B 3WYAA 1FP7A 1QVRA 2PX3A 3A4LA 3K8YA 3NHAA 4JL8A 4NKRA 4DDVA 4PPFA 1OXXK 5FBWB 5BN4A 5E95A 3TUZC 3J81k 1NMXA 2RKOA 2YOGA 4JVNA 1UADA 3W3AA 2EYUA 3LXRA 3V4RA 1KO4A 4ZI2A 4LBWA 1KSJA 3Q5DA 1VTKA 2VTKA 3AKYA 4A8JB 5DE3A 1DADA 1QG4A 3T34A 3RWMB 4HB2A 5JS8A 2JJ1A 1Z0KA 5JWOA 3U7GA 521PA 1EFTA 2QP9X 2VP4A 4II7A 3RRNA 4BFVA 1FTNA 2ZI5A 5FOWA 3NEJA 1ESMA 3QBTA 1NG1A 4LHWA 5HZHA 3WYGA 4OK3A 1ZM2A 3AVQA 4M0LA 2O0JA 4DLXA 1R5OA 3CF2A 2GJAA 4JLJA 1N6RA 3Q8XB 2CHQA 4HZUA 5GJWC 4EPWA 4GMDA 1G18A 1F5NA 4ZDKA 1Z83A 3GJXC 2CHVA 2ZITA 4HAXA 5EE3A 1HT2E 2R44A 1KTVA 1Q44A 5EE1A 3RC3A 4YDSA 3LY5A 3KZ1E 4FCTA 1S3SA 2LKCA 5DI3B 2BOVA 4JLOA 3FGNA 2AFHE 1NLFA 3OIUA 2BEJA 4ITRC 1CR4A 3K53A 3QKUA 4N0EA 2O8DB 1MRNA 2ZJ5A 4M9SA 4EKDA 5JHHB 3U7EB 3X1XA 4A2WA 4I4LA 2QMEA 4CEIA 4FMCF 3OE7D 4XVQA 2O52A 3VR1A 3U7FB 1W36B 4US0R 1P72A 4PC1A 3VR6A 5GJBA 2XB4A 4M1KA 3Q7QA 4Q4JB 4QJ3A 1ZAKA 2VEDA 5B57C 4ILEA 1FNNA 4LYFA 4OJKA 3PEVA 4RSGA 2YC4C 5HKKA 2HJGA 1HTWA 1XZPA 2EFHB 2PMDA 3BORA 4CF7A 3MWJA 4I1VA 1M7BA 3FOZA 2RGBA 1RE0A 5FTKA 1KO1A 1YJ5A 2FG5A 4E09A 5KNCA 3V9PA 2QQEA 2ZRLA 1IXZA 4QBGB 1QG2A 3CUEF 1KSHA 2PJRA 3SJZA 3TUIC 3UG6A 3THYB 2FSFA 4PSAA 3PJRA 1GL6A 4IVPA 4PQFA 2GZAA 3RWOA 1O3YA 3PG5A 2C99A 1DOAA 1E4YA 3SYNA 2PT7A 3CX6A 2R9VA 1MH1A 1K5DA 5CLQA 1QRAA 3W5IA 2R8RA 2O8CA 1G1MA 1B0UA 4Q48A 1FX0A 1GRQA 1DO0A 4LYHA 2OBNA 3KXKA 1KI9A 1OB5A 3LNCA 3PITA 4JLKA 1T4GA 4IFBA 3RLFA 4TZ0A 3CH5A 4K8OA 3EZ6A 2JATA 3K0CA 3FYHA 2YV5A 2A78A 1NVUQ 4LJAA 5FUXA 1N6LA 4ESVA 2J7PD 2QG6A 3WNDA 1D9XA 2D74A 1Y63A 1OIXA 4JT4A 1OIWA 1XNJA 1YZQA 1TPZA 4NCKA 3WRYC 1P2UA 4ASUA 1XD9A 1OXVA 3WXMA 3GP8A 4DBLC 4QBIA 2GDJA 2OG2A 4URWR 2A2ZA 5DIFA 4L9SA 5JS7A 2F1JA 1A2KC 2PLFA 2C9YA 1KZGB 3GEEA 1CKEA 3KFXA 2J5XA 2OXRA 2WKPA 1ZCBA 2E9SA 4Q21A 4D4MA 3AP2A 2DHRA 2IK8A 1P2TA 2N46A 2XJ4A 2Q6TA 1JI0A 2VF8A 3PEUA 4V0MA 5BQ5A 3ZQ6A 4AYWA 3EAQA 2ZJAA 4A6XA 5K8IA 3DOEA 4B44A 3BFKA 1G41A 2J59A 3TVDA 3CX8A 1SVWA 2C96A 1E9AA 3EARA 1NLZA 4IXNA 4B34A 3GJ7A 2ZU0C 4BPBA 4DCVA 5DHFA 1QHGA 3HJNA 2UVQA 1NMZA 1OKKA 4AKIA 2IUTA 2GXUA 1KIMA 4TMKA 3L0PA 1NRJB 3CNLA 2QRZA 1XX6A 3UMFA 1WBBA 5IF9A 3OIVA 2IYVA 3DHWC 4TQ9A 4GNKA 4EIWA 2QROA 2GJKA 2DWOA 4P4UA 1UDWA 2GEVA 4A0HA 3LO5A 4NMMA 3AF0A 2XZPA 3I62A 3HU1A 4JVMA 5JMTA 1YQTA 4LV5B 2IYLD 2HV8A 4NCHA 4I99A 5FOSA 4TLEA 1GNRA 3GQBA 1ZD9A 4UXJA 1D2NA 2JIZD 3D8BA 2GCPA 5KOYA 2DWQA 2F1IA 5KSYA 3K1JA 4DZZA 4NYMR 3T5GA 3GJ0A 2H16A 5BYJA 1BOFA 5CJ2A 2X1VA 4FMBB 2QMUA 3ZLJA 2JLWA 4ACBA 4DLUA 2VLIA 3DKVA 1DPFA 1XXHB 3FE2A 4KBGA 3RC8A 4MRSA 3DM9B 4HLQB 1LTQA 5EXPA 3ZIAA 621PA 1GUAA 3CKLA 2ZTSA 3N70A 1HA3A 3TKLA 2QN6A 5CK4A 2IYZA 4IOKA 4RCYA 6Q21A 3WMEA 4FCVA 2EFDB 3I73A 2GWHA 2NO7A 3OIWA 2ZI4A 4M1YA 3ZYCA 2RH5A 2OXCA 4URXR 5IT5A 2ZI7A 3MLEA 2Y8EA 3IPXA 3B1YA 1N5IA 1NF3A 2ZYTX 4OI2A 5EXXA 3OE7A 1S0UA 2QTHA 4EDHA 3AF4A 4PPGA 2ZR0A 5EXSA 1H8HD 1N0VC 1XMJA 2NO6A 4G5QA 2GXAA 1FOEB 3AF2A 2CLDX 4U02A 1P61B 1DARA 3B9QA 3QUSA 1OSNA 1T9HA 2ZJBA 2C8VA 4Q1FA 3NBFA 3BOSA 4M9ZA 3ZGXA 1KK2A 4FWIB 1Z8FA 4LI0A 3L8YA 5FBQB 1W4CA 5EUQB 1OFUX 1JR3E 4DUGD 1ZBDA 2IWHA 2QNRA 1R0YA 2PLRA 2YJTD 3X1WA 4MYTA 3PIRA 121PA 3SU8A 4GFDA 2W6IA 3L43A 2EFCB 3ZZUA 2WOJA 2XNSA 2RGNA 4BFSA 2QAJA 1VG1A 2B21A 3MRSA 4Q01A 2REBA 2ZE8A 1RVDA 1GM5A 1G7RA 3GFTA 4B3GA 1QHNA 1NSFA 2C95A 4TSFA 2ORIA 3QNUA 3R20A 1MO5A 4RFSB 2W0SA 2CXXA 1RIFA 1SXJA 1W4BA 3IO3A 5JJLA 2ZI3A 3L2OB 2BMFA 1NN0A 4D4KA 3QXHA 2GCNA 3H86A 4CIDA 4D82A 1OFTA 4IDHA 1QHYA 1O87A 4HDOB 2QI9C 1E79A 1P75A 1RFLA 4NCNA 2IEZA 5L3QB 1JJVA 1JNYA 3NVAA 3KQUA 3WNBA 5LPNA 2SHKA 1XEWX 3AKEA 3EZ7A 1E2GA 4XOIA 4KV9A 4RZUA 1WA5A 4WVFA 1FPMA 5A4JA 3REGA 2HF8A 2D3WA 3HU2A 3N2IA 4DJTA 4RD4A 1LY1A 4Q4HA 1AGRA 4U00A 2DWPA 2JASA 2F1RA 1JPNA 4QNRA 3KTAA 1IQPA 1ZRHA 1S8FA 4NP6A 4EQ6A 3LFUA 2ZSFA 3CIOA 4TYWA 4JL6A 2Z0MA 4Q9LA 2HF9A 5AJZA 2GF0A 2F55A 2N42A 4CGZA 2ONJA 1F6BA 1NN5A 4GBMA 1SKYE 1GITA 3K70B 2ZXUA 2QRNA 4A2PA 721PA 1R5NA 5JI3E 4PAMA 2O8BA 4HUQA 5FR1A 1UBFA 4LHVA 2XXAA 4PO1A 1XD2B 2GK7A 3CPJB 4PX9A 2GBLA 1UAAA 3QVUA 4UNSA 5IDVA 2UZ3A 3SI7A 2F43B 2QA5A 3QF7A 2IS1A 2QUZA 4QFMA 2WWHA 1U90A 2VP9A 3BGWA 3TH5A 4EPXA 1AQUA 1TUIA 4Q18A 2D7CA 1ZNWA 3PQCA 4BFZA 5K8UA 1X8JA 4F7WA 2ZAOA 1TQDA 3MG9A 4DC9A 2HJVA 2IF0A 2NO1A 2ORVA 3BE4A 4KYUA 3KQHA 2I1VB 5G41A 2RGCA 5KDDA 3ZVMA 3B85A 221PA 4OYHA 3VR5A 3DZ8A 4JT2A 4AG5A 1U9IA 4YQFA 1WBDA 4HDQB 3RS5A 4LYJA 4LPKA 3WP0A 2HEIA 3VMFA 5B58C 5F9HA 2DB3A 1W47A 2IC5A 4LCBA 1II0A 3K0AB 4V0ME 4GI7A 1T5IA 3F5FA 2V7QD 4R9UC 1DBSA 4YMVA 1UF9A 1JR6A 3QF4B 3BWDD 3MJRA 3NBZC 4Q9KA 3WRXC 3W90A 4LYAA 3VNVA 1Z5ZA 4D25A 2O8CB 2OUKA 1G8FA 3W3ZB 2OCYC 2ZPTX 2YVUA 3K0EA 1BO6A 4J0QA 1MV5A 1NKTA 4BZXA 4Q1CA 2P65A 1E1RD 3DMDA 2CL6X 3W9YA 3BXZA 1PLJA 4RZ2A 2QGZA 3Q72A 3EXAA 1BKDR 4Q5IA 4PHTA 3SOPA 3DPUA 4Q4AB 4DDWA 1IN7A 2ANBA 2E87A 4OJQA 4DLWA 4Q03A 4NU0A 4FMCB 3T1OA 3CB4A 1CJVC 3LLUA 1DTSA 4P31A 1YHNA 2ORWA 3CBQA 2JJ8A 1XCMA 3RAPR 1N6KA 1ZUIA 1JEDA 3Q7PA 5JFGA 4BEBA 5HCNA 3ICEA 3B13B 1QVAA 4TZ6A 1L2TA 1G5PA 1KO8A 1US8A 4LHXA 3SHFA 4U7DA 1YU9A 4TN1A 4UJ3A 1DS6A 2D2FA 1W5TA 4TMWA 4LJ9A 2R6DA 3GLIE 3QKRA 1HURA 5C4GB 2YWEA 3EG5A 3AGPA 2IL1A 1X3SA 1OLOA 2BCGY 1LFDB 1SVKA 4CZ2A 1T0JB 5AJVB 3C15C 2CJWB 4LBVA 1D2EA 1XTIA 2BHRA 2CK3A 1IN5A 5CIQA 5JI2E 2VYFA 4M53A 5FOXA 4IKEA 1VIAA 4PC7A 3U3KA 1UPTA 2ZRIA 4OQNA 4P4SA 2CL0X 5JCZA 1E2FA 1JXMA 2CCJA 3JVVA 4LC0A 4LOAA 1E98A 4A82A 1G3UA 4ZCLA 2WJHA 4DT1B 2XTNA 2F9MA 1J8MF 1FQJA 2IYXA 4DB4A 4L4UA 4LBYA 5C4MA 4Q19A 4Y0AA 3CLVA 3WP1B 1G3IA 3VX3A 1CJMA 2QL6A 2QMHA 3C14C 3OFNA 3SJAA 1IN4A 2ATVA 1BYIA 1KMHA 1YR6A 2WJIA 2BBOA 5B30A 5LDDC 1M1YE 2ODBA 3IO5A 5E3HA 2ZRKA 4HB3A 1RRCA 4OK6A 2OCBA 1OF1A 1JALA 2R6CA 3AQ4A 4I1OA 5CM9C 5L3RA 3GLGE 4GPTA 3CM0A 1G3QA 4LK2A 2VSXA 2QBYA 5F2EA 1UJ2A 5BYKA 1SQ5A 1E2DA 1XEWY 1X6VA 3OFND 1KI7A 2PX0A 3C5HA 3FHTA 3T12A 1VYTA 4L5BA 2BDTA 4ZKDA 2IS6A 5LB2A 2WWIA 1SKYB 2ZSAA 2VPPA 3WYFA 2PBRA 1XXHE 1XDBA 3KKQA 2XZLA 4AY2A 4QKQA 1Q1BA 1HE8B 1VCIA 3AP1A 4D4LA 5JHGB 3GPLA 1ZM4A 1U99A 3SN6A 4B6EA 1T6NA 3I8SA 4A8JC 1SXJC 2MSCB 1S1CA 1XTQA 2QQ0A 3RS0A 3X2SA 4PC3A 4KSCA 4D6PA 4S35A 1HT1E 2VSFA 1M2OB 1LF5A 3W34A 4C7OA 2I4IA 4HSEA 3B9PA 1AZSC 1T3SA 3KQLA 5KUTA 2PEZA 1E0AA 2AWOA 5J40A 3BFVA 1KAGA 4JIMA 2RAPA 1I4DD 3VQTA 5F3WB 1F2TA 3SE0A 5C2JB 1Z6AA 4BLSA 1RRGA 2NIPA 3JZMA 1ZJ6A 4GSYA 4WXRA 1XJQA 2FFBA 2XITA 1EWRA 3T61A 3U44A 4O3MA 3IUYA 4B3XA 1D6JA 1HH4A 1KK3A 2I3BA 5AWFC 4E03A 2VSOA 1UBGA 1EX6A 2JLRA 3TUJC 3VX4A 4ZDIA 5KO2A 4G5SA 4ZIRA 2OCAA 1M8PA 5GVRA 1U0LA 2WZQA 3QKSB 2A30A 2BCJQ 2FOLA 2G3YA 5ANRB 1QF9A 1R0XA 3HYRA 1W0JD 5F9FA 4JYCA 2IS4A 1MKYA 1LNZA 2CBZA 5FPYA 3TMKA 3CWQA 4QGFA 3SJBA 4JBWA 2XGJA 1KDTA 4US1R 2GJ8A 3MWKA 4TSFD 2WOOA 5FL7D 4OQXA 3TW8B 4QM7A 1OH5A 1SXJB 1PVOA 2J0UB 2ZSBA 3W8RA 3FMIA 2HXSA 3P4YA 1E3MA 2H18A 4HLDA 5TXGA 2WJVA 5KPJA 1F2UA 2ECKA 5CB6A 3AEZA 1JQJC 4LWZA 4QJ4A 3TLXA 3EW9A 4Q47A 4TMXA 5KPDA 2OV2A 3KL4A 2OFWA 4JVSB 2HLDD 5FL3A 1EFRD 1NY5A 3AVUA 5HKKD 4C0AC 2FNAA 4MKHA 1RRFA 4GOJA 1Z6XA 4W9MC 3HR8A 4MKIA 3RYTC 2C77A 3OEED 1E9CA 4OHXA 4IVRA 2XNDA 4BLTA 3R9XA 2MSEB 2IBMA 4CW7A 1CR1A 1IY2A 2FEMA 3OF5A 4BLOA 3UWKA 1CTQA 1E69A 1VECA 5F98A 2DPXA 3FHCB 1JB1A 1G5TA 2P0EA 2VBCA 2AL7A 4TL6A 4QC2A 3UMRA 2NG1A 2WSSD 4OI4A 1P2SA 2D2EA 1VG9B 2XAUA 1J2JA 1OHHD 5KYKA 2P5SA 2FEOA 1AA9A 4HZUB 1JAHA 4GDFA 2YOFA 1P9RA 3ADBA 1I2MA 3W5JA 5C1BA 1CXZA 4YMUA 5K8LA 4DB2A 1GFIA 1FUUA 1ZM9A 5EP3A 4PAQA 3RVBA 2ZRAA 3IIKA 4LDJA 2CDNA 4PSVA 3DO6A 1KYIA 4WBSA 1JAIA 2JLZA 3B82A 4P4TA 1S1MA 2JLYA 2CCGA 4IDPA 3CX7A 3GJ8A 1KY2A 2R62A 4QGAA 4BWYA 4D0GA 2O8DA 3CRQA 1M34E 3DKPA 1WF3A 1Z6GA 3WNCA 3THXB 1NL3A 3VHLB 2Q9BA 1GIAA 4M1MA 3OEHD 3UK6A 5FUYA 2JLQA 3HU3A 2OLKA 3BD9A 3EC2A 1ZC3A 4PZLA 2O8FB 1IBRA 1OYWA 1JR3D 3U5ZB 4B74A 1N3BA 2YZ2A 3K9GA 3LBIA 2VHQA 2VQSA 4F4JA 4DLZA 3FTQA 2ZYVX 2ZJ8A 3KUCA 2Q9AA 2HDNB 1Z22A 1TADA 2GETA 4LV6A 1PUJA 1Z2AA 5DN6D 1F48A 4S2EA 4A0GA 4A1FA 3AVYA 4A15A 3ZIAD 3AVVA 2IS2A 4OHWA 4W5HA 4ZPXA 3NWJA 5JZVA 5L8VA 4KCGA 3I4LA 3QVVA 4KYIB 1E9EA 1GOTA 2NMVA 4A2QA 3VKWA 3D3QA 4NYJR 3AM1A 5E4FA 4GL2A 4NDZA 2IUUA 5GADl 1BH2A 2EWWA 3K0FA 1Z0FA 1C4OA 2ZQ5A 3LWNA 3GFPA 1GL9B 2CVFA 2LCFA 4BFXA 3A8TA 2WPDD 4LPSA 3TAUA 3I72A 2FE4A 1NNEA 5JBQA 2R6GA 2DBYA 5J4VA 2J7PA 3W6OA 3O8BA 1A5TA 2Q3MA 3SJCA 1FX0B 3MCAA 3HPQA 2G0TA 5FPSA 5HR5A 5FL7A 1II8B 5TB5A 3THWA 1W44A 3K9LA 1UDXA 1IONA 2ZUBA 3GD7A 5TDHA 2ZUDA 4WIAA 3EWSA 1DAFA 1P6XA 2JLXA 4DSOA 2DYKA 2MMGA 2DFLA 3R8FA 2ZVQX 3N2EA 2ODWA 4FW9A 4N0DA 5CLLA 2BBWA 1ONBA 1ZINA 3QG1A 1ZNZA 4K81B 2DFTA 1D9ZA 1L4UA 3BK7A 3GLFB 3CPEA 3BH6A 1CEEA 2OM2A 2VHCA 1CU1A 1NBMD 2IYTA 1N6NA 3AH8A 2VP6A 1R8QA 2FSGA 3X1YA 4RD6A 1Z28A 1GZSA 4YMSA 1TL7C 4WAUA 3IILA 2VHJA 2BM1A 3NDPA 3IEVA 3VNUA 4AD8A 4FCWA 4JBYA 5LBIA 1AIPA 2OHFA 3FKSD 1Z07A 3IBGA 2ONKA 2X2FA 4JLDA 4C0SA 3KFVA 2Z83A 1UEJA 3A58B 3GEIA 5L3SB 3AVXA 1Q0UA 3O8DA 3QXCA 4PR0A 2QORA 1E96A 4DLTA 4C0QC 4Q7MB 1SVSA 4PPNA 4C4PA 5BXQC 5CDFE 1CLUA 3EZ2A 4E07A 1BMFD 5J4YA 2H8KA 4XWKA 4O0MA 1GVNB 4P4SB 1FMJA 2VA8A 1E9FA 1VCOA 1VDZA 3QXJA 2W2VA 1R10A 1ZUNB 5SZKB 2Q3FA 3QXXA 3R7WA 1DAGA 3ZVLA 4ZCIA 3FMPB 4C30A 2OLJA 4MDFA 2WJYA 3LX5A 3CW2A 4M2LA 4PZZA 5H1YA 4Q00A 2AKYA 1EGAA 3WBJA 1B23P 1DAMA 1XEXA 4GT1A 2OT3B 4BLRA 2VP5A 5HE9A 5CJPA 3A1WA 4FMDF 3EIEA 821PA 1HQYE 1XP8A 4RKEA 3PEYA 3QKTA 2H5EA 4AG6A 5SZHB 1E94E 3BB1A 1CRPA 2B8WA 5B2ZA 4A6PA 1S2MA 1GDDA 4TWZA 2IYRA 4HYYA 1A1VA 1GKUB 4LUCA 2J0QA 1DAKA 2AX4A 2IF2A 2RGXA 1XWIA 2XB2A 3RS7A 1CIPA 2J1LA 2DFNA 2ZS8A 1Z0AA 4XIGS 2RGNC 3RANA 3UATA 3GCGA 1TNDA 1XTKA 2GBLC 2REOA 1GILA 2RMKA 5EP2A 5J4KA 1CF4A 4HB4A 2GXSA 1E0KA 2ERYA 4OQMA 3T1QA 1SXJD 2A7QA 2J87A 4XD7A 1E1QD 3K70D 3K70C 1KAOA 1VPLA 2G88A 1FP6A 4KSBA 1DEKA 4UJ5A 2QZ4A 3A1SA 1G20E 1GKYA 3U3RA 3QY0A 1YZGA 4G5OA 4EFLA 3T1TA 4B48A 3ZS9A 1LS6A 2V1XA 5G53C 1E79D 1TUEA 3AVOA 3AUYA 1D2MA 1N6IA 3SZRA 5IHPA 4V0OA 1UEIA 3QPUA 1NBMA 2QE7A 3HDTA 4F4CA 2QM8A 1Q22A 4KVGA 4CEIB 2QTVB 5IRCD 4PTLA 4MITA 3KX2A 3O8RA 2C03A 1J70A 1RJ9B 1G8PA 1W1WA 3EZ9A 2D7DA 3U44B 1V5WA 3A36A 4CEJB 4NE2A 1SVLA 2JLUA 1OXTA 3LX8A 2AFIE 5B64A 2F9LA 3O8CA 2BVNA 3VHXA 1T3HA 2PT5A 2V8OA 3KB2A 3FKSA 421PA 3TNFA 1DAIA 4QHSA 2ZM5A 3C4JA 3UIEA 4R7ZA 1D5CA 4FIDA 3KUDA 3C16C 2ANCA 4LSGA 3KJGA 5FBRB 1QHHB 1TQ2A 4IHQA 4DCUA 2BWJA 3THYA 1Z08A 2FSIA 2JLSA 1QBKC 2QGNA 4TQUS 4B76A 1S9DA 1TF5A 2OCPA 4EJSC 4B33A 1MOZA 5EQTA 1P60A 1GTVA 3MUFA 5JSZB 3ECCA 1UKYA 3SFZA 1AGPA 5JEDA 2NZ8A 1CR0A 1LB1B 1WXQA 3KKOA 1KNXA 1KKMA 2AD1A 4KFUA 1U8AA 4P0TA 5J4HA 2JIZA 1U8ZA 3F3YA 1RZ3A 3GLIB 5AUOB 1MT0A 1VHTA 1X1SA 4KLZA 3MMPA 2P6NA 3PXGA 4TYNA 3O47A 2W6JD 3CR7A 2Z43A 2F1HA 2OAP1 2QPOA 2BC9A 3ADKA 4FMDB 1LVGA 3W6PA 3LV8A 3UG7A 2A5FA 2G83A 3PEWA 3IDQA 1TMKA 2GF9A 2VHTA 3T1VA 2NOAA 4WZ6A 3B2EA 5KSZA 1UKVY 1EXMA 4EPVA 1KKLA 2YWHA 2GAOA 3U3JA 1U98A 3OZXA 3GLFE 2G9NA 1S3GA 2DR3A 5CDFA 3UANA 4Q4JA 1OXSC 1ZIPA 4B32A 1Q20A 1R6BX 2A9KA 2ZS7A 3IHWA 4RKFA 2PMKA 3JVUA 3L0IB 2KWIA 4NZYA 1EK0A 1TEVA 2C78A 4HATA 1CJKC 3QG5A 3OEEA 4BASA 1A7JA 4HUQB 5AJWA 3I61A 1XPUA 4I1SA 5CK5A 2VP2A 1OYYA 1COWA 4H9GA 4GP6A 1WMSA 5FH9A 5LD2C 3TR5A 3AP3A 4M9QA 1CBUA 1ZMXA 2C2HA 2FMXA 1GP2A 3U3OA 1TX4B 3UWOA 2W58A 2O8EB 2GCOB 4Q02A 1Z6TA 3TBKA 4DRZA 2CE7A 1GSIA 4ABYA 1ZP6A 3QEOA 4JLNA 2CHGA 1IOZA 2ZRDA 5C46F 1GL7A 4BLQA 3A37A 4TL9A 1J8YF 1EFCA 3C8UA 4PPQA 4C9BA 4DHEA 1OB2A 3VKGA 2GHIA 1E9DA 3KKMA 2BMDA 1EESA 4G5RA 4IEEA 1DVRA 2WVJA 3AKDA 3LXXA 2XZOA 1U94A 4JVLA 4DEXA 3RSLA 4B75A 3TGPA 4H1UA 1PLLA 4C0HA 1E2MA 1XZQA 2R65A 1XMSA 2FGKA 3MWLA 4KO8A 3B7GA 4IOLA 2BBTA 4GP7A 2DCUA 4NBSA 5IK2D 2H57A 3NTUA 4QHTA 4WXPA 3B1XA 5FUWA 3UXMA 4DLYA 1IJEA 2PJZA 4LZZA 5GJVC 1SXJE 4DIDA 1N0WA 1LW7A 2PZFA 4GZMA 5JEEA 3SYLA 4ZKEA 3IIMA 4MUAA 3FB4A 1W36C 1V43A 3THOA 3KJIA 2IXEA 4ERNA 3K0SA 5GJCA 3KKPA 1DAEA 4MDEA 1UKZA 2HXYA 1P62B 4XD7D 4HEJA 1Z06A 3GFOA 4QGHA 3P4XA 5CYOA 5EXTA 1U9IC 5CIWA 1LV7A 1KNQA 2ZUCA 3MGCA 3CRRA 3VFDA 4JKYA 3Q9LA 4LJ5A 3GLGA 2JEOA 4WZBE 4B3BA 3PR1A 4DDUA 3NBXX 1KI6B 2ZEJA 1EG7A 3CO5A 1KJZA 1NI3A 2WKQA 5H8WA 2XTZA 1AN0A 4EAQA 3PUZA 4W5WA 3A4MA 2CNWA 3HPRA 4FI3C 2BBSA 2NQ2C 4W5JA 3QKRB 2EU8A 5E7MA 2QMOA 2ZR9A 4PQYA 1ZU4A 3BB3A 3ETLA 4XSGA 5D3MA 4A92A 1MR3F 1JEEA 5L3SA 1E2NA 1G3MA 2EQBA 1ZM3A 3F8TA 4O25A 4HAUA 4ZDWA 5FOTA 4D81A 3I3SR 2BEKA 3DOFA 1SZPA 4B2PA 2BKEA 1E2JA 4HUTA 4MQBA 2G1JA 3NXSA 1RKBA 4R2HA 4NHOA 4F93B 3BH0A 2CVHA 1T91A 2WWXA 2EVWX 1KGDA 1K5GA 3P32A 3LVQE 4PFSA 3UPUA 3D7MA 2V6JA 1ZCAA 2G6BA 5DYGA 3R8CA 1T8UA 2B8TA 3RHFA 1NKSA 2GK6A 3PUYA 4PO9A 1MO3A 1MRSA 4Z8XA 1W0JA 4EFNA 2FSHA 5SZIA 4A9AA 3KXLA 1JR3A 2ZR7A 3KQNA 4X8LA 3QQ5A 4MKGA 4IJMA 2XX3A 5FFMA 1HY3A 3IIJA 4MH0R 1XJCA 1YZKA 4R71A 4HZIA 1P73A 3GLHA 4KU4A 5JECA 2OEPA 4XSHA 4EUNA 2FPKA 2IHBA 4EJSA 3OEHA 1S96A 3TSZA 3FMOB 2D4HA 4M8NE 1IJFA 4U5XA 4IVQA 3QXSA 3SHWA 3HWSA 1PZNA 3ND9A 4EQ6B 1I2DA 2RHDA 3I8XA 3RDPA 2GKSA 5EP4A 3FWYA 4C3ZA 4QL3A 1YRBA 3PFIA 3CONA 3NIBA 4LX0A 3QEJA 2YWFA 1NY6A 1WE2A 1AJEA 3BBPA 1FFHA 3BRWD 2J41A 2OBMA 1MO4A 4JLBA 4DSUA 2RGDA 1R4AA 4TLDA 2XXAB 4TTRA 4XVRA 5FOVA 1DELA 4WZAE 4AYTA 3ZD7A 2X77A 3AGQA 1NJFA 4JKIA 3AUXA 3A1UA 5HZKA 3EZFA 4CT5A 1II9A 4YDHB 1NP6A 3BB4A 1N6HA 2GVZC 5J4LA 1RJ9A 3FVQA 3LW8A 2Q0HA 4TMVA 5FBLB 1FTSA 1FZQA 1MABA 1CJTC 4FN5A 1AS3A 1E2LA 4TLBA 5AJXA 1XPRA 4GMXA 2A5DA 1OE0A 3BH7A 4UNPA 4URUR 2JGNA 5E7JA 2XSZD 3NC0C 1T3LA 5L3QA 2G0NA 1E1RA 2WM9B 4X8OA 1U8YA 2FA9A 5J5CA 2ATXA 3H4MA 2Z5FA 4A0FA 3W6NA 2FH5B 1SGWA 2ZRMA 4HI0E 4A8JA 2FZ4A 2P67A 1G21E 4QGGA 2W2XA 4BRUA 1NIPA 1QHHA 5EUMA 1CRQA 1NVWQ 2R6AA 3TK1A 1Z3IX 3DM5A 1A82A 1KHTA 5FI0B 1ODFA 4RD2A 4DSNA 2CCKA 3TW4A 4RCZA 2ZS9A 4C2UA 1E0JA 2F6RA 3BAFA 2NPIA 4LJ6A 5A5GA 4QJ5A 4ARZB 3TIFA 1I4LD 2OSBA 2QSYA 3R9IA 4F92B 5LD2B 1Y3AA 3TSWA 5K8TA 4I1UA 3LAWA 4F38A 4JL5A 2NPFA 4BGDA 1DE0A 3B1ZA 3LD9A 1ZNYA 2OESA 4R2IA 3U61B 2K5UA 1OFHA 2NO0A 4AKHA 4LJ4A 1PJRA 1RYFA 2WWYA 3RS3A 5DI9A 2IXFA 1HYQA 2ZRHA 4C0BA 4DDTA 4V0KA 4PQRA 4YXWA 3VU9B 4MRVA 1RPZA 1FW6A 3U6KA 3DVLA 3HP1A 2DFKB 2F43A 2HUPA 2REXB 2FN4A 3M6AA 3NBYC 1JJ7A 4LJ7A 4MYUA 2V4ZA 4MRRA 2O0HA 4ZI3A 3GJ5A 3NDBB 1YKSA 1NJGA 1M7GA 2IYYA 2GEUA 3CZQA 4BFTA 5G40A 4YXWD 2MMCA 4LBZA 1W0KA 1Q3HA 4MGZR 1AS0A 1IXSB 1ZD8A 1A4RA 4C0LA 4F4IA 2ZI9A 2H17A 4TMTA 1JECA 4X8HA 1R5BA 2V6IA 2GJSA 4KI0A 2JJ2D 4R98A 1ZYUA 3I92A 3TAHA 2OILA 3SFVA 3H1TA 4H1VA 1BS1A 3HR7A 1Q12A 4FXPA 2ZU6A 3QENA 4NCIA 4OQLA 4NCJA 5CITA 1WRBA 3FMFA 3EASA 4IDOA 1OXUA 1UBCA 1N5JA 3EC1A 4FD2A 1TU4A 3WHLA 1KDPA 1NN3A 1E2IA 4TQAA 4Q1EA 4B3CA 1H8EA 4YONB 3PUXA 1ZC4A 2V7QA 4IOMA 4EPRA 4BUJA 3AVWA 3IEUA 5FPHA 2WSSA 4DT1A 5HPYB 3CR8A 4DLSA 3GJ4A 3ND8A 2P3SA 2WIBA 5FOUA 4YMTA 2C04A 2O5VA 2I1QA 3D6TB 1XPOA 1ELOA 2Z4RA 3DDCA 2FWRA 2X8AA 2GEDA 5A0FA 3TRFA 1PLKA 1KJWA 2QM7A 2J0VA 3OIYA 1OFIA 4RD1A 2EYQA 1UM8A 3AVPA 2IX3A 2BMJA 3A4NA 1P4SA 4M22A 1GNPA 3AKCA 3MSXA 3CPHA 5DHAA 2ZE6A 1EFRA 2W83A 4PHGA 4DIEA 3LQRA 4AKGA 4PZYA 2VF7A 2CLSA 2AXNA 2EWVA 3T06B 4M1TA 2G77B 1WDTA 4MGKR 4JZKA 3CNOA 3EIQA 3D31A 3L82B 3WMFA 3FKQA 4C0KA 2WHXA 5KNBA 2OFXA 3GEHA 5DH9A 1OW3B 1KI1A 2O0KA 3P1JA 3EX7C 2F7SA 1KI4A 3I1FA 5P21A 1TU3A 4Q1DA 4V03A 1U0JA 1KI8A 2AN9A 3M4YA 4M4SA 4Q66C 4YC7A 2V1UA 1ETUA 5TMPA 2CNWD 1NLYA 1QHSA 1UBEA 2ZI6A 3E70C 3M0EA 2QPAA 2WWFA 2BIFA 2JJ1D 4A4DA 1F2TB 1OH6A 3CNNA 4BFYA 3B5JA 4NYIQ 4MRPA 1DG1G 4UXIA 4ON9A 1IAQA 3OAAA 3SC3A 4JLPA 3OHMA 2CE2X 3KB1A 1E2HA 3REFA 1WB9A 3WHKA 5FTJA 2WIAA 2F3RA 3QSYA 1NVXQ 4ZIRB 1OH7A 3K09A 4OHYA 4XH9B 1P7CA 2WWWA 2WJJA 3SR0A 4DXAA 2WAXA 3QI2A 4DEYA 1EWQA 4JLAA 4JJZA 1L8QA 1JBKA 2J7KA 1HV8A 4KFRA 5FR2A 1P5ZB 4M1SA 1VMAA 3KXIA 2QBYB 2OE2A 4NH0A 2F3TA 4D80A 4KJZA 1N5KA 2QENA 2BMEA 2KJQA 3FDIA 3Q3JB 1PV4A 2R6FA 3CRMA 4OL0A 1KO5A 1XRJA 2ZREA 2AK3A 3MFYA 5D3QA 2P6RA 1G17A 1XTRA 4LV8B 1NSTA 4P3YA 3T5DA 2P5TB 3ZJYA 3ZZTA 3X1ZA 2RCNA 3FFBA 3K9HA 1XEXB 1XBTA 1E99A 2ZJZA 1R7RA 4C0JA 2ZRPA 2YNMA 3T15A 4QOSA 1CP2A 1GRRA 2QU8A 4AIIA 1RRPA 2RHMA 4PC6A 3GLHE 1WQ1R 3DZDA 1KI2A 5DI3A 2WPDA 4JBXA 3RABA 2Z6VA 3EPKA 4P33A 1FL9A 1TF7A 3VKHA 2YKGA 3BIFA 1SVIA 2ODEA 1ZUHA 1G7SA 1ZNXA 4B35A 2AKAB 4V02A 3B1WA 1BIFA 4Q4HB 1J7KA 1Q3TA 2BM0A 4TL7A 4EJSB 2GRJA 4FINA 2GXQA 3CF6R 1H8HA 4HAWA 1E2QA 2GZDA 4TLCA 1Z0IA 3CH4B 3HYTA 4L15A 5C18A 3ZVNA 1G16A 5SZJA 3E5HA 2ZRBA 2ZE7A 4AURA 4Q9IA 5DISB 2ZJYA 3QPWA 4N3NA 4HAYA 1JXOA 3K0CC 2PCJA 1RYHA 2KB0A 4M21A 4PANA 3SS8A 1K6MA 4BE7B 3DMNA 3WBKA 1W7AA 4DSTA 5AUPB 1RW4A 5G3ZA 1R8SA 4LJYA 5AJYA 2O8BB 4PHHA 4MYCA 4O2RA 4W7SA 3RRYA 3GMTA 3QJYA 1ZVQA 4D0LB 1ANKA 3EPHA 2YOHA 4CT4B 4TTQA 3P20A 3BJIC 3L0OA 1TQ6A 4HLUC 2WTUA 4KVAA 3ZVRA 1GRNA 5IK2A 4LHZA 1X86B 2GZHA 3A1TA 3X1DA 4X8MA 2QSZA 1W4AA 1ZU5A 4QM6A 1CULC 4HDCA 2LKDA 3PUVA 2ZIAA 1WCV1 3F0TA 3TJZA 5KU1A 2VH5R 1KSFX 1YZUA 2KE5A 2G1KA 4FWTA 3Q5EA 2GVDC 2IWRA 2B7CA 1RC8A 4Z1MD 1Z6YA 4N1AA 4QBHA 4D26A 3KJEA 3M1IA 1SULA 4AC9A 5DNYB 2NTYC 1PUIA 2W00A 3VR2A 4DCSA 1EFUA 2ZRGA 3C7KA 3RSOA 1OPXA 1G5RA 4BECA 2ASEA 3G0HA 4Y0VA 4HAVA 1GWNA 5JSZA 4YLGA 3KTAB 4ARZA 1WP9A 1KZ7B 2QAGB 3B78A 4XWAA 4Z1MA 4PXAA 1KJYA 1XMVA 2LWIA 2ZRFA 5H68A 5KSPA 4B73A 3A1VA 5CYPA 3IKJA 3ASYA 2XTMA 3P26A 1P9WA 2ODNA 2R2AA 3THWB 1AKYA 3L0SA 4URVR 5L3VA 3NH6A 1F3OA 1EFHA 4Q4AA 3CZPA 3NC1C 2W6JA 4CYMA 3KKNA 4OKSA 3S1AB 2RGGA 4TT3D 5M04A 1XD2A 2BJWA 2VRWA 5FI1B 2UZIR 1IY0A 3NG1A 2ZETA 1W0KD 1Q1EA 3DL0A 3VR3A 1G3RA 1AM4D 1W5SA 5FBVB 4JSTA 5JCPA 4RD0A 2QTFA 2FFQA 1YRAA 1DAHA 1VKJA 2HYDA 1G4AE 4Q7LA 1CS4C 4TLAA 1OKKD 5BN5A 2HYIC 4LJ8A 4PSKA 2BKUA 4LHYA 2FF7A 3U7HB 1TEXA 1QHIA 4V0NA 4RFVA 4JLMA 2V55B 1N0UA 5JJIA 1N5LA 2B92A 2H7VA 1NN1A 5FPTA 1YZTA 1NBME 5JLJA 4UNRA 3EIHA 2JDIA 4URZR 4DKXA 4OK5A 4TL8A 1KOFA 1E2EA 1E9SA 4G5GA 3ZS8A 3QBVA 1XCPA 2AXPA 4RZ3A 2NGRA 3E1SA 3FPAA 4D0NA 4NL4H 4RJLA 4Q7KA 4TT3A 1VG8A 2IYQA 2JLVA 3R9WA 2HLDA 4UNQA 2B7BA 2V9PA 5FPKA 2MSDB 2GCOA 1S9HA 5UKDA 1VHLA 3FFAA 4DVGA 3U4QB 3NHBA 4TYYA 4PHFA 2ZANA 1T0HB 4NYIR 2Z4SA 1KI3A 5AR1A 3QPVA 4HAZA 5TARA 4CEHB 3AVTA 3G5UA 5J47A 3C5CA 1S4QA 5EP1A 1R0WA 1G8YA 5BW8A 3SQXA 2WAYA 8OHMA 1II8A 1XXHA 1XD8A 3BC1A 3H84A 1QDEA 5FTMA 1E2PA 3SEAA 2OAQ1 4IFEA 2ZRJA 4QRHA 4PO8A 1E9BA 2HCBA 1GAJA 1VYUA 2XSZA 1N25A 1W48A 3IGFA 1KO7A 1Q21A 4MA4A 3U60B 4O2LA 4PC2A 3ZD6A 1VG0B 3I32A 1EX7A 4RVCA 2PL3A 4A0RA 4IEIA 2ZJ2A 4EPTA 4KLNA 1US8B 3PVSA 4KBFA 3EA5A 3NKVA 4RD3A 1KDOA 4BFUA 5TV2A 4IW3B 4B71A 2AHOA 5G3YA 3EPJA 4NYJQ 1SVOA 2QP3A 4BQSA 1OT3A 3JZAA 3TVTA 3DEFA 3LH5A 4DCNA 2QP4A 2YYZA 5AUQA 1XF9A 1OV4A 5HCIA 4AWXA 2HT1A 1NVVR 4GOKA 5EZ6B 2P2LA 4RZXA 2E1RA 1COWD 1Z0DA 1G8HA 3ASZA 4IRUB 4WOPA 3TR0A 4BLPA 2NZJA 3LW7A 2IA5A 4B6FA 4ASUD 3GLGB 3MAAC 3H2YA 4L9WA 1TF2A 4RFSA 5DGXA 4TYQA 4ZCMA 1YR8A 2IHYA 1E32A 1KI6A 2PCLA 1M6NA 3IPYA 1G6HA 2ZYUX 3LVRE 4ZO4A 2GESA 4QXAA 4I81A 4IOJA 2J45A 1IHUA 2UKDA 4JLVA 2GTPA 1CJUC 2Q3HA 3LLMA 3NH9A 3TQCA 2J3EA 4OBEA 1AZTA 2V3CC 1KMHB 1KMQA 5FTNA 4ESHA 1DO2A 2RGEA 1ESNA 1P2VA 1G7CA 5D3MB 4Q1AA 4BEJA 3WMGA 2HT6A 2WICA 1NVVQ 1Z29A 4L8GA 1W49A 4BZPA 1VYVA 3RRZA 2AWNA 3C41J 4DLRA 2XJ9A 5GVSA 1XTSA 2A3RA 5KNDA 4OI0A 4HLUA 1IXRC 5KHOC 2J0UA 4GRAA 2IT1A 4LGMA 3ADDA 4ZDJA 1G64A 2L0XA 1W36D 3OAAD 1OJLA 4MYHA 2PZEA 3B8HA 1Q57A 3TSOA 2WMNB 4G3XA 4XTRA 2B6HA 4CVNA 1N6OA 5EE9A 2WBLC 2XOKA 3EA0A 4AK9A 1YZLA 2FPMA 3K09C 3MD0A 3W8NA 1Z47A 5BWMA 1ZIOA 2J0SA 2ZSEA 3GLIA 2ZVPX 1G19A 1H65A 1VCMA 1YE8A 5JJKA 2XNDD 1G8GA 2FGJA 2QEQA 4UQOA 5DSZA 4ACAA 3LRPA 2CLCX 3CRVA 3ZZ0A 4IXMA 2QAGC 4QBFA 3GLHB 1F60A 3ZDQA 4NYMQ 4TYPA 5CB8A 5JRJA 1SHKA 3AF1A 1TAGA 3IQXA 5DO9A 4DLVA 1E9RA 3LBNA 3KDSE 3U3MA 3U2QA 4E22A 4EFMA 4WA7A 3AB3A 1TTTA 2ZRNA 2OZEA 1DG3A 4MRNA 2ZSDA 5AUNB 4HLCA 4OHVA 2Q9CA 4E5UA 1FNMA 3LDAA 1OIVA 1G291 1BMFA 4MUBA 1G4UR 4DCTA 1XJ0A 3L8ZA 3QKSA 3RRMA 5EZ5A 4XWOA 2J9RA 1FUKA 1U2RA 4A36A 1NMYA 4D2IA 4C2TA 2H1LA 2PH1A 1LF0A 2WJGA 4KFSA 2HCJB 4Q9JA 1X8KA 3UMSA 4QNMA 3VAAA 3CF0A 4RY2A 2KSQA 1OHHA 2P6UA 3EPLA 4UNNA 4B2LA 2EFEB 2FZLA 4OI1A 4B47A 1ZW6A 2EFGA 3B60A 4MGIR 4Z51A 2QT1A 2GILA 2WV9A 3K9NA 3ICQB 4TMZA 3K0AA 4HB0A 5DYIA 4K46A 5CM8B 5KDOA 3I5XA 1XEFA 2GA8A 3QF4A 2A5YB 1HEIA 4JS0A 1F2UB 4B2IA 1UFQA 4LC1A 5EJEA 4G01B 2IYSA 5EE5B 3U6BA 1HUQA 1MABB 1Z0JA 2FFHA 1GNQA 1W2HA 3EWAA 1W4RA 1KK0A 3LBHA 4Q4LA 1E4VA 1KSGA 3AV0B 4CRWB 4DWJA 1NG9A 3T35A 1HQCA 2JAQA 3B1VA 2W2TA 4L16A 1M7HA 2A5JA 1L4YA 2X19A 1A2BA 1W46A 4G0NA 5KSOA 3SQWA 4MGYR 1K8RA 2XEXA 4KHZA 1T8TA 1UKEA 2CEAA 5HE8A 1XFAA 3MWYW 2YC2C 2VIIA 1N6PA 2QE7D 2BV3A 2IXGA 2N1BA 1VCNA 1LS1A 1D8TA 2AK2A 1JPJA 4M1WA 5DLQC 3RS4A 1SHZA 2FV8A 5KTYA 4G1UC 2WSMA 1R0ZA 4BRWA 2WKRA 3BERA 5JWHA 2QAGA 2OBLA 1Q1ZA 1Z2CA 3LQQA 1AQYA 5EE0A 2YWGA 3SNHA 1Q1QA 2V54A 3RNLA 3BS4A 2C9OA 4AKEA 2IYWA 3FHOA 2VHUA 1KK1A 2IEYA 3ADCA 3VR4A 4F91B 5JRZA 2RB4A 4Q7JB 2D06A 2AR7A 2ZYWX 5KDLA 3QE0A 1QHXA 1XCGB 3GJ6A 2BJVA 4B43A 2EW1A 3S1AA 2CJWA 3VU9A 4KITB 1J99A 2C98A 1KY3A 1J90A 1XB2A 2WMOB 2XOKD 3THXA 3GLFA 4LY6A 1G9XA 2GNOA 3CRW1 4UXHA 2NO9A 2O8EA 3H0KA 2QY9A 3BFXA 3I5YA 4OQFA 1N2CE 3ZQJA 4D4JA 2O8FA 1YR7A 2ERXA 3G82C 1C1YA 3PENA 4B3FX 2JA1A 1IM2A 3MJHA 2YINC 2KBFA 2GAAA 3OESA 1JQLB 5FTLA 2PEYA 4LRWA 4P32A 3PV0A 3SDZA 4BZQA 3TQFA 4DUGA 1SKQA 5DN6A 5TY0A 2ZRCA 1CR2A 2QT0A 2ZAMA 3IQWA 1P3JA 1W2GA 1C9KA 1E1QA 2AD5A 3IHLA 1SVMA 4CDGA 2H92A 1QZXA 1AS2A 4KAXA 2D62A 3PCRB 1NIJA 5HTKA 2KI5A 1X8LA 2FU5C 4JSYA 3V00A 5ELXA 2A5GA 4EPYA 4ZV4A 1ZD1A 5E7IA 1U0HC 2X2EA 2FFAA 4KODA 3KQKA 3P27A 3PUWA 5H70A 3WY9A 1ZM7A 3K0FB 2FX3A 4M1OA 5TVKA 1G7TA 1H8ED 1XTJA 2JCSA 4KFTA 4MKFA 4B3DA 4QG7A 2KBEA 3VTKA 3U4QA 1Z63A 2TMKA 4JMPA 4AI6A 1OH8A 4CEHA 2CK3D 3V4FA 1FQKA 4OHZA 1E0SA 1M74A 2CMKA 2Q21A 2ZJOA 3NEYA 3RS2A 1AKEA 1G6OA 2RGAA 2GJ9A 3A6PC 4US2R 3QIAA 1YR9A 4NPHA 4POAA 3Q85A 2VL7A 1KDRA 2C5LA 4JJKA 5AK0A 5LB4A 4C7OB 2W6ID 1HE1C 4Q9HA 4UKDA 5FUVA 3ONWA 3KJHA 4Q1BA 3AF3A 4JYBA 1P9NA 2OFOA 2YHSA 2IUSA 2DY1A 2J46A 4AYXA 4QHYA 2ZROA 4YMWA 1GG2A 3GJ3A 1TQ4A 5BN3A 4GOXA 3SBDA 1MO6A 4TTPA 3B6EA 1AK2A 3SBEA 1R2QA 1YVDA 1IY1A 3IBYA 1GKIA 4IDQA 2ZE5A 4XJXA 2IYUA 2WWGA 4KXFB 2FPLA 4M9XA 3LA6A 2OO7A 2JDID 2FDCA 2QPTA 3TE6A 4Z8YA 4Z54A 3QOFA 4URYR 2W0MA 5JWRA 2FJUA 2VO1A 4PAOA 3E2IA 2C9CA 1L7VC 2CL7X 4GZLA 1FMLA 1I4TD 1X1RA 4IDNA 4XTCS 4BFWA 1U81A 3UKDA 2VP0A 4XVUA 2PZGA 4WW0A 2JJ2A 3SYKA 1E2KA 1XU4A 1T5LA 4NTZA 3R7WB 1XMIA 1YZNA 1IN8A 4V0LA 1E6CA 1BYUA 2IW3A 4CEJA
chains in the Genus database with same CATH superfamily
1U4NA 4NONA 3R0ZA 1XV5A 2LRHA 1H1LA 1SFRA 1G6Q1 3RQIA 1N2XA 3WYAA 3A4LA 3INGA 1RM0A 3NHAA 2WSLA 4JDPA 4RFLA 4EATA 1K7YA 1QE3A 2QVBA 1OXXK 1Y8RA 4YT2A 1RI3A 2WMDA 4K9RA 2PL9A 3OJOA 1UADA 3K72B 4PIVA 4QULA 1I4WA 4LRXA 5C7IO 1EIZA 2D54A 3ORYA 1R8JA 3V4RA 3RIYA 1KSJA 1RRKA 2EWMA 3AEKB 3NALA 3Q5DA 3R3YA 1ZCJA 4YJHA 2VTKA 4JASB 3ZGOA 2XMBA 2CZCA 3EISA 5DE3A 2XQKA 3RT1A 3UVEA 5KPJA 3F4KA 3T34A 2GHRA 3UQZA 5KX5B 4M98A 1WDWB 3IX7A 3P4UA 4PXYA 4WKBA 5JS8A 3QMVA 3N8GA 3U7GA 2VDLB 5EMNA 1W5FA 2YYYA 1V6SA 3RRNA 1AUVA 1GFZA 3OJLA 4BFVA 4CUZA 3VOSA 3O9ZA 1XTTA 3MB8A 4AF8A 2XVZA 3CUVA 5HZHA 1SAYA 5CT8A 2IP4A 4BOYA 2J3DA 2IV7A 2D6FA 1Q16A 2FZVA 1H1DA 4ENPA 3A1NA 3PR2B 3CF2A 5DM60 2P2ZA 1JFVA 4KE7A 2YDYA 1QGUA 1XF1A 2O2JA 4GMDA 1G18A 3HYLA 4P3KA 5HDBB 4ZDKA 2IYOA 3D1LA 2ZITA 2R47A 2YW9A 4JP2A 3TMYA 3RFFA 1JQEA 1KTVA 1QIKA 5KX5F 1KVSA 2O6HA 3ODPA 4K2HA 1OMOA 4YDSA 1JEOA 5AH0A 3SQDA 3CWCA 3W77A 1N2HA 5DI3B 2BEUA 4JLOA 4R2WA 1NLFA 4YGXB 4FC7A 4ITRC 3K53A 3P19A 2ZB3A 3K05A 4X1YB 3HJGA 2O7QA 4CQLB 1RM4A 2Y1XA 4BAZA 3WLFA 4DFDA 2ZJ5A 4EKDA 3EXHC 1DBWA 1NVMB 3I5AA 1G8MA 2QMEA 3C8ZA 3CX3A 3NEAA 3ZWQA 2CV1A 4CEIA 1CDEA 5TEVA 3NDIA 2NX2A 2PVCA 5LL6P 1FMTA 1IPEA 3VR1A 1OLUA 2VPZA 3U7FB 2AQHA 1WHTB 1JF8A 2QI9F 4QDOA 1YOVB 4US0R 1RZRD 4G85A 5GJBA 3A3KA 4G65A 3F8WA 4GLFA 4M1KA 3Q7QA 3WK4A 2AZDA 5FEUA 2O1SA 3H2SA 3Q8WA 2B4RO 1VL6A 4RA6B 5DGHA 3RUAA 5JMPA 1G20B 2XMRA 4ZOLF 2RCYA 3KLNA 6PFKA 4NCAA 3HCCA 2YC4C 4RSGA 3AERA 5HKKA 1IRIA 3ZE7A 4XJVA 1FUIA 3V5NA 3MWJA 1FP4B 1C9EA 2RGBA 1E4EB 3WLTA 3TXYA 1TYBE 2IOFA 4KWIA 1L5GB 5HMMA 2ZRLA 4U7FA 3LQ1A 2ACEA 1QG2A 4FB5A 3UOGA 3G2IA 4R1SA 3OICA 4EB6A 3CUEF 3QY9A 1A9PA 2PJRA 3LGAA 2Q8NA 3SJZA 3TUIC 1BVYF 4RHYA 1Q0LA 1YJAA 4IVPA 1JEYB 1AQLA 2Z2ZA 1C3LA 2AGVA 3QX3A 1A9QA 3MYYA 1NDHA 4XUEA 3ZCRA 3PG5A 1IOVA 1HDXA 2H6EA 1DWUA 1E4YA 1DOAA 2V5UA 2PT7A 2YJNA 4P6VF 3CX6A 4CLRB 3VA7A 4NU8X 1EDOA 3WK9A 1K5DA 2XRMA 2RB5A 1EWTA 3HCDA 1U3UA 3NJRA 2PU5A 3LGXA 3GMDA 4FX2A 5ARDA 2OCIA 2Z57A 4LZOA 4QDZA 3VYRB 1FX0A 4DCPA 4Y18A 5AQ1A 4WKOA 1MJFA 3LO8A 1B74A 1H22A 4LYHA 2Q27A 1KI9A 4EA7A 3LNCA 1BN7A 1T4GA 3C4QA 4IFBA 5A05A 4CR8A 4WJZA 5KS2A 1TDJA 4WJLA 2WAOA 3STHA 4UM9D 4W5QA 3UMJA 3V4ZA 3BXEA 4L0CA 4P38A 3F49S 1RXIA 1UANA 1LX6A 1TOAA 1YD7A 4Q93A 2RHLA 2WYOA 1HSOA 4ESVA 2JIRA 5LR6A 4PYQA 2VJYA 2D74A 3WRYC 3TQQA 1QRRA 1CLEA 1TPZA 4MJ7A 8GPBA 1PEYA 2I3ZA 3J7TA 2IPMA 1ODKA 2ZUFA 2FW0A 1UMKA 1YZYA 3JQ8B 3RIGA 1OXVA 2QX7A 4NZMA 2G9QA 3DFIA 3TXXA 3GP8A 4QBIA 3L6OO 1KMIY 2FW8A 3UK7A 1TM4E 3M5CA 2A2ZA 4W1SA 3SF8A 1R8YA 1HLPA 1MXHA 4MPDA 2F1JA 3EXIA 2Z04A 5HS4A 5JZOA 2WF5A 1E1DA 4LF7B 2QZZA 3GEEA 4UFNA 3HU5A 5REQA 1V8DA 1EFPA 2QOEA 2PYDA 1USVA 2J5XA 5AVYA 1R6UA 3NUGA 5K99A 4BGVA 1PKXA 4X7MA 1ZCBA 4ZQGA 3HUUA 2GSWA 4ISBA 1TT7A 4LX8A 3IQHX 1DI0A 2DHRA 1MD9A 4EEXA 1YB7A 2YBDA 3R3HA 2IK8A 1P2TA 4AY6A 2R84A 1JI0A 1AXEA 3KEMA 3HADA 3PEUA 3CLSD 3EZLA 3EAQA 1GCIA 2IZZA 3DOEA 1O6FA 3ZXYA 2FDRA 3UAWA 3WQRA 4Q9DA 3CX8A 5EWLA 4GDMA 1YFLA 1SVWA 4OXNA 2HPZA 5IARA 4YRCA 1E9AA 3EARA 2VF4X 3OX1A 4IXNA 3V8PA 3RHZA 4UUOA 3DMGA 4FNGA 5ITSA 4EL5A 3UJNA 2HHLA 1WL8A 4DCVA 1EK6A 1E62A 2OV4A 3H9GA 3IXQA 4Y30A 3DT8A 1M75A 3TIIA 3K71B 2UVQA 2OXFA 3INTA 3KT0A 4LMBA 3L0PA 4H1HA 2FUCA 3CNLA 4XX0B 3UMFA 4DLKA 1WBBA 3QUTA 4YCJA 5K0TA 3OIVA 1KVRA 3DHWC 4PZAA 4GNKA 3WGJA 2IXAA 1EB9A 3MTDA 1KE1A 5F1KA 5AICA 3DVSX 3LYUA 5FPQA 3JWJA 1WXGA 5THQA 4JELA 3KEGA 5J3JA 1ECFA 1DCFA 1Q1AA 4YJGB 1PL7A 5ARCA 4QOIA 4CCAA 4FSHA 3WK5A 4NCHA 4I99A 3MT9A 3KU1A 1SXGA 3KQTA 1LSJA 3VVCA 2GRAA 1FFEA 4UXJA 1OC2A 2PYZA 3SE7A 4UD2A 1YQWA 1G9TA 2GCPA 2WP8J 5SYNA 2DWQA 2F1IA 1EFLA 4PBTA 1XRMA 5E6UA 1JG3A 3VJKA 4C2AA 4DZZA 4UZFA 3RUFA 1LLFA 4OBXA 1KZHA 3RVRA 2XQIA 3MGAA 4O63O 2L42A 4ZEWA 1G60A 5SYMA 1AK9A 4NFHA 1Y5LA 4JC0A 2OXTA 3KXPA 5LLDA 1BOFA 1MEEA 4FMBB 2JLWA 1N7GA 4W1RA 3L9XA 2ZZMA 2YVQA 1D7AA 3VPCA 1SQGA 5FAXA 3GUHA 2JFQA 3NASA 5TQ0B 5B5SA 4PRYA 4DWWA 3N70A 4BP1A 1UWLA 4TPKA 3TKLA 2QN6A 3K9WA 5CK4A 1DC7A 4U3JA 1XTPA 3W3AH 3OE1A 3ZGNA 2ZYGA 2Q5EA 1LU9A 5D7NA 5E4YA 2GX6A 4B3RB 4HJXA 1WMBA 5AM5A 1XTZA 4D8XA 3L07A 1GRVA 1M6EX 2A57A 2C59A 2JRLA 5CB0A 2MHCA 4CMIA 2X0NA 5EXXA 2I9PA 1C4XA 3AF4A 1RHMA 4PPGA 3TLMA 2NSYA 1N0VC 5JZ9A 2NO6A 1JEQA 5HXAA 1FOEB 1JWLA 2CLDX 2ZDGA 2I1WA 2AKEA 3QUSA 1T9HA 4YR9A 1YI8A 5AKEA 2C8VA 2XB9A 3MELA 4N5IX 4Q1FA 2HFKA 1ULTA 3VPSA 1M2JA 3BOSA 1RWBA 1F5SA 3IBTA 4J0DA 5EQJB 3ZGXA 3HY4A 3V8VA 4CF3A 2R1VA 1Z8FA 1ACMA 3RU3A 3Q0IA 5IDQA 3RVJA 4A0SA 1ZBDA 2AN1A 2IWHA 2EDAA 2PD3A 2PLRA 4ZAFA 4MYTA 3PIRA 2NYAA 121PA 4MWSA 1L4MA 3N2KB 4XCXA 2RGNA 3WAJA 5CVDA 1T5TA 4PSCA 4ALMA 1GGJA 2B21A 3HKEA 1DC4A 1HL7A 2REBA 4AZ3B 2ZE8A 4B81A 2XVXA 5LP6A 1QHNA 2WSBA 3MCWA 1PL6A 3OZBA 3B6JA 4JT8A 4QGBA 1MVLA 2AG6A 2I2WA 5LYJA 3DLBA 3T9EA 2W0SA 1OTYA 1RIFA 1W4BA 2P69A 2OK7A 3LUPA 4IHAA 3ZJ5A 3E8SA 3L4SO 3P5BA 4QXPA 5EYPA 1TPYA 2IU0A 4ALLA 5JJLA 1C30B 1NPDA 3L2OB 3QJ5A 5B12A 3ZCUA 1QXSA 3KHSA 4D4KA 2XT6A 1OJ7A 3WWZA 2GCNA 4DA6A 2PU7A 5DM1A 2HBYA 1XK7A 4K6HA 1ORRA 1T4MA 3WOHA 4BQOA 2Z6QA 1OXKB 2JBAA 3AI7A 2YZ7A 1RFLA 3EF0A 4NCNA 1HRKA 1T1RA 1VFPA 3D7SA 4EM6A 5TPWA 2H2FA 4GOMD 4N5MA 2RBEA 4CLOB 1XEWX 2PQ0A 4OLAA 3EZ7A 1PJ4A 2SKCA 4XOIA 1QO0A 4CQMA 2VTDA 1ISIA 4G1BA 4DDHA 4HH3C 4YO8A 5A4JA 3JAKA 2XCUA 4HYTA 2HF8A 2X2OA 2D3WA 4E2FA 4DJTA 1JZQA 4M37A 4FOPA 1HKHA 2IIBA 1M3SA 2DX7A 1AGRA 3AJ9A 3FBGA 3QA9A 1FRQA 3DT6A 4K87A 2DFDA 2E85A 4HDKA 5H0IA 3R75A 4D96A 4Z6KA 8ABPA 3KETA 3AINA 4E5KA 4RZHA 3TKYA 4GF5A 1A7UA 3ZW8A 1R3UA 1JPNA 3S5UA 1YB6A 4F2GA 1J06A 4DVJA 1EKXA 3I1YA 1IQPA 4F12A 1HDIA 1SIOA 1S8FA 4HD8A 1WOYA 4RIGA 1T0BA 1JKIA 1YCFA 2ZSFA 4KQCA 1J0EA 2J6HA 2YWCA 4W4TA 5DP2A 3TJMA 2JW5A 4CGZA 3AR5A 3WBFA 4JV5B 4FQ5A 4Y2SA 1F6BA 3EEIA 1F4VA 1SKYE 3IUMA 4PLPA 3W5DA 4RDIA 3M81A 1DCKA 2QE6A 1KEUA 2X4LA 2Z2XA 3OP1A 1R5NA 2MWMA 4HUQA 4K0RA 3WGIA 3OG9A 1BGVA 1UBFA 5A9SB 4UU7A 1XD2B 3HVRA 3TOVA 1UAAA 3WICA 1TXGA 3L3BA 2ZUSA 5D00A 5IDVA 2ZYHA 4KO3S 2C4TA 4QQ8A 5DSTA 2PNJA 2DBQA 3V7WA 2A0KA 4UZSA 5J5VA 2IS1A 4QQRA 5EKXA 1E1NA 2OP1A 4QFMA 1GGMA 2PV0A 3O4RA 4FYVA 2VP9A 5A2QA 4F9FA 1RAFA 4E4YA 3HSSA 2VWPA 1AQUA 5I7AA 2G08A 5IEBA 1ZNWA 1O7JA 1GPLA 4LVUA 4MK4A 4BFZA 3QLVC 1X8JA 1Y6QA 4KN6A 1OT5A 5K8UA 2X6QA 1R0RE 2W7TA 4WZBA 2FJPA 2W48A 4IL5A 4XLLA 3ZBQA 4DC9A 3RYCA 2I1VB 4OJMX 1YGYA 2RGCA 4QZVA 5KVCA 3TQOA 1KEKA 3VJRA 5DLEA 4N12A 1JQ3A 4AG5A 1V16A 1U9IA 3DMYA 3DTTA 1ZD4A 1WBDA 4ZGWA 2FKNA 3RS5A 4LYJA 2ZWIA 2O0MA 4TXMA 5FQOA 2HEIA 3OZDA 3SQOA 3VOTA 4BE4A 4BGIA 5AVVA 1GAXA 4P92A 5T5QA 1TCCA 4LSMA 1CJCA 1ZLYA 4LNUA 2ZM6B 1V6CA 4C4SA 5AW4A 1LKZA 2WZDA 2YXPX 1OLXA 4YROA 5EGSA 3N58A 1Z7GA 5JPDA 3EOZA 3FG9A 4GI7A 5E3JA 1LW6E 3EVBA 4L8YA 1G21A 3BWEA 4FN4A 3JYPA 1JLHA 5EMLA 1NHGA 2NVBA 3GT3A 4Q9KA 1UBKS 5DOVA 3KM0A 3IVAA 4OKIA 4ONEA 4LYAA 4XFJA 2A9FA 1PYDA 1ODJA 2XA1A 4O1HA 2PGXA 5ELLA 5JISA 1YL7A 2FY8A 1GT91 1G8FA 3W3ZB 2YVUA 4OGWA 4IS3A 1NKTA 2X5KO 1Y42X 5T41A 4Q1CA 2O3TA 2P65A 3C3YA 1FDOA 1FS4A 3Q72A 1QANA 1GN8A 1QAQA 1ZK0A 1QZ3A 2PMEA 4PHTA 3WYNA 4NAUA 1HE3A 4WUTA 5GOZA 1L5KA 4JR1A 4E4RA 5B6IA 1IN7A 4YAIA 4D4IA 1M6VA 5KCMA 2E87A 4OJQA 4RGVA 1ZK3A 1H4TA 4DQLA 3CB4A 2ZSKA 4NBRA 1PIWA 1S3FA 4TS9A 1JKFA 3LLUA 3NV7A 4PFKA 3CBQA 3NHZA 3V9AA 4YAWA 3NYWA 4QEDA 4L73A 5EY5B 5K4AA 5KNLA 3RAPR 3P9ZA 2H29A 3IUJA 3D3EA 4BKMA 4YAUA 1HNWB 1WUJS 4TZ6A 1JMKC 1G5PA 4AQDA 4D9KA 1QOQB 3UAVA 1L5FA 3SOZA 2OO5A 3A2KA 4NULA 4R1PA 4P2GA 2D2FA 1VKOA 1OYVA 3C3KA 3H5IA 3IKMB 4TMWA 3A2MA 1LK0A 4D0RA 3T15A 2H9AA 3DDNA 4DS3A 1F17A 1ZH2A 1ZZGA 2GD1O 1D4OA 3GYGA 3RLIA 1AK1A 1E3QA 4AU1A 2HTFA 4ND3A 3ZPXA 4BC1A 3HCFA 4QYXA 2VJQA 1NF8A 4Z0HO 5IJ9B 3PLNA 3DLTA 4OHOA 3R7SA 6ABPA 1D2EA 3P0JA 3WRVA 1YV9A 2BCEA 2GTIA 4JLWA 1VPEA 1ZGBA 5HOQA 1IN5A 1YMUA 2QLTA 4CMKA 2X9VA 5JI2E 2BELA 3QX9A 5FOXA 2HDOA 4PWYA 3BRQA 4OQNA 3OT1B 5IAJA 4GE0A 1YVEI 4F5YA 5T4BA 4BO5A 3V2HA 3WLHA 1JXMA 3WWEA 3HMKA 2YJ3A 3EF3A 4LXIA 2VJPA 4ZCLA 1U6JA 2BP7A 5TT0A 3PC7A 3TQRA 5I3ZA 1JXAA 4RTNA 3FUCA 3GIDA 2IYXA 2FW6A 3O8OA 3DWFA 2I6SA 3AW9A 1TECE 3CLVA 1CUEA 3PUIA 1YSCA 2EKBA 2XUDA 4PLZA 4UARA 3C14C 1NMSA 3AESB 2VJKA 4DA8A 2VOEA 1BYIA 4QPNA 5CDGA 1KMHA 2QMYA 5B30A 3ZQKA 3PRYA 4B7XA 4CT0A 3AFNA 5E3HA 1PFVA 3O4GA 4IGEA 4HB3A 1Y3HA 1WZUA 3K73O 4MV8A 4UVIA 4X7PA 1RRCA 1QKKA 1OF1A 3QVWA 2JGJA 2GUWA 4JBLA 4MRMB 5L3RA 3CM0A 4LK2A 2Z9BA 1B2LA 3M6MD 5AVQA 1UJ2A 2W6OA 3M33A 1DV2A 1XEWY 3OFND 4MDHA 4M76B 4BTLA 1KU0A 3U31A 4Z86A 1VYTA 4L5BA 1LSOA 1PFGA 2B9VA 3MQ4A 5GIOE 4IIJB 2UXDB 3NQ41 1XU7A 4ZT6A 5ESXA 1A69A 1XXHE 3KKQA 4NJEB 5CXSA 2VHZA 5IBPA 2C2YA 4UMDA 1CZUA 2VTEA 3A4TA 3BVPA 3AP1A 3WE7A 4IDCA 2NU6A 2ZR8A 4D9FA 5JHGB 3F5SA 3B1FA 5DWDA 1T6NA 1O9GA 3WLQA 4A8JC 4F5EA 4BYMA 2IW1A 4R1MA 4DV5B 1EVZA 3JQBA 1QE5A 1P7ZA 3RBXA 3X2SA 4KSCA 1DL5A 1GAWA 4CDNA 1HT1E 1GL3A 3SYRA 1P1BA 1ZHOA 1YMVA 2I4IA 3DE1X 1AZSC 4HDMA 5IC5A 2FEKA 4OH7A 5FWDA 1HYHA 4F7DA 3DBVO 5FTWA 2D1SA 5A6SA 4PYKA 4EYSA 5BSEA 3AEYA 2NT4A 1EUDA 2I7CA 3O95A 4BZWA 3BFVA 1RCTE 4O3FA 1I0IA 2QJOA 4S1WA 1YDMA 5C51B 1NW3A 1WMDA 3PYMA 4BLSA 4WPGA 2NIPA 3TKAA 2PFKA 3AK4A 5LDGA 3GWGA 3VO2A 4JI6B 4FUTA 2R66A 3AHJA 1DXOA 3KKLA 2Q0XA 4K88A 5JO9A 4K9PA 5THXA 4B80A 4O3MA 1UPBA 3IUYA 1S3IA 2IHVA 4H3SA 4KXVA 5G1OA 2QLFA 3T6KA 3ZEIA 2VSOA 5JDIA 1EX6A 2JLRA 4R5HA 3TUJC 4ZDIA 1PWXA 4C5BA 3ZV5A 3EY4A 3H7AA 2ID4A 5GVRA 2WZQA 3QKSB 4NBUA 4BE9A 4I9FA 4XOUA 5AVZA 5ANRB 1QF9A 2VZEA 1HR0B 2ADFA 4X0EA 4JYCA 1CHNA 3ZJ4A 3CLKA 2NAPA 1LNZA 1TCAA 2H0QA 3GC6A 4XCQA 4ZQIA 1LI7A 1RP1A 4I4TB 4QGFA 3ZE8A 2C3OA 3B5IA 5ICCA 2EG9A 4COKA 2XGJA 3VNQA 3WLAA 1TEZA 1LBQA 5DNVA 3ZWDA 3NOOA 4L4XA 2AI1A 3ZX5A 3DLIA 4OLHA 2NP6A 1ZJZA 3NB0A 1IZ9A 3UGKA 4EUEA 1Q0TA 1XDZA 2YN0A 1C2TA 2EIHA 2J0UB 1F4LA 2GZSA 4LCJA 2GH1A 1GPWB 1CY6A 3RSHA 3P4YA 2NXWA 3G2OA 5A4KA 2WJVA 5MGBA 3QZUA 1JEAA 3W2IA 4QJ4A 5SV2A 2VYCA 4Q47A 5DTQA 1OI7A 4G97A 2HQRA 5ALWA 2J3JA 2LIVA 2OV2A 4GXTA 4FYMA 3DAPA 4JVSB 2HLDD 4IAOA 1YQXA 3L93A 1QFMA 3DC7A 3ZDRA 2BMAA 1JQDA 5EIEA 1ZGCA 4C0AC 2OXEA 1Y8QA 2MSKA 1HQKA 2WUVA 1AN9A 1Z6XA 2P11A 1A50B 5I7WA 1TW3A 4MKIA 3RYTC 3WGHA 3KAKA 2YMLA 5JDCC 4O2AB 1WOMA 3ESCA 4OHXA 3ROZA 1B1AA 3QTTA 3RUDA 4TXJA 2XNDA 3WWYA 4BLTA 4ZRMA 4Z49A 3EJWA 3JX9A 1T8RA 2VQ6A 2IBMA 1CR1A 2I6QA 2FP3A 1I1QB 1T10A 1U5CA 4NMHA 1CUIA 2H4WA 1CTQA 3HKCA 1E69A 3L6CA 3FRJA 1VECA 4TSRA 1QU2A 2DPXA 1JB1A 5KSWB 4TL6A 2VBCA 5ILOA 3T3DA 4Y6LA 2WSSD 4MVXA 4EG3A 3UT0A 5BSTA 4FS3A 1P2SA 1J24A 2D2EA 2XAUA 4OU4A 3PCTA 4RORA 2IBSA 1YBMA 3A31A 2P5SA 2W4MA 2FEOA 1AA9A 4GDFA 3U4MA 1I2MA 1I1OA 2GFHA 3BKWA 3GFQA 2DPMA 1GFIA 1DUIA 4CLHA 1ZM9A 3DXXA 5DBHX 3RVBA 5AP9A 2AHRA 3CLUC 1DQSA 2YZKA 2HQSA 4PSVA 1KYIA 3II6X 4P4TA 3L7YA 4HNRA 4EP1A 3GJ8A 1Z0UA 1ZITA 4C89A 4QGAA 4WBNF 2G06A 1M34E 3A3NA 2HREA 1A8QA 1CUWA 3HDHA 1M6WA 3WNCA 2ZT7A 3THXB 1L4NA 3MS2A 4RAQA 5TSDA 4BNZA 2A1IA 1FBTA 4G5HA 8AT1A 3OEHD 5LBUA 2C2MA 2W8BB 4QO7A 2DF8A 2JLQA 3UK6A 2CDAA 2OLKA 1VPDA 3BD9A 4EMSA 2JFOA 3KD2A 4CBVA 5TQ2B 1JR3D 4YR7A 3B5EA 4WEOA 1N3BA 2YZ2A 4B74A 3LC7O 3G1WA 4CETA 1RLMA 3KQQA 4CV0A 3OZFA 2ZYVX 1NBIA 2ZJ8A 4O4HA 3CS3A 3WKDA 5JATA 4I5DA 2X13A 4RANA 2GBPA 5DN6D 3IR5A 5K4HA 1N2SA 1QB7A 4S2EA 4A1FA 5ILQA 3AVYA 3S8EA 2L69A 4EQZA 3OJCA 4L28A 3DOUA 2R1TB 4BNJA 5HSGA 2HMTA 5HNKA 4EI9A 1LLDA 3QVVA 4KCGA 5L8VA 3TM4A 1GOTA 2NMVA 2WEKA 1RRMA 3D3QA 5ECGC 4GUDA 2QRPA 2CHEA 4LWOA 5E4FA 2XZTA 3Q0EA 1GG8A 1BH2A 2PT6A 2AG8A 2ZBPA 4YRRA 1Z8NA 1ZX1A 2IU6A 3V2GA 1C4OA 3I52A 4G81A 1X9HA 2IYAA 3LWNA 4Q39A 1GL9B 4Y67A 2LCFA 3FCCA 2QPLA 2WPDD 5E1BA 4BFXA 3I72A 1QX4A 2EGHA 3KQSA 5JBQA 1RCFA 2I3GA 1AKWA 4G0OA 4UEKA 5DPMA 2VLBA 3SJCA 3ANMA 1JDNA 1PEKE 3RWBA 7ADHA 2WTEA 4BPRA 2HD4A 4B45A 2ICAA 3THWA 4AB1A 2P8SA 3NLLA 3G02A 3GD7A 5TDHA 4DJDC 2BFMA 4R7GA 4Z0PA 2PX5A 4E51A 5INTA 1JLMA 2RH8A 1P6XA 2JLXA 4DSOA 3MMSA 4V2UA 4EW6A 3GT0A 1MUUA 5CLLA 4IG9A 4E70A 1ONBA 3D59A 4LZAA 4HNUA 3C7TA 3QG1A 5L95A 3PJEA 4K81B 3T99A 1WXDA 1CEEA 3M6VA 2VHCA 1O0CA 1NBMD 3ED5A 1Z62A 3IE2A 3KT3A 3MIIA 4IHJA 1L0BA 2GA9A 4RD6A 1Z28A 4YMSA 3C39A 4KK4A 4KZPA 4ZMBA 4AY4A 4TZTA 4FCWA 3M70A 1M33A 4UC0A 1O6CA 4DUPA 1Z4LA 2FXIA 2WTBA 5LBIA 1AIPA 2AXEA 1DJLA 3MWGA 2RG1A 3FKSD 2B2XA 1VRCA 1Z07A 3ETJA 1UKAA 4C0SA 4F60A 2Q3CA 5DZSA 4OOFA 1HNZB 3A58B 4D43A 5L3SB 2C8JA 1AMNA 2VRCA 3AVXA 4M46A 3O8DA 5KI6A 4FEEA 2VZ8A 5LZ7A 3EN0A 2B7LA 1XA0A 4PGHA 2F3SA 4WLUA 1J1ZA 1C7QA 1SVSA 3L6BA 4PEVA 5BXQC 1E3DA 2HRBA 4XR4A 1TVEA 4E07A 5CDFE 5JAPA 2PZ8A 3FW1A 3ETGA 3M5DA 4P4SB 1FMJA 1PR5A 1B93A 2V9ZA 1SXHA 3AJ8A 2QHXA 4K2AA 1R10A 1UOQA 3A6GA 5SZKB 4DV6B 3GBVA 2XF8A 5JH7F 1DAGA 3ILVA 3GW8A 4MDFA 1XROA 2OLJA 1CEXA 3LX5A 3AZQA 2E21A 3DFFA 2AN5A 5A3JA 3HDGA 4EO4A 4NU6A 4WECA 1PW7A 3WBJA 4HWSA 3GUUA 1B8OA 1TB4A 3K6SB 3OP4A 2VUIB 5EJIA 3JQAD 3I2GA 3C8DA 3EYWA 1BGXT 3IUBA 3QHQA 2ZXFA 3ST7A 5ALNA 2CN1A 1NX9A 3PHIA 4DRXA 1EE1A 4RKEA 3QLEA 4UTPA 1CT9A 3P5SA 4B43A 1A5SB 5MFZA 5DNUA 3PEYA 4JODA 1Q0QA 4JUFA 5JCOA 3BB1A 2ZZKA 4HDRB 4LZNA 3DE3X 3JALA 3L0BA 2Y99A 5WRFA 3PGXA 4QEZA 3S29A 4DOMA 4ENSA 1S2MA 4G0VA 4JLUA 4TWZA 3WIOA 1Y4AE 3Q3HA 4KPGA 1GKUB 3F6YA 5AM2A 1DAKA 2A9QA 2AX4A 3B38A 2JZNA 3LIPA 1VSUA 1GGNA 1YASA 5JG7A 4BBZA 2XB2A 2A9JA 2F1OA 3UPTA 1X7WB 2XW6A 2ZS8A 4OREX 4YRSA 3RANA 2JANA 2Y1CA 1A04A 2OMKA 4ZT5A 1TTQB 4AO6A 2GBLC 1GILA 2NU8B 4AUNA 1Z88A 2Y9MB 3C6MA 1T0IA 3E22B 2R4TA 3DW3X 3MA0A 2ERYA 3MJEA 3C6XA 2IYFA 3OM9A 4WKNA 2G28A 3U4DA 4B1FA 4BP3A 5I7HA 2PUFA 5EMMA 2HADA 1GPDG 1IVNA 3GROA 1QIDA 2OBBA 4F3NA 1Y7TA 1VP9A 4NABA 3UFBA 5BT9A 3P9RA 4NX2A 2G9ZA 5KHAA 4ARSA 1AT1A 3T1TA 3QY0A 1YZGA 4AMYA 13PKA 3EEOA 3ZS9A 1UCFA 1LS6A 2QUJA 1MEJA 2X2PA 1E79D 1RP7A 1U2GC 2DQKA 5IHPA 3B1KA 3FCOA 5IZCC 1UEIA 1P2DA 2QE7A 2FK8A 4BCCA 4F3RA 4KVGA 4NEHB 3HBNA 4M0KA 1TMOA 3LJKA 2UYYA 2PMWB 2RHWA 3EQ9A 4UOZA 2XQGA 4Z4FA 1J70A 1V37A 3ZWOA 1W1WA 1GKKA 3EZ9A 2D7DA 3U44B 3A36A 4UFOA 1HM5A 4NE2A 1SVLA 4QU8A 2JLUA 4DV0B 1MG5A 2F9LA 3G6KA 4OBWA 3VHXA 2Q6KA 2NZ2A 2ZTUA 1GG9A 3EF1A 3KB2A 4L6IA 2VATA 4FW8A 4HRXA 4MDYA 2XNHA 3R8XA 421PA 1KH3A 1P39A 1UM9B 2DQ4A 4DXDA 1SBZA 2IVFA 1PN3A 5JNSA 1SVNA 1EX9A 2NM0A 2ZTLA 3BWXA 3N0XA 4R7ZA 5FI5A 3UIEA 4ZHQA 2D0OB 4FIDA 3KUDA 5TPZD 1K89A 4LSGA 4D3YA 4OHUA 3ADPA 1AVTA 1HETA 4P08A 4ARVA 4QTTB 5L4NA 5FBRB 4O2AF 1DKNA 5AIBA 3THYA 1V48A 5BY2A 2CNNA 2FSIA 4EY8A 3VHQA 1YZVA 2QGNA 1HOTA 4MMXB 4I3HA 1CETA 3DEIA 1S9DA 1TF5A 5LA6F 5A62A 1EPUA 2F8LA 4L2IA 5AVWA 2Q3EA 2ZPAA 5JSZB 1DBVO 2YHIA 4ICIA 1Z34A 3J80A 3SFZA 3CU5A 5LDHA 3UCEA 4A27A 4MB0A 3LMKA 4GYWA 1KNXA 1POXA 3UK1A 4KGVA 4Q7QA 1U8AA 2ACKA 4P0TA 1P31A 1VMIA 1CY7A 1SPXA 2HI0A 3A9TA 1RZ3A 3F3YA 5A5VA 3GLIB 1VHTA 3QBDA 2I8LA 3BXFA 3O2SB 4GMHA 1B6TA 3FTPA 1XPJA 3QX8A 2C3YA 1F51E 4OFXA 1X7XB 2Z43A 1HMYA 1FFAA 3RW9A 3B3JA 5CVVA 2BGTA 3ADKA 3L4BA 1V9SA 3HZZA 2P5YA 3Q3CA 3W6PA 2DHEA 4X94A 2A5FA 4ZXPA 3MHPA 4HWRA 1AG9A 2XDAA 1JIKA 1VL8A 1H94A 3IRVA 1UPXA 1OAOA 2C2WA 4PZ9A 1DB3A 2LDXA 4JK3A 4RXUA 2BKVA 4WZ6A 4AJJA 1UKVY 4U6NA 5CURA 2I4TA 3PVCA 2PGJA 1I80A 3FPHA 2YWHA 4RVHA 4CM6A 4EH1A 5B36A 2ZUEA 2XGMA 1V9CA 4NCBA 1B26A 2DR3A 1D1QA 5TX7A 3UANA 3F4LA 1OXSC 4Z9BA 3TOSA 1Q20A 3UQYS 3AYZB 1R6BX 4AMBA 2RHBA 3I1IA 3WWOA 2FWAA 3L0IB 3W06A 3E5MA 3NEPX 3UK0A 4FVTA 1TEVA 4F72A 1M34B 1C1DB 4HATA 4NMLA 4FZRA 4G8JA 2AJBA 4OATA 4WOCA 3CVYA 2WF6A 3OEEA 5AJWA 4JJEA 1VI5A 1HDZA 3S27A 4I1SA 3U19A 2FZCA 2B4YA 3L0DA 5G1NA 5LD2C 4NDNE 3WNZA 1X77A 5BPFA 5KC9A 2O2SA 3AP3A 5BSUA 3SXJA 4C78A 3KYCA 1GP2A 2GJ4A 1PDOA 1TX4B 1V8FA 3U3OA 5CFMA 2EFYA 1QAOA 4RTRA 1ES9A 1WV1A 1JAYA 3TIVA 4Q02A 3CY6A 5BNTA 2NW6A 2OA0A 1MIHA 1U8FO 3HUDA 3LUKA 4JLNA 2ZRDA 3AI3A 3GNLA 4GQIA 5AM3A 1X8XA 2WTXA 4BLQA 4AULA 1WXIA 1IQRA 1XU9A 1E8DA 3D1JA 4PPQA 4DHEA 1JSXA 1GQOA 1UQUA 2QRVA 5IKEA 5G0UA 1IZ7A 1VA4A 4GGOA 3HXLA 3T94A 2GBFA 1EGQA 5DVZA 1YQGA 4RC9A 1UK6A 3AKDA 4W99A 3DE2X 4B9EA 1W8IA 2X8JB 1O96A 3C0KA 1F06A 2C4MA 1AB5A 1XQVA 3RYIB 4BVBA 1T9CA 4X44A 4DEXA 1XSEA 4N7RA 1C9NA 2A0YA 2H48A 4G1EB 4MRAA 1PLLA 2EBWA 3DV0A 1E2MA 4QUBA 1XZQA 2R65A 1XMSA 2FGKA 2PQ6A 4I1RA 3WB9A 3GQVA 2AFIA 3TW6A 1FSPA 4MA5A 4CI0B 1Z9BA 2WU8A 1AZLA 4XQ9A 3TBHA 2IEBA 3ZWWA 1WCIA 2MOKA 1UBHS 4BRSA 3NTUA 1IOLA 3BHJA 4WXPA 4LZZA 4PXSA 4DIDA 3FXAA 1LW7A 2EG5A 2PZFA 1RMYA 2WNSA 3WRWA 3ZTYA 5LJLA 4MIEA 3IMKA 5K8JB 2R5NA 3RVQA 3FB4A 2MJLA 1V43A 5F7JA 3THOA 3H11B 3VSEA 2G0AA 4OQPA 5K0GA 1TLFA 4O4IF 2HSJA 4FB4A 5BWCA 3DE0X 5JJBA 1SC4A 3K0SA 3OLCX 1CQXA 5DP1A 2XMQA 1NMQA 2VBFA 3QE4A 1DAEA 1BXRA 4QECA 3RAGA 5JSFA 1DQZA 1P62B 4R84A 4XD7D 3TL2A 3V4VB 1DC5A 3ML1A 4HEJA 3ZKWB 5BV8A 4XARA 1QH8B 4J3FA 2QX4A 2R7MA 2HO5A 4U3JB 3WLIA 3OA0A 1GADO 1YKFA 4CG2A 1LV7A 2R751 2L18A 2HDWA 2WY2D 3Q9LA 3PPVA 1SKAA 1JBQA 1HYBA 5JYDA 4G8DA 3U3DA 1REQB 2H5JA 3BD6A 3BMOA 1NC3A 3DGEC 3PR1A 4L74A 3RG8A 3QNWA 4BNHA 1TIPA 2W2LA 3CO5A 2BFDB 1KYXA 1YZ3A 2WKQA 1AN0A 1P7WA 5LFAA 2FP4A 2IXTA 2VPYA 3PUZA 4MPRA 4EAQA 2B4KA 4C7BA 1QR6A 4KUEA 3A4MA 3C2QA 5ERYA 4EHHA 2CNWA 5CBPB 1SR8A 4D44A 3E3AA 3BGSA 4NXMB 1DHTA 2X4DA 1L5QA 1DX6A 2EU8A 2IQIA 1KXJA 4V1CA 1AE1A 2ZR9A 3LLSA 1THMA 2OOKA 2X6RA 4WTOA 3VPDA 5B4UA 1SUEA 2XA2A 2AW3A 4BNDA 2GFIA 3ELWA 3OWHA 2G1PA 1E2NA 1G3MA 3F8TA 4ENQA 2RBGA 4O25A 2DQZA 4BJ5A 4BNXA 1TO6A 1PK9A 1FSFA 1Z25A 3RTDA 3P2IA 3COZA 4Y98A 1CY8A 4I50B 3CB2A 1DZIA 3PXDA 1DSSG 5DMHA 2FQQA 2ZTHA 3PFGA 5U1PA 4E1BA 3ANYB 1L7OA 2ZSJA 3HY3A 2QN9A 3NXSA 4R2HA 2DJIA 4ZVKA 2IPLA 1BKSB 2WYIA 3BH0A 5AMXA 4BVEA 2MSWA 4D3ZA 2CVHA 2TSYB 3T5MA 2EVWX 1K5GA 2V7WA 3LVQE 1O08A 3CKKA 2LCQA 3UPUA 2AVNA 1DTEA 2OUIA 1ZCAA 2G9RA 1ZRNA 1LPSA 4NPAA 4OGKA 3ITDA 4PU0A 4QODA 1N2OA 4YUXA 1AUXA 3RK1A 3QYJA 4JB3A 5CLGA 3P9XA 1RWVA 3PGA1 3RHFA 3NO4A 3PYLA 4PO9A 3PZBA 1MO3A 4Z8XA 4Y2HA 3PNLA 3DE7X 2FSHA 1UZUA 1YZHA 4K28A 3OEWA 4A9AA 3Q7EA 3U16A 4RV9A 4EO9A 1MPTA 4MW7A 4X8LA 2EP5A 3QQ5A 5DU2A 3PHBE 3HJCA 1Q0HA 4M8KA 1OWMA 2WTMA 1Y8AA 4CCYA 3V8RA 5B55A 5JECA