3W3ZB

Crystal structure of kap121p bound to rangtp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
171
structure length
171
Chain Sequence
EPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Importin subunit beta-3
publication title Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport/nuclear protein
total genus 52
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w3zB00
3KXKA 4RKEA 5DO9A 1MO5A 2IUSA 2QP9X 4A1FA 4IDOA 2J7PD 4L15A 2BBOA 3EIEA 2FFBA 2ZITA 4MRRA 1KMHA 2AXPA 2VA8A 1XTJA 1OKKD 3Q8XB 4EJSC 2O0KA 1NBME 4C0KA 3VU9A 4KCGA 3AF3A 3F3YA 1L4UA 2NTYC 1X1SA 4JVSB 2VBCA 1VG8A 2NO7A 4M22A 4QBFA 1LV7A 4PC2A 1BS1A 1ZNXA 4QHTA 1DARA 2OE2A 2IYXA 3TW4A 3HYRA 2CXXA 2FPLA 2DFTA 4P4UA 3TVDA 1VIAA 3ASZA 1S2MA 1XU4A 4DWJA 2NO6A 4A6PA 4BLPA 1JXOA 1E9BA 2VHJA 2VH5R 4P32A 2RMKA 4WBSA 2XITA 1Z22A 1QHGA 4LJ9A 2CE2X 4PSKA 2EYQA 2KBEA 2ZVQX 4RFSB 1KAOA 2FEOA 1JECA 2VP2A 4BFTA 4J0QA 3EZ2A 1VG0B 2P65A 2O0JA 2QRZA 2ZRAA 4PC7A 4Y0VA 3OE7A 5KHOC 3KQKA 2PCJA 3ND8A 2XNDD 1E9SA 4YDSA 4I99A 1XDBA 4LV6A 5AJVB 4LC0A 1XEWX 1N6PA 2VP5A 1MV5A 3KUDA 4MRNA 4BLSA 2WBLC 4NMMA 5EXPA 2YKGA 2IUTA 2LCFA 1S9HA 1IN6A 2C9CA 1XEFA 2A5JA 3B9QA 4ACBA 1B23P 2ZSDA 4A0RA 1DG1G 2ZTSA 4B44A 4CT5A 5G40A 3UMRA 2VHTA 3ND9A 3GLFA 1RRPA 5EUMA 4KBFA 2EFGA 3U2QA 2IA5A 5P21A 1D6JA 5FFMA 4Q19A 1N6IA 5J40A 4GBMA 4US0R 4O3MA 2YOHA 1E99A 2OLKA 2FH5B 5AJYA 4HZIA 4EPRA 4HB4A 3TSWA 1CJKC 1DAIA 2YC2C 3LWNA 1RIFA 3LY5A 1L2TA 2VF7A 4XVRA 3RANA 4EPTA 2XB2A 3EX7C 3L8YA 3REFA 2VO1A 5A4JA 2NOAA 2QORA 4HLUC 4A6XA 4M9QA 3B9PA 2VHCA 2D2FA 2CHGA 1Z6GA 4Q4AA 1M8PA 3KZ1E 4RSGA 5E7IA 5DN6D 4QGGA 3RLFA 2HJGA 1S96A 1W2GA 4TLEA 1ETUA 2DWPA 5TDHA 2BDTA 3IO5A 3GLIE 1L7VC 2V9PA 3VHLB 3SFVA 1D2NA 1SXJB 3GJ5A 3KJEA 3L0SA 3K70D 1D2MA 4V02A 1Z2CA 1XXHB 3QENA 3K9HA 1OB2A 2IS4A 3H0KA 3ADDA 2OILA 2PMKA 4GNKA 1W0JA 4GDFA 2DHRA 4BECA 5GADl 1CRPA 2F7SA 1F3OA 2XTNA 5J4KA 1EFUA 4EPVA 1NJGA 3VNVA 1VCOA 1WE2A 3H1TA 4Q18A 4TQ9A 4Q01A 4ZO4A 5KPJA 4WW0A 1BMFA 3FFBA 2J5XA 2ZJ8A 4IJMA 1EFHA 3GEHA 1W36C 1VECA 3UIEA 1JQJC 3GJXC 1GSIA 2AFIE 2PL3A 4TL6A 4Q9HA 1G9XA 2HJVA 4GP7A 3ADKA 1ZJ6A 2VYFA 4H9GA 4O2LA 1YR8A 3GJ3A 3QXHA 1E9RA 4CRWB 5KO2A 5CYPA 3WY9A 2OFXA 1KDTA 2WJGA 4C0SA 3KX2A 4JT2A 3SFZA 2X2EA 3U44B 4IDQA 5LD2C 3FPAA 1LY1A 4PPNA 4S2EA 2JEOA 2GTPA 3UPUA 4PZYA 2WICA 4Q1FA 5FI0B 2ANCA 4FMCB 4E22A 2JA1A 2JATA 2GF9A 2IX3A 3EPLA 3LLMA 2OBMA 4QBGB 2ZJBA 4EUNA 3I3SR 1MABB 2W00A 3W5IA 2Z0MA 1R0WA 2HXSA 3A37A 4DEXA 2G6BA 2QI9C 1Z5ZA 4ON9A 1W1WA 2GK6A 3QF7A 3VKGA 3DZ8A 3GD7A 3E1SA 2RGBA 3VR4A 1CTQA 4IOLA 4N1AA 1GRNA 2OBNA 1E1QD 4UNPA 4D82A 5BN3A 1U8ZA 5B30A 3NHBA 3N5CA 5KOYA 4Q66C 3GLGE 3O8CA 2ZRLA 1TUIA 3AVXA 2QY9A 1E2FA 3B78A 3R7WA 1Q0UA 2GKSA 2KE5A 5FOXA 4D4JA 2ASEA 5J4LA 4N0DA 1QRAA 3IPXA 1OB5A 1VDZA 3WYAA 5FBLB 4FCVA 4R71A 1COWA 3EIHA 3CNOA 3MWLA 1LW7A 3K8YA 4JLAA 4RKFA 2QL6A 1Q21A 4JVNA 1YRAA 2CCJA 1E4VA 4YC7A 2I4IA 3ASYA 1J8MF 4W5HA 3WHLA 2OBLA 3K09C 4CEHB 4AKEA 1WBBA 2MMCA 1EX7A 1F2TB 3K0AA 1RJ9A 4YONB 3A4LA 3BOSA 3SE0A 1RVDA 4XVQA 2JLVA 1KKMA 5M04A 1NBMA 4FINA 2QTHA 3EXAA 1G4AE 3L0PA 1R0YA 1NSFA 4TSFD 3I62A 4RFVA 3W8NA 1N3BA 3KKNA 1UDXA 1T3HA 4ZCIA 5L3VA 1E2KA 1JALA 1U9IA 1R5BA 1Y63A 4AKGA 1ZBDA 1SVIA 1KK3A 3L43A 4U00A 4I4LA 2RGNC 2DR3A 4HYYA 2JLUA 2QUZA 4C7OB 1AGRA 3IQWA 1E9DA 1XJQA 4LYHA 2CVHA 4TLBA 1R8QA 5DI9A 3CPHA 3EPKA 1U8AA 5L3RA 4L9SA 1AA9A 3P1JA 2DPXA 4L9WA 4G5SA 3BFXA 3RS7A 1NN5A 1DE0A 2EW1A 2FGJA 1VKJA 3PUXA 1N6HA 5GJCA 3AVVA 4ACAA 2O8FA 1DAFA 3A1WA 1DAGA 1MO4A 3A4NA 3R9XA 1KTVA 3QKUA 1AGPA 3BS4A 4NBSA 1DPFA 4Z1MD 1ZVQA 2PEYA 3EWAA 3AM1A 2BIFA 3LNCA 4II7A 1TU4A 1F2UA 4GZMA 1KSJA 2VLIA 1E2JA 1G8PA 1SZPA 2AK2A 2XX3A 2CBZA 5CIWA 3A1VA 1N0UA 1FP7A 3LD9A 1K5GA 3DKVA 3T1VA 2REXB 4TWZA 3I5XA 4LJ8A 3U3RA 2IHYA 2ZE6A 4KBGA 5KSPA 2V7QD 4CEIB 3JVUA 2IYYA 2ZRFA 2H8KA 3AGQA 1XF9A 3E2IA 3TQCA 4C2UA 3KJGA 3EA5A 2UZIR 4RY2A 4NP6A 1S4QA 1SVSA 1MT0A 3CX6A 2BM0A 2CL6X 2QBYB 4BLRA 2W6ID 2WIAA 1JB1A 3BGWA 4OHVA 4HDQB 3KQHA 1IQPA 3OIVA 5EZ5A 3QBVA 4JVMA 1D2EA 2GCOA 5GVSA 2C77A 2VHUA 4IOMA 4OYHA 1G1MA 1KI1A 2D4HA 2OT3B 2FJUA 4XSHA 5EXTA 3TAUA 4DJTA 3ICEA 5BYJA 2A2ZA 3AQ4A 4JLDA 3BWDD 2ZS8A 1PJRA 4OK5A 5FUXA 2X1VA 1KZGB 2D7CA 2IW3A 3HYTA 3RS5A 4EJSB 1JXMA 4HUQB 3GLIA 4M1WA 5EZ6B 2PMDA 6Q21A 4L8GA 4FMDB 5LB4A 1WCV1 2X77A 3BB4A 3CF6R 5JHHB 3NIBA 1CR1A 3EA0A 2Q3FA 4HLUA 4LJ5A 1TPZA 1O3YA 1R0XA 1U90A 2WJIA 5KNDA 2ZRJA 5HCNA 5AK0A 1T8UA 2JAQA 1W44A 2MMGA 4KLZA 4P3YA 4MITA 1XZQA 3MJRA 3VR2A 2A9KA 4EPWA 1E2NA 5L3SB 1G18A 3MWKA 4JT4A 5H8WA 1RZ3A 1YQTA 2B7CA 5JZVA 1M74A 4BPBA 1G64A 4UJ5A 2RAPA 1TQDA 2V6JA 4DUGD 4A9AA 2ANBA 1NKTA 2DWQA 3AP2A 1IM2A 4QGHA 3EWSA 2WWIA 5DISB 4TTPA 4DKXA 1C9KA 1K5DA 1YZGA 2AHOA 4FCWA 1R10A 2AWNA 3DKPA 3TUZC 4LJYA 1IY1A 4XIGS 1Q12A 1TF2A 4Q4HA 3AVTA 2QSZA 4F92B 1E2IA 1XTRA 3O8RA 4PPGA 2BMDA 2ZYVX 2A78A 1AZSC 4JBYA 2GJAA 1G7TA 3TUIC 4DCSA 3SYNA 4JL6A 3CWZA 5EXXA 1PLLA 3CF2A 1QG2A 3IIKA 1ZD1A 2TMKA 1BO6A 3VX4A 1EFCA 1G21E 521PA 4IOKA 4C0JA 2X19A 4C0QC 1N2CE 3THYB 3T34A 2QROA 4A8JC 3FDIA 3U3JA 2CEAA 3OF5A 3K0FA 3CWQA 2GAAA 1E2PA 3RSOA 1N6OA 3EZ6A 3D8BA 3NG1A 3GLHE 1A7JA 2IYWA 4W5JA 3QKRA 3TW8B 1QF9A 3F8TA 221PA 1ZINA 4KU4A 1G3MA 2RGGA 1BYUA 1UKZA 1E96A 3A36A 2PJZA 3DO6A 1Q57A 2OXCA 1DAHA 4C0HA 3GLGA 1OYYA 1TF5A 1Z29A 3TQFA 2GXAA 2O8DB 4NH0A 4A0HA 3AVPA 3MSXA 4R7ZA 2W83A 5FTJA 4PX9A 2OCAA 5J4YA 3X1ZA 4CYMA 4C3ZA 1U0LA 5JJIA 2P5SA 1CU1A 4NYMQ 2YHSA 1F5NA 5EE3A 2OXRA 3SI7A 1KDOA 2IS2A 3B1YA 1Z6YA 1K6MA 3IDQA 1WB9A 1YJ5A 1UBCA 5FPYA 3I73A 2HLDD 4NZYA 4YXWA 2BMFA 3K0EA 3ONWA 2ZI9A 1GZSA 4QGAA 1OXSC 2BOVA 4QBIA 1ZRHA 1DAMA 2FMXA 3KTAB 2YWHA 1W36B 2JJ1A 1HE8B 1PLJA 2GZHA 4JLOA 4DXAA 1DTSA 3EC2A 3D31A 1AN0A 2OAQ1 3O47A 1K8RA 4C0AC 1GL7A 2D74A 2AN9A 5G41A 5JEDA 3BJIC 4ZI3A 1ZIOA 2ZPTX 1G3UA 2ZROA 2KBFA 4HB0A 1FZQA 2E1RA 5LD2B 3ZZUA 4DDUA 2ZETA 4GFDA 1RYHA 1YZNA 1XWIA 2JIZD 3GFTA 2ZSFA 4M0LA 2Q9CA 4JKYA 3Q7PA 5AUNB 5JRZA 3EZ9A 5JWOA 3K70C 3M6AA 4UKDA 2H16A 2FNAA 4TLDA 2XOKD 1ZD8A 3K0SA 4UQOA 1XPUA 1KNXA 1G8FA 1KI4A 5FL7A 2GAOA 3IEVA 2KJQA 5DI3B 1DEKA 1UBGA 1RRFA 2R6DA 2W58A 2WOOA 4DDWA 3WP0A 1FX0A 1XMVA 2GXQA 2ZVPX 4AC9A 2JLSA 3GJ0A 4LV5B 4QM7A 1N25A 2ONKA 2QZ4A 1ZM3A 5FOTA 5HTKA 3R8FA 3LVQE 2GVZC 2DB3A 1CULC 4MKFA 2BBTA 1UDWA 2BC9A 4Q1BA 2FSHA 2VEDA 3PIRA 1U8YA 4PHTA 4NCNA 1UFQA 1OHHA 1VCNA 2FEMA 5KDOA 1IY0A 2FX3A 3C16C 1KMQA 1HV8A 1EG7A 1WXQA 1E9AA 4QNMA 1XD9A 5EP3A 1MRNA 1P2UA 5DNYB 4PPFA 4TL7A 2AFHE 1KK0A 4MQBA 4BFZA 4B33A 2J46A 4B71A 3OEED 1ZCAA 2NPIA 3HU2A 3T35A 4D0NA 1JR3D 1XTIA 4HAXA 2GK7A 5TY0A 5JFGA 1AKYA 4Q9KA 2QRNA 5H70A 4ZIRA 3WXMA 4Q48A 1NVWQ 1RKBA 1J8YF 4RZ2A 4RD1A 1XTQA 5FBWB 3EW9A 2WWXA 4TT3D 2LKCA 3QF4B 2FU5C 4JYCA 4XD7A 1IN5A 4URYR 4D81A 1GILA 3QKSB 1G8GA 3BORA 4LV8B 4NKRA 1ZC4A 5HCIA 1G4UR 2WJJA 1E0AA 2C2HA 3AP3A 3QE0A 1M7HA 1FL9A 3W90A 5L3QA 2IWRA 2C96A 5EP2A 1YKSA 1UPTA 1V5WA 3LO5A 4B73A 2WIBA 3CH4B 4O2RA 4U7DA 4QM6A 4QNRA 5TB5A 3NKVA 4GI7A 1P75A 1R4AA 2RGCA 2QPAA 3TKLA 4MGYR 1GG2A 4M53A 4CW7A 5FOVA 1IN7A 4O0MA 4BZXA 4PQRA 3LQQA 4G5OA 5CM8B 1E32A 1L4YA 2ZRIA 2GEVA 3O8BA 1FNMA 1X6VA 2ZJZA 1OH5A 1UKVY 4ZCLA 1E98A 3U4QA 1P9WA 2O8CA 3HU1A 4HAWA 1XMJA 4LC1A 1KO8A 1F6BA 3FE2A 3IHWA 3CZPA 2R6AA 4U5XA 3SS8A 1VHLA 4QGFA 2V3CC 1M6NA 3C5HA 2VP0A 3I92A 4PQYA 3S1AA 5JS8A 3U61B 3RRYA 5J47A 2N46A 1I4LD 4ESVA 1KO7A 4NCIA 4OJKA 1XCPA 3BIFA 2H1LA 2IF2A 2H18A 3P4YA 3UWOA 1ZNWA 2OLJA 4LK2A 2J7PA 2LWIA 4U02A 3FYHA 4DSOA 4DCTA 3VNUA 1GM5A 4LYFA 1YU9A 2BMEA 2PT7A 1Q3TA 4B2PA 3WYFA 3U7FB 4MYUA 3SNHA 1OKKA 1Z0AA 1OXVA 3KJIA 3ZS9A 4CDGA 1OW3B 3JZAA 1G8YA 3VKWA 1PVOA 5KUTA 4KSCA 2Z6VA 5CB6A 2J0QA 2RHMA 3GLHA 1D9ZA 2FV8A 3TVTA 3U3KA 4D26A 2V55B 1JR6A 1V43A 1KYIA 1XJ0A 1EK0A 4A36A 4RD3A 1U98A 3AEZA 1Z3IX 4HLDA 3U7EB 2C9YA 3NTUA 4JLVA 5DLQC 4NYJR 3SJCA 4BLQA 3KKQA 1X8JA 1XP8A 2GRJA 2ZI4A 2WM9B 2Z43A 3NHAA 2WJYA 3EG5A 1YR9A 4POAA 5FPKA 3VMFA 1AQYA 1US8A 2QQ0A 5CITA 2VP9A 2PZGA 4CF7A 3PFIA 1E0JA 2XB4A 5B58C 1XD2B 3IUYA 5KDLA 1ZM9A 4JSTA 2QPTA 2FWRA 3J81k 1S0UA 2BJWA 2XNDA 3MUFA 4KFSA 3CRRA 2O8CB 3A4MA 5J4HA 1TMKA 3I1FA 1IONA 2GJKA 3A8TA 4PHGA 3LW8A 3X1WA 1U9IC 3K0CA 4HLCA 2ZYWX 3WNBA 3THWB 4P4SB 2OHFA 2C8VA 1RYFA 3RS3A 2NZJA 4E03A 5J5CA 5FI1B 1TUEA 2AWOA 1MR3F 4EPXA 1SKYB 1YZUA 2VP6A 2J41A 2GESA 1OFUX 1NNEA 2VTKA 4BFYA 5F9HA 2O8BB 2PX0A 5BW8A 1G7CA 3PEVA 2ZAOA 3OIUA 1Z0DA 2XGJA 3CNLA 4ARZB 1NVVR 3HPQA 1XJCA 4JIMA 1QDEA 2HDNB 3CF0A 1ZYUA 3Q72A 2ZREA 2J0VA 3UK6A 2A5DA 1X8KA 3LBNA 1QZXA 1GNQA 1M2OB 4NYIR 3LBHA 3OZXA 5DN6A 3RDPA 2XXAB 5FR1A 5IDVA 1DG3A 2IL1A 2GWHA 3D3QA 2GZAA 4A0FA 5KSYA 4JLBA 2QAGB 4A8JB 4NE2A 3MLEA 4M2LA 3C15C 5FTNA 1QHHB 3A58B 3PEUA 1SVLA 3U7HB 3C41J 4DSUA 1ZNYA 2CL0X 1U94A 2PH1A 4HZUA 5D3MB 3PUZA 4NCJA 2PEZA 1FPMA 2HT1A 2ODBA 2AL7A 4HAVA 4AYXA 1VYTA 1FTSA 4AI6A 3K9NA 3A1SA 4EIWA 4HDCA 2BVNA 8OHMA 1T3SA 4FW9A 5HE8A 4B3DA 5KYKA 2EQBA 4ILEA 5GVRA 1NIPA 2IYUA 4BEBA 1KMHB 4DSNA 4JSYA 3VU9B 4IOJA 4B35A 2BEJA 4D6PA 4PSAA 4M1YA 1JI0A 2BHRA 2QP3A 3NH9A 2Q9AA 4PC3A 2ZS7A 2WAXA 1N6RA 3RC3A 5AJZA 4IXNA 3BH7A 3P27A 4A92A 2ZJ5A 2BKEA 2D06A 3TIFA 2YZ2A 1E69A 3PEWA 5BXQC 2H92A 4IVPA 1P5ZB 4P4TA 2ZRPA 3U3MA 4KHZA 2Q0HA 1OXTA 3THXA 2GJ8A 1KNQA 1A4RA 4LX0A 2IC5A 1O87A 2QMEA 2WWFA 3Q7QA 4AYTA 4URXR 3TR5A 1NLZA 1JJVA 3MCAA 3WNDA 4YDHB 2OZEA 1SQ5A 4Q47A 1W4BA 4MGZR 1OH6A 5CDFE 1H8ED 3BB1A 1SXJD 1II0A 1W4AA 2J9RA 1ZP6A 3ZVLA 5KNCA 4NTZA 1F60A 4OHWA 3N70A 2AX4A 1TEVA 2WWHA 2ZS9A 4PAOA 1BOFA 1E1QA 4URUR 4QJ4A 2OM2A 5G3ZA 3QUSA 4BRUA 1AS3A 3UATA 1TX4B 1TQ2A 3LV8A 1CJVC 1NIJA 2BV3A 4JL5A 3SJBA 3CIOA 3KJHA 4TMZA 1GRQA 2CLCX 2JASA 4IDNA 3GLFB 4FWIB 1DAKA 4RZUA 3RRZA 2BCGY 3KQNA 2GXUA 2J45A 3CM0A 3PVSA 3SOPA 4LCBA 4BLOA 1YHNA 2XEXA 3UG7A 4DIEA 3CB4A 5JJKA 4RD0A 1Z0FA 4RVCA 2NMVA 1XFAA 3O8DA 3CPEA 3RVBA 2ODEA 3L0OA 3OEHD 1KO4A 2W2TA 4ITRC 4NDZA 2JJ8A 1A5TA 2P6RA 4V0ME 1E79D 3WHKA 1T0HB 1R5OA 2ZJOA 2P0EA 2IWHA 3SU8A 1F48A 3ZYCA 5CJPA 4Q4AB 2A30A 2Z4RA 4IRUB 2PT5A 4TSFA 1G16A 4B3GA 3L82B 1G291 2P3SA 3X1XA 2ZM5A 4C0LA 3KQLA 3F5FA 3OFND 3IHLA 2WSSD 2CCGA 4NONA 3B85A 1BH2A 1QG4A 1OV4A 4LJ7A 3I4LA 1IBRA 3FFAA 1NY6A 3T1OA 4DLYA 1E6CA 3PITA 3DMNA 2QT1A 3NWJA 2ORIA 1Z6XA 3LFUA 1PUJA 1Z08A 4W5WA 1P62B 4LBZA 2XTZA 1KHTA 2ORVA 1J2JA 3FKSD 2R2AA 1E2DA 4KLNA 4ASUD 3PR1A 4Z8YA 2XSZD 2ZSAA 4Y0AA 3X2SA 5IT5A 1CF4A 4F4JA 1KI6A 5E4FA 4B3XA 4CVNA 2DCUA 4JJZA 4Z1MA 5JI3E 3C5CA 3DM5A 3TJZA 2D7DA 5DIFA 2DY1A 2DFNA 1TEXA 4B43A 5H68A 3WP1B 3WBKA 4BZPA 3SZRA 3KKMA 2CVFA 1A2KC 1Z2AA 2NO0A 3K53A 4QKQA 1D9XA 1HQCA 4YQFA 3MAAC 4BUJA 4D4LA 4Q7JB 1KSGA 3AF2A 2EFDB 1T5LA 4DRZA 2ZE8A 1CP2A 2O8EA 1OLOA 4KVAA 2V7QA 1Z06A 2V1XA 3SHFA 2GCPA 4TL9A 3BC1A 4PAMA 3VFDA 4GMDA 1E3MA 3TAHA 4PTLA 1QVRA 4KFUA 2Q9BA 4ZDIA 3U6KA 4CT4B 4TLAA 1G19A 1JR3E 2ATXA 4KVGA 3CBQA 5FBQB 1GNRA 2IS6A 4AKIA 4KJZA 2F1JA 2BM1A 4XWAA 1N6NA 4Q00A 3BFKA 3NBFA 5FUYA 1N5IA 2EU8A 1H65A 3AKYA 4JLMA 4M9ZA 3H86A 1JPNA 3QG5A 4QJ5A 5HE9A 1M1YE 4Q21A 1QHYA 4D25A 4QHYA 1DADA 3B2EA 4B3FX 1XTKA 2FFHA 1QHNA 1NMYA 2ZUBA 4CEJA 2WAYA 2VSXA 2Z5FA 2YJTD 1MO6A 3VTKA 2E9SA 1DS6A 4PANA 4OQLA 1DO2A 1IXRC 3R7WB 1WF3A 4B47A 1Q3HA 3RHFA 3ZD6A 2RGDA 3C4JA 2I3BA 2JLZA 1G5RA 2HV8A 2F1IA 1LVGA 1NLFA 3HPRA 4RZXA 3OESA 4PC1A 4IKEA 2LKDA 4DLUA 4RCYA 1NRJB 1EFTA 4Q1DA 5CLQA 3KUCA 1G5PA 1CRQA 3K0AB 1HA3A 3B8HA 1RJ9B 4JBWA 3KKPA 4DT1A 2REOA 4DUGA 2A5YB 1COWD 2Z4SA 4PZZA 1E0SA 4V0NA 1GNPA 2EFCB 2QE7D 1KJWA 2JJ2D 5JCPA 3T5GA 4L4UA 1VPLA 4HDOB 2G1JA 2P67A 2WJHA 1IN4A 2XTMA 4I1SA 5IF9A 3R9WA 2OEPA 2QGNA 5FOSA 4BE7B 2GZDA 1ZUHA 4OI2A 5TV2A 2O0HA 3QPVA 2PZEA 4RD6A 2G3YA 3KXIA 1OFTA 2JDID 2P2LA 1XNJA 2FSIA 4E5UA 4LHYA 3NDBB 4FIDA 4Q4JA 3SYKA 3GJ6A 4UNNA 1OJLA 2G9NA 3BB3A 3UANA 5EE1A 5AJWA 3QVUA 2WPDD 3T61A 2RGEA 4JMPA 3QJYA 2JLRA 4WXPA 2OV2A 4G0NA 4WAUA 2VSFA 2F1RA 4K81B 4A2PA 1JNYA 3ZDQA 4DBLC 4F7WA 5KDDA 5SZIA 2F43A 4DVGA 4QL3A 1NY5A 4TTQA 1OYWA 4M4SA 4PC6A 2O8FB 2NQ2C 3V4RA 4EKDA 4PFSA 2ZJAA 5CDFA 2YV5A 1P6XA 2GJSA 3W5JA 3E70C 3V00A 1T91A 1UEIA 2AXNA 2B8TA 5E3HA 1P73A 2X8AA 1F2UB 3W3AA 5DYIA 5C4GB 2C03A 1Z28A 4DCVA 1YZKA 4M21A 1U0HC 1EGAA 4Z54A 3AVWA 3GMTA 1VIYA 1GKUB 4KAXA 1R8SA 1G41A 3W8RA 4TYNA 2FDCA 4X8HA 2ZI7A 2C9OA 5FTMA 2G1KA 1FMLA 3QI2A 4MKHA 3NBXX 3T06B 5UKDA 4UXJA 1HT2E 1N6KA 3F0TA 1IY2A 4TQAA 4HB3A 1OSNA 5DSZA 4OJQA 2HLDA 4BGDA 1IJEA 1S8FA 2FSFA 3HU3A 4JKIA 2GCOB 2QTFA 4V0MA 4XTCS 5HR5A 1HURA 3AF4A 4TMWA 4XWOA 2J0UA 4TQUS 4X8OA 3AKDA 1VCIA 3GQBA 5FUWA 5BQ5A 4TL8A 3QOFA 3RWOA 5C4MA 1JJ7A 2W0SA 1CEEA 3T1TA 2RCNA 1J90A 3GLIB 121PA 3RSLA 1NN3A 3GP8A 4HB2A 1W0KD 3B1ZA 1ZM2A 1J99A 2CMKA 1GUAA 3KL4A 3LXXA 4WZAE 2G88A 2IYTA 4JJKA 3W6OA 1HY3A 4JVLA 5FPTA 2W2VA 2W2XA 4ERNA 2JIZA 2WOJA 1X86B 1TL7C 1KZ7B 1G6HA 2V54A 3K9GA 2XOKA 2WMOB 2YNMA 1LF0A 3NXSA 2ODNA 1GWNA 4H1VA 3ZIAD 4M8NE 4PAQA 3K0CC 1Q20A 1XZPA 1HH4A 4N0EA 2NGRA 1A2BA 3AUYA 4AG6A 1SVWA 3R9IA 4MYTA 1VG1A 2W6JD 3DL0A 2R8RA 4DB2A 5HKKD 2R65A 4B34A 5L8VA 1LB1B 1NN1A 1UBFA 1N5JA 1RC8A 2DBYA 2IT1A 1S1CA 2ERXA 2IYZA 2X2FA 3QEOA 5FBRB 3WNCA 1AQUA 3Q9LA 3IIJA 1FMJA 4P31A 4Q4HB 3ZVMA 1N5KA 1G8HA 2ZQ5A 4A2QA 1HT1E 1DVRA 2GEUA 3EAQA 1OF1A 1NMXA 2J87A 1WMSA 3H84A 1II9A 3CRVA 3AVQA 3FHOA 3PJRA 1UJ2A 2A5FA 2L0XA 4C30A 1W36D 5SZJA 1TTTA 3LXRA 3OEEA 4F4IA 3SJZA 1JR3A 2CJWA 1SHKA 2WWWA 2JGNA 4G5RA 5JSZA 1AS2A 1WA5A 3K0FB 3E5HA 5EE0A 3QY0A 2ZRHA 1JEEA 2HT6A 4B48A 1A1VA 1DAEA 2OO7A 2EFHB 1DOAA 5FL3A 3QKRB 3N2EA 4R9UC 1CKEA 1ZCBA 5AUOB 4Q9JA 3QXCA 4FI3C 1GKYA 3TR0A 4TYPA 5F2EA 3LRPA 2EYUA 4OI4A 1PZNA 1W2HA 4BWYA 4V0OA 5DHFA 3GLGB 4LHVA 4Q1AA 1H8HD 2JCSA 3AKCA 3RRMA 3EARA 1ZM7A 3IO3A 4WVFA 4ZI2A 4IHQA 3X1DA 4BZQA 3K9LA 2HYDA 3LX8A 4GL2A 2J3EA 1A82A 821PA 1CIPA 1WQ1R 2ERYA 2WHXA 4DZZA 1JQLB 5EE9A 1SXJE 1P7CA 4E07A 2ZSEA 3UG6A 1GKIA 1XXHE 2DWOA 4F4CA 3U7GA 4M1KA 3SJAA 2XJ9A 3ZD7A 4D2IA 3L2OB 2JLWA 5EJEA 4HATA 2C95A 2ZEJA 5K8IA 1I2DA 3TLXA 3VHXA 1M7BA 2EFEB 1CR2A 2P5TB 1MKYA 3D7MA 2IYSA 1S3SA 2FPMA 1ZU5A 4XTRA 3U6BA 1N5LA 4EQ6A 3MWJA 2UKDA 1BYIA 1II8A 2CCKA 3P20A 4DDTA 3JVVA 4WZ6A 4GP6A 4JZKA 1TADA 4I1OA 5FOWA 4MYCA 4S35A 2CLSA 2QEQA 2BWJA 4OKSA 2JJ1D 1CBUA 1TQ6A 2CNWD 3IBGA 4ZDJA 4FWTA 1T0JB 2IUUA 4NYJQ 3SR0A 4PQFA 1UEJA 1Z83A 3T12A 3KB2A 5DH9A 1I4DD 3JZMA 2VIIA 4A2WA 4LI0A 4ZDKA 4QRHA 3LA6A 5EQTA 2IXGA 4WXRA 5A5GA 3AVUA 4NYMR 2CK3D 1T6NA 2C04A 5G3YA 1GITA 2RB4A 2A5GA 1GIAA 1KI8A 4HAUA 4QBHA 1Z0IA 2AR7A 2F9LA 4F38A 2V8OA 2F55A 3EPHA 5HPYB 1NSTA 3SYLA 1FX0B 3KFVA 2R44A 1FNNA 2YOFA 4BFWA 3OAAD 3ZLJA 1X1RA 2ZYTX 4DLRA 4F93B 2QGZA 3RS4A 5JI2E 3FHTA 2CDNA 3PQCA 4AY2A 2V4ZA 4LHWA 1UBEA 3SHWA 3PUWA 4LJAA 1E2MA 4IW3B 4G3XA 4EPYA 1AK2A 3NC1C 3NDPA 3TSZA 4LYAA 2PBRA 4Q02A 1AS0A 5C2JB 1KK1A 2VP4A 4KV9A 1GL6A 4JLNA 4QHSA 1ZUIA 2JLQA 4YLGA 2JLXA 1RFLA 4W9MC 2F6RA 4KFTA 4Q7KA 2P6UA 4MUBA 4LUCA 4NYIQ 4ZIRB 2NO1A 3P32A 3MD0A 2OSBA 1CR4A 3BBPA 5TMPA 1N0WA 2BKUA 2EWVA 1VTKA 1Q1BA 2ORWA 2MSDB 5AUPB 2FF7A 4B75A 2G0TA 2HCJB 1XEXA 1XD8A 2B6HA 5E7MA 3HR8A 1KDRA 1EWRA 2ZANA 5TARA 4BFSA 2KI5A 3FVQA 2HF8A 3CX7A 3GPLA 5BYKA 1P2TA 5L3QB 4LJ4A 5JBQA 5ANRB 1XTSA 2QN6A 2ZJ2A 2C78A 4ZKEA 2XZOA 1Z07A 3DMDA 4PSVA 3ZGXA 5HZHA 2G83A 3B5JA 1ZUNB 4JLJA 3TRFA 4UNSA 4TMKA 3HDTA 2B7BA 3BH0A 5IK2D 5SZHB 1QHSA 5E7JA 5DGXA 3C7KA 2F1HA 3HR7A 4LYJA 4DEYA 1KJYA 1QVAA 1S3GA 4D4KA 1OH7A 1UM8A 1YZQA 1L8QA 2IEZA 2OCPA 4I81A 4N3NA 1OXXK 2GJ9A 2ZIAA 3FMPB 3CONA 5LPNA 5IRCD 2HF9A 3U4QB 4MA4A 4M1OA 2QM7A 1XMIA 2OCYC 4RFSA 2BMJA 3H2YA 2FGKA 3CX8A 1ELOA 2RGAA 5EP4A 3CR7A 4G5GA 4X8MA 2QTVB 3S1AB 3ECCA 1NG1A 1XBTA 2XZPA 4BASA 1XPRA 3BFVA 1P9RA 5G53C 3AV0B 2W0MA 3QG1A 4FMCF 4NHOA 2IHBA 1AM4D 3IPYA 3WMEA 4DLWA 2GETA 1W46A 3IBYA 2OAP1 5GJBA 4QOSA 2ZRNA 3KB1A 1KSHA 4C0BA 1R7RA 3CR8A 3DOEA 2R6CA 5LBIA 4JYBA 4K46A 3QPUA 4LHZA 1VYUA 1KKLA 2OG2A 3SBEA 5LDDC 4PO8A 3GLHB 1R0ZA 2QAJA 5K8LA 3QSYA 1CLUA 4BEJA 4C9BA 2REBA 3VR3A 3W6PA 5BN4A 4OI1A 2CE7A 1CS4C 4A82A 1VMAA 2Q3HA 1EFRD 2K5UA 1US8B 4LPKA 3H4MA 3DZDA 5JWRA 4ZKDA 2XNSA 3M4YA 3W3ZB 2CL7X 2NZ8A 1E1RD 1H8EA 3T1QA 1SXJA 1MOZA 1N6LA 5FR2A 1RE0A 2ZRMA 1HTWA 2GA8A 1XXHA 1CR0A 1JPJA 3KDSE 3GEEA 3PXGA 4F91B 1U0JA 3TNFA 2QG6A 2OFWA 4JBXA 1OE0A 3NC0C 3TE6A 1PV4A 1U99A 4PHFA 3KQUA 4NCHA 1NMZA 1VHTA 4QFMA 3MG9A 2ZR7A 1W5TA 1CXZA 3FWYA 3DDCA 3PV0A 4US1R 3SN6A 1LNZA 3ZQJA 4MGIR 4OI0A 4TMTA 5BWMA 3AUXA 4AURA 3I8SA 1P60A 2I1VB 2J7KA 1P72A 1W7AA 3BK7A 2WWYA 3FHCB 1C4OA 3OEHA 3Q5EA 2D3WA 2CLDX 2MSCB 5DE3A 4IVQA 1J70A 3Q3JB 3CLVA 1RRGA 1LS1A 3FKQA 1SVMA 4P33A 5BN5A 2AKAB 4MRVA 5IHPA 1E79A 1KO1A 4YMUA 1ANKA 2RGXA 5CLLA 4XVUA 1KI3A 4FCTA 4PPQA 1OFIA 3U44A 2ZRKA 3QIAA 3NVAA 3ZZ0A 2PLFA 3AVOA 2WKQA 1QHXA 3MJHA 2RKOA 3UWKA 2YOGA 3LVRE 3QBTA 3Q5DA 2FFAA 4BFVA 2B8WA 3OFNA 3N2IA 3DEFA 2WSSA 4M9XA 3K70B 3RYTC 4BRWA 4R2IA 4IDHA 4L5BA 4CZ2A 4BFUA 4HZUB 4G5QA 3EASA 1E2GA 2B92A 3BERA 1MABA 4OQXA 3VKHA 1U81A 3OE7D 3B82A 2HXYA 3FKSA 3DM9B 3FTQA 1EWQA 1J7KA 2ZSBA 4ASUA 2IF0A 4EAQA 2IYLD 2XSZA 4NPHA 5KTYA 3BD9A 2WKPA 2E87A 2RHDA 1G3IA 4GOKA 4B6FA 2UZ3A 1FUUA 1ZW6A 2OFOA 1W48A 2QM8A 1NJFA 1E2LA 1S9DA 3C14C 3ETLA 1XPOA 3GJ8A 4Q1EA 4K8OA 2A3RA 2IXEA 4PO9A 1HE1C 3U60B 1XMSA 2NPFA 1UKEA 1WBDA 2ZRBA 2ZU0C 4LJ6A 5CB8A 2FG5A 4FMDF 4URZR 2HCBA 1XRJA 4LBWA 2IYVA 2O52A 4CEHA 2ZAMA 1E4YA 1F2TA 5KSOA 4Q03A 1SULA 2KWIA 3B60A 4B2LA 3B7GA 5H1YA 3I61A 4MDEA 2ZI5A 2J1LA 3THXB 2GVDC 2DYKA 2R62A 2GDJA 1TQ4A 2OUKA 1GOTA 1G20E 2ZYUX 3CZQA 1AJEA 3VX3A 3IILA 1ODFA 5EXSA 1XEWY 2YC4C 4DCUA 3CKLA 4I1VA 3BXZA 4HUTA 4KITB 4HEJA 2ZUCA 1U2RA 1ZC3A 2ZRGA 4MKGA 4ZCMA 4C7OA 1W0JD 2GBLA 1KK2A 2ECKA 4Z51A 3LBIA 4LBVA 5DYGA 4EDHA 1PUIA 1TAGA 4LRWA 2ZE7A 1Z63A 4LBYA 5FPHA 3IQXA 1NKSA 1E9CA 3UMFA 1BMFD 1KDPA 1LF5A 1Z6TA 4JS0A 5AWFC 4X8LA 2KSQA 4TMXA 3RNLA 1AZTA 3KXLA 621PA 4FN5A 1Z8FA 3GJ4A 1SHZA 3LDAA 1I4TD 3IKJA 4OHZA 3VQTA 4D4MA 1G5TA 4XJXA 3WYGA 1E0KA 2PCLA 3M1IA 2GEDA 1P61B 3EZFA 4D0GA 4GOJA 1C1YA 4A4DA 3I32A 2YWEA 1N0VC 4UXHA 1TU3A 3ZQ6A 1FQJA 1FFHA 4UJ3A 1WRBA 1GTVA 4B32A 2W6IA 4OHXA 4TTRA 3QVVA 2H17A 2QE7A 4LPSA 1R2QA 1JEDA 2JJ2A 2P6NA 3RRNA 1HUQA 4CEIA 1UADA 5EE5B 4MKIA 3IGFA 2AD5A 1B0UA 2WMNB 2WVJA 4MRSA 1D5CA 1IAQA 1W5SA 3RS0A 3G0HA 3A1TA 2N1BA 2QBYA 3C8UA 1YRBA 2ZUDA 5EUQB 3AGPA 2IS1A 1GL9B 2JDIA 3EZ7A 1OIWA 5ELXA 2H57A 4QC2A 1BKDR 2WPDA 2FE4A 1Z47A 1EX6A 2Q6TA 3B1VA 2QPOA 4KO8A 1QBKC 5FBVB 4M9SA 5KSZA 2PLRA 5C1BA 5B2ZA 4EJSA 4GOXA 1SKQA 2SHKA 4HUQA 3W6NA 5B57C 1KAGA 5E95A 1NLYA 1KI6B 2VL7A 4P0TA 3BRWD 4IFBA 4DHEA 3P4XA 1ZU4A 4JLPA 3UMSA 3QNUA 4QJ3A 5CJ2A 3L8ZA 5F3WB 4QG7A 2R6GA 5K8UA 4AIIA 4URVR 4TYWA 2C98A 3AF1A 4DC9A 4DLVA 2H7VA 2QU8A 1X3SA 2N42A 3QXSA 4WA7A 3UXMA 3WMGA 2O8EB 5KNBA 3SQXA 2EWWA 5L3SA 3MFYA 1D8TA 4PHHA 2F3RA 4DCNA 3ZZTA 2QNRA 1MH1A 4EFMA 5JMTA 1NBMD 1MRSA 4B3BA 2FPKA 4OBEA 3DOFA 3W9YA 4G1UC 4AYWA 1Q1EA 1FTNA 5CK5A 3AH8A 2NIPA 4LHXA 3QPWA 3VAAA 2ZJYA 3GJ7A 1ESNA 3X1YA 4V03A 1SVOA 2C5LA 3SC3A 1T3LA 4ZDWA 2GHIA 4URWR 1Y3AA 2H5EA 2FA9A 1YR7A 4AK9A 1UAAA 2BEKA 4HSEA 3PENA 4R2HA 1W0KA 4DLTA 1YVDA 4CEJB 1G3QA 4B3CA 3I72A 4FMBB 4M1TA 3ICQB 1KSFX 4WOPA 4HI0E 3WMFA 1G3RA 4AWXA 5JHGB 3THYA 2VRWA 2Z83A 1P3JA 1E9FA 2FZ4A 2QENA 4LY6A 4YMTA 1FOEB 1NL3A 2O5VA 2G77B 3RS2A 3SBDA 4DDVA 3V4FA 1OPXA 3GFOA 2CHQA 1Z0KA 3ZIAA 3QKTA 5JECA 3U3OA 1LFDB 4DLXA 4ABYA 2C99A 1XX6A 4W7SA 4DT1B 3W34A 2W6JA 4TYYA 3MRSA 4ESHA 5HKKA 2JLYA 1Q22A 2O8DA 1GP2A 4FXPA 1G7SA 2F3TA 1XCGB 4DIDA 4O25A 1GVNB 4LZZA 4RD4A 4B6EA 2IEYA 1G17A 4IVRA 2QQEA 3GCGA 5JWHA 1ZD9A 4Q7LA 1NI3A 2VQSA 3A1UA 5GJVC 3BAFA 1SGWA 1HQYE 4Q4LA 1AIPA 4RCZA 1DBSA 2FN4A 4Q4JB 5FTLA 4Z8XA 2ONJA 1E9EA 3KTAA 1IXZA 1TNDA 1NVXQ 4RZ3A 3B13B 2AKYA 1DO0A 1M34E 2F43B 3DPUA 2QA5A 3QXXA 2YWGA 3D6TB 4NL4H 1T9HA 3T5DA 3BH6A 1SKYE 4G01B 4OQFA 1OIVA 1XCMA 1Z0JA 2RH5A 3HJNA 1E2QA 1GRRA 4CIDA 4UNQA 1KO5A 4KFRA 4GMXA 3M0EA 1KI2A 3B1WA 4MUAA 5JS7A 2QAGC 3KKOA 2HYIC 2YVUA 3VR5A 3ADCA 2AK3A 2FOLA 1Q1QA 4PR0A 2Q21A 2ZXUA 3G5UA 3TGPA 1NVUQ 3CRW1 2VF8A 5JRJA 5FOUA 4BFXA 3LX5A 1H8HA 3ZH9B 1Q1ZA 1AKEA 4GT1A 4A15A 1CJTC 5AR1A 3I8XA 2B21A 2CHVA 5DI3A 4LOAA 5SZKB 1ZIPA 3HP1A 3EPJA 2WZQA 2YYZA 2PJRA 4XSGA 3WBJA 4TZ6A 1RPZA 1IOZA 3FMOB 5JLJA 1NN0A 1PLKA 1VG9B 3I5YA 3WRXC 1W49A 4AG5A 2HUPA 1WP9A 2VHQA 1GAJA 1FUKA 4NCKA 3LAWA 1ESMA 2BJVA 2Y8EA 2J0UB 4BQSA 1KJZA 4EFLA 5HZKA 2QSYA 2NO9A 2ZI6A 4NU0A 4US2R 2I1QA 3SDZA 1T8TA 2XZLA 3V9PA 3T15A 1UF9A 2PX3A 4E09A 1KY3A 1KOFA 1EESA 1MO3A 3MMPA 4KYUA 1T5IA 4BLTA 4DSTA 1R5NA 1OH8A 1HYQA 3K1JA 2DFLA 3RABA 3DHWC 4RJLA 5F9FA 2CNWA 4PZLA 3RWMB 4KYIB 4TT3A 1YZLA 2WJVA 5JJLA 1QHIA 4XH9B 3MWYW 1SXJC 1OIXA 4LSGA 4EFNA 3K09A 3NBZC 1CJUC 2ZRDA 1P4SA 3NEYA 4D80A 2CK3A 4KODA 4Q1CA 1P2VA 3P26A 3CPJB 5JCZA 4AKHA 2QP4A 3QF4A 5KPDA 1RW4A 1CJMA 4RD2A 2OESA 4Q9LA 3QKSA 3WRYC 2R9VA 1VCMA 4MRPA 3B6EA 3ZVRA 3OAAA 1JBKA 1JAHA 4MGKR 2HEIA 4IXMA 5TXGA 4DLZA 5K8TA 5TVKA 4H1UA 4C4PA 1G7RA 1XB2A 2RGNA 1ZMXA 1VYVA 2BBSA 3AF0A 2FSGA 4OK3A 4YMVA 1NF3A 2QMUA 1S1MA 1HEIA 5CIQA 1W47A 2ATVA 2F9MA 5F98A 4B2IA 4D0LB 2ZE5A 4TMVA 4YXWD 5FPSA 1W4CA 2V6IA 2UVQA 721PA 1P9NA 1FW6A 3TSOA 1T4GA 2WV9A 2IBMA 4HAYA 4OQNA 3GEIA 2CJWB 4DB4A 2ZR0A 4CGZA 3FOZA 3ZJYA 3AVYA 5JSZB 5FUVA 3EIQA 4KI0A 2XAUA 1R6BX 3CUEF 4M1MA 4YMSA 3GLFE 421PA 3A6PC 4YMWA 1YR6A 2J59A 1OXUA 2D62A 2ZI3A 4TZ0A 3QEJA 5EP1A 3LLUA 2D2EA 2MSEB 4XOIA 1FP6A 2GF0A 2ZR9A 4JL8A 3RC8A 2VSOA 4IEEA 3PEYA 2FZLA 5AJXA 2QMHA 1ZNZA 2YWFA 3KFXA 4PXAA 5JEEA 1ZAKA 3PCRB 4MYHA 5FL7D 2Q3MA 3FMFA 2AD1A 1M7GA 3R8CA 3TUJC 4HAZA 3QQ5A 3QXJA 1YE8A 4OQMA 4XWKA 3TMKA 4GZLA 2IK8A 1I2MA 5DHAA 3Q85A 4WIAA 2WKRA 3L0IB 2GCNA 4MDFA 1KI7A 5IK2A 5FTKA 3SQWA 5GJWC 3PUYA 4Q7MB 1FQKA 1P2SA 3LQRA 4IEIA 2DFKB 2BCJQ 4LDJA 1E2EA 1IXSB 1OFHA 1IHUA 1ONBA 1SVKA 2ZU6A 1IJFA 4ZPXA 3CRQA 3OIYA 1EXMA 3THOA 2IYQA 5J4VA 4GRAA 1NVVQ 4MH0R 4Q9IA 4WZBE 2NG1A 1Q44A 1W4RA 3OIWA 1ZM4A 4A0GA 4EQ6B 5A0FA 1G6OA 5KU1A 1II8B 1OHHD 1KI9A 2QT0A 2ODWA 1JAIA 1XD2A 1IN8A 3AKEA 4R98A 1KGDA 3LH5A 3AP1A 4V0KA 1WDTA 3B1XA 4DLSA 3CH5A 3RAPR 4FD2A 2WTUA 1KY2A 1GDDA 3EC1A 3LW7A 3CO5A 1NP6A 2G0NA 3PUVA 4KSBA 3ADBA 1RRCA 4KXFB 3MGCA 2EVWX 3ZVNA 3THWA 4P4SA 2R6FA 1GFIA 2WWGA 4L16A 3GFPA 3TBKA 1UKYA 4OHYA 3FB4A 2OCBA 2GNOA 1NG9A 2A7QA 4XD7D 3IIMA 4C2TA 3SEAA 2GBLC 3TK1A 2GILA 2YINC 4TN1A 4IFEA 3NBYC 2WSMA 2O8BA 5LB2A 1DELA 1X8LA 1LS6A 1BIFA 3BE4A 4ARZA 2IXFA 5CYOA 5FH9A 2PZFA 3HWSA 3R20A 3VR6A 3FGNA 4OK6A 4AD8A 3G82C 3DVLA 1EFRA 3FMIA 3REGA 2QMOA 3CNNA 3ZS8A 3PG5A 4LWZA 2XXAA 3IEUA 3NH6A 5CM9C 3VR1A 4UNRA 4I1UA 1LTQA 2BBWA 3CW2A 4V0LA 5CK4A 2QAGA 4A8JA 4Q5IA 1E1RA 3UKDA 4LGMA 4B76A 1QHHA 4UXIA 2J0SA 1OT3A 4QXAA 2KB0A 2XJ4A 1E2HA 2GXSA 4TYQA 5B64A 4OL0A 5D3QA 3OHMA 1YZTA 2V1UA 2IYRA 4TLCA 5D3MA 4PO1A 4ZV4A 3CRMA 1KIMA 4B74A 5C18A 1Z6AA 3AB3A 3U5ZB 3NEJA 4GPTA 4IDPA 2VPPA 1TF7A 2ZRCA 4GSYA 4HLQB 1E94E 5C46F 4JLKA 3TH5A 4M1SA 2FFQA 1XEXB 5AUQA
chains in the Genus database with same CATH superfamily
4RKEA 1JLMA 1ECCA 1MO5A 3EGXA 4R8KA 1C4XA 3S2SA 3DMYA 3NB0A 2BSAA 4MXDA 2I8AA 3EIEA 4R1MA 3SJUA 3AXTA 4R8SA 1GG8A 5C8VA 2FFBA 2Q5OA 2ZITA 3BMQB 3B51X 2IHVA 3IAM6 4EJSC 1W4LA 1PL0A 4QDKA 3WAKA 4TRRA 3RIMA 5LR6A 2IP4A 3KBOA 5I7RA 2XY4A 3OOJA 4M0CA 1SKUA 2NTYC 3KAQA 3QEMA 4BVJA 2WC1A 3KYCA 4BJ1A 4HDAA 4FQ5A 4RAOA 1HYHA 2DSTA 1VG8A 5CEFA 4A36A 3SXUB 4JUCA 1XT6A 4QBFA 3RC9A 1LV7A 2VPTA 4PC2A 4A5SA 1Z26A 5H4GA 3I37X 2H0QA 1JQDA 3GXBA 4PNEA 2DFTA 4BV9A 1QH1B 3SDSA 4KXLA 1R6VA 1Y3DE 5CVJA 4C76A 3OU2A 4NZ9A 1IUPA 3ROZA 4DWJA 4WY2A 1Y89A 4NPAA 1SUFA 4U2FA 3ZY2A 3DB2A 2P75A 2M1ZA 2DY0A 3ABZA 3HLKA 3JRXA 4WBSA 4E51A 4LJ9A 4MHOA 4RDXA 1KS9A 2ISSD 3A1EA 1P5HA 5C8YF 3PC6A 1G55A 4I19A 4J4BA 3UJAA 3ZE6A 1H1LB 3UMVA 4E94A 2QW8A 1Z37A 1IQUA 1XA4A 4MULA 3S44A 1KFEB 3L8CA 1XTPA 4RU1A 5TSDA 1YQUA 1E9SA 1T4CA 4OHPA 3A9UA 3I09A 5AJVB 4EJ0A 3EPPA 4EHDA 3HYLA 3ER6A 3O3NB 4MS1A 5D1NA 1N75A 3KUDA 1QANA 1P5JA 4NMMA 5F7JA 5BOVA 3DVAB 5B4VA 3WRVA 2RKWA 2ECFA 1FS5A 3L02A 1ULHA 3KJZA 1SNYA 5AW3A 1N1EA 1LKZA 3K1TA 3WMWA 4ACBA 4F4HA 5H59A 4A0RA 5JMPA 5HNKA 4S04A 1UEXC 3SVLA 4CFSA 4CT5A 5G40A 5IG2A 2IPXA 4AMZA 4ZHQA 1DJLA 2ESRA 2EFGA 1V16A 2HCTA 2W2KA 3QVOA 5P21A 3CEAA 4XQ0A 3SLRA 5B7PA 4QPZA 3HC7A 2X8LA 2EJBA 3LT4A 1C81A 3NNDA 4A10A 2GFHA 2YOHA 2OLKA 2FH5B 2CFCA 3CZAA 4HZIA 4JQYA 2ST1A 4EPRA 3G59A 4AP6A 3LY5A 1RIFA 1L2TA 1TKCA 3ED1A 1U6IA 4IH1A 3N9IA 1SKMA 5JUWA 2WFZA 2COEA 1EVIA 2VO1A 1TC1A 4IMJB 2II6A 3RFXA 3VA7A 1AQLA 2QG4A 3KSMA 3C7CB 4Q3AA 4Q4AA 2JI6A 3KZ1E 1HYBA 2NQ8A 3L7MA 4QGGA 1YCHA 3O9ZA 4N5HX 4H7IA 3UHJA 1X15A 5BN1A 4D5GA 1S96A 5TDHA 2J09A 1FFWA 1RLTA 1DU4A 3IO5A 1L7VC 3CLRC 4UUAA 4BHTA 4DV6B 1SXJB 1VGRA 4Z9FA 2I5PO 1IQRA 4EA9A 3L0SA 1SN7A 4K6OA 4KTTE 3D9QX 4UBKA 1H05A 3ZV4A 5FWNA 3TSYA 1V41E 1Z2CA 2FWBA 2VDQB 4V02A 1MX3A 3QENA 4XDHA 4AUMA 2ID7A 4CU2A 2R5FA 1OB2A 1GGVA 1WNTA 3DBOB 1LFAA 3MYYA 1N9GA 4U2KA 1TJ4A 3MMSA 5NLLA 3BTSA 4GDFA 4BECA 2F7SA 1FVXA 1NJ1A 5LQDA 2GLUA 5J4KA 3HM2A 5DM2A 4I55B 3MW8A 1QPGA 2IYAA 1NXVA 1P0MA 2ONCA 2IKQA 3KSZO 1BMFA 3KZCA 4WW0A 2B2XA 1KAMA 3PU6A 2AG6A 2J5XA 2ZJ8A 3P9PA 1EFHA 3TYXA 3R7NA 3SHOA 1JLLB 4C89A 1GSIA 1ZJ6A 5T4BA 1RZVA 4RV5A 4O2LA 5I7UA 5BN5B 2AC7A 4WVLA 4UVHA 4CRWB 3WGNA 4DJJA 1FZTA 2IVFA 1XVLA 1YBFA 4C0SA 4N76A 3KX2A 3PGXA 4KQWA 2X3UA 3D64A 1K3FA 5C8YA 2D5CA 5LD2C 2KLHA 3GLSA 1XI2A 4M0PA 4PPNA 3OCYA 1U2TA 1RPNA 3NMUF 2FE1A 1J2UA 4LFAB 1IU9A 1VIVA 3GCDA 4Z9YA 3UPUA 4PZYA 3UMJA 2HIGA 3FETA 2CD7A 4FFVA 3UFXA 5CLHA 2FPPA 2IOFA 2D1FA 2FPGB 4E22A 2JATA 3OZSA 1Q0LA 3O0DA 2GF9A 2ALJA 1GGFA 5BV8A 2ZIGA 1KJJA 5AW6A 2X40A 1VOTA 4NULA 4LXQA 3L7AA 1LSSA 1W76A 4P92A 4QBGB 3WQRA 3MUOA 3C24A 4JA0A 2HZ7A 1XAJA 3ZDAA 2W00A 4RKWA 1Z2EA 3QWBA 3W5IA 2Z0MA 1R0WA 3C1OA 3NRCA 5CAEA 1IATA 2M98A 3HBFA 4J6EA 4EYQA 3IDAA 2G6BA 3TKYA 3VKGA 1H6CA 1LPAB 5MDHA 3AUJB 3HXLA 1V5IA 2NT3A 3PKJA 1SUIA 4LJLA 4ZEVA 1Z5WA 4GO1A 1TB4A 2RGBA 2WYOA 3TCKA 3VR4A 4IOLA 2UYQA 2O4CA 1QWOA 1R4MA 2X6RA 1V0JA 2OBNA 4K6MA 4XSVA 5BN3A 3A0RB 1U8ZA 3N5CA 1NUTA 2H29A 5ITWA 5BVGA 3O8CA 2ZRLA 1F8YA 1TUIA 4X63A 3AVXA 2G6TA 1FFGA 2QRVA 4RF5A 5EESA 4CG3A 5AM2A 1PWEA 4DA7A 4CTMA 5HFJA 3AJAA 4N0DA 1QRAA 2LXNA 3MTGA 5EFZA 2Q0QA 4GMHA 2W43A 4CL0A 1SRRA 1LW7A 1RHRA 3AHHA 3CGWA 3UUWA 2WD8A 1T1EA 1JE0A 1OZAA 1E4VA 1JKFA 1XZNA 3D7RA 1J8MF 1RDFA 4YC7A 5GY7A 4CCSA 5FEUA 1CVRA 2B94A 3K09C 3QYFA 3N75A 4IS2A 5FT9A 4AKEA 3EXIB 3U37A 1RJ9A 3BOSA 5D84A 5A9SA 4KXMA 3SE0A 3U7JA 2X7JA 3RF6A 1MO2A 5JXWA 2JLVA 1NBMA 4FINA 2QVBA 3EXAA 2PYZA 4YRFA 1NYLA 1NSFA 1W25A 2VFAA 4HAIA 2AN1A 4TSFD 1YDHA 2J3KA 3JXEA 1CZRA 4L28A 2O48X 1IPEA 3A27A 4MVYA 1T3HA 1E2KA 2N47A 2JL1A 1U9IA 4Y2VA 1R5BA 1UT6A 4RELA 3CLUD 1KYWA 2A9RA 1BA2A 4DR3B 2PUTA 1UZAA 3LUGA 4U00A 4I4LA 4PLYA 5T8KC 2DR3A 3TINA 2EKQA 3EDMA 3TS1A 5HZGA 1AGRA 5BYBA 1UBJS 1XJQA 4L4RA 4LYHA 3LTNC 4YEDA 1QCYA 4TLBA 4IP0A 3EPKA 3AHDA 1GNLA 1Y3BE 2WA1A 3QWFA 3KAKA 5LUAA 1EFVA 1BXRA 1NN5A 2BFMA 3SVTA 4N48A 1VKJA 3WWZA 4EVIA 5GJCA 1YSCA 2O8FA 3A1WA 2BSQA 3ENNA 1VJ1A 4NBWA 2YS7A 2XT6A 3RYIA 3A4NA 5HMMA 4B7AA 3AUKA 4MUGA 3R9XA 2RBEA 1KAQA 1YZ3A 4YRMA 3N05A 5MFZA 4LF7B 4II7A 2HC9A 3RCBA 4TKMA 2H1SA 4ZVRA 5F7XA 1SZPA 3REQA 1JKIA 3EA4A 1N4AA 1N0UA 1DIBA 4FFLA 4ZK6A 3A10A 3H2KA 3LD9A 3UZUA 4LZJA 4Z0PA 4YLEA 4BV8A 5JNRA 2R86A 1BHO1 1P44A 2XYHA 4DQ0A 2MCFA 4CEIB 1QGDA 3DYIA 4MRMA 1XF9A 1GTRA 5LQUA 1MV8A 3EA5A 1TKRA 4NP6A 5TRTA 1CDZA 1MT0A 1ZHFA 4X7PA 4C20A 4RTJA 1NQWA 3Q7TA 2XQFA 1RJFA 3QE2A 1VJTA 2WIAA 1JB1A 1Z4LA 4OHVA 4TV8F 4BLRA 4LGVA 2AJBA 3HFRA 1L5SA 2FZWA 5J43A 3UNXA 3HG7A 2C77A 1TYDE 1K9SA 1X9GA 2XNHA 1QO7A 3COWA 2QI9F 4TX1A 3OFKA 2D4HA 2OT3B 1REQB 3NCTA 4HNSA 3E58A 2A2ZA 5DT2A 4EFDA 3AQ4A 3CEMA 4UAJA 5IJXA 4OK5A 3REOA 2GUWA 3RS5A 1P1BA 3D6NB 3BIOA 4E14A 5I4BA 1JXMA 2HA6A 2XUZA 1JA1A 4KMRA 1TVEA 2VHWA 4MW0A 3L1IA 2OBYA 2IGTA 3HA5A 4FMDB 3CF6R 2R8PA 5JHHB 1RWMA 4UMDA 1CR1A 1QFMA 3EA0A 4W6ZA 4FHCA 4LJ5A 4IIJF 4BV2A 1XQWA 4HGQA 3RYHB 3NALA 1IL0A 1W44A 5FWYA 4KLZA 2OBFA 1P2FA 4GYJA 4P3YA 3EVAA 1GM5A 1LLCA 1MOSA 2OZLB 4CF4A 1UDAA 1K7XB 4NOMA 5JDIC 1JWBB 3KEFA 3LP5A 4F06A 4DBLE 1TZKA 2P9GA 3L7YA 2PMBA 4WCDA 1YQTA 2OHVA 3F7MA 3PGA1 2C7PA 1WD7A 1Z17A 4BLVA 4EG6A 2V6JA 2AFIA 2ANBA 2Y71A 1NKTA 4QGHA 3EWSA 2HPAA 2XUPA 4IILA 4TTPA 3C97A 4RS4A 7ABPA 5K2MA 3OZDA 4LDNA 3DUFA 3N6XA 2ECOA 2WE8A 4KR2A 4FCWA 1AN9A 1EK2A 1GFWA 1R10A 4MV8A 4QULA 5LQJA 3OZ7A 3S2YA 4DTCA 1MAVA 1MJ5A 2WU4A 4B87A 1ADGA 3H8JA 4GYWA 3AVTA 3ZDEA 2PRZA 1PZEA 5C1BA 3U4IA 2ZYVX 4ER3A 5FPPA 2G4CA 3IVMA 3TTWA 1GQFA 4BNMA 4QU0A 4EL5A 5LYJF 4JL6A 4G09A 3F6BX 1BS9A 1MDBA 3UAVA 3CUYA 3IIKA 2J4DA 4FVTA 4UATA 4K6CA 2OOSA 5FWAA 4B4KA 1E6UA 3BN3A 1BO6A 1JQAA 1G21E 4OTZA 2EX4A 1CQWA 3RM3A 4F9EA 2NQTA 2X19A 4C0QC 2A9VA 1JFRA 4PBRA 4G2NA 2WSIA 3FDIA 1A9OA 2X8JA 4ZOLF 3ABSB 3GRRA 4HQNA 1ODLA 3E9ZA 3OUUA 3E9CA 3DHNA 2FDXA 1N6OA 4KVFA 2VHZA 3QUQA 3WL4A 2EL9A 1UKBA 3NG1A 2PMCA 2DBZA 3BMOB 3GLHE 4EZBA 3FPBA 4JI7B 1VB3A 1BE8A 1QF9A 3F8TA 3LIIA 4DV5B 3JYNA 1E96A 1SOMA 4YBZA 2PJZA 4OHFA 3EOBI 3RVJA 1Q17A 3DL2A 4QE3A 5K5EA 5HEKA 3BCUA 4TV8A 3EVFA 2HLPA 2Z3ZA 4C5BA 3TECE 2V4UA 2PANA 4Z4CA 1TF5A 4O4JA 3E3MA 3QEKA 4YRNA 3K9QO 8ABPA 3HKEA 4TVKA 1IDOA 4R7ZA 2CT8A 1D1QA 1R5JA 5ESWA 5FTJA 3QPDA 1KKUA 4G0ZA 5AKHA 3VDXA 1JG4A 1XZEA 3BVPA 3SX0A 2EKLA 1FFBA 2P5SA 1CU1A 3PBKA 4NYMQ 4ZODA 5A02A 1C3LA 2Y27A 3SI7A 1QKJA 3I45A 3JWHA 4M46A 1ENYA 1D4OA 1KOJA 1Y1SA 4YXWA 5JS2A 3K0EA 4BX3A 1EFDN 1G2IA 1U8FO 4QJBA 4QX6A 2VUSA 1K4MA 4G8DA 3PGLA 5AXAA 4K0RA 3ZE0B 4B0PA 3QFRA 4CETA 4IIJA 3KTAB 2YWHA 2JJ1A 1JFLA 2GZHA 3MCZA 4DC0A 3BMNA 3TE7A 4DXAA 3VOSA 1QIKA 3WO0A 1L5MA 3IOEA 3D31A 3KKEA 2WEKA 1K8RA 3VO9A 4C0AC 3R5SA 2AN9A 2G7MC 5G41A 3CMCO 2CB0A 3O4GA 4ZOAA 5JEDA 3BJIC 4ZI3A 4CV3A 3P19A 4HAOA 3DLHA 2ZROA 3KSUA 3LX4A 5M34A 2GN8A 1F9AA 1SC4A 2VYCA 1FZQA 2I29A 3D6MA 4CMEC 2VTBB 4DDUA 2QN2A 2FQWA 4TS3A 1XWIA 5AJUA 3GFTA 1U1FA 4M0LA 2Q9CA 4FEGA 4ZT6A 2X5NA 5PGMA 5A4MS 4BYGA 1O6BA 4UKDA 5HDBB 4A0SA 2XOKD 2GPNA 4LSWA 1E2BA 3DO8A 1K7CA 3Q6NA 3FW1A 3R24A 1Z6QA 3C6BA 3FM9A 2IYPA 3DNFA 2VCEA 4H35A 4ZT2A 3I58A 1DEKA 1E5QA 1UBGA 1FJHA 1TRHA 4M9UA 5EY5B 1YRWA 4ZVNA 4ZJUA 3G6KA 4DDWA 3GT4A 1V1JA 4BQOA 3FGPA 2GXQA 2PIAA 3WJ2A 1V11A 1YB4A 4AC9A 2PKRA 2JLSA 4FFWA 1SUSA 5LJIA 2Z3WA 3DMFA 5AM3A 4J76A 2H1CA 4QM7A 2ONKA 3CB2A 4MEBA 1YIAA 2NN3C 3B8EA 4NJEA 2I2CA 4QPPA 3V8NA 1CULC 3A1DA 1CDEA 4RXUA 4EGSA 2BBTA 4ZOLA 4RH0A 5A3QA 1KYZA 4MR8B 3L4BA 1SBNE 1SU8A 2VEDA 4LXYA 3PIRA 1U8YA 2OV8A 3EBLA 1O5OA 2I4TA 1VCNA 1OHHA 2FX3A 1NM5C 1H2YA 3C16C 3IHKA 4X1OA 1TZCA 3SYMA 4L6CA 3QGMA 1DT3A 4QNMA 3DDWA 3EIFA 5DGTA 2A4KA 1V47A 3L7OA 4ZI7F 5DNYB 2RC5A 1RJEA 5KX5F 3JASA 4Y3UA 3CCBA 1JR3D 3P9NA 5AKJA 3VZPA 3OLXA 2GK7A 4BX0A 3WQBA 4C0WA 1AKYA 1FVOA 3THSA 2QRNA 4ZOCA 2OWDA 3PP8A 3FROA 1KYXA 2PK3A 3U3DA 3WXMA 1KETA 4Q9DA 3WAJA 5FBKA 1NVWQ 1J8YF 1JBEA 4RD1A 3H0CA 3OX2A 3RIXA 5I9NA 1Q15A 4NBRA 4PYOA 4D81A 1MT3A 3CUVA 1C3JA 3U9SA 2FEPA 4IDAA 2GD6A 3QKSB 2QN8A 1G8GA 5F2NA 3PFFA 1MPXA 2YQ5A 5CVEA 5CUQA 4PV7A 2C2HA 3LHIA 3N2LA 5K20A 1LWOA 4GMFA 1DDOA 5DU2A 7GPBA 3KVRA 3C3MA 2FKAA 4J75A 4AWBA 4DQXA 3E18A 1JXAA 2ZPUA 2OCLA 1KC1A 3IOCA 1LI5A 1QLWA 3CH4B 3LO5A 3NT5A 2QTZA 5DNEA 4B73A 4YRPA 2UUCB 1XNQB 1U0GA 2WYVA 3N8DA 4REQA 5LYJB 3NKVA 1ZUNA 2AQHA 1BCSB 2K2WA 1R4AA 1ZL2A 2RG7A 2RGCA 1GTL1 1PV1A 3DBRB 3GP5A 1IN7A 5FOVA 3V6LA 1PGOA 4RIHA 1DBWA 1DUSA 1MIOB 3IQEA 3SZGA 5CM8B 2OA0A 1DOHA 3UQYS 2ODTX 3NUQA 3O8BA 1FNMA 4OQZA 1SXPA 2O3TA 3EDRA 5K0FA 3AEXA 3O26A 1E98A 2QRMA 4N0PA 1ADCA 5ICFA 4KRGA 3INRA 4EI9A 3KLBA 5DGDA 4N8SA 3P2EA 2EEZA 3K8QA 5KQSA 3DAFA 3IHWA 2R751 3BE5A 1KMMA 3DZFA 4GLOA 4QGFA 2UZ1B 3HA2A 3I92A 2VP0A 3S1AA 5JS8A 1A77A 3UEOA 1V4VA 3O4RA 3QX9A 2N46A 1I4LD 2OK7A 3KOZA 1C9YA 1GRCA 4NCIA 4OJKA 4U63A 3GWGA 2FQYA 1EVKA 4FE3A 1ZNWA 3EZNA 4KWIA 2LWIA 3FYHA 3GVIA 4CQMB 2AC4A 1UM9B 3JARA 3WBFA 4B2PA 3GJQA 3WGMA 3OTIA 1D6SA 2GRAA 2KMLA 3F5QA 1Y3HA 2OC4A 3TPZA 3QYPA 4IVNA 3W7BA 5LQNA 4NPCA 1U0TA 3NORA 1G8YA 1LDBA 3DJFA 1FSZA 1RVV1 3G0BA 3HVUA 2YYYA 3VKWA 2R1TA 5KUTA 1CQZA 2RHJA 3T54A 4KSCA 2TMYA 3FF1A 4J16C 3B9BA 5TQVA 1U1CA 2RHMA 2FV8A 3NATA 4JEHA 3TVTA 3GBSA 4ZYLA 4CKEA 4H1WA 1JR6A 3V8EA 1KYIA 1DFGA 3C43A 4Z9BA 1J4AA 2BMVA 3N3BC 3Q3HA 2G1PA 4CIWA 1NJ8A 1GARA 3R09A 4QAJA 4JLVA 5DLQC 4ZI7A 1XP8A 2A59A 4I2VA 3G5LA 1VP3A 5KX5A 3T7TA 1J5XA 2JAPA 5GGXA 3VNAA 3EG5A 2YZ7A 5FPKA 2WTNA 3VMFA 3ZJ4A 2WFAA 1EJ0A 1US8A 2OTCA 3I9FA 3TLJA 5CITA 5KQPA 4GXNA 1U7DA 2NU8A 2R1UA 3PFIA 4HTFA 4IJ5A 3TD9A 4UOZA 3BT7A 1XD2B 5HQTA 2FPSA 2PMEA 5AOVA 1PEAA 1YXMA 3OFVA 5HW0A 2BCEA 4YNBA 4ILKA 3RVSA 1S0UA 2BJWA 2XNDA 1G8SA 1BZYA 1HRDA 3A4MA 3GDGA 2QGFA 2EJTA 3C0KA 3I1FA 4EF5A 5J4HA 2D6FA 2X5JO 4DM4A 1U3UA 3HZZA 4PGGA 4UTVA 3LW8A 1HDGO 3M49A 2FQ1A 1VJ0A 4LVNA 4XD2A 1TMOA 1VHWA 2GR9A 1PR0A 3CSDA 3H4IA 3IXLA 2FLVA 3WNBA 5KSWB 1Y81A 4GX1A 5J3JA 1J33A 2DH6A 3DFMA 1W34A 4HD8A 5TQ2A 1N1GA 3H4VA 3P97A 3VZSA 1T9BA 2PJDA 1TUEA 5HIIA 4AZ0B 1UC9A 4L95C 1MR3F 1U11A 3FLBA 3L0DA 2R60A 4EPXA 4ZQCB 1B4DA 2J41A 3I05A 1NNEA 1KDYA 3EXG1 4IH9A 1GG5A 1PT5A 1XXLA 3FNFA 1X9IA 1W5EA 1VB5A 1XVUA 3S2IA 2XGJA 3KYDB 2V45A 4LZPA 1NVVR 4N03A 4L07A 4BS9A 1NW7A 2PD6A 4B40A 3Q72A 1GA1A 3ND7A 3H11B 4IY1A 2C3YA 4OJTA 3EZGA 4DMMA 4JUIA 1H85A 2A5DA 2VXCA 3IIIA 1X8KA 5FJIA 1E2UA 2QY6A 3C1TA 1KR5A 5IW8A 3TCXB 4EW2A 3ESDA 4HWSA 4N7JA 3CCCA 5DN6A 3RDPA 4Y30A 2M1XA 1U0BB 1IBLB 5HDQA 4IICA 2FR8C 4EKEA 4ZGGA 2FAXA 3ER9A 4BQIA 1DRUA 2GZAA 3WK8A 1UWCA 1TLTA 3OCWA 3CH6A 3OQIA 4NE2A 3MLEA 4M2LA 1SHTX 5FTNA 3ND6A 2Z8XA 1YNOA 1ZNYA 3NCHA 1XN1A 2CL0X 4BLUA 2ZZNA 3WADA 2E85A 5J9FA 4YAUA 1PR6A 4IO1A 3RGWS 4UOQA 4P53A 5ESXA 5D3MB 4DJAA 2C4HA 1EUDB 2PEZA 2AN4A 4RSMA 1L8XA 1ZN9A 4GUAA 1F0KA 1MLDA 2ODBA 3RT9A 5L6MB 1DL5A 2RDMA 2OGUA 2FY8A 4AYXA 3IUEA 4DE5A 3KLPX 3FGOA 2XI4A 3K9NA 2XQVA 5CP8A 5L7WA 4HDCA 6AT1A 1IEVA 4JWTA 2BVNA 8OHMA 2VOJA 3EQZA 2CYCA 3GFBA 4E1BA 4G0VA 4ILEA 5KS2A 3NTOA 5GVRA 1PFYA 2HOQA 4XVCA 1AHNA 4QQRA 1XNRB 3C5WP 2Y0CA 3LSYA 3KZOA 1XDWA 1DIOB 3ASUA 4PSUA 1OX4B 3VI4B 3SHTA 5F2OA 2HDWA 4FOLA 4D6PA 1QMPA 4MGHA 4WEQA 2I67A 4X91A 4PSAA 5EINA 4M1YA 4KL8S 2GBIA 2FRXA 1YJAA 1LXCA 2Q9AA 3L4KA 3GGOA 2ZS7A 1QKIA 3HDHA 4FILA 4QUGA 1N6RA 4C5CA 4KPYA 1JKMA 3OTQA 4X95A 3FCEA 4GKJB 3BH7A 3Q3CA 3OOYA 2F3QA 4PGFA 3PSAA 3R6WA 3ZHBA 4CR6A 1XVTA 5ESRA 2H1OA 1BN7A 1E69A 1H1DA 1MORA 3D3WB 3G0IA 3TFOA 3CSUA 3FJYA 1PNQA 4P4TA 1NV8A 4HDKA 4EEZA 3HSYA 3W9BA 5EQDA 4KHZA 2Q0HA 3THXA 3SQXA 1N7IA 2GERA 1O87A 2P9CA 2WWFA 3I6QA 3Q7QA 5JS6A 3TR5A 1RZRA 3WNDA 2OZEA 5IS2A 1SQ5A 3GCWA 4JLUA 5I7VA 5LN1A 3MA0A 1I14A 3A9CA 3PFBA 4M3NA 3W8DA 1Q5PA 1Z9BA 4MJLA 5CFRA 1IQ0A 1OH6A 1II0A 3ZZ1A 1TRKA 2R7MA 5C3UA 4D3FA 1W4AA 1YS1X 2J9RA 4HFNA 3ZVLA 1YBVA 1AKUA 2VP3A 3VISA 4NTZA 1ZCZA 2D1SA 4TWBA 5AVSA 4OQDA 5TJ9A 1BOFA 1S2NA 1E1QA 4UM9B 5KTKA 1I36A 4E88A 3CR3C 3BEOA 1J5EB 4EO9A 1TX4B 1TQ2A 2PVPA 3CT4A 3DZJA 1NIJA 2VDMB 3GMSA 3H04A 4JL5A 3SJBA 2UZAA 5KYGA 1VC2A 4TMZA 2JASA 5REQB 1DAKA 2O7SA 2NLOA 3IL2A 3KQNA 1S2GA 2PTHA 3PVSA 3HB1A 1N34B 4G41A 1Y34E 2C92A 1OLSA 3ANYB 4RD0A 4RVCA 4KSYA 1XYGA 3UG7A 1YHZA 2C8JA 1P4GA 2GZ2A 1DAPA 5AVYA 3FNEA 1SD1A 4OMDA 1DZIA 4NDZA 3NV7A 2C7BA 2JJ8A 4EUFA 2F1KA 4JBLA 3JTMA 2P6RA 4MICA 1O4VA 4V0ME 4IR7A 3MVEA 1R5OA 1CY8A 1ISFA 1OVMA 1U0EA 1XQ1A 3OU7A 3OZUA 4S0XA 3SU8A 4ABTA 1MB2A 4XE5A 1KJ8A 1U9YA 3ISTA 4LYEA 1HDIA 3F4LA 4QTXA 2JFOA 3W2FA 4KQMA 1UKCA 2ZW9A 2B4TO 1QGUB 3NGLA 2P5UA 1RQLA 3OE5A 1J7JA 4B3GA 2JI4A 4GX5A 1UBMS 3F5FA 1P17A 3OFND 1T2DA 3IHLA 3X1MA 5BUCA 3B85A 4U9HS 5BMOA 1Y5LA 3ZU4A 3UJNA 4LJ7A 1NULA 3I4LA 1CVIA 1IBRA 4X90A 1NY6A 4DLYA 4CGYA 1Y1KE 5JH7B 4ARCA 3LDHA 2HRZA 4UQPA 1Z6XA 3LFUA 2MYUA 4H27A 2UDPA 3DAYA 2Q5JA 3I9OA 2IHKA 3WZMA 4JXJA 1P77A 1E8DA 1SG9A 1XKQA 2Q3EA 4RQAA 3FKSD 5AKXA 5I9MA 1OWLA 2HADA 1L1FA 1TM1E 3NUGA 2OYCA 1ECGA 3BCRA 4UASA 2XSZD 3TD2A 4D92A 2PO7A 3KT3A 1FUEA 3LU1A 3H9QA 3PNQA 3X2SA 4C7JA 3RVKA 4B3XA 1U7TA 3O4IA 2WR8A 3KHKA 4JJZA 2VDJA 3FBTA 5JI3E 4JI3B 1NVEA 3GELA 3E9MA 1F1JA 3WYEA 1C0PA 5K0EA 1KJ9A 3E61A 5C81A 2DFNA 3F9CA 4BZPA 3WP1B 7ADHA 3SZRA 4JQSA 2I2BA 1Z2AA 4R16A 1PFUA 2OCXA 4XFDA 5DNVA 3D8UA 4GOLD 4D4LA 3GCXA 5GIOE 2CFOA 2EFJA 2XGMA 2GEKA 1W19A 3AF2A 3WGVA 5BR4A 3DW1X 1JS1X 1T5LA 1V48A 4DRZA 5IN5A 1Z06A 2SCUA 2V1XA 1HO3A 3L6CA 1JZSA 1HDZA 3PCXA 1TD9A 3LVBA 3PRHA 3ANTA 3A1NA 1V1RB 3IKLA 1DHRA 5A9TA 1SQGA 2OG1A 3HEMA 3ZDXB 2Q9BA 2UYHA 4PCLA 1IUOA 5KHLB 2P9FA 3U6KA 4DPKA 3CRNA 1G19A 1PZHA 2ATXA 3EG9B 2IPMA 4YCMA 1GNRA 2CLHB 3P0FA 2FZGA 3DDHA 3W5BA 1QIDA 2HMTA 1CS0B 1N6NA 2ZT8A 3BFKA 4RF2A 4JI5B 3RVLA 1N5IA 3DHEA 3AKYA 4MPDA 2B61A 2BEUB 3H86A 5JQGB 1SPBS 4TT8A 1M1YE 2EW2A 1B41A 3GNTA 4F2DA 4CCYB 1AHIA 3FG9A 1DADA 1ZISA 2IZ1A 4QHYA 1B8PA 6NULA 2FFHA 3ZJVA 1EDEA 2VOEA 1NMYA 1NU8A 2ZUBA 2AIRA 2I4MA 2WAYA 1YIDA 4CNBA 3FXAA 2C20A 2VT7A 2E9SA 2LPMA 4P35A 5CNJA 5EA2A 1V2GA 4E2ZA 1O94A 5EIFA 4EQZA 2HK9A 1WF3A 1M2VA 2V03A 1OZHA 1UT5A 2CXHA 2RGDA 2I3BA 3BXXA 4B47A 5CVTA 2JLZA 2NYUA 3FDZA 1G5RA 2O7RA 4LMAA 5I4IA 3LY9A 2F1IA 2AE1A 1ONSA 4J91A 1V7ZA 4RZXA 4HQLA 4PC1A 1A9TA 4NMHA 2AEFA 4LK3A 5I7OA 2ZUFA 1SCUA 3CZ5A 4ZVMA 1T1GA 3KTOA 1QGAA 3P2JA 1C9MA 1FDIA 1ULTA 3F4BA 4FGSA 4I4TA 3RKSA 4C4SA 3K0AB 2OQIA 5C32A 1ISPA 1IOWA 4ZYWA 4MPTA 4ZYZA 2I3GA 4C04A 1LPNA 3HJGA 3NIWA 1XAIA 4RVOA 3VPGA 3L4SO 1LV8A 5DWVA 5A3SA 3WK7A 3OTHA 4HF7A 4PRKA 4GM4A 4UEKA 3MWFA 1J24A 3DWGA 4OHCA 2WQ7A 2CY0A 2G1JA 2JIBA 1IN4A 2PS0A 2Y0EA 3D3KA 2EG9A 1SCAA 2AXEA 1JVNA 2QGNA 4XIJA 1KEEB 2GZDA 5TV2A 2JH3A 1RFGE 4CMKA 1QK3A 2O0HA 2PZEA 3M4NA 4RD6A 4JR2A 2VWPA 3ROXA 2FMTA 2I6GA 1I0LA 5JDCA 1O97C 2JDID 3ORQA 2P2LA 1XNJA 3RYFB 4BNXA 4AY5A 2A88A 1EK1A 4P86A 1GFSA 3R0QA 1T4BA 2G9NA 4PCUA 4PTYA 2I2FA 1E5TA 1YU6A 2RGEA 4RJTA 3QJYA 2JLRA 5A9RA 2OV2A 4RVHA 4U2BA 4F7WA 4DBLC 3R9WA 1JNYA 2NPOA 1NX9A 2C5EA 1H2RS 5JY6A 1X39A 1XHFA 2WD7A 3V4RA 4EKDA 1F7VA 3BXGA 2ZJAA 3LPCA 5AW0A 1CB7A 2ZUEA 1V8PA 2C8LA 4FOSA 3U4HA 2AXNA 5ICMA 5E3HA 1P73A 1Z88A 2LDBA 3F1KA 3KYIB 1F2UB 2AQIA 2DETA 5T41A 2DUWA 3KEGA 5DYIA 5C4GB 5BW5A 4M0UA 1QR6A 5ALHA 4LQ4A 4J94A 1LLQA 1BWQA 4OMUA 1ECBA 2POQX 4CKYA 5BVHA 2HN9A 2HRCA 4PHCA 4WA8A 2JFQA 1WO8A 3DD1A 3DHVA 1KZ6A 3GFGA 3GMTA 1O5IA 2W2OA 4XUEA 2YZNA 1ZGBA 5KNBD 4G0UA 3DPSA 1R8SA 3U1VA 4X8HA 3D6UA 1UZNA 4ND8B 5FTMA 3PWTA 5JT1A 3WYBA 4ZQEA 4DR5B 1JDUA 1N78A 2ZIUB 3KJXA 3P9RA 5I3CA 4LMRA 2A7XA 2BISA 2G76A 3CLTC 1HT2E 2Q4EA 4UOEA 2GFIA 3HKDA 1IY2A 4HFMA 4TQAA 4DANA 2Q8QA 4R6WA 2HLDA 2XVXA 4BGDA 3HO1A 1YBAA 3IULA 2FI1A 4HDMB 2GCOB 1M0WA 1N3IA 1XV5A 3SK0A 1AA6A 2WJZB 1ISMA 1NYQA 2J0UA 4TQUS 1XCLA 1V6SA 1VCIA 2YASA 1Q19A 2GHQA 4EHJA 1NF9A 3TOVA 3MJEA 4Z2YA 1JZQA 3E22B 5TMEA 1USGA 2HSEA 1XO1A 2J5BA 2HJWA 2LR0A 4LGCA 2CDAA 3V1KA 1GL3A 4HGPA 3GLIB 1PTKA 4HB2A 1W0KD 1ZM2A 1J99A 4X3OA 2C2OA 4EENA 4MCAA 3BREA 3VPXA 5FPTA 5BSFA 3UW1A 4OSPA 2VWQA 1H9BA 3B52X 2GOYA 2WOJA 2OOKA 3H05A 4XQ9A 5D85A 3UAXA 3H97A 4DA8A 3FMVA 3T0GA 1G6HA 1QUEA 3K9GA 1QM5A 2VNAA 4E5YA 2OMEA 4M6WA 3KE8A 2HDOA 4ZAFA 2YNMA 1BVRA 3QJ5A 4CXMA 3I1JA 2JIPA 2IYFA 3PTLA 3H2BA 1GZ4A 2D0IA 2V9CA 3FUCA 5EJGA 4WK6A 3A9VA 1Q3KA 3K0CC 1XZPA 1HH4A 1I0ZA 2HA5A 2X1MA 3AUYA 5BNIA 3M70A 3DMGA 2JFPA 3FAKA 4H6VA 4ZI5A 2OHGA 3ZGYA 4E2WA 5THQA 1VG1A 5FOQA 2W6JD 4UE6A 4RZIA 4ZP1A 5L4SA 3K5PA 4FTWA 5FV4A 3ZW9A 3M9WA 1A76A 1GLGA 1GQSA 3AJRA 2UV8A 2NTNA 4Y0NA 1MAHA 2VKQA 3E9DA 1N5JA 3BA1A 1SVNA 3P0HA 4G8JA 2DBYA 5DX8A 3TOSA 4Q7QA 5BUZA 1IOLA 1KH1A 1MA3A 1S1CA 2A94A 2B2CA 2ERXA 2PSDA 4L08A 4N39A 4RY9A 2SKEA 5ALPA 1AQUA 3PI7A 1G5QA 3B2QA 4OG2A 2CXQA 4Q4HB 1N5KA 3SS9X 1XU9A 3E53A 3M6XA 1HT1E 2GEUA 3H1PA 2EJCA 4L5JA 3IERA 4TXMA 3NVMB 5DWDA 4UDOA 1QIHA 3Q41A 1BKSB 4Q3DA 4D3YA 5BRJA 3OZWA 1X80A 1FP1D 1GEEA 1II9A 2YXLA 4PIVA 1L5WA 3CRVA 3AVQA 3ZHUA 1WAMA 1N92A 3PJRA 4QU8A 2DPLA 4B79A 2XNCA 1N2GA 3KSBC 5SZJA 1TTTA 2VSYA 2ECQA 1ORDA 4R71A 2CJWA 1E6MA 1ZLYA 3E35A 5DM4A 2JGNA 3WTCA 4H18A 1Y6QA 1AS2A 1U04A 1K7EB 3AEQB 3K0FB 2N1MA 2WT9A 3QY0A 3ZG6A 1JEEA 2HMUA 2P9ZA 4OYLA 4E2FA 4OYRA 4B6JA 2OO7A 3FZGA 1T9GR 2DTEA 1C14A 4LXHA 1M1UA 1OLXB 2HX1A 3L0YA 3RUAA 2PSFA 4ARUA 2GGSA 1OXBB 4Q9JA 4EJFA 3GGPA 4X92A 3EOAI 4IZ6A 3C6XA 1GKYA 4F6LA 1O95C 1V9LA 4RSHA 1D8AA 4OI4A 1W2HA 1F6DA 4BWYA 2WHYA 1FSGA 1P7ZA 3EGOA 3GLGB 4LHVA 1Q7BA 3DHYA 3A3NA 3HNRA 3SLKA 4CUKA 4DA9A 4K9RA 3JZFA 3JWPA 2MINB 5KYWB 3PWZA 1ZM7A 3TIIA 4RW0A 1UDCA 4CLRA 1ZITA 3IUBA 4BZQA 4CMGA 3MUNA 1C7ZA 1MB0A 1O57A 4H77A 1ISRA 4DMFA 1CIPA 1UOOA 1WQ1R 4LCEA 5DEIA 2JAWA 1HOXA 4PSDA 5EJAA 4B4OA 1YQWA 2D8MA 1SXJE 5EE9A 3R6TA 3VYUB 5IBQA 1VSUA 2C9MA 1U8UA 4N5LA 3UAGA 1PHPA 1KDZA 3Q10A 1GKIA 1CQPA 4DF3A 3GRUA 4O2AA 1ODTC 2D7JA 4M1KA 3SJAA 1J22A 4D2IA 3GYBA 3L2OB 1RQ2A 3OCCA 4HATA 5K8IA 1J8DA 1GD1O 1M7BA 2QTCA 2I2DA 5HS4A 1P6QA 2XMCA 1MKYA 3LVFO 1MJFA 1WTAA 2F90A 5DLEA 4EB0A 1VRWA 1ZI9A 4OGGA 2AYZA 2WJ4A 3IBFA 4WDRA 3WA7A