3W3ZB

Crystal structure of kap121p bound to rangtp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
171
structure length
171
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
pubmed doi rcsb
molecule keywords Importin subunit beta-3
molecule tags Protein transport/nuclear protein
source organism Saccharomyces cerevisiae
total genus 52
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w3zB00
1XWIA 4DRZA 3GLGE 2OO7A 4EPXA 2GDJA 4LYJA 4XVRA 5LBIA 2CK3A 4QG7A 4B71A 3RWOA 5AJYA 3REFA 4DIEA 2EFDB 2WWHA 4WIAA 4C0KA 4F92B 2VHQA 1CBUA 5KPDA 2ANCA 2NO0A 3GLGB 1CRQA 1GKYA 1XPUA 2JLVA 5DN6A 2RMKA 2CLCX 2QORA 5FOTA 4QGHA 1YJ5A 2V8OA 2G88A 3FYHA 3EZ7A 2BJWA 4PHGA 4C2UA 3K9GA 1ZM9A 1X1RA 3EC1A 3P32A 3GLFA 1MO5A 3SYKA 4BFWA 1BO6A 2F3TA 2P6RA 2CDNA 2PBRA 1IN6A 1ZMXA 5CM8B 1Z22A 3SHWA 2OXCA 2Y8EA 1LTQA 4JLBA 5BW8A 5L3QB 3I5YA 1HE1C 2JDID 3RVBA 5LDDC 4GFDA 5KDLA 1U9IC 4KBGA 4W5HA 3FHTA 2I1VB 3EW9A 1TQ6A 4B3CA 4C4PA 4HLCA 1MV5A 5FI0B 4A0RA 4H1VA 2CCJA 4B6EA 1KI1A 1N25A 3NVAA 1NMZA 3FB4A 3D3QA 4KBFA 4TL9A 4DWJA 3LBIA 3R20A 1G3IA 4LJ5A 3ZS8A 2J0VA 1E1RD 1P7CA 2GKSA 2JCSA 3W9YA 2F1IA 3VX3A 1JALA 1C4OA 1JJ7A 4PC6A 5KNCA 1LY1A 2XTNA 1JEEA 4XWKA 2IHYA 2KBEA 2WPDD 1KO1A 2NO9A 5GJWC 4W5JA 2QM7A 4D0GA 2OT3B 3THWB 4WVFA 2JGNA 1ZVQA 4L9WA 2ZITA 3NG1A 3QG5A 4BGDA 4BQSA 4PQFA 5FR2A 3IILA 2ZM5A 4KFSA 2IYZA 4I1OA 1N2CE 5E7JA 2ZYVX 4BRUA 1LS1A 3B1XA 5JS7A 4GP7A 3H0KA 4WAUA 3VQTA 3TIFA 3MWLA 3PUWA 4TMZA 3CR8A 2ZEJA 3RANA 3GLHA 4O2RA 1COWA 1LNZA 4L15A 3WRXC 4E22A 5HKKD 2J7KA 3LAWA 3VNVA 2Z5FA 2QQ0A 4P4TA 4US0R 2C9OA 4OI2A 1JR3A 3EWSA 1TEXA 4ESVA 2O8CA 4LSGA 4BECA 1VECA 1T9HA 2BCJQ 1COWD 1G18A 1L2TA 3KDSE 1T3HA 2ZPTX 4MGYR 3F5FA 1KDOA 1JR3D 1OFTA 1RKBA 2REXB 1XTIA 4PO9A 3X1XA 4KO8A 3W8NA 3SJAA 2A3RA 2IYXA 3QY0A 1EESA 4D4MA 2J3EA 2IYUA 1Z6GA 2RAPA 2R65A 3ASZA 1RRGA 1IY0A 5EUQB 2Q9CA 1SHZA 3A58B 4WW0A 3U7EB 1JPNA 2ZSBA 2DYKA 1VHLA 3K0CA 4AC9A 3P4YA 3CRRA 1UJ2A 3M4YA 2XX3A 4AURA 4URVR 2ZR9A 5C46F 1P60A 1OT3A 3GLIA 3RDPA 2HEIA 5B2ZA 1Z3IX 1NN5A 4F4CA 4NCNA 4D2IA 5A4JA 3K09A 2YNMA 2QM8A 5CB8A 2ECKA 4RKFA 2IF0A 2VP0A 521PA 3W5IA 2J87A 1DAGA 1Z28A 2JLZA 4PO8A 1C1YA 1VHTA 2V7QD 1G21E 1FTNA 5FTMA 4RD4A 2RHDA 4KFTA 1HY3A 1ZP6A 4TQ9A 3UATA 1FNMA 3LH5A 2GF0A 4B2IA 4BFSA 2IT1A 1WMSA 4Q9JA 1YHNA 3VAAA 3IEUA 4CIDA 3GEIA 1XJCA 2QG6A 2W0SA 3B7GA 4IVRA 1CR4A 2AK3A 2JJ1A 4YXWA 2Q0HA 3QF4B 2IEZA 3AGQA 4I4LA 4B34A 2OBLA 1ZAKA 4IVQA 3IIMA 5KHOC 3PEYA 1OFIA 2J0SA 3BK7A 1FP6A 2IL1A 3KL4A 3THXA 4PQYA 1TTTA 3SZRA 2JJ1D 1XMVA 4DHEA 2FEOA 2VP2A 4B47A 4BZQA 1OH6A 1PVOA 1W0KA 4BFTA 1E2HA 3B1VA 3QF7A 4W5WA 3A1TA 1FNNA 5AJZA 4HLUA 1JXMA 1G4UR 5EE9A 1IJFA 1RE0A 2WHXA 1A5TA 1HQYE 5L3VA 3WYGA 5KPJA 1KSGA 2AFHE 3AP1A 4M4SA 2H1LA 2ZSFA 2Q3FA 3C14C 4HUQB 1D2NA 2DHRA 2JLRA 2V54A 2YJTD 2XB2A 1NIJA 3HWSA 3GJ4A 4RD3A 4UNRA 2W83A 4B48A 1ZINA 5FFMA 1A1VA 1E1QD 5CJPA 3BWDD 1E79A 3G0HA 4KYIB 1U8AA 3T35A 1US8B 1KMHB 4FMCF 4C30A 2KBFA 4WXPA 3SJCA 1Z0AA 1KI3A 2CL0X 1CKEA 1E79D 2WIAA 4LHXA 3I72A 4P4UA 1OFHA 1RIFA 3QXSA 4LI0A 3RAPR 2XZPA 1QHGA 3NDBB 4OQMA 4RD0A 2REOA 2J9RA 1P6XA 4XJXA 2BWJA 1Q44A 2W58A 1XRJA 1ZNYA 2G0NA 3U44A 2DFNA 1BMFA 4JLDA 4CEJA 1BYIA 2HF8A 1E2JA 1W0JD 3KB2A 2QU8A 4MGKR 2X19A 1XXHB 3CONA 3I61A 4S2EA 1N6HA 2OCAA 4C7OA 3VR6A 3E5HA 3DDCA 5SZKB 3ZQ6A 5FPTA 2ZJ5A 1SXJA 2BVNA 3I3SR 4XOIA 5FTJA 4MRPA 4CYMA 1XD2A 1XJQA 5B57C 1EFHA 2ANBA 3SFVA 2CVFA 4BLTA 2HXSA 3KQKA 3CZPA 3QKRB 4GZMA 1KI4A 2WAYA 1R8QA 4N1AA 3EAQA 4O0MA 1KI6B 4ZDWA 2I3BA 5BYJA 3LBNA 4DCUA 3MGCA 4OHZA 1P9NA 1N3BA 3KKPA 1GP2A 1N0UA 1F2UB 2XNDD 5J5CA 3FVQA 2V1UA 3EPHA 2DFLA 4HAUA 3SE0A 4DIDA 2RGGA 5F3WB 1G5RA 2HDNB 4IOLA 3TRFA 3PEVA 2CE2X 3F3YA 3IDQA 2H16A 4RFSA 2QP4A 1II8A 4Q9KA 3SQXA 2ONJA 2FWRA 2PMDA 5BN4A 3RRNA 4OI1A 1M7HA 3FFAA 2FZLA 2LKDA 5HCNA 3BGWA 3KKOA 3SJBA 3I4LA 3ADBA 1VG8A 2WJGA 1SGWA 4V0LA 2ZI4A 4RKEA 4HAYA 1M7BA 4ARZA 3RS5A 2R6AA 4LX0A 5HE8A 3QPWA 1NVVQ 1HT1E 2FV8A 4LBVA 2H7VA 5JI2E 4P3YA 2VYFA 4HB2A 1G64A 2G3YA 1D8TA 4E09A 1NN0A 4EJSB 3I8XA 3PEWA 3NIBA 4BLRA 1JEDA 3B78A 4O3MA 2E9SA 1EFRD 2WOOA 3AKEA 1W46A 4JYBA 4PSKA 4MDEA 2MSCB 2VO1A 4DLRA 2WMOB 4Q48A 4HATA 1K5GA 1AZTA 1G3MA 1QG2A 2ZR0A 2D62A 3K0CC 1G8GA 821PA 4C0LA 2FFAA 4KFRA 1H8ED 3MFYA 3LW8A 3KTAA 3V4FA 2ZI7A 1O3YA 1P4SA 1NL3A 4KI0A 1AS3A 1T3LA 1GL6A 2P65A 1KTVA 1PLKA 4HSEA 3IBYA 1YZKA 2GF9A 2IYRA 1P2TA 3K09C 4QOSA 3IGFA 3W5JA 2ZJZA 5JSZA 2JIZD 3GFPA 3LDAA 4TZ6A 4JBYA 1HQCA 4IJMA 3QPUA 1D2EA 5F9FA 1E9BA 5DHFA 5F9HA 1XMIA 2IXEA 3RSLA 4TZ0A 4LHYA 2ZRJA 4MKIA 5C2JB 1NN1A 4ON9A 2ZROA 1ZD1A 1RC8A 4PR0A 3C8UA 1VMAA 4TMKA 2KE5A 3OFNA 3ZJYA 1YR9A 4DLXA 5HPYB 2QSYA 1GDDA 1L8QA 4NZYA 4Q03A 3QVUA 3R8FA 4OQLA 4TYYA 2GAOA 4TLCA 3MMPA 1E3MA 2OUKA 2NOAA 2PT5A 1YZTA 4O25A 5CLLA 3AUYA 1SKQA 1ZM3A 1FUKA 1R8SA 2G0TA 2P67A 1ZC3A 2WJJA 3BRWD 4KLZA 1UBEA 5E7MA 2FSIA 4ZKDA 1XTKA 3I1FA 3BJIC 3HJNA 2D2EA 4EPTA 4OYHA 1S9HA 5H1YA 3MJRA 4RSGA 2WKQA 1JAIA 1Z83A 2GJKA 1W36B 3PQCA 2GBLA 4QXAA 2ZI3A 1SVKA 4HLUC 2JJ8A 2FFHA 1AIPA 1PLLA 5FPKA 5K8LA 3VNUA 3VKGA 2BC9A 2ZRLA 3C15C 1BH2A 1KK3A 5FOVA 2R6DA 1RJ9A 3S1AB 1NVUQ 1Q1EA 3EPLA 4URWR 5K8IA 2AR7A 3B8HA 4YMUA 5J40A 721PA 3VR1A 4CDGA 5KOYA 3KQUA 1KMQA 2D7DA 3I32A 4JLPA 4M1MA 4FI3C 3B1YA 4HDOB 1ZM2A 2YWFA 5AWFC 3WP1B 3VFDA 1H8HA 2AWNA 4FMCB 3SJZA 5JFGA 1G3QA 3M0EA 4I99A 4E5UA 1AKYA 5CYOA 3HP1A 4GI7A 3KJGA 2AX4A 4XTRA 5EJEA 3U3OA 2FE4A 3D6TB 4OK6A 2IWRA 3UK6A 1AGRA 2TMKA 2Q3MA 3C4JA 3HYTA 4GMXA 2VSXA 2VHTA 4X8OA 4PQRA 5AUQA 3VX4A 4TMXA 1TQ4A 2F1RA 3SQWA 1Z2CA 4C2TA 2FX3A 1VTKA 2EFEB 2R8RA 3NTUA 3Q8XB 4Q01A 4TWZA 3SFZA 3U4QB 2AK2A 4PFSA 4D81A 3DMDA 2A5GA 2FGKA 4LYFA 1XD8A 5GADl 2YV5A 2OLJA 3CW2A 2WKRA 5FUWA 1G20E 1HH4A 4IEEA 3QI2A 221PA 5DYIA 1DPFA 1X1SA 4QKQA 3UIEA 1SXJC 4AG6A 2FPLA 5GVRA 3D7MA 4XSGA 1OHHA 4OI4A 1MABB 4RY2A 4M9ZA 2ONKA 1AJEA 4TTRA 3BC1A 1MO4A 1ZW6A 5IK2D 4YQFA 1IBRA 3GJ8A 3PJRA 3H86A 5CDFE 3I8SA 2EYUA 2A5FA 2ZJAA 4M53A 3BERA 1T5IA 2MSEB 2QSZA 3I92A 5BQ5A 1SVWA 1ZUIA 5FBLB 1F5NA 4FINA 4JVMA 1JECA 4DC9A 3TUZC 1NMXA 1CTQA 1AZSC 2ZI6A 2JAQA 3K1JA 1Q1BA 2J0QA 1U94A 4PAQA 1VYTA 3GMTA 4DEYA 5KUTA 3FHOA 4GL2A 4PPFA 4G01B 4QRHA 4UJ3A 3LX5A 1MO3A 4FWIB 4QBGB 5DE3A 3GLIE 2GWHA 1NN3A 4ZO4A 2GHIA 1MH1A 2ZRPA 4AY2A 5FTNA 4A82A 1M1YE 1IJEA 2VEDA 2Z6VA 1FQKA 3VHLB 1U81A 3ZZTA 3VU9B 4MDFA 1G7RA 2JLQA 4FXPA 4YLGA 2IK8A 3A8TA 3EZ9A 2FJUA 2GCNA 2ZETA 4X8HA 2O8DA 2J46A 2R6FA 3K0FA 3AF0A 1X6VA 3TSOA 3R7WB 1N6KA 1GAJA 3K70B 4DLUA 2I4IA 4AKHA 3KKMA 5TARA 4LY6A 4DUGA 5DH9A 3BB3A 4PHHA 2IUSA 4OJKA 1R7RA 4LJAA 1KGDA 4F91B 3RNLA 2JLXA 2PLFA 4AKIA 2GXQA 5JS8A 5CIQA 5HE9A 3QKSB 2XTZA 2Z4SA 4Q1DA 4A2PA 1YZNA 4HLDA 1N5JA 4V0NA 3B1ZA 4V0MA 3CNLA 4KVGA 1KDPA 2KWIA 2H92A 2V1XA 2ZSEA 3PUZA 3OF5A 4TL7A 4Y0VA 5FPYA 2LWIA 1DOAA 1QHHA 1U0HC 3PENA 1ZUNB 4K8OA 4Q4AB 2YWGA 3DO6A 5H8WA 4AKGA 5HZHA 3B2EA 4WBSA 4UXIA 1XXHA 1XEWY 3SBDA 3RS4A 3L2OB 3O8CA 3AF3A 3IO3A 1X8LA 3GJ7A 4IOKA 2PX0A 2R9VA 1IHUA 2OCBA 5GJCA 4ZV4A 4TN1A 3H84A 3NDPA 4TQAA 2FZ4A 2OHFA 3WXMA 3QKRA 3TQFA 2A5YB 3MLEA 1G1MA 1GZSA 1Z0IA 2AXPA 2Q21A 3LWNA 4HDQB 4Q1CA 1G7TA 1W5TA 3SYLA 1A2KC 4C0QC 4CEIA 4XD7A 1G6OA 3EA0A 4EFLA 1F2UA 3K9LA 4NCKA 1XP8A 3T06B 1KK2A 4Y0AA 2P5SA 4H9GA 1D9XA 1TUEA 2OAP1 2HF9A 4D80A 4G5GA 2CL7X 2VQSA 3Q5DA 4S35A 1R5OA 2D7CA 3LXXA 3THYB 3CUEF 3Q5EA 1XMJA 3OAAD 5EE3A 3IEVA 4A8JB 4TYPA 2D4HA 4PX9A 3RS2A 1G6HA 4RJLA 3W3AA 4AI6A 4N0DA 2GBLC 1XCMA 2ZRBA 1ZJ6A 4Q1AA 1N6RA 2OSBA 3AM1A 4ZCLA 5JHGB 3KUDA 3KX2A 5FL7A 1F48A 1KY2A 4TMVA 4Q9LA 3LV8A 3EASA 4A0FA 4FCTA 1NKSA 2J59A 1UKZA 4QHTA 3WMFA 4ERNA 3U2QA 4K81B 5FL7D 2VP5A 2ERXA 3I5XA 2OBNA 4II7A 3G82C 4MKFA 4OK5A 1NRJB 2R6GA 1YRBA 3NXSA 4F4JA 2IWHA 3BH7A 1S8FA 3EIHA 4NYJR 3RS7A 2BEJA 3DKPA 2JLWA 4ZDKA 2L0XA 3OEED 1T6NA 1SVSA 3R9XA 2ZREA 2RKOA 2WWYA 3U7FB 1UDXA 3MJHA 2RCNA 4B3XA 3PXGA 3BB1A 4Q5IA 1XX6A 4M21A 1AA9A 2BHRA 5JEDA 2UZIR 4IW3B 2OE2A 3Q72A 1OSNA 4XTCS 4EPWA 1I4TD 1KK1A 2BBSA 2QE7A 2EFCB 4LYHA 5TDHA 4TTQA 5EXPA 4GOXA 1LFDB 2GAAA 2OCYC 4TYWA 3TW8B 1UEIA 1QBKC 2WWFA 1P62B 2P6NA 3AVXA 4B3GA 2JEOA 2LCFA 4DLTA 4TSFA 2QE7D 2O0HA 3Q3JB 2CK3D 5SZIA 2XZOA 3MWKA 2CHQA 3CWQA 1E9RA 2QUZA 1ZC4A 1ZD8A 3PR1A 3DM5A 2KB0A 2B21A 3QEJA 3IPYA 2DY1A 3A1SA 3L8ZA 5IT5A 5KSOA 4XWAA 4B32A 2BMFA 4NYMR 621PA 5DN6D 5EP3A 2FH5B 2N1BA 4BLSA 4B3DA 4D26A 3TK1A 1OH5A 2HCJB 4Q4HA 1PV4A 5H68A 3PFIA 3TH5A 2AHOA 4PSAA 2GRJA 2V6JA 4GZLA 5TMPA 3NBZC 3FFBA 1Z07A 1GIAA 1AGPA 1F2TB 2ZRGA 1RRFA 2EQBA 1AQUA 2VHUA 2VHJA 5F2EA 5EE1A 1Z6TA 5L3SA 4LPKA 4U00A 1DAKA 2GA8A 2ZU6A 2ZRAA 2JLUA 2IHBA 3S1AA 1U98A 1LB1B 3A36A 4RCYA 2R6CA 4B2LA 1DBSA 3O47A 1X86B 4P4SA 4DKXA 1DG3A 4P0TA 1W4AA 1QG4A 2P5TB 3KJHA 1B0UA 2WBLC 2ZJYA 1GTVA 1KNXA 2CJWA 2EFGA 2QPTA 2VH5R 2VF8A 4OKSA 2BKUA 3PEUA 4WZBE 1T0JB 4EIWA 3H1TA 2ODEA 3GJXC 2J0UA 2RGEA 3CNNA 1JXOA 2AN9A 4Q4JA 3NKVA 3DZ8A 2EVWX 2PCLA 4JLVA 1ESNA 2Q9BA 1E0AA 3EA5A 1NVWQ 2H5EA 5J4LA 3AVYA 1IXRC 4ZI3A 3K0AA 2FGJA 1HTWA 2AD1A 2CHVA 4QGFA 3KQNA 4Q4LA 2BM1A 1A2BA 1II0A 2QI9C 2XXAB 1YQTA 1VCIA 3F0TA 4ZCMA 2C2HA 3CB4A 3RABA 2ZS9A 4EQ6B 1J8YF 4PPGA 5AR1A 4GNKA 2QY9A 1G19A 1HA3A 5J47A 3RHFA 1SULA 2RHMA 5DIFA 4B6FA 4HAZA 4MRSA 4R2IA 1JPJA 1JR6A 1W4CA 1N0VC 3AVUA 3U3KA 2ORIA 2EYQA 3FGNA 2YZ2A 4D6PA 2ZAMA 1JB1A 1KDTA 3IIKA 2GCOB 4CT5A 3GJ0A 3WYFA 4C9BA 4F4IA 1LF5A 4I81A 2QTVB 4RZ3A 2WTUA 2CE7A 4JBXA 4B3FX 4EFNA 1VIYA 3KKNA 5M04A 5JECA 3FMOB 5KDDA 5LD2C 1NBMA 1CU1A 2OXRA 1NKTA 1WP9A 3JVUA 5J4YA 4MKHA 4LCBA 3CH5A 2X77A 2RGDA 1X3SA 2IYLD 4DSUA 4NDZA 5FPHA 3DM9B 1T0HB 4IDNA 3TVDA 4LHWA 1SVIA 2F43B 1T8UA 3QEOA 1CJUC 3U3MA 3OHMA 2C9YA 3AV0B 3GFTA 1S1MA 3L43A 1TMKA 1YZQA 1OFUX 1GNRA 3VR3A 4A0HA 1ZRHA 5G40A 1EGAA 1OB2A 1MO6A 3AKDA 3QBTA 1Y3AA 2BBOA 4A6PA 2IYQA 4Z1MA 3R9IA 3ZQJA 3VR2A 4W7SA 4A2QA 1M8PA 1G17A 3ZS9A 1J7KA 4Q9HA 1W2GA 5LB4A 2X8AA 4YXWD 2V3CC 2XB4A 1CULC 1FUUA 5IRCD 3C5CA 2OBMA 4LYAA 1U90A 2QAGA 2QRNA 2NGRA 5AJXA 4PPQA 4XSHA 2CEAA 2DWQA 4HAXA 2PMKA 3ASYA 5FOUA 1E2PA 4PPNA 1KI7A 3N70A 1P61B 1W0KD 4DSOA 5TVKA 4FMDF 3LW7A 4JLJA 1AM4D 3CKLA 3CPEA 2RGBA 1QHYA 1KJYA 3C7KA 2QBYA 3K9NA 3CLVA 1XCPA 1XJ0A 4KAXA 1NNEA 1ELOA 1SQ5A 4JJZA 5HZKA 3GP8A 1E9CA 3E70C 4A9AA 4LGMA 5GJVC 2ZVPX 1UKVY 1RW4A 3TMKA 4L8GA 3LLMA 3N2EA 3JVVA 1IQPA 3BFXA 2P6UA 5BN5A 1WF3A 2GETA 1RRCA 1ZCBA 1P3JA 2J5XA 5JJIA 4Q1EA 4M22A 3ADKA 2R44A 3BXZA 4FIDA 4A92A 4HZUB 2F1JA 4JBWA 2HJVA 3THOA 2CHGA 4JL5A 2AD5A 4QHYA 1YKSA 3CNOA 4KHZA 3RS3A 3O8RA 3DVLA 1XD9A 3AF4A 5B64A 4PHTA 2ZU0C 3EZFA 5AK0A 3CF0A 3THYA 1ZM4A 1TQDA 3AB3A 1M7GA 4A8JA 2XITA 5EZ5A 1XDBA 1KOFA 1M6NA 1Z0KA 3EIQA 1BMFD 3Q9LA 4O2LA 1W36C 1G16A 1OE0A 3NEJA 4MUBA 1WCV1 2C98A 4AD8A 4OQNA 2WZQA 5FTLA 3N5CA 3W90A 1CJVC 2DCUA 4LUCA 1I2MA 1SXJD 2UZ3A 3T1QA 1KAOA 5D3MB 3CO5A 5EXSA 2B6HA 3KJIA 4BFXA 3B60A 1XNJA 4DJTA 2WAXA 4E07A 4JJKA 1TU4A 3GPLA 3W8RA 1IM2A 4F38A 2ASEA 4A2WA 2QMEA 1VG9B 1VIAA 1S1CA 4JVNA 2WIBA 4FCVA 2GEUA 4LJ7A 4F7WA 1KO7A 1U8ZA 1LVGA 4ESHA 4FWTA 5KNDA 1KHTA 1E2GA 2O8BA 4PANA 3GJ6A 4QL3A 2W6IA 1OJLA 3WMGA 2DWOA 3ZVRA 2PEYA 4OQFA 4BEBA 4AYWA 3CIOA 2ZRKA 1CEEA 1CF4A 3L82B 4ZIRB 2IS2A 1OKKA 2C04A 3CRVA 5EP2A 1N0WA 4AKEA 4TMTA 4Q21A 3REGA 2OAQ1 3A4MA 3X2SA 2GJ9A 2W6ID 2V9PA 4BFUA 1RYHA 2QTHA 2CLSA 4LHVA 2HT1A 1OKKD 2JLSA 3GJ3A 4KSBA 2YC2C 5FOXA 1E6CA 5JCPA 3GLGA 3I62A 5G53C 1FP7A 4IOMA 2ZJBA 4B74A 3AVVA 2XGJA 2DWPA 2QP3A 1ZM7A 1Q22A 2IUTA 1LV7A 4U5XA 3VHXA 2LKCA 4I1VA 1R6BX 1ZIPA 3X1WA 1IAQA 4BLPA 1SVLA 2C03A 1DEKA 4Q1FA 3AP3A 1N6IA 2JA1A 5CYPA 4MGZR 4GT1A 2Q6TA 4C0SA 1Z6XA 1A82A 2VPPA 2BJVA 5HCIA 5L3QA 2DB3A 2ATVA 3IUYA 2O0JA 2QMOA 3FE2A 1GL7A 3IBGA 1XTSA 5EE0A 1QVAA 1U99A 5L3RA 4JVLA 3RRMA 4D4LA 3GCGA 1KZGB 1YZLA 5JZVA 2NG1A 2J7PA 1CJKC 3OESA 1F2TA 3JZMA 2ZE8A 3P20A 4R2HA 4CEHB 1TX4B 3WYAA 3Q7QA 3UMFA 1G3RA 4PHFA 4URUR 5CM9C 1KDRA 2KI5A 4JYCA 4XH9B 3ONWA 3CRQA 5JWRA 1M34E 3LO5A 4Z8YA 1E2FA 2ZSAA 1FL9A 1QDEA 4IDOA 4PC2A 4EPRA 5C18A 3E2IA 4TLBA 4ZDIA 5ANRB 2ZYUX 3THWA 1E98A 5EXXA 1GRQA 3D8BA 2AFIE 2ODBA 2XEXA 3OFND 4TLEA 4XVQA 1S3SA 2BBWA 2BV3A 3LY5A 4M9QA 2IXGA 3NC1C 1DAIA 2SHKA 3LLUA 1KZ7B 2IYYA 4IEIA 1TU3A 2HT6A 4DDTA 1WBBA 2OEPA 2OV2A 2CMKA 3GLFE 1Z6AA 4QBFA 5K8UA 2GNOA 1XBTA 3BIFA 3MWJA 2QAGC 3A4LA 2FPKA 3OIUA 2BM0A 2IYVA 5JMTA 1YRAA 2WSSA 4HYYA 3GLFB 4EAQA 2XXAA 2OFWA 2YWHA 1K5DA 4V0KA 4BZPA 3T12A 3QKUA 2IUUA 4FMDB 1CRPA 4LRWA 4YMVA 3P4XA 4JT4A 1E2DA 1QHNA 1VYVA 3WNCA 4LBYA 4KODA 4M1TA 1XZPA 3KJEA 1DTSA 2A5JA 2WJIA 2ZR7A 4DCSA 2PH1A 4CW7A 1BYUA 4OI0A 4PZLA 2C5LA 4NCHA 1XU4A 2QEQA 1S96A 3WHKA 1W4RA 4L9SA 5TB5A 2BDTA 3SYNA 1GRRA 4A6XA 3U61B 5KSZA 1G41A 1CJMA 3CPHA 2XZLA 2GJAA 2J1LA 1E0JA 2GCOA 3KXLA 5FBWB 4R9UC 3V4RA 2G6BA 5JHHB 2ZRNA 3TUJC 421PA 1QRAA 1GUAA 1H8HD 3LX8A 3O8DA 1G9XA 1SHKA 1T8TA 4NP6A 4DB2A 1L7VC 4Q00A 1I2DA 1Z0DA 2EWWA 4CZ2A 3U7HB 4DLZA 5JEEA 3EC2A 3QQ5A 5D3QA 4TQUS 1RZ3A 2B7CA 2F1HA 2IYWA 3TKLA 1GITA 2ZQ5A 1I4LD 4LOAA 4KU4A 3GLHE 1N6PA 5IF9A 1H65A 2REBA 2A5DA 3CX6A 1NF3A 4B76A 3UWOA 4J0QA 5CJ2A 4A8JC 1R0YA 1GWNA 3KQLA 1JR3E 5DSZA 2WVJA 3MCAA 1R4AA 1ZD9A 1SZPA 1QHXA 3GLHB 3L0SA 3L0PA 2CLDX 3TBKA 3VKWA 4EPVA 4LC1A 4JSTA 4UNQA 3BE4A 4M0LA 4ASUA 4BEJA 5FL3A 1CXZA 2Z0MA 4NPHA 1NIPA 2YOFA 4WZAE 8OHMA 5JRJA 3QF4A 3EWAA 4WZ6A 4XVUA 1E0SA 4LJYA 1OHHD 4N3NA 2FFBA 2ZE7A 1LW7A 3DEFA 1FX0B 2D3WA 3CF6R 4CRWB 3ZVMA 2XNSA 1OIVA 1IY1A 5J4VA 1T91A 3FPAA 4YMTA 5HR5A 2FU5C 1DE0A 4BFZA 4KFUA 2IA5A 5JBQA 1E2KA 4U7DA 1G4AE 1E2IA 3FKQA 4JZKA 2QT0A 4URZR 5KO2A 1HT2E 3TSZA 3WNBA 3CR7A 4NL4H 4UNPA 1NVVR 1DAHA 3LD9A 4GSYA 5EUMA 2WWIA 2FSHA 1OXUA 2CVHA 4HUQA 4OHYA 5EP1A 3LNCA 4NYMQ 3GLIB 1OB5A 3CZQA 2C8VA 2GZDA 4XWOA 1S9DA 1XFAA 2VP6A 3ZIAA 1CR2A 3AUXA 2N42A 3B1WA 2NO7A 2GK7A 2YYZA 2IXFA 4ZCIA 4JT2A 1KO8A 2CL6X 4AWXA 2EWVA 1US8A 2YVUA 3P27A 1KMHA 3LXRA 3B13B 2ZJOA 3EX7C 1EK0A 1YE8A 1SKYE 2C95A 3IQXA 4TLAA 1FTSA 1ETUA 2FN4A 2ZJ8A 3EIEA 3V9PA 2IF2A 3WHLA 4B2PA 4DUGD 1OIWA 4ITRC 3QXHA 2QP9X 3FHCB 1GOTA 2ZRDA 3O8BA 2PX3A 4UQOA 5G41A 1D5CA 2GEDA 1E9EA 3ZH9B 4UXHA 3TNFA 1TPZA 4RD2A 3W34A 1ZIOA 1UBCA 3CWZA 1PLJA 4WA7A 1EWRA 1CIPA 3THXB 4US1R 2WWGA 4JLMA 5DISB 3K53A 4D0LB 1E96A 1NLYA 2JJ2A 4RD6A 5KSYA 1Z08A 5FR1A 3VTKA 1IOZA 4Q7LA 2ZI5A 2O52A 3RC3A 3UXMA 1W44A 2QMHA 3M6AA 3BD9A 4GP6A 4NBSA 4NCJA 5CITA 2YOHA 2JJ2D 2CNWA 1CS4C 4URXR 2GZHA 1KI6A 3AVQA 3KUCA 1CR0A 4JIMA 5D3MA 1IN8A 1N6LA 4OK3A 3ZVNA 2GK6A 4NH0A 1FQJA 2G77B 2GTPA 4DSNA 3PIRA 1E2QA 2W2XA 3VKHA 4BRWA 5JCZA 2CNWD 1MKYA 5CK4A 1XEXB 3V00A 2R62A 3QSYA 2W6JA 4AIIA 3BBPA 1AQYA 1XTRA 3TVTA 4XD7D 4MYTA 3UG6A 3T1VA 1OF1A 4TYQA 5FUVA 4AG5A 1WB9A 3SNHA 1TQ2A 4ZIRA 4DLVA 1K6MA 4OQXA 1IXZA 4DVGA 2XOKA 1CP2A 4IXMA 4G3XA 1K8RA 1KSJA 5J4HA 1EWQA 3W6NA 1ZCAA 2GXSA 3DZDA 1R0ZA 1Z29A 4YC7A 3AEZA 1J2JA 2ODWA 2VBCA 4AYTA 1SXJE 4CEJB 1NY6A 3ND8A 4QJ5A 5DI3B 4A36A 1N5IA 3R9WA 1UAAA 3W6OA 4C7OB 1DARA 2D2FA 3WMEA 4Z51A 1IY2A 3BH6A 4EJSA 3TUIC 3KFVA 1SXJB 2F3RA 2YOGA 2IS6A 1OH7A 3OE7A 1EX7A 4M2LA 1XD2B 3B82A 5C1BA 2H8KA 1VG1A 2DBYA 5B58C 2QRZA 1YZUA 2FA9A 2ZS7A 3BH0A 3HDTA 3PCRB 2YINC 2JASA 2MMCA 2W2TA 2J41A 4KCGA 5H70A 1SVMA 5C4GB 3OIYA 2ZANA 4ILEA 3SOPA 1NVXQ 1P2VA 2FF7A 3FMIA 4QBIA 1R5NA 1P2UA 4MRVA 4QJ3A 3FOZA 3BFKA 5LB2A 2HCBA 1PUJA 4H1UA 3ZGXA 5F98A 1KAGA 1QZXA 2VHCA 2FPMA 4UKDA 4BASA 5TXGA 4D25A 3T1OA 2VSOA 5CK5A 2WV9A 2ZUCA 4V0OA 1Y63A 4A1FA 4RFSB 3T34A 1MR3F 2KSQA 1II8B 3CX7A 3LQQA 2BIFA 4QHSA 4M1KA 1G3UA 1RYFA 5KTYA 4NU0A 1R10A 4YDHB 1FFHA 1DO0A 2BMJA 3LVRE 5KNBA 3CM0A 2W00A 4LK2A 3I73A 4TL8A 4TSFD 3U60B 1E9AA 2V4ZA 3HR7A 2OZEA 4PTLA 3KB1A 3QXXA 3DOFA 4MYHA 1FOEB 4ARZB 4CVNA 1Z8FA 4M9XA 4JLKA 4MGIR 2WOJA 2YC4C 3ZD6A 3OIWA 5DNYB 3PG5A 4JLOA 3NBYC 2C96A 4L5BA 2WJVA 4RZ2A 4HB4A 4DBLC 4Q19A 4POAA 4KITB 2WKPA 2EU8A 3QG1A 4D4JA 4QBHA 2BCGY 1WQ1R 2O8FB 1AN0A 2JDIA 2PCJA 4G5OA 3U7GA 2OM2A 5FPSA 2O8EB 5JJKA 1E9SA 2HYDA 3EZ6A 1E4VA 1XB2A 1JAHA 1W36D 1AKEA 3K8YA 1SVOA 2WM9B 1RVDA 3KTAB 4LJ4A 4DXAA 1BKDR 2C77A 3KZ1E 4Q9IA 3QJYA 1KI2A 2QMUA 1E1RA 2OFXA 3MWYW 2NPFA 3BORA 4PXAA 2O0KA 2JATA 5JSZB 1ZNXA 1QHSA 4M9SA 1GVNB 4HB0A 1RFLA 4FW9A 2WPDA 1DVRA 1YVDA 4C0AC 4DDWA 3OEHA 4GDFA 3MSXA 4JLAA 2WICA 3A37A 3IHWA 3HR8A 4E03A 2OG2A 2IC5A 2ZIAA 1HYQA 2OESA 2VA8A 3MUFA 2H18A 1NSTA 4HI0E 3NHAA 2ZYTX 3DOEA 3IO5A 1KKMA 3OEHD 4TL6A 3K0SA 1IXSB 3TQCA 2QZ4A 3PVSA 1PJRA 4IFBA 4RZUA 5BN3A 4ACAA 1G8FA 2HLDA 1Z06A 4PC7A 2YHSA 1YR8A 3U4QA 3BB4A 4DCNA 1GG2A 4RCZA 3BFVA 3UKDA 3NC0C 1RPZA 5HKKA 1KI8A 1XCGB 5FBQB 3T5GA 1B23P 2BKEA 1VG0B 2HLDD 1CJTC 2MMGA 3FWYA 3QENA 1UM8A 2GEVA 4KVAA 2PLRA 4B44A 4N0EA 3SBEA 1Q1ZA 1Z2AA 2X1VA 4KYUA 1NG1A 4M1SA 1MABA 4Z54A 1FW6A 3TGPA 1DO2A 3AF1A 4OHWA 2WJHA 5UKDA 4KLNA 2H57A 2EFHB 1FZQA 1ZBDA 1Z0JA 2G83A 1DAMA 1RJ9B 3FDIA 4XIGS 1JNYA 2F9MA 5K8TA 5FUXA 2ORVA 4LC0A 1NY5A 1QF9A 1FX0A 1TEVA 1OYYA 2QL6A 4G5RA 4HEJA 4Q47A 4BUJA 5CDFA 1FMLA 1IN4A 3QE0A 2X2FA 1VDZA 4LJ6A 1L4YA 1XZQA 2BOVA 4UJ5A 3NH9A 1G8PA 1F3OA 1DELA 4ZDJA 2DR3A 3QUSA 2ERYA 2AKYA 5GJBA 1G5PA 1NBMD 4NCIA 2F9LA 2QT1A 1Z5ZA 1NP6A 1P5ZB 2VP4A 4G0NA 4JLNA 4L16A 4IDPA 5A0FA 4W9MC 3EPKA 3QNUA 3VU9A 4RZXA 4DDVA 2VTKA 2IX3A 4MYUA 3NH6A 4L4UA 3W6PA 1UADA 3X1DA 4NYIR 2V7QA 1TF2A 2ZE5A 3R7WA 4PZYA 1AS2A 3AKCA 4PC1A 4NE2A 2G1JA 3TR5A 2YWEA 1OV4A 2HUPA 3EARA 4LBZA 4MITA 4R98A 2F6RA 2J45A 2CXXA 2Z4RA 3AKYA 1KSHA 3K70D 4EJSC 4QFMA 2RB4A 4ZPXA 2IBMA 3QKSA 4B3BA 4Z1MD 4RD1A 4LV5B 5E7IA 1S0UA 2QROA 2WJYA 2CCKA 2ZRIA 4BLOA 3RLFA 2CCGA 3AQ4A 4LV6A 5TY0A 2P3SA 3RC8A 1TF7A 2D74A 5EP4A 3SN6A 3CRW1 1XTQA 3NWJA 1G8YA 2ORWA 1ZU4A 1XPOA 3FMFA 2IS1A 4G5QA 4Q4AA 2B92A 3W3ZB 3J81k 1R2QA 5G3YA 3WY9A 3B6EA 3VR5A 1YU9A 1BS1A 3ADCA 1Q20A 2FSFA 1W47A 4JL8A 3A6PC 1UBGA 3TW4A 1HUQA 3DHWC 4AK9A 2QPOA 3ZVLA 2XAUA 2B8TA 2PZFA 1CLUA 4UNNA 3UG7A 5JJLA 4EFMA 1P2SA 3QOFA 1PZNA 2FEMA 1OPXA 2VRWA 5E4FA 4C0JA 3PV0A 1E1QA 4M8NE 4JS0A 3WNDA 3TJZA 3CX8A 1GILA 3B9QA 4TYNA 2A78A 1R5BA 1XEFA 3K0FB 4BWYA 2O8DB 1GM5A 3EZ2A 3NHBA 2ZRHA 3HU2A 1U8YA 1N6NA 1XEXA 2WMNB 4EPYA 2KJQA 1AS0A 1P72A 5DO9A 2PJRA 3TSWA 3AF2A 3ZLJA 3T5DA 4BFYA 4GMDA 6Q21A 1UBFA 1UKYA 4V0ME 3MG9A 1ZNZA 1OXXK 3U3JA 1W48A 3AGPA 4YMSA 5FBRB 1R0WA 1ZYUA 2NPIA 2OLKA 4LZZA 1VCNA 1W0JA 1EFTA 3GFOA 3MD0A 4EKDA 5IHPA 1XXHE 4AYXA 1E2LA 1Q0UA 4BFVA 1BIFA 3TLXA 3ZZ0A 4RVCA 3N2IA 1QHHB 1I4DD 1GFIA 5DI3A 3D31A 2DFKB 1UPTA 3ETLA 4DT1B 1J8MF 2QPAA 3U6KA 5KDOA 2VP9A 4OJQA 3OZXA 5AUNB 1PUIA 2EW1A 4R7ZA 3IKJA 5JI3E 2GVDC 2ZYWX 2NO6A 2ZAOA 3FKSA 2RGNA 3ZDQA 4LV8B 2G9NA 4GPTA 1L4UA 1M74A 2PT7A 2XNDA 2BMDA 3NBXX 5GVSA 4PSVA 5SZJA 2OFOA 1MOZA 1KY3A 4CEIB 2QQEA 3FKSD 1W5SA 4MRNA 3Q7PA 4DLWA 1WDTA 4HUTA 2BMEA 5EZ6B 3DKVA 1N5LA 4X8MA 5FBVB 1FPMA 5LD2B 4IHQA 2VL7A 1UKEA 2FNAA 3PITA 1OXTA 4MKGA 1OLOA 1TUIA 2A30A 3DMNA 4I1SA 1E32A 2RGXA 3RYTC 2YKGA 1T5LA 1J90A 4UNSA 1KO4A 3RSOA 3SEAA 1Q57A 3HPRA 3HU3A 4GRAA 3ZYCA 2G1KA 4A15A 2Q9AA 3MRSA 3KXKA 1O87A 3SU8A 1KI9A 4CF7A 1DADA 3K9HA 4Q7JB 1S4QA 4GBMA 2IS4A 1Q12A 1W49A 1E69A 4PAMA 3L0IB 5TV2A 2A2ZA 1DS6A 4M1OA 2NZ8A 4QGAA 3E1SA 1VCOA 4YONB 2ZJ2A 1VYUA 1U0LA 2PJZA 1HE8B 1IN5A 2ZXUA 4YDSA 3HU1A 1N6OA 3C16C 1EFRA 4MA4A 3QBVA 5AJWA 3IIJA 4IXNA 1G7CA 3T15A 4V02A 5DGXA 3SS8A 1G291 5CB6A 3X1ZA 1NSFA 3KKQA 2FMXA 3KXIA 3LRPA 3QIAA 2UKDA 5EE5B 1EG7A 5AUPB 5JRZA 1WBDA 1W4BA 2A7QA 4F93B 2O8FA 4KJZA 1H8EA 1E4YA 1GKUB 4FCWA 4B75A 1NLZA 2ZRFA 1G8HA 2GVZC 3GQBA 4Q1BA 3T61A 2O8EA 2VSFA 2DFTA 3C41J 5CIWA 3OIVA 4C3ZA 2J7PD 4OHVA 1YR6A 4JVSB 4RFVA 2PZEA 1WXQA 2AXNA 1MT0A 3PUYA 2JIZA 4KXFB 1T4GA 3UMSA 4BE7B 2OILA 2QA5A 2A9KA 1VKJA 4JL6A 2VIIA 4D4KA 4DB4A 5FTKA 2IYSA 2DPXA 1WRBA 1OXSC 2QAJA 4OL0A 3K70C 2ZUBA 2NO1A 3AVTA 1R0XA 2C9CA 2D06A 3RRZA 1JBKA 1Q21A 4QC2A 3EPJA 2OCPA 1RRPA 1E0KA 4LWZA 3RWMB 1EFCA 5AUOB 3P26A 3SR0A 2QTFA 4MQBA 4Q7KA 2RGAA 3Q85A 2HYIC 2H17A 3BAFA 3TAHA 2ZTSA 4EDHA 1Q3HA 4Q66C 1S2MA 4MYCA 5AJVB 5B30A 4EQ6A 3U3RA 4Q4HB 5G3ZA 2QGZA 2ODNA 2WSSD 1E9DA 1UFQA 3GEEA 3LA6A 4B33A 2BBTA 4IKEA 3SHFA 3VR4A 4R71A 1XPRA 3QXJA 2FSGA 2ZRMA 4U02A 1DAFA 3X1YA 1AK2A 4LJ9A 4I1UA 5FH9A 2O5VA 4KSCA 4GOKA 5L3SB 1P75A 4K46A 3UANA 2JLYA 4QM6A 4PZZA 4NKRA 4P33A 4KV9A 3F8TA 1GSIA 3L8YA 5P21A 2NIPA 1HURA 1XF9A 3WBKA 4P4SB 4LHZA 4B73A 3GEHA 4EUNA 4QNMA 2GJSA 1E2MA 2CJWB 2I1QA 3DPUA 4NONA 5E95A 1E94E 2ZS8A 4URYR 2J0UB 3A1UA 3UWKA 3LQRA 3EG5A 2Z83A 3ZD7A 1Q1QA 4Q4JB 4LPSA 1KO5A 3FMPB 2PZGA 4TLDA 1WA5A 1V5WA 2GXAA 2X2EA 2ZE6A 1TAGA 4IVPA 1U2RA 4PAOA 3QPVA 1KJZA 1T3SA 2XJ9A 3AP2A 4CT4B 1OXVA 3L0OA 3K0AB 1GRNA 1NG9A 2PEZA 4G1UC 3IQWA 1KKLA 1KYIA 2F43A 4Z8XA 4BZXA 1HV8A 3K0EA 4NYJQ 4A0GA 4HAWA 4DEXA 2AL7A 2PL3A 4TMWA 2GCPA 3CPJB 3RS0A 2K5UA 2IW3A 1KK0A 2QNRA 2O8CB 1NLFA 3M1IA 4GOJA 2XSZA 3P1JA 4YMWA 2UVQA 3LFUA 4WXRA 4ASUD 2P2LA 2WWXA 3NEYA 121PA 2Z43A 1ZUHA 2R2AA 1J99A 1Z6YA 5IK2A 2HXYA 5L8VA 2XSZD 1EXMA 2ZSDA 1G7SA 5HTKA 3ND9A 1YZGA 5SZHB 3U6BA 4WOPA 2RGNC 2QGNA 4ZKEA 3B5JA 3B85A 1JQLB 5FUYA 1S3GA 3UPUA 5DI9A 5FI1B 4X8LA 3U5ZB 5J4KA 5KYKA 2NQ2C 4NMMA 1NBME 2E1RA 3WRYC 4ACBA 3G5UA 1Z0FA 1XEWX 2Q3HA 1VCMA 3BOSA 1HEIA 1U9IA 3CH4B 4HB3A 3JZAA 4Q7MB 3T1TA 1BOFA 3HPQA 2QN6A 3TAUA 3R8CA 2AKAB 4OHXA 1JI0A 3AVPA 4DLSA 4MUAA 5FOSA 5JLJA 3IHLA 1V43A 3IPXA 1NMYA 3KFXA 4OBEA 2F55A 1DAEA 4B43A 2CBZA 3CF2A 3ZIAD 1ODFA 3H4MA 4NHOA 1EX6A 2ZI9A 1X8JA 2IEYA 1D2MA 4IDQA 4NTZA 2HJGA 4MH0R 4DLYA 4HZUA 3WBJA 2AWOA 4PC3A 4Q18A 2P0EA 1E2EA 1SKYB 3UMRA 2WWWA 5ELXA 2ZUDA 3GJ5A 3PUXA 1II9A 4G5SA 1X8KA 2ZVQX 1IN7A 4MRRA 4V03A 2C99A 4JKIA 3A1WA 1ANKA 4HLQB 3BS4A 1ESMA 3AVOA 3CRMA 1DG1G 2GXUA 5E3HA 4IDHA 4P32A 3QVVA 2VLIA 1QHIA 4IRUB 1OW3B 3VMFA 1VPLA 2QAGB 4LDJA 5EQTA 4JMPA 5FOWA 3AH8A 1LF0A 1E99A 2FDCA 1MRSA 5DYGA 1E2NA 5KSPA 2FG5A 4DDUA 1UEJA 4IOJA 1NI3A 2W2VA 4M1YA 2NTYC 5A5GA 4TT3A 4UXJA 4C0HA 1GNPA 4D0NA 3SC3A 5BWMA 5CLQA 2ATXA 3SDZA 4CGZA 3AVWA 5IDVA 3TE6A 1Q3TA 4D82A 1GNQA 2NMVA 1NJFA 1Z47A 4DT1A 2GZAA 4TTPA 1GL9B 3PUVA 2QBYB 3NBFA 1ZU5A 1LS6A 1P9RA 4TT3D 1YR7A 3MAAC 1N5KA 1NJGA 4M1WA 1F60A 4ABYA 2GILA 4FD2A 1W1WA 4JSYA 1A4RA 1W2HA 4LJ8A 4BLQA 2ZRCA 4FMBB 2FFQA 5BYKA 1TNDA 2QENA 1UF9A 2W0MA 4QJ4A 1TF5A 4US2R 5KU1A 4PO1A 1F6BA 4HZIA 1W7AA 4JKYA 2W6JD 4Q02A 4QGGA 3SI7A 4A4DA 4DZZA 1KSFX 2GJ8A 5LPNA 2B8WA 4B35A 5JWOA 4ZI2A 3ECCA 5BXQC 3EXAA 2MSDB 5DHAA 3OAAA 4C0BA 3ICQB 2F7SA 3KQHA 5JWHA 1IONA 3LBHA 4LBWA 3TR0A 3U44B 4HDCA 1A7JA 2C78A 1OIXA 1KIMA 2XOKD 3H2YA 1JQJC 3QKTA 1XMSA 3QXCA 1WE2A 4QM7A 5EXTA 4DCVA 3C5HA 4DCTA 1P73A 4DSTA 1D6JA 1GKIA 3DL0A 1E9FA 1FMJA 1C9KA 2N46A 2NZJA 1M2OB 1OH8A 3ADDA 1KJWA 1KNQA 3WP0A 1Z63A 1D9ZA 2IYTA 1P9WA 3B9PA 2FOLA 2XJ4A 1TL7C 4P31A 2GESA 2RGCA 2XTMA 1ZNWA 3ZZUA 4HAVA 2V55B 4FN5A 1UDWA 1QVRA 3OE7D 3ICEA 1EFUA 4IFEA 4QNRA 1JJVA 1OYWA 1MRNA 2HV8A 3HYRA 1TADA 3OEEA 3LVQE 1ONBA 1U0JA 4NYIQ 5C4MA 1CR1A 2BEKA 2O8BB 2RH5A 2WSMA 3RRYA 3CBQA 3FTQA 4CEHA 2V6IA 1J70A 1G5TA 1XTJA 3A1VA 3A4NA 2VF7A 2B7BA 3GD7A 2E87A 4BPBA 5DLQC
chains in the Genus database with same CATH superfamily
4XYLA 4CR8A 3L1IA 3ZDXB 3GLGE 1W5AA 5EMNA 4EPXA 5LBIA 4FGZA 4WN9B 1N77A 1CQJA 4QG7A 3SMQA 4DIEA 3RW9A 3E27A 5LMZA 1P0MA 1BOOA 2ANCA 1M67A 3I2HA 4U2FA 5EOVA 2JLAA 3BXHA 4CKBB 1XPUA 4IRXA 4UCXA 4AQDA 1FLDA 5FOTA 4CTMA 4QGHA 1EVEA 4P08A 2VZ8A 4EUKA 4DA8A 5GZ1A 2JFYA 2ZZMA 2M1ZA 2GCEA 3A27A 3B9BA 5BSFA 1XALA 4RXMA 1JSZA 3K9GA 1X1RA 5L40A 1OVMA 2JRCA 3P32A 4PYQA 2EQ5A 2P1DA 2O2IA 3QVGA 1ZRNA 4BFWA 2F3TA 3KWFA 5GGYA 5HQJA 3L7AA 4BMOB 2ECOA 4EAAA 2GCIA 1GCOA 2PBRA 2QN1A 1IN6A 1YZYA 1OWNA 4IV5A 3O1LA 4LISA 3SHWA 2OXCA 2V0NA 3OCVA 1JDBC 3AEUB 1UBNA 4LDAA 2BFDB 4V3CA 3RVBA 3PHIA 3VHRA 5TX7A 3KLPX 4AKTA 4P4NA 4WE3A 1ODCA 3COYA 4KBGA 4W5HA 1E18A 2XDQA 3EW9A 4TWIA 4ZMRA 3FHTA 1AZLA 4B3CA 2FEKA 3IP9A 1NNLA 4D99A 4ZYVA 2Y9MB 1MV5A 1NXWA 1V9CA 5AO9A 4H1VA 5FI0B 3ERCA 4JUBA 1KI1A 4WUTA 4OJTA 4ZU3A 4KBFA 3H5OA 4DWJA 2QZJA 5CRIA 3GJZA 2HA4A 2P3OA 3UJDA 3MMNA 1ISFA 1G3IA 3R20A 5T8KC 3VVMA 2VSYA 3W9YA 2JCSA 5I4IA 1F2VA 4XGNA 1CUDA 5KTRA 1JJ7A 4PC6A 4YXFA 3IHTA 2CLLB 5KTTA 3ZLVA 1HOTA 1FP2A 4TMFA 5GM2A 3FBTA 4BMNA 1ZEMA 1TYCA 3LT5A 4C4XA 5JZMA 3IKVA 4GYKA 4WVFA 2P79A 3HZOA 2DWCA 2XH8A 4L9WA 4NE7A 5F9MA 4BGDA 2HN9A 3DJFA 1I3OA 3QG5A 1KPGA 4N6GA 3D6JA 2HBZA 4PSDA 3RFXA 5IVHA 4PQFA 2CFCA 1CCWA 3CEAA 3G0GA 4QVGA 2EG5A 3IILA 3Q6IA 5FR2A 2JI4A 5BSMA 3BJEA 3TCNA 4BHTA 5E7JA 5KYUB 4BRUA 1W87A 2O50A 3P19A 3Q6NA 5E8JA 1BEZA 2RH9B 3UPDA 3VQTA 5K6AC 2HIHA 3MWLA 3IR5A 4TMZA 3SEFA 3UWSA 4C4ZA 1SCUB 1LFAA 1RQNA 2QNIA 3RJMA 5LA6F 1V5GA 5ALKA 3RFCA 3UK0A 1ZH6A 5ILQA 1COWA 4L15A 4JGIA 4LZNA 4WCFA 4E22A 5HKKD 5JNLA 1ATIA 4OQYA 2IZ6A 5JALA 2AG5A 1JEJA 2EZ9A 1SQGA 2DHDA 4RQBA 3EWSA 3LUJA 4QICA 3ODPA 1TEXA 3Q7EA 1OY1A 1Q7RA 2SICE 3QVTA 3D3WB 5IYZF 4AX4A 3DDNA 4D9IA 4ZYTA 4FKZA 2CVPA 1L2TA 1Z5OA 3V7YA 1TK9A 1JHXA 5KYYB 2KQUA 3KHKA 5TF0A 5EERA 2VHWA 1OFTA 1JHRA 1OLUA 2I5PO 1XTIA 5JXWA 3KCQA 1KVQA 4Q3CA 4E3ZA 4KO8A 4YJ3F 2ZDQA 1P8JA 2ZR8A 2IYXA 1GLGA 1W8DA 3UXYA 5AKYA 1AMNA 5EJ8A 4R3UC 3DLBA 2HA7A 1NW7A 4F6LA 2X9NA 3ASZA 1RRGA 3E3LA 4ZVSA 2IBTA 1ZN9A 4K9LA 2Q9CA 3A58B 1EDBA 3HA5A 2ZSBA 3C3WA 5ED0A 3ZCQA 2HWKA 3CV3A 1EUQA 1GGJA 3IB6A 4KW7A 1ORHA 5K3SA 3TQQA 3CRRA 1RLJA 3VTZA 1OGIA 2XX3A 2ZR9A 2UUPA 2VHXA 3NCHA 4K6HA 5C46F 4R16A 5HUHA 1YJBA 3DG9A 4ZAGA 5B2ZA 3V4OA 4KWIA 1W76A 3AZOA 4RA6B 1FA9A 3FOFC 3K09A 2YNMA 5LDDC 2QB5A 5BWNA 2C29D 4Y1GA 1VXOA 4P4GA 1DFGA 521PA 1ST2A 4MVJI 1KGSA 2HMUA 4YRTA 1DAGA 4V1CA 1DOHA 1SUSA 4YR9A 5LUBA 4R1QA 3PKZA 1AE1A 2BFPA 5BT9A 2W8BB 3EIUA 3LTNC 2H51A 1PDOA 1BDJA 1HY3A 3A04A 4TQ9A 3UATA 3T9AA 2Q2WA 3D4OA 4NG5A 2V3WA 3IEUA 3FCSB 1W73A 3VAAA 4ES6A 4CIDA 3S99A 3E3NA 2VQ3A 4ITVA 4HXEB 2QG6A 3GW8A 1T6ZA 3L1VA 3CFYA 2G4VA 1NPTO 2Z2KA 4RY8A 2Q0HA 1P4JA 1SXHA 1GRVA 1MA3A 1Z4NA 5TQ0A 3RADC 1ZAKA 1B6SA 3EXEB 4GM0A 3IIMA 4IVQA 2JD2A 1JHUA 4DDHA 3L7KA 1TTTA 3NJ8A 2JJ1D 4PGAA 3RR2A 4CQLB 4B47A 1TTQB 1ODSA 1X15A 3EPHA 4RNCA 3K9CA 3M6VA 3LUAA 4BFTA 5B1EA 3C5VA 2J9FA 1BN6A 4WADA 4CF5A 2ID9A 1FNNA 2CZCA 4HLUA 4FOSA 1CUUA 3KU4A 1T2UA 3VR5D 5EE9A 4CLEA 1IJFA 1MZVA 1HO3A 2HFJA 3SVLA 3WYGA 1DJMA 5HHTA 1HX7A 1KSGA 3OY2A 4M4SA 3O1HB 4CTNA 2ZSFA 2HCRA 3C14C 2E4ZA 2MT9A 3JWJA 5ICCA 3NHPA 3O95A 4LF6B 1GZ5A 1XK7A 2V54A 3TIGA 3WGQA 5LZ2A 1Y8CA 2W83A 3LZDA 4GLBA 1SZDA 1YGYA 3FSGD 1E1QD 3LL4A 1I1HA 2DP4E 3G0HA 3ZXIA 1T8SA 4KYIB 1PHRA 3VH1A 1U8AA 1Z5UA 1HFEL 3IP7A 1UP6A 4RMGA 3T35A 1ONSA 1TW2A 3NOXA 1G0OA 1I32A 3K0HA 3MT0A 4ETNA 5DBIA 2AN4A 3SJCA 3A6JA 2HHCA 4X91A 1SCJA 2CL0X 2BFWA 2ZYGA 2QAIA 3L1HA 4KXXA 5H5JA 1DQZA 5FOQA 5JANA 3RWBA 1OFHA 5LLDA 4LI0A 3RAPR 3ANNA 1NXOA 2QXUA 5DHRA 2XZPA 2ZJFA 1PJAA 4WNIA 3NDBB 4K9OA 5IAJA 1N9KA 3MQFA 1MX3A 5CNKA 5CA0A 1HDZA 1OX4B 5I3CA 2M2IA 1Z82A 3HGTA 4OHOA 2NUTA 1ZN8A 4PYJA 2WTXA 3PK0A 3R4CA 2HBRA 2QL7A 1ILWA 4JLDA 1RCTE 4YAWA 1P9OA 2JAHA 3TLMA 1WS6A 3ONNA 4MS3A 2V58A 1XZIA 4ZEMA 1XDWA 3Q8LA 2WUDA 2OCAA 3ZQ6A 1M8JA 3LRXA 4BFCA 4PNHA 1FFXB 2PT6A 3M5DA 2WU1A 2ATEA 4BAUA 1FW8A 1SBIA 2D5LA 4BLTA 2VA9A 2HXSA 4XRGA 1R0RE 3CZPA 5DKFA 1Z74A 2WAYA 3WK4A 4KAAA 1Y42X 1PEKE 3H5RA 3RB8A 1MJGA 4O0MA 1K6XA 2O07A 4ZDWA 1BW9A 1UUFA 3HFGA 3RBXA 4F3NA 5IS2A 3WGKA 2WG2A 1C3JA 3MGCA 4OHZA 1Q5PA 4IIVA 3KKPA 4FK8A 1NYRA 3H2IA 3A9CA 3ZD8A 1LSSA 1N0UA 2H2DA 3HM9A 1E6MA 2IE8A 4JJAA 7YASA 3DTYA 3FVQA 1U3DA 3JALB 4R0VA 4I4TF 1HE2A 2J3KA 2PS9A 4KVZA 4DIDA 4E1VA 2WFLA 5K8VA 3IDAA 5JS2A 1KXJA 3CMMA 4RIEA 4EG7A 4Z0TA 3IDZA 2CE2X 3NTQA 3LPAA 4BOYA 3HK2A 2XI4A 1NJ5A 3IDQA 4OPMA 1DKQA 2YMLA 5DNVA 3BXEA 4MSUA 4RFSA 3LY9A 1II8A 4TVKA 4Q9KA 3V6LA 3SQXA 2FWRA 2PMDA 2WLSA 1HR0B 3HU5A 1XDZA 5BN4A 1ZD5A 4OI1A 4EKGA 3RUCA 1FRFS 2P0AA 3ITDA 2VRBA 3CZAA 5HCNA 1RP7A 3I4LA 1NVMB 1Z5VA 3SJBA 5HRUA 3QP9A 2Q3LA 3WYEA 3ADBA 3IOMA 1T24A 4D3DA 4V0LA 3DKKA 2Q7OE 4F3CA 1Z4IA 1M7BA 3OOYA 2YUTA 1XE3A 1CE8A 1JJAA 3IERA 4XUGB 3WB9A 3CURA 5HE8A 5BMVF 3GCWA 5BR7A 3NUGA 4A0SA 4P3YA 5GV8A 2BSXA 1JL3A 1PT5A 1G64A 2G3YA 1EJ2A 1NZDA 2P90A 4C7VA 3I8XA 3DE5X 3VOSA 1YAHA 4AROA 4FYHA 4YRGA 2E9SA 3U1VA 1JBEA 3IVGA 4MDEA 4FWBA 1HDGO 2XHEA 4GD3Q 4G24A 2I4NA 4II3A 4K03A 4TTVA 4MX8A 2ZM6B 3EAFA 3G79A 2MR6A 4DFDA 1AZTA 1QG2A 3DNFA 3OQIA 3PYXA 4X71A 1OC2A 4JX8A 1H8ED 3ORRA 3V4FA 1KZ9A 5GM1A 1ZSVA 1O3YA 5P8WA 4MAAA 3IALA 3FDZB 5JV5A 4IGAA 3NI2A 2C94A 3A1FA 1V7CA 5H9VA 4H0NA 5HMLA 3SC2B 2Y77A 1X70A 3DZIA 3MHPA 4PG4A 5JAZA 1CRWG 2HBQA 2XQGA 3CUVA 3WSVA 5IHPA 2JIZD 2UYHA 1ZY2A 3GFPA 3LDAA 4L3VA 3CVVA 2H4HA 1D2EA 3M33A 1E9BA 2IIPA 4HGZA 3WBKA 4JJ8A 4CF4A 1EYZA 2IXEA 4TZ0A 1WW3A 1IM8A 4LHYA 2ZRJA 3VU0A 4A03A 4CR7A 4ON9A 5KOHB 3JVDA 2YVKA 2BE7A 3IE2A 4B84A 1RTTA 4TMKA 3ZJYA 4EG3A 3OFNA 1DJPA 4DLXA 2XCSB 2DZDA 1E3TA 2OD7A 2E4YA 3SEZA 2UUAB 3EEFA 2C3YA 5DT9A 4MQ4A 3R8FA 4IZ6A 4QPDA 4W8OA 5ESXA 2GAOA 2CXHA 4B17A 2OO5A 2PKEA 4S3MA 1PG0A 2NOAA 3A6LA 4EHLA 1U8XX 2C5HA 2BEWA 3O2SB 1GVHA 1FUKA 2G0TA 4HNRA 1ZC3A 2EW8A 1GEGA 1XYGA 3LU1A 4HBZA 1NQVA 2XB9A 3I6ZA 5DPMA 2ZTUA 3EDRA 1CT9A 1XTKA 5KYVA 3SZMA 1DKRA 2D2EA 4FOPA 4JUIA 4AT1A 1MEEA 4I50A 5H1YA 4RKQA 1BMTA 1Z35A 4CM4B 1GPBA 2WKQA 1JAIA 2GJKA 1W88B 3W8FA 3BMOA 2V65A 1QLJA 1W36B 3PQCA 1CNMA 4Z2YA 4K1LA 1OBOA 2ZI3A 4M8KA 2H54A 3RSGA 5BSRA 3QVJA 4ZI7F 2C0CA 2X15A 4CCAA 1M5TA 1Q0SA 1IC6A 5JVDB 1PFKA 1DBQA 3E03A 3VNUA 3VKGA 4QGSA 4GM1A 2ZRLA 3I37X 2W7TA 3TINA 1KK3A 4Z4HA 1RJ9A 2CLHB 2CWDA 1C1XB 2P9QA 1HNXB 4E94A 1R0SA 3QFCA 1QH0A 2AQHA 3IEPA 4RL6A 4UDOA 4YMUA 3H2JA 2WSYB 3RRBA 2XGGA 1T13A 3FUWA 2NVUA 2D7DA 1SK8A 1N2SA 4JLPA 1IUKA 4M1MA 3UAVA 5IBCA 1WD5A 5AWFC 3AY0A 3TLAA 3VPXA 4M9CA 3GUUA 3G0OA 3FOWA 5D5HA 5A5DA 1BX3A 4K9MA 1FBTA 3M0EA 4I9GA 2Q1UA 4E5UA 3AIIA 3OE1A 1AKYA 1RQ7A 2CHFA 2EWMA 3OJCA 1VMDA 3HP1A 2Q62A 3VAYA 2F8LA 3KKEA 5G1PA 3Q5GA 1UPXA 3DAHA 3LE8A 3NNSA 5DNAA 1S89A 4JBLA 4NBTA 5GTDA 3FCAA 1I7DA 2IWRA 3UK6A 4UHCA 4MS1A 1AGRA 3OSZA 1AN9A 2A9QA 2C5FA 3U19A 2EOAA 2X41A 5M7EA 1UZAA 2VHTA 3VX4A 2E3JA 4PQRA 1XVVA 3SS7X 3MGGA 3SQWA 4C2TA 4O1IA 2FX3A 1L5LA 4OHUA 4TWZA 1FXWA 3SFZA 5EIXA 2FLKA 5C3MA 4K40A 2PXCA 1VRVA 4J0FA 3B3AA 2YFHA 3HB0A 4PFSA 3T99A 1QH9A 2A5GA 2FGKA 4LYFA 3NFRA 3CW2A 5FUWA 5IFLA 3G8DA 3H5VA 2R86A 4WEQA 4Z2AA 1I0ZA 5DYIA 1M83A 3H5TA 4NU5A 3DZBA 1RYZA 3PWSA 1LTHR 1N1GA 2YXLA 4PYKA 5GVRA 1IULA 4DPKA 4HUJA 3D7MA 2DT8A 1AV7A 1R6UA 5JO0A 1RVV1 4N39A 1FYXA 2ONKA 3PC8A 3BC1A 4KMSA 1MO4A 2INGX 5IK2D 2MWMA 5EQJB 2Z3ZA 2JIRA 3GJ8A 4EBFA 1V41E 3H86A 5BSKA 5CDFE 2F4VB 5F51A 1G6KA 1RXVA 2HMWA 3BERA 2MSEB 1X1QA 2QSZA 2PX4A 2RIRA 5BQ5A 4EW2A 1JMKC 5I8ZA 1MD9A 5A4DA 4DANA 4FINA 4JVMA 4F7DA 4IJKA 5FV4A 4L5CA 3T7KA 1CTQA 3EIFA 3OJWA 2WP8J 4S04A 2XCIA 2YQZA 1NDQA 2J0QA 3IQEA 1U1EA 4FHCA 1UJNA 4M9RA 2OZPA 3ML1A 3NT2A 3W2HA 3FOBA 1Z12A 5IN5A 5EZYA 3LX5A 5PGMA 4E11A 4QFCA 1JLKA 1MH1A 1FMFA 4O4HB 5IJ9B 3VVBA 3HCWA 1IJEA 1GN8A 2VEDA 4B0OA 1FQKA 3JQ9C 1U81A 3OU6A 1VE7A 3DT9A 4PXYA 5IBPA 4FXPA 3RC2A 2PJDA 2RGYA 3GVCA 1DBIA 3EZ9A 2ZETA 4X8HA 3ILYA 2R6FA 2NQTA 1X6VA 3R7WB 1M1YB 1V7ZA 1GAJA 2CNOA 3L6RA 3CMCO 5FLEX 2C88A 2VSNA 3DEJA 4GQBA 4P93A 4AKHA 3PF9A 4EOGA 1I9GA 3PE6A 4LY6A 1IZ7A 4I4NA 1CZNA 5DH9A 4AJ2A 3D8UA 1SHTX 1T2VA 2IUSA 4LHSA 5DJ5A 4KOEC 1XAGA 2GN0A 1U2DA 2I3GA 3LQFA 1QQTA 2OYRA 1O4VA 2WEKA 4F91B 2JLXA 3ZY3A 3FCEA 1V95A 3DQPA 4NXMB 4DQLA 3QKSB 2C8KA 2WU3A 3R6WA 4IJ6A 3KHSA 4Q1DA 1K5PA 1FNSA 1PV2A 3SF8A 1UM9B 5K01A 3IUPA 3PTAA 3B3GA 4AY3A 1WXWA 5JARA 1TXGA 3L4KA 1I7PA 1PGPA 2H0QA 2I8LA 4NEQA 4OGFA 4DDMA 2OTCA 2V6FA 4Q4AB 4AKGA 3DO6A 4RQTA 4DL9A 1ZLYA 5EIFA 1JT2A 5D3ZA 3C3YA 4GNRA 3B2EA 4H4DA 3DWEX 4UXIA 1XEWY 4XQEA 5JY1A 3FYSA 3L2OB 2G4LA 5EJMA 1A77A 5LQKA 3UM9A 3ER8A 4IOKA 1XEAA 5EGSA 3O4HA 5BWOA 1NASA 2R9VA 3LCUA 1LJ8A 1KP2A 1U0RA 3GLUA 5BV1A 2OCBA 2W6ZA 4DABA 1UBSB 2XVMA 4Y2TA 3CUTA 2FZ4A 1P1BA 1KYYA 5E6UB 4NDNE 1E5XA 4CQMA 2A5YB 1G1MA 1Z0IA 2AXPA 4X65B 3HVRA 1R6AA 3EFOB 4UAVA 2AEEA 1TYZA 1X7XB 3VPFA 2QVBA 3AOEC 3JQAA 1C4XA 4L57A 4NQRA 4Y1FA 3EVCA 4NQZA 2PJUA 3AESA 4XD7A 1IOLA 1SAYA 1E3DA 2PZMA 3G9ZA 3GRFA 4WBNA 1XP8A 1WUHS 1IEWA 3ICVA 1KK2A 4R05A 2FZVA 4Y0AA 5DCLA 3T06B 4U2EA 4CKCA 1D9XA 2C3OA 3HXLA 1TUEA 2OAP1 3NOOA 4UAGA 3TZBA 2M6RA 2HFKA 1F14A 1GHTA 2XMCA 3PHHA 4G5GA 5G2OA 2VQSA 3JYHA 2YWBA 3Q5DA 4EKDA 1R5OA 2QN3A 5AVTA 3LXXA 4QOEA 3THYB 3CUEF 3S40A 2GLUA 3IR6A 1YIOA 5CFOA 4I1PA 3IEVA 1YDMA 2CVQA 4TYPA 3RS2A 4G1BA 2XW6A 2H59A 2W6NA 1U3UA 3AUAA 4G23A 5EIWA 2IRWA 5IWCA 1PL8A 3EVFA 1XCMA 3DUFB 4RS3A 1QO0D 2PG3A 3MUEA 2XD4A 2X14A 2CV1A 3O4JA 1XYYA 3WICA 1FFDA 1KEUA 3LYUA 2WDZA 3NDRA 1JHYA 1X1DA 2P62A 4RWEA 4WEOA 2JFUA 3LV8A 1VL0A 1TM7E 4A0FA 5I9SA 5DXAA 3W2TA 1B0PA 4MVJM 3CNQS 4L95C 1MNAA 4MLCA 4RIFA 4UUQA 3WMFA 3DC2A 2ERXA 3DTVA 1M9NA 3DZJA 2OBNA 3HFJA 4FYKA 4L50A 4K5QA 3WZ2A 3G82C 3AG5A 2UYCA 4OK5A 1CZKA 1JDNA 1YRBA 1UMKA 3NXSA 1NE2A 4QAJA 1QIFA 2IWHA 4CKEB 2L19A 1S8FA 3RS7A 2BEJA 2QN9A 2V45A 3EE6A 1T6NA 1ZGAA 2CMFA 1XZMA 3OEED 4W1RA 2WWYA 1UDXA 4B3XA 4OP2A 1S2LA 2ADMA 3K2BA 3VA7A 5M34A 2OQ2A 2B82A 4MUKA 4Q5IA 1AA9A 1LNSA 2BHRA 2ZBFA 3GELA 2GLTA 3DDUA 3UNXA 3WXBA 2QK4A 5CFZA 5JEDA 1T9BA 2PV0A 4WTOA 1OSNA 1ND5A 2ZWPA 3BTUA 1GQRA 1W8IA 1BEEA 4XTCS 1YZ3A 1KK1A 3RTCA 4HNUA 1J2YA 4NX2A 2QE7A 1PD1A 3ESQA 4YAUA 1EMDA 1QRUA 2ABWA 5EXPA 1SUWA 1FXUA 5C8ZA 2VNKA 2V03A 3URKA 2HRQA 1ZCJA 5COAA 3TW8B 2BJHA 3EBOA 2WWFA 1VLQA 4UE6A 4H18A 2VAWA 2JEOA 3EGVA 4X1YB 4G37A 5DWDA 4TSFA 2E48A 1OI4A 1CJSA 2AW3A 3Q3JB 4HS9A 4M36A 2B8NA 3B38A 1DEAA 3UZUA 3W77A 4CCWA 2CK3D 3MWKA 2ZKIA 1T34A 1E9RA 2LCQA 4QIHA 2J6IA 1U9ZA 3DM5A 3WLPA 3ZY4A 3WA7A 2H9YA 3A1SA 3L8ZA 3P9XA 3DUWA 2A1IA 2OENG 4U3JB 2Q3BA 3C6BA 2BMFA 4XWAA 4BVLA 3EGIA 3CVWA 1BE0A 2DF8A 4JI2B 5I6DA 3PSHA 1P2GA 2FH5B 1FDSA 2N1BA 2XWSA 4X41A 1ZVJA 2D00A 4B3DA 1DEOA 4B3HA 3PNVA 1ORRA 2X86A 5AQ1A 1CFZA 1XL1A 2I0FA 2IP2A 5F12A 1OH5A 4B7ZA 1RYNA 1MB0A 3ZGNA 3OSUA 3JR7A 4Q4HA 2X8WA 1LVUA 8GPBA 1C3OB 2AHOA 4PSAA 3PHJA 2NM0A 4MK4A 1HZJA 1Q2UA 1E3IA 1MX1A 1PS0A 3NBZC 4GZLA 4Z6KA 5DDIP 5AOAA 5JE8A 4CN8A 1GGMA 5K3AA 1GGEA 1AGPA 3OWOA 1AXGA 3D1LA 1PI3A 4R2KA 5EWLB 5I7AA 2NW6A 1WF6A 2VHUA 2WWRA 1IHDA 4JASB 2ZSKA 3A26A 3H9QA 4ME6A 1PWEA 4U00A 4BYGA 5T7BA 1WU8A 1DAKA 2C4UA 2EKDA 2ZU6A 3C1AA 4JB8A 2JLUA 1IRIA 1FRNA 1IAVA 1TPYA 1VJ1A 1ZD3A 2IHBA 4KQCA 3LVBA 3PZRA 2AN1A 3UC9A 3A36A 3V55A 3PPIA 2R6CA 3L04A 1DBSA 3REOA 4EHFA 3O47A 3SQMA 1Y9EA 2NZUG 4TTTS 1EK1A 1LDEA 2WBLC 1GTVA 2CJWA 2VH5R 2VF8A 1KR2A 3C3BA 3LC2O 3OOHA 3PEUA 4HNSA 4YUYA 3H1TA 3TOVA 3RIGA 1JSRA 4MB2A 1XR3A 4Q4JA 5TEVA 4L3OA 2AX3A 3HDGA 3QQPA 3QZUA 3HNOA 3VKUA 2J3LA 1TQ8A 3DZ8A 4RTRA 2PUAA 2GPSA 5IJWA 3KV3O 2Q9BA 2EGUA 4ETMA 1NQXA 3E15A 3S2IA 5AHXA 4JROA 3FI9A 1LX6A 1IXRC 4RGYA 3KOYA 4HAOA 1HTWA 3UBTA 2JZOA 3CVYA 3FRIA 3D7LA 1LDGA 2IUYA 2GZ1A 3ELYA 3GVIA 6YASA 1Z4LA 3KQNA 3AO0B 3LCVB 1N32B 4CF3A 1L8AA 3MAJA 2QI9C 3QEMB 4QWMA 4MQEB 1WDWB 3BCRA 4DM3A 1LRJA 2XKAA 5TGTA 4HMOA 5HF5A 4D3SA 5K9ZA 2WP0A 2NVWA 3FLBA 1FJGB 5HIMA 3DXZA 5BPHA 2QM3A 1QX3A 3CGGA 3V4VB 3WL4A 4Q3BA 1R12A 3R23A 4FBGA 4N3CA 3MWEA 3OF3A 4ZCQA 1SULA 4E70A 5K05A 3CEHA 4IICA 1JPJA 3R3UA 2SKDA 2W22A 3FXAA 2X8JA 2Q5QA 1NATA 3OCWA 4MO2A 3TOZA 3OJEA 1CX9B 3MQ2A 1KBQA 1N2HA 1DWPA 1YDFA 1QKKA 1CB0A 4UM5A 4QU5A 1TI7A 4D79A 1A4UA 3M83A 1Y3IA 2P2ZA 1O54A 4F4IA 2CLMB 4LCJA 5FUQA 4URHA 5IJZA 4MHSA 2WTUA 1CVIA 2CE7A 4JBXA 5EY5B 3T7DA 5DHQA 4K9DA 5SV2A 3ZXSA 2ZBVA 2PO5A 3AXSA 3KKNA 4OBXA 5JCOA 5E4TA 3EZGA 3I3OA 5KDDA 1M1XB 2HRRA 5B4UA 1JMVA 2HADA 2QJWA 1CU1A 1LBIA 4XYBA 4HWTA 1ICIA 1DC7A 1MN6A 1N5RA 1HOXA 1NKTA 2N75A 1WP9A 3KQQA 3JVUA 3NP7A 3S4YA 5AM4A 4KQXA 1JHDA 4LXUA 5LZ8A 5BRJA 1X3SA 1MOQA 5I51A 2CJFA 4NR0A 4XDYA 1PSZA 5CB0A 1YI0A 2Y1KA 1YB1A 3BTSA 5DRYA 2OPHA 4LHWA 2F43B 2X5OA 1T8UA 2GPWA 3AJ9A 5AKIA 5EKDA 3OHMA 4HADA 3T7CA 1Y37A 3GFTA 3ZUPA 1S1MA 3QV1A 3SIWA 4REMA 1YZQA 4EI9A 1OFUX 3N7TA 1GNRA 4MAFA 4ER0A 3VR3A 5J1SB 2MDTA 2XNKA 3EUAA 4UVEA 1OB2A 1UT6A 4WKNA 4ALLA 3DW3X 1TA9A 3QBTA 5HVNA 1OLXB 3TM4A 2IYQA 4QTZA 3R9IA 4A2QA 1E9VA 1C8VB 1U2TA 4IINA 3DT6A 3UTCA 1M8PA 1G17A 1K6IA 5LB4A 3A6HA 4YXWD 2XQJA 4D5GA 4E1BA 3C5CA 2R8YA 5B1IA 4LYAA 3WA6A 4BE4A 3STXA 4XD2A 3RBZA 1AD2A 3GLRA 2IEDA 4XSHA 3V6MA 3ASYA 3VXKA 4DG9A 5FOUA 4NJEA 4B3IA 5IVPA 4NOLA 1GG8A 1K7CA 1VP9A 2HGSA 3Q2KA 4OH1A 1WUYA 1P61B 2FR8A 5GQSA 5BR1A 1KBOA 2EGHA 2GHQA 5TVKA 3L8HA 1AM4D 2L17A 3CKLA 3CU5A 3T3GA 3ZGLA 3CPEA 3WFIA 3VDMA 4F2WA 2OK7A 3PYMA 4M0MA 2HK6A 1RRKA 3K9NA 2I2WA 4JIGA 4KAXA 1NNEA 1ELOA 1XZGA 1JLLA 3L3BA 4L3WA 1E9CA 4A9AA 1Y8ZA 1B8PA 3O3NB 4MW0A 1PUXA 1PG2A 1RW4A 3JQ8A 4W5QA 2B1JA 1L5RA 5A4AA 4FHDA 2O14A 1V7PC 1APBA 2X5JO 1ZCBA 3MGAA 1IB6A 1RAAA 5JJIA 4I0WB 3OPNA 3EDQA 3BXZA 4WLUA 5A3JA 4HZUB 1JJFA 1RAGA 2O7SA 3E7WA 4ENTA 3UUWA 4W1SA 3H1AA 4B8WA 2PWBA 4X1KA 3THOA 2B35A 3IAM1 4WXEA 4UTPA 3EXIB 1JT9A 2AD5A 3A9WA 2D54A 1YKSA 1QK4A 3CNOA 5ALHA 3O8RA 4RH1A 1WKBA 4E1AA 5B64A 1DWUA 1KXZA 2I87A 2RJOA 1I5OA 1XCOA 3IELA 4NNOA 3WGZA 4W5TA 1O6CA 4IHKA 4NV0A 1U65A 4W9NC 1XDBA 5CW1A 1KOFA 1Z0KA 2AFRA 1W59A 1BMFD 3Q9LA 1E5QA 2J3IA 3A2LA 4UD6A 4YPOA 3P5SA 1W36C 4GPD1 2K87A 4U63A 5CBPA 3NEJA 3QE3A 1JJBA 4WY5A 2II6A 1WCV1 2BFCA 3DWIA 1DNPA 1T29A 2AOWA 3RUHA 4LUCA 3G2IA 2GPAA 2IGBA 1MJ5A 1AV6A 2B6HA 3NTOA 2E4AA 5EXDA 4BFXA 1KZHA 4BP1A 4J3FA 1YB7A 4JJKA 4G56A 3NWPA 2ASEA 2ZBRA 4A2WA 1VIAA 4F5EA 5ALZA 3UWDA 4JVNA 4TUYB 1EA5A 4LJ7A 2O7QA 1RWVA 1U8ZA 2NV0A 1LVGA 3OHPA 4MULA 4ESHA 1JSCA 1X42A 5KNDA 4HVCA 2HGZA 2O8BA 1DUVG 3GJ6A 1ACMA 2DUJA 3LQYA 4QL3A 2W6IA 1ECPA 1KQ3A 3QHQA 3WMGA 2F8TA 2PEYA 3IMCA 5EMLA 2FPXA 3FUTA 3CIOA 3QHAA 3GGPA 3WGJA 4B8YA 4NFYA 1CF4A 4Z3OA 1YNSA 4ZIRB 1KERA 3HWWA 3BMQB 4AFNA 2Y1XA 3S7ZA 4M0PA 3OJLA 1ABBA 2XCRB 2GJ9A 4ZC1A 1IG0A 4BFUA 1EKXA 3FCUB 5DM4A 3AV3A 4MV8A 4MUGA 2IU4A 4E2FA 4LRYA 3DAFA 4KE8A 4WN9A 1JX6A 4DRXB 4JT9A 4PM4A 5LL6P 1J22A 4WY2A 5FOXA 3R7AA 1SIOA 3H2GA 1EHIA 3LY8A 1D4FA 3M6IA 1Q17A 2D4AA 2WI8A 4M1ZA 1NVDA 4PONA 5G53C 3I62A 5CG2A 3LM8A 5B1SA 2IEGA 2JAUA 1FYVA 3C4VA 2FPGA 2ZJBA 3GOQA 3KOXA 3RKSA 3QW4B 4CKBA 1AQ6A 1E6LA 3E82A 2DWPA 3OX4A 1A8UA 2IUTA 3U7QA 3ZG6A 1EE2A 2QE6A 1BS9A 1R6BX 4YJDA 1ZIPA 1V4BA 3LBYA 1LGYA 1BHSA 2KLBA 3HCEA 2JFWA 2C4HA 2ZJ4A 4CV0A 3AP3A 1N6IA 3KZMA 2XT0A 5CYPA 4JI3B 2GAFA 2H1SA 4LA4A 1A9RA 4F4UA 1XI2A 1VE3A 4C0SA 1B1AA 3AEQA 2VPPA 2XE7A 3IVXA 3P9RA 3W2IA 4LZAA 5HCIA 2MOKA 4OXRA 3CEJA 3AEUA 4R2LA 1VYHA 3LUGA 2BFDA 3EVBA 1GL7A 3FE2A 3IP1A 3IBGA 1XTSA 5EE0A 3SOZA 1U99A 4UUPA 1FU7A 3UUFA 3U1BA 2JKZA 3FDXA 4GVPA 4L8YA 4KPUB 1ZXXA 2JJYA 3RRMA 4X61A 3WIEA 4D4LA 2NG1A 2GQ0A 1GUBA 2PVSA 5JZVA 5JD6A 1CJKC 2ORED 2YNMC 1OBCA 1P1HA 4IYRA 1EJBA 4PIMA 4C22A 4J3JA 3CIFA 3PE4A 3SDSA 4U5QA 1LEHA 1E2UA 2ZE8A 3TQSA 3ZK7A 1L8OA 1R0CA 2HDOA 1BEUB 1U7HA 1VPVA 3KQWA 1FVXA 3HS3A 1Z68A 4LMBA 3HKBB 3RHSA 1LCIA 4WI1A 4DKJA 3UMFA 1V1MB 4URUR 4G81A 3DBRB 5J63A 3SF8B 3ONWA 2IY8A 3HM2A 4KQWA 4LRSB 3FMVA 1LBSA 3LO5A 3U0BA 1J0AA 1M66A 1NFQA 3AFNA 4TLBA 4DJEC 4B45A 3UWMA 1C8LA 1OOEA 2P9ZA 2V97A 2ZYUX 3CZCA 1E98A 2QUBA 4HEA6 4PX2A 5F2NA 3D8BA 4PLTA 4BO2A 2LBPA 5E8RA 3MFQA 1JEAA 4KDEA 1WMDA 1TAUA 2BBWA 4PF1A 3VZQA 1PNVA 4QUKA 1KZ7B 3I2GA 2IDKA 2WJ4A 2ZBGA 5C1PA 2HT6A 5KYUA 1T9KA 5KKCA 2QYOA 2BGGA 3V4LA 2LP4Y 4HR7A 1Q1GA 3GLFE 1KEVA 1D3AA 4GOOD 1B0AA 4MUHA 4BCDA 2GNOA 1VP3A 2JIMA 1XBTA 2FR1A 3MWJA 3OWXA 2FJPA 1TZJA 2Z56A 1N2CA 4LOLA 3EIOA 4EY6A 5JMTA 1DC6A 2Z5GA 1OZAA 4EAQA 3SC6A 2OAGA 1Z62A 4MV0A 4LW8A 4NFLA 4R7GA 4DW8A 4N54A 2IPAB 4CBVA 4FMDB 1RACA 4X62B 3ZI7A 1OBFO 2B3DA 4UM9B 3WKAA 3CJTA 1NNI1 3LPMA 1J09A 4XQCA 3TGLA 2V5AA 5KYYA 4LBYA 3G7UA 2WFZA 4OLHA 4WOCA 4CW7A 4EATA 4B79A 1WXEA 2EG9A 4Z4GA 3EULA 3LYHA 4L76A 1QGAA 3WHKA 1W4RA 2ZJ7A 2TS1A 1GRRA 3BRQA 5KSZA 5CA1B 1VIVA 1CF2O 3A4IA 3L01A 3NHRA 4JODA 3QTLA 4RHYA 3ZNNA 5FLXA 1E0JA 5FBWB 4XZ3A 2PQ6A 3GGOA 1QKIA 2G6BA 4R9UC 4RV4A 2YY5A 4L0CA 4GWKA 421PA 1N3YA 3I45A 3Q10A 3PQEA 1GLVA 3O8DA 1P80A 4NP6A 4DB2A 3ETCA 3ZI0A 1J9ZA 1KDYA 2VG8A 1Z0DA 1NE7A 3R5HA 2FQ1A 4NBNA 4OFWA 2EWWA 4ND3A 4U2GA 3KSMA 5A04A 4CKWB 4IXTA 3IT0A 3BG5A 5D3QA 1A3CA 4TQUS 5FYDA 1DHTA 2F1HA 3ESRA 3R76A 5ADUS 1U9JA 3UMYA 1GITA 1L5SA 2ZQ5A 1UBLS 5E38A 5ILOA 4LOAA 5EG5A 3EOBI 4DIMA 1TYAE 2REBA 2A5DA 3KQSA 1XRLA 4DV2B 3CVOA 3T1NA 3UWOA 4F9FA 2BSQA 3PXCX 2W8BA 8ABPA 2HA3A 3KPWA 1JR3E 2J5QA 2H4ZA 2WVJA 4RTKA 1ZD9A 3L0PA 1FDUA 3M6FA 5ALSA 4TXHA 4EPVA 2CLDX 3F7OA 6NULA 4JI7B 3WGTA 1N2GA 2R1ZA 4LC1A 1L5ZA 3ED1A 4BE9A 3ECAA 3NKLA 3CHYA 3JD0A 3NNNA 2GKGA 1Z6PA 1ODIA 1T9GS 1OVGA 3H5LA 3AL0C 4OMFG 4N7BA 4GX2A 3D8HA 3M5CA 3BT7A 2IZ5A 1FFCA 1OHHD 3EXEA 1J07A 3HCAA 4DR3B 2ZE7A 3VYRB 4KL8S 3V33A 3PD7A 3J7TA 1O03A 1UAYA 5EKUA 1QYIA 2G7ZA 5B7PA 1ZO8A 1EFAA 1Z34A 2QW0X 3HJBA 4L8WB 3TI7A 1XMQB 1BVRA 2OBBA 1Y9AA 3BWYA 3FPAA 4YMTA 5HR5A 2FU5C 2CVZA 3JARA 3EFEA 1E60A 2I2AA 3B51X 3ABIA 3LKZA 4KFUA 3P9KA 3K1YA 3VDRA 3D4PA 1IN1A 5DWQA 3NM6B 1HT2E 3WNBA 5E2BA 5L7TA 4UNPA 4GSYA 3LD9A 1PNQA 5ECWA 3S68A 2FSHA 1OXUA 3CZMA 4IQ4A 3ROTA 4OHYA 1XZ8A 3LNCA 2JBWA 3CZQA 3IT1A 3RGGA 5E0KB 4U8GA 1EAYA