3W40A

Crystal structure of rsbx in complex with magnesium in space group p1
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
199
structure length
199
Chain Sequence
b'MIQVEENEHIQTLVYQLNKEGKSICGDSFFMKADDKELICAVADGLGSGSLANESSAAIKDLVENYASEDVESIIERCNQAMKNKRGATASILKINFEQRQFTYCSVGNVRFILHSPSGESFYPLPISGYLSGKPQKYKTHTATYEKGSKFIIHTDGLNVPDIRSHLKKGQSVEEISNSLKMYTTSRKDDLTYILGQLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoserine phosphatase RsbX
publication title Structure of the RsbX phosphatase involved in the general stress response of Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 64
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2013-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07228 SpoIIE Stage II sporulation protein E (SpoIIE)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.40.10 Alpha Beta 4-Layer Sandwich Phosphatase 2c; domain 1 PPM-type phosphatase domain 3w40A00
2PK0A 3FXLA 4WVOB 3QN1B 3W42A 4DS8B 2XZVA 3F79A 3UJKA 2I44A 4YZGA 3D8KA 4RA2A 2J82A 5F1MA 3T91A 3W41A 2I0OA 2J4OA 3PU9A 4N0GA 3EQ2A 4LGBB 3RT0A 2ISNA 3RNRA 4JNDA 4LG5B 3ZT9A 2POPA 3UJGB 4DA1A 2PNQA 3UJLB 1TXOA 3KE6A 3KDJB 2J86A 2IQ1A 2JFSA 3FXJA 5D2UA 3W45A 2IRMA 3FXOA 2Y09A 2JFRA 4RAGA 3ZVUB 3FXMA 3KB3B 3T9QA 4LGAB 5JO2B 3NMTB 3JRQA 4RAFA 3W40A 3W43A 4LA7B 2CM1A 3N3CA 3NMVB 2JFTA 3NMNB 1A6QA 2P8EA 3FXKA 5JO1B 2V06A 4OICB 3W44A 5ITIA 3ES2A 3MQ3A 2POMA 4YZHA
chains in the Genus database with same CATH superfamily
4IIKA 2PK0A 3FXLA 4WVOB 3QN1B 3W42A 4DS8B 2XZVA 3F79A 3UJKA 2I44A 4YZGA 3D8KA 4RA2A 2J82A 5F1MA 3T91A 3W41A 2I0OA 2J4OA 3PU9A 4N0GA 3EQ2A 4LGBB 3RT0A 2ISNA 3RNRA 4JNDA 4LG5B 3ZT9A 2POPA 3UJGB 4DA1A 2PNQA 3UJLB 1TXOA 3KE6A 3KDJB 2J86A 2IQ1A 2JFSA 3FXJA 5D2UA 3W45A 2IRMA 3FXOA 2Y09A 2JFRA 4RAGA 3ZVUB 3FXMA 3KB3B 3T9QA 4LGAB 5JO2B 4IIPA 3NMTB 3JRQA 4RAFA 3W40A 3W43A 4LA7B 2CM1A 3N3CA 3NMVB 2JFTA 3NMNB 1A6QA 2P8EA 3FXKA 2V06A 4OICB 3W44A 5JO1B 5ITIA 3ES2A 3MQ3A 2POMA 4YZHA
chains in the Genus database with same CATH topology
2PK0A 3FXLA 4WVOB 3QN1B 3W42A 4DS8B 2XZVA 3F79A 3UJKA 2I44A 4YZGA 3D8KA 4RA2A 2J82A 5F1MA 3T91A 3W41A 2I0OA 2J4OA 3PU9A 4N0GA 3EQ2A 4LGBB 3RT0A 2ISNA 3RNRA 4JNDA 4LG5B 3ZT9A 2POPA 3UJGB 4DA1A 2PNQA 3UJLB 1TXOA 3KE6A 3KDJB 2J86A 2IQ1A 2JFSA 3FXJA 5D2UA 3W45A 2IRMA 3FXOA 2Y09A 2JFRA 4RAGA 3ZVUB 3FXMA 3KB3B 3T9QA 4LGAB 5JO2B 3NMTB 3JRQA 4RAFA 3W40A 3W43A 4LA7B 2CM1A 3N3CA 3NMVB 2JFTA 3NMNB 1A6QA 2P8EA 3FXKA 5JO1B 2V06A 4OICB 3W44A 5ITIA 3ES2A 3MQ3A 2POMA 4YZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PK0 A;  3FXL A;  4WVO B;  3QN1 B;  3W42 A;  4DS8 B;  2XZV A;  3F79 A;  3UJK A;  2I44 A;  4YZG A;  3D8K A;  4RA2 A;  2J82 A;  5F1M A;  3T91 A;  3W41 A;  2I0O A;  2J4O A;  3PU9 A;  4N0G A;  3EQ2 A;  4LGB B;  3RT0 A;  2ISN A;  3RNR A;  4JND A;  4LG5 B;  3ZT9 A;  2POP A;  3UJG B;  4DA1 A;  2PNQ A;  3UJL B;  1TXO A;  3KE6 A;  3KDJ B;  2J86 A;  2IQ1 A;  2JFS A;  3FXJ A;  5D2U A;  3W45 A;  2IRM A;  3FXO A;  2Y09 A;  2JFR A;  4RAG A;  3ZVU B;  3FXM A;  3KB3 B;  3T9Q A;  4LGA B;  5JO2 B;  3NMT B;  3JRQ A;  4RAF A;  3W40 A;  3W43 A;  4LA7 B;  2CM1 A;  3N3C A;  3NMV B;  2JFT A;  3NMN B;  1A6Q A;  2P8E A;  3FXK A;  5JO1 B;  2V06 A;  4OIC B;  3W44 A;  5ITI A;  3ES2 A;  3MQ3 A;  2POM A;  4YZH A; 
#chains in the Genus database with same CATH topology
 4IIK A;  2PK0 A;  3FXL A;  4WVO B;  3QN1 B;  3W42 A;  4DS8 B;  2XZV A;  3F79 A;  3UJK A;  2I44 A;  4YZG A;  3D8K A;  4RA2 A;  2J82 A;  5F1M A;  3T91 A;  3W41 A;  2I0O A;  2J4O A;  3PU9 A;  4N0G A;  3EQ2 A;  4LGB B;  3RT0 A;  2ISN A;  3RNR A;  4JND A;  4LG5 B;  3ZT9 A;  2POP A;  3UJG B;  4DA1 A;  2PNQ A;  3UJL B;  1TXO A;  3KE6 A;  3KDJ B;  2J86 A;  2IQ1 A;  2JFS A;  3FXJ A;  5D2U A;  3W45 A;  2IRM A;  3FXO A;  2Y09 A;  2JFR A;  4RAG A;  3ZVU B;  3FXM A;  3KB3 B;  3T9Q A;  4LGA B;  5JO2 B;  4IIP A;  3NMT B;  3JRQ A;  4RAF A;  3W40 A;  3W43 A;  4LA7 B;  2CM1 A;  3N3C A;  3NMV B;  2JFT A;  3NMN B;  1A6Q A;  2P8E A;  3FXK A;  2V06 A;  4OIC B;  3W44 A;  5JO1 B;  5ITI A;  3ES2 A;  3MQ3 A;  2POM A;  4YZH A; 
#chains in the Genus database with same CATH homology
 2PK0 A;  3FXL A;  4WVO B;  3QN1 B;  3W42 A;  4DS8 B;  2XZV A;  3F79 A;  3UJK A;  2I44 A;  4YZG A;  3D8K A;  4RA2 A;  2J82 A;  5F1M A;  3T91 A;  3W41 A;  2I0O A;  2J4O A;  3PU9 A;  4N0G A;  3EQ2 A;  4LGB B;  3RT0 A;  2ISN A;  3RNR A;  4JND A;  4LG5 B;  3ZT9 A;  2POP A;  3UJG B;  4DA1 A;  2PNQ A;  3UJL B;  1TXO A;  3KE6 A;  3KDJ B;  2J86 A;  2IQ1 A;  2JFS A;  3FXJ A;  5D2U A;  3W45 A;  2IRM A;  3FXO A;  2Y09 A;  2JFR A;  4RAG A;  3ZVU B;  3FXM A;  3KB3 B;  3T9Q A;  4LGA B;  5JO2 B;  3NMT B;  3JRQ A;  4RAF A;  3W40 A;  3W43 A;  4LA7 B;  2CM1 A;  3N3C A;  3NMV B;  2JFT A;  3NMN B;  1A6Q A;  2P8E A;  3FXK A;  5JO1 B;  2V06 A;  4OIC B;  3W44 A;  5ITI A;  3ES2 A;  3MQ3 A;  2POM A;  4YZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...