3W5HA

Ultra-high resolution structure of nadh-cytochrome b5 reductase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
272
structure length
272
Chain Sequence
STPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NADH-cytochrome b5 reductase 3
publication title Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
total genus 71
structure length 272
sequence length 272
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w5hA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w5hA02
2OK7A 4B47A 1XE1A 2B7BA 4M4SA 3ZC3A 1ELOA 1KTVA 1VQLB 1EP3B 3CMAB 3E1YE 4LBWA 4LBYA 3CCRB 3CC4B 1AMOA 4HE6A 2HMAA 2BPOA 3P26A 4ZCIA 4F7DA 2VNIA 1CNEA 4J0QA 1ZM2A 1KRHA 1YHQB 1N0UA 2BGJA 3QFRA 3VMFA 1JNYA 2PMDA 1KK0A 3U6BA 3W5HA 4PGOA 4PC7A 4B48A 2XNJA 3WNDA 1E62A 4YHBA 2RC5A 1FNMA 3VNUA 2YWHA 4AC9A 1BX1A 1QFYA 3ZBUA 5H5JA 1D2EA 1WDTA 3JQQA 4Y7CA 1SM4A 4B43A 3PENA 1JB9A 5GV8A 1B23P 5H59A 1QUEA 4YAOA 2VYQA 1OGIA 5AN9A 2GPJA 1VQ9B 2EFGA 4G1BA 5GV7A 1KK2A 4B44A 1R5OA 2D74A 1FNCA 4UAJA 3ZZTA 2HCJB 3WBJA 1VQNB 4TMTA 4BPRA 1BJKA 5FA6A 3J81k 1DDGA 3FPKA 3AVTA 1Q82D 4MYUA 1H42A 1U2RA 3WXMA 4RCZA 1M90D 3WY9A 1VQOB 3CC7B 3JQPA 1ZM4A 4K1XA 1TTTA 3W5VA 3CCVB 1GO2A 2YWEA 2B5OA 1B2RA 3CCQB 2RC6A 2NPFA 1FRNA 2GQFA 1F20A 1I7PA 1K8AD 2VNKA 1GAQA 3CCEB 1FDRA 3AVYA 2QTLA 3E20A 3ZZUA 3P27A 2DERA 1EFCA 2R6HA 4HE5A 1N0VC 2PIAA 4RD6A 4RCYA 1GVHA 1QVGB 2BSAA 3W5UA 3WNCA 1D1NA 3W2GA 4B3XA 4ZV4A 4WQMA 1VQ8B 2BVNA 1E63A 1N8RD 1W35A 3MMPA 1SKQA 3OZWA 2OTJB 1KK1A 3CXCB 1NDHA 4C43A 2CNDA 1OGJA 1YJWB 4AF6A 2BV3A 5JBQA 3AVUA 3G6EB 2YWFA 1YIJB 1KD1D 3AGPA 3QFSA 1S0UA 3OZVA 4TMWA 1W87A 3CCUB 3QFTA 1VQ6B 2DY1A 4PC6A 3CB4A 5THXA 4N3NA 4G5GA 1CNFA 3B82A 3QSYA 1VQKB 3W2HA 3WYAA 1GR1A 4M2LA 1IJEA 1XB2A 1QUFA 1QGAA 4FK8A 4LC0A 1YI2B 2QDXA 2BF4A 1G7SA 4TMZA 3AVVA 1FNDA 2AHOA 3W2IA 4QFMA 1VQ4B 2YWGA 3CCJB 3CC2B 4P3YA 1EP2B 4TMXA 4C0SA 3CD6B 4Y9UA 1G7RA 3JQRA 5TR9A 1YJNB 3OW2B 1IJFA 1AIPA 1J9ZA 1ZM3A 4RD4A 4YAFA 2E1RA 1HA3A 1QG0A 4ACAA 3WNBA 4LBZA 4ZGQB 3LVBA 4RD0A 2BGIA 4TMVA 1H85A 4RD2A 1FNBA 1EXMA 1G7TA 3CW2A 2PLFA 1QH0A 4Q7JB 4DQKA 3CCLB 4IW3B 3CCMB 5EMNA 1ZUNB 3CCSB 2DEUA 1JA0A 2CRVA 1EFUA 1Q81D 2C78A 1DDIA 1QGZA 3CMEB 1VQ5B 1EP1B 1KJZA 1M1KD 3W2EA 2EIXA 4ACBA 3VO2A 1R5NA 1VQ7B 5TY0A 5DSZA 1QGYA 1DG1G 2QMUA 1TLLA 3V76A 1K9MD 3AVWA 3FJOA 4MYTA 2BM1A 4QHYA 3ZBTA 4M1KA 4B4DA 3ES9A 3CPWB 4P6VF 1DARA 2C77A 2FX3A 3AVXA 4NBSA 1S72B 2VZLA 2BM0A 4FN5A 4YAUA 1KK3A 1YJ9B 4PC1A 1NJID 1TUIA 2VNHA 1EFTA 2XNCA 4ZCLA 1FRQA 1GAWA 3QE2A 1W2BB 1W34A 4EH1A 1F60A 1GJRA 3LYUA 1IB0A 3B78A 3W2FA 1ZM9A 1G7CA 2BN4A 3OJWA 5HXBA 2QA4B 1Q7YD 1JA1A 2B7CA 4FWTA 3OJXA 2HDNB 4ZCMA 1A8PA 4AF7A 4PC2A 4TN1A 4U9UA 4RD3A 4N3GA 3LO8A 3U2QA 1QVFB 3I1FA 1QFZA 4R71A 4ZGNB 2X3UA 1Q86D 4YAWA 1TVCA 4PC3A 1D8TA 2VNJA 1BQEA 1VQMB 3G71B 4M53A 1QFJA 3OZUA 3SJZA 1R5BA 3B8HA 1JJ2B 1EWYA 2BMWA 3MCAA 2OTLB 1K73D 1CQXA 5TV2A 4LBVA 1QX4A 1E64A 3U6KA 1YITB 3QFCA 4Y9RA 4RJLA 2XEXA 4RD1A 3G4SB 3AGQA 4M0LA 1BX0A 2QN6A 2ZITA 2DCUA 3WBKA 2QTZA 4H9GA 3I55B 2DETA 1KC8D 1OB2A 2OK8A 2J7KA 3I56B 1KQSB 3ZZ0A 4DQLA 5KSWB 1VQPB 3A1FA 3CRZA 3MHPA 2QEXB 3LRXA 3VO1A 4NCNA 4YALA 1UMKA 4G1VA 1OB5A 3VNVA
chains in the Genus database with same CATH superfamily
2C7BA 3EARA 3IT1A 4N0PA 4BWYA 1G5FA 4JUFA 3L8EA 4R8MA 1ZK4A 2VJMB 1TEVA 2NLOA 1NE7A 3ZHZA 5JROA 1JR3A 2Q3MA 1XRNA 3JQAB 1LZLA 3K0FB 3IX7A 3ISTA 2W2QA 3MJCA 1TM4E 2NZJA 1ELOA 3QXSA 4ZCSA 1CUXA 1UXHA 2JANA 4HY3A 4Q9AA 5GOTA 3FPGA 2Q8QA 1AUQA 1Q1AA 3EXEA 2E89A 3M9WA 3MCZA 4OI2A 3F46A 2CNBA 3R23A 5PNTA 3UK6A 1ARZA 2J3JA 2P3LA 3CLRD 3ZHSA 2IU0A 4BGEA 2Q3CA 4F7DA 1K5GA 3CSSA 2PG3A 2QHXA 1BA3A 2A1UB 1AZWA 4UNNA 5E1MA 1QK3A 4JUIA 4KFSA 2J07A 1QE0A 3KOUA 1KJIA 3VKUA 3DVLA 1JFFA 1SFRA 2GM5A 4BATA 3LLUA 4C0HA 3KSDO 1ABFA 5BRAA 3F73A 1VHQA 2X1VA 2PT7A 1NW8A 4DA9A 2AX3A 3P45A 1E0JA 1AXGA 3HN7A 3PPIA 2YJZA 1U8YA 1CEYA 3K6SB 1AQYA 3H3FA 1II0A 2B2NA 4Q0MA 4QTYA 5T8KA 4AS1A 4PXYA 3S44A 2J0SA 5IXSA 3WRYC 3N39C 5FF9A 4DJEC 4Z4IA 2YJGA 3GJ6A 2ZJ4A 1DVRA 1P6UA 2PMBA 4G1MB 5DKFA 1SUWA 2XVZA 2GN0A 4KRYA 4QUDA 4D0NA 1HFWA 1NWHA 2NO9A 3NC1C 4G0QA 4QVJA 1G6OA 3O0DA 1NN0A 1IH8A 2PH5A 4A6EA 1Y7HA 2H2AA 4S0ZA 1VQ1A 2H5JA 1YMVA 3OQ1A 2CLDX 3RTGA 4FWIB 2HJ9A 2FU5C 2FW6A 2RJOA 4G5XA 3K2QA 2CB9A 3SIPA 3VSAA 1RACA 3UAZA 4BV3A 3ESDA 4G0VA 2IDZA 4GI5A 4GI3A 1LGYA 4KO1S 2UVQA 3ACBA 4G8BA 2D5CA 4YHBA 2FRDC 5TPZD 4WKCA 2O1SA 1I32A 2BRUC 4ZU6X 2IX3A 1N5KA 3T41A 1RM5A 3IQZA 2UZ0A 4V0ME 4Z7NB 2HFJA 4KV7A 2C3YA 5BSGA 3TQIA 3CMMA 3FCUB 3G49A 1IN8A 1PVDA 1NXPA 1RM3A 2F55A 5HBRA 1SC4A 1F0YA 2OB1A 1U8XX 4ZQFA 1AX9A 4KIWA 5INTA 2W90A 3NTOA 4UNPA 2AGVA 3DDHA 4LNUA 1EFRD 2R5FA 3GJSA 4BEWA 4I5DA 3NTVA 1DMRA 1Z08A 4EI8A 4NABA 5HK8A 1MC4A 3EIFA 4D02A 2BR4A 1W36C 2HPHA 4XA8A 3ZDFA 5B12A 1WMBA 1QVVA 1FUYB 3NWBA 2H65A 3SZGA 3ILYA 1KYZA 2COKA 3BKXA 3AB7A 1PYDA 2CC2A 3ND5A 2HRBA 4LSWA 3WBJA 4CR6A 2OZVA 4ZI5A 4EKIA 2JLUA 4P80A 2GTPA 3ZHYA 3AL0C 1MPXA 3DZBA 5CNJA 3UMBA 1R0WA 3TW6A 1E5VA 2P4EA 2HADA 1FFAA 4A0HA 2JFPA 1M6NA 4IUDS 4WCDA 3SZLA 4CEJB 4OXRA 1WP6A 3AVTA 2C00A 1HFKA 1PR2A 2QYHA 3TZCA 3IXQA 3JRXA 3QLJA 3JY6A 5AM0A 2ZUEA 2ZTNA 2GCNA 4B6OA 4DLBA 1ZZEA 1G98A 3HSKA 1Y3FE 3JATB 4EUHA 2BHLA 4IJKA 3GSIA 1RKVA 3KZVA 4OFWA 3ZDXB 5JZVA 3TTVA 1IVSA 1RQ2A 2DUMA 5J23A 2CV0A 2HW8A 1E3MA 1WUJS 1KZ7B 4V3CA 3AEUA 1GTG1 2F59A 3FFWA 3MMSA 3QUCA 3WKDA 4ER7A 4G24A 3RU7A 3HP1A 1MMFB 1Y3AA 2Q4EA 3PRYA 3AUXA 3GEGA 2FKNA 4YXWA 2PGNA 3H9JA 5DM4A 3KJFA 5DSTA 1KMHA 2AJBA 4D9GA 2VTBB 1NVTA 2B4AA 4BLTA 1OC4A 4MJ7A 1KEVA 5AK3A 3K9BA 3TLMA 2C8KA 3STHA 1UD2A 4U2BA 4Y2PA 4JL6A 2ID8A 2KJQA 1A3CA 2Q5JA 2DH6A 3EZ7A 4O4JF 3U4GA 3OURA 4KXVA 2OZLA 2Q0QA 4EYQA 2ZCJA 1X38A 2H85A 4MARA 1VPWA 3CCEB 1IN7A 1W1IA 4I6JA 4B2PA 1KDRA 2FMHA 4OJQA 4R16A 1U2ZA 1XWIA 3OKXA 4HXEB 3F47A 3W8DA 2CVZA 3ZV6A 5K0GA 3ANTA 4DRXB 1MXFA 3R3HA 1RLIA 3K31A 2VYND 4L76A 2PA3A 4NV0A 1SQ6A 1FP2A 4XQEA 1JHVA 1EFCA 1X7WB 1C2TA 4MVWA 5A8AA 5I8PA 1YZUA 5HRCA 5AUNB 4ASUA 1NVBA 1FQJA 2OECA 4REQA 121PA 3AHEA 1WNFA 2ORED 1TLFA 1RHUA 1YD7A 4GOXA 4RVOA 5JAIA 3R9XB 2G71A 3K0EA 1DXYA 4DA7A 4GZ5A 2WWYA 3BGWA 1P1BA 3V48A 5AJTA 1J0AA 2ADFA 4D8VA 5HA5A 4NULA 3FOFC 4XIFA 3FZEA 1UAAA 1UMCB 3CE6A 1YI8A 2VZEA 1VLQA 2Q3HA 4RMIA 4MR8A 3QXCA 2H1HA 5FDFA 2PKYX 4DCNA 3WIEA 4P26A 3IBSA 3RK1A 3AKDA 3NBAA 3LPDA 2ZS7A 3QEKA 2GRUA 4YAIA 2RGDA 2BFEB 2P0EA 1UMBA 3F6RA 2CNDA 3D2CA 5KNDH 2W0MA 3AQ4A 2XD9A 1JIUA 2X5KO 4HADA 2AC7A 3ENVA 4R84A 1TPZA 1XEFA 3E2PA 4EDHA 4CG3A 5AVYA 3TIGA 1LY1A 4BVAA 3Q9LA 3V33A 4RPDA 4PM4A 4YRNA 3M33A 4B2LA 4KLNA 1MQAA 3ML1A 1AUVA 2L19A 2EKDA 4NMWA 4LVNA 3B3QA 1WDLA 4H1VA 1ECFA 1J24A 4CKZA 1CJSA 1XAIA 2V7BA 3BK2A 4AM8A 4R8VA 1VQ6B 1U9IA 3L43A 1JUDA 2AQKA 1IXYA 3KFVA 5EZ6B 4KMOA 4DLSA 4RFSA 3L93A 1U80A 1YHNA 2YHBA 1O6ZA 2E1BA 3GCDA 3BDAA 3LVQE 2AXPA 4JT2A 4PR3A 1BPLA 4NEGA 2UYCA 3BXOA 3W2HA 2NP6A 1JEEA 1UP6A 4PNZA 4QNNA 3VHXA 4Z7OB 3LOUA 1PX0A 2W9XA 3W5BA 4DMKA 1A69A 4FQ7A 3D4PA 3H1GA 4B3JA 1KVUA 3E7DA 4EEKA 2SKCA 4FFMA 2IUUA 2I6UA 1TUGA 4JB2A 4OPMA 1C4XA 4WNCA 1ULUA 1K08A 1NYQA 1M6VA 2AEEA 2DHCA 2DX7A 4D99A 5BN3B 3KEOA 2IPXA 5KTOA 1NQOA 1GRNA 2MWMA 1FNDA 1SG9A 2BFFA 4WCFA 4MDEA 4AJEA 2P11A 4U6NA 1XGKA 2VPYA 4MV3A 2C1EA 1DKUA 4G6ZA 1P80A 2I55A 2QJWA 3T12A 1JDBB 2YZ2A 5E9JA 1KAOA 1NMZA 3ZU5A 3ZWPA 3I5YA 5CT4A 4FEGA 2P8SA 4Q9KA 5AHRA 5GPBA 5A7FA 2XA2A 2IV7A 2VH5R 3I9LA 3ODGA 4BP9A 1PFVA 1XMXA 1UJ6A 3ZLVA 4HKTA 1V11B 1UBUS 3MWEA 2QU8A 4KPUA 4N0QA 1RQRA 1T8UA 3WNBA 2J9YB 1JH8A 2QN7A 2Y71A 3MS4A 3PR3A 1VBNA 3EXAA 1VG9B 4A8JC 3H18A 4IZHA 4J1TA 4FHEA 2A86A 3HB9A 4Q1AA 2OAP1 1Y1SA 5BW4A 4XYLA 2BFMA 3A9WA 3D8UA 4JJIA 1RWMA 2CDBA 5I4IA 1KI1A 5FNZA 3DXXA 3IAAA 2PE5A 2V6JA 3UQZA 3NLLA 5BMVA 1QHXA 3HU5A 1A4XA 3PEFA 3PI6A 1ZUWA 3GVXA 2VCEA 1DKPA 2GXSA 4G56A 3GBSA 1YS7A 4FP9A 4XPIA 2Q28A 2QRZA 3CW8X 1AJEA 4RIEA 4KBYA 3QPAA 1YB4A 3JQ6A 1L7PA 4HI0E 4NJMA 5JD6A 1ZMBA 1XQWA 1SVIA 2RGWA 1JEAA 3CHYA 4MUFA 1FMJA 2IZ7A 4OLJA 2H11A 4LQ4A 3BE8A 4KJXA 2H9IA 3BGDA 2P30A 1IUKA 3ILVA 2WF7A 3KOXA 2ZAIA 4HC4A 4G9BA 4C2UA 5TY0A 5AKYA 2OFOA 3HCWA 3LY9A 1S2IA 5G0VA 1H2FA 1OJLA 1BOOA 1QO0D 1TK9A 3BKWA 1WCIA 1BX3A 1N1GA 1TMOA 2OO3A 2QJRA 5LB4A 2UKDA 1JKFA 3JD0A 3HJHA 4RSMA 5KDDA 3PEEA 4R40A 3ADBA 2NX2A 3CY6A 2RKBA 3CN9A 5IDXA 3SS7X 3QYAA 4UM9B 4RVDA 1VA4A 3LP5A 3HSSA 3TH5A 4CTOA 2XGJA 1NG1A 4TRNA 4MDYA 3WDKA 2HUNA 4ITVA 3QKUA 3G5UA 3OOWA 1E20A 3LCCA 4PAWA 3KCQA 3TR0A 1UBGA 4G01B 3TOVA 3M6AA 4RH1A 1G66A 3E3MA 1C0PA 1PEAA 1SKAA 2REQA 2WHXA 3L1UA 1DARA 3DEFA 3VR5D 3USZA 3AFHA 3EXHB 3FKSD 2GWRA 1G8SA 3BWDD 4DBLC 3OP1A 2P4HX 4KXNA 1T34A 1G6HA 3BE4A 1Y8RA 3JYNA 2ZRDA 2JCBA 2BD0A 1N36B 4IF4A 4P84A 4H59A 2AG1A 1ZA1A 1RHRA 1SG6A 3P9ZA 4I46A 4H1WA 5LQAA 3AY3A 3RFXA 3JQ9C 4YCBA 4A6PA 1JQEA 3HCDA 5TJHA 3GNTA 2O2SA 1JQDA 2XSZD 3WLJA 2C1ZA 2WIBA 2EARA 4KOAA 3HFRA 4L8VA 1TUIA 5HKOA 4BNKA 2Y93A 4O2LA 3OC0A 3W0LB 3NOOA 5JQWA 3U0VA 1QJ4A 3HCAA 2JHGA 5J2UA 1DIOB 2VUSA 1U94A 2GRJA 4CL8A 3G02A 1I2AA 1BFUA 2O05A 1YS2X 1XZ8A 2WJYA 2B8EA 2R2AA 2CLIB 3E7PA 3KPWA 1IWOA 1VMKA 4K9RA 4BB9A 3ZVKA 1S3SA 2J0UB 2BMFA 2ILVA 3LM8A 3KWLA 4OHVA 4GXRA 1EPUA 1YAJA 1GQOA 5A71A 5BNIA 2I4TA 1QONA 3IIJA 5L4SA 5FQOA 3EDCA 3MGBA 5DTIA 3ZGXA 3DDWA 1UD4A 1XFAA 5EJ9A 2R1ZA 3GARA 2RK6A 5ICEA 1Q0LA 1XK6A 3EUWA 4JC5A 2HDNB 1REQB 1LQTA 1NMSA 2Z2KA 1Z6PA 4BNDA 5JJBA 4O0MA 4BVJA 4YAGA 1NURA 2PFGA 3DAPA 1SBHA 2GBCA 2B9VA 3C5HA 3E82A 4FZ5A 3H99A 4A1OA 5B1EA 2VHYA 4GE3A 3ER6A 2RD2A 5DOVA 3QEJA 1QOPB 3QU5A 1L7MA 3TQQA 2H5IA 3CX8A 3I1FA 4R71A 1GNTA 2Y27A 4Z6KA 5JS8A 5F4JA 4I7EA 1CUGA 1E94E 4RJTA 5IHXA 2AXNA 4D6XA 1Q12A 1RWVA 2W2KB 1OFGA 3AEYA 4IDHA 4EUSA 1OLOA 1KY4A 3GRKA 4O2BF 3LDFA 1L8XA 3U5ZB 2C8VA 1F06A 4W5JA 2RGCA 3M6WA 5AYVA 4BEVA 4BDTA 1HDIA 1I01A 1TD9A 3R4VA 4YEJA 4UXIA 4EARA 3V55A 2UYQA 3JWHA 2H4FA 5EMHA 1WZNA 3H5WA 5T6BA 1CVRA 1Q6YA 1K3TA 5E4TA 2D13A 1K73D 2Q3LA 2ZI9A 2C8JA 1ZU5A 2PXAA 2NUTB 5JAHA 1IWBB 4BEJA 2AKYA 2V4MA 5CTAA 5BN1A 5EMJA 2AWNA 1WVGA 1YVDA 2GUGA 3K1AA 3A58B 4RF4A 3QFCA 3S2IA 16PKA 1MZVA 2XUOA 4FYIA 1E1KA 4HQKA 4Z1MA 1T2EA 3A26A 2P3SA 3GJYA 2XXAB 2EHJA 4MZXA 1QP7A 3RV4A 4NWIA 4TRJA 1F0PA 5EL0A 2IH5A 2A5FA 1WU8A 4Y6QA 1DQYA 4EJFA 4B6RA 4EJMA 4K9KA 2DCUA 1A76A 4OQEA 1K4KA 4NZOA 5KC9A 2DSNA 3GG9A 1EB8A 4OAOA 4MK4A 3F7MA 3RB8A 3QOFA 2DPLA 3TIIA 3ZPXA 4YMTA 3E22B 2AFHE 2BKVA 3G85A 3O94A 1RI5A 2AHRA 2GFIA 2UZIR 2PMWB 1W25A 3D7RA 3IKLA 1L8OA 4L2IB 2DKFA 1ILEA 2VOJA 3KAJA 2J59A 3RPEA 2PKXA 1XKTA 2O8BA 4PGAA 2VSOA 2C4NA 2VRWA 2AFHA 3AF2A 3WXBA 1BTOA 2Q6IA 1EK0A 1C3LA 2Z8YM 2W6OA 1NHWA 5KYVA 2W00A 4Q5IA 3TEFA 1VQPB 3PTAA 5L3QA 5F98A 4V0LA 2ONJA 3MWDB 3W6OA 4YCCA 1M2NA 1P3DA 3LBNA 1M6EX 5J58A 4WXPA 3TIFA 1MW9X 2YV4A 4E08A 3CVVA 3PPXA 2PT5A 4Y8VA 3V4LA 2IH4A 2ZXFA 3KXKA 2NVWA 4ZVMA 1IUOA 4YXFA 2Y1FA 3WLRA 5C7YA 2QGZA 1IM2A 2JLVA 5LMCA 4RUKA 1M2OB 3GJ4A 2ID4A 3ER9A 1GTL1 5E1OA 3CPEA 4DB4A 1Y9EA 4LDZA 3KM0A 4R9VA 4CLOB 4ID9A 1KQ3A 1Q7CA 1KFEB 1W59A 1CF9A 5KVCA 3MJDA 4N5NA 2R6DA 4HF7A 3IDSA 1Z34A 1CBUA 4MVJD 1A8SA 4PQEA 4S0XA 3UAYA 4BLUA 1XUOA 3OJEA 3FD8A 3B7WA 4PYLA 4GQNA 4MWOA 1JTFA 1MRSA 1U8UA 2EJWA 5EOVA 3ZHRA 3BHIA 4Z4QA 1ID1A 3AKZA 2EJBA 1EP3B 2HBQA 4Q37A 2VZ9A 3BA1A 4TWZA 3IP3A 2YUIA 1K89A 1PD0A 1J0BA 1DIRA 2VJKA 3KQSA 3LUAA 2WZCA 2CK3A 5JRDS 5AJWA 1K9VF 4KUHA 5ALNA 1MHPA 4RA6A 4ZC1A 5K6AA 3IQFA 5HOEA 3WGZA 1PJZA 1N0UA 3INGA 4MV0A 2EG9A 1TJ4A 1Z5GA 3E3AA 2BGJA 2O50A 5TQJA 1PTJA 1H6DA 2R1VA 2YOHA 1XZMA 4JGGA 2HCBA 4UFNA 2WG0A 1S3GA 4UJ5A 2CD7A 3UJCA 5CYPA 5DNYB 3UGTA 4F93B 1SQFA 3EWIA 1T5HX 3ZV5A 5EJGA 2AIRA 1KZHA 4AKTA 3L0ZA 3QBVA 4P54A 5F1PA 1KK0A 3JQFA 2GZMA 3U6BA 4IJQA 3BOSA 3WWCA 3JVVA 3G2NA 3L1VA 1Q0UA 4LOKA 3K4QA 4ENVA 3STTA 2G76A 5L3SA 2B3TA 2J5BA 5AHWA 4V38A 1QH1B 2H31A 4YJFA 3U9LA 2YY6A 5IYWA 4MPTA 3ZGNA 1AK2A 1CZUA 2IY9A 1BXZA 3EGWA 2JCYA 3MOIA 5COBA 2CCGA 1YL7A 1U5BB 5H1YA 4PS1A 5LDGA 3BH7A 1RCFA 3HUFA 5G0SA 4DLZA 5I7WA 2OCDA 2N3ZA 2AQ8A 2YFQA 3R77A 4Z0PA 1OKKA 3PUXA 1PJ5A 3L7JA 4UHHA 1Z36A 2BHNA 2GLUA 2J4FA 3I9KA 3K9WA 1A9RA 4C4TA 5H81A 5F73A 2GT1A 4FDMA 3V7UA 1LFAA 2OVBA 4JVOA 3FGZA 2UUAB 4P31A 1KGDA 4XN3A 4WLOA 2AX4A 3ZE2B 3UJHA 4KKUA 4BNLA 1Y1RA 1T6BY 5LBTA 1BX1A 4OA8A 4KQFA 1A8IA 3I76A 5H5JA 5DASA 3NXSA 2NQTA 3WP0A 1IZYA 2Q2NA 3HAGA 3D4LA 4D44A 1Z75A 3DHWC 3KWMA 4QASA 3T1YB 1J9GA 3LP6A 1MUUA 1WO8A 4MW9A 5M34A 1CY4A 4XSGA 1RBZA 1HR0B 4OG2A 3VU8A 1PNQA 1KQFA 2W8BB 1PK7A 1OXUA 3TKAA 4YUZA 2EFJA 3QNMA 4QQFA 3EGIA 1HPLA 2J6CA 4B4OA 3TTXA 1DAOA 1V43A 4ZIRB 4KWIA 5K0SA 3VR6D 4KH0A 3AHDA 4HFMA 1TEHA 4Y6GB 5EKUA 5CVVA 3ZDBA 3INTA 4L9SA 5DYNA 1PO7A 1V1RA 2FN9A 3PT5A 4BVFA 3TZEA 1XALA 4CCYB 4X1YA 5LQUA 1L1QA 4CM1A 3WZ2A 2ZJ6A 5DI9A 4ROXA 1RJ9B 4XJTA 4QC2A 3VPFA 4AX8A 1G41A 3ITKA 3UENA 5JU6A 4PAOA 1TC1A 1JB1A 2R2GA 3P2IA 3TQRA 4J94A 5CH8A 3CLUC 3LLVA 3DOEA 1GZSA 2RG1A 2YWJA 3IRUA 5CMLA 4RDJA 2GBIA 2M98A 4S1TA 2VPZA 2PANA 1WTHD 3L05A 1XTPA 1CY1A 3L92A 1MN6A 1U8ZA 2R6JA 3DEAA 3KXLA 2F9LA 4IIBA 3DB2A 4F5YA 2AZDA 5CVCA 1OHHA 1NF8A 4WUVA 4QBKA 4ZYTA 2ZDGA 2N0SA 4MWCA 1XHLA 3TGWA 1VCNA 3CRNA 3DLCA 4G2TA 2QTAA 5HF9A 5CIYA 3EEYA 1PG5A 5AUQA 3WYDA 4Z53A 1YC5A 4XM0A 4F9TA 5AIBA 3OFKA 3QEOA 4CEHB 4Z1OA 2EFEB 4TV9A 2GCGA 2AMFA 4LVUA 1MC8A 3MW8A 4WKPA 3T4PA 3NYWA 2VNKA 1CUVA 3SICE 4D43A 3OEHD 1NM5A 3PA1A 3K9GA 1ENOA 1MPTA 1FDRA 1NUAA 1Q0HA 3OO1A 4NENA 4WOPA 2XQJA 5U4QA 3UWPA 3O1LA 3IUBA 3T3HA 4BGIA 2IBTA 3MQ4A 1KMCA 3T5GA 1GLVA 1ORDA 1R00A 4FT4A 1Q91A 3LUHA 2YYSA 5M7EA 1B6RA 5JSQA 1Y4UA 2YASA 4QYXA 2WUEA 5IKPA 5K0CA 2J7PD 2E6UX 2DERA 1VECA 4AJPA 1A7KA 5K9ZA 2HQRA 5I3ZA 3ERCA 4Y30A 4MWTA 1AKTA 4RVFA 3UXMA 2ZRMA 2H4JA 1F1JA 1ODSA 4HE5A 2YICA 3L0IB 1Y6RA 3L4SO 5HG0A 4TXMA 3CKYA 1VPEA 1ACLA 2PZLA 1F8FA 2IEZA 4LY3A 1P18A 1N9ZA 3A3PA 3ROGA 1GSHA 1Y81A 1ORIA 1QIKA 1SVSA 3E7FA 4IKEA 4MICA 1H0RA 3A31A 2YCLA 3LUFA 4OK5A 4PNPA 4W99A 3X2FA 4N7BA 3T52A 3ZLUA 4H0NA 2J6BA 4GPIB 1FYEA 3M3DA 1DQZA 2Y1LA 3JALA 3V4SA 1HYEA 3GDWA 2VDJA 4WA8A 4F1KA 3P20A 4FSHA 3ORYA 3AR4A 1Y0RA 3UAXA 4FMDB 5AW0A 3ZCXA 3ICVA 1W35A 5J1TB 1EGVB 4U1RA 3IIEA 2VJBA 5EJAA 4BNZA 3F2VA 1GG9A 4NPCA 2ODNA 4QGGA 5MN4A 2B98A 2ZU6A 2H1CA 3C3KA 3LX6A 4KXLA 4LRSB 4RZQA 4GECA 4TOIA 5TQ2B 4ZGBA 1UBNA 1OT5A 2F3TA 2ZAMA 1F6WA 5JNTA 3M5CA 1GUYA 3VR2D 3MAAC 1VDZA 1UD3A 5DHRA 4YCMA 4XGIA 4PSAA 4EB6B 3VZDA 2JGNA 1YRYE 3RVPA 3EFBA 2AUNA 3M5WA 1WOYA 3A6KA 3HCPA 4A6DA 1HZJA 2VAMA 2R8OA 5BSHA 1NVUQ 1S0UA 2NU7B 3ZNNA 1K68A 2FR1A 3R7AA 1T4BA 4LOHA 4JHLA 4XQ9A 1QE3A 1LA2A 3FSGD 3EIQA 3ZDYB 1TAQA 4P7FA 5TEVA 2DY1A 4JSTA 1FS5A 2CVQA 1B8VA 2KE5A 3LUCA 3NHBA 2QSJA 4WY2A 4X60A 5EE1A 1BQ4A 3JARB 3WZLA 1QGUB 4YUAA 4W9MC 4R1OA 3DL4A 3FFAA 1XRRA 4H60A 3WYAA 1P2BA 1GA6A 1JHXA 2V9ZA 2PZAA 1E7QA 3VH3A 5IUJC 1IBCA 4IIXA 4NQZA 1SZDA 2O5VA 4F6CA 4IOLA 1DRKA 2OEPA 3DXYA 3GZJA 2JRCA 3LQEA 4RQTA 1N7HA 1OWMA 5D5PA 1LKZA 2QRPA 4PBTA 4TPKA 4B3HA 3UJ8A 3HCCA 3IKMB 3JAWA 1I5OA 2LKDA 4F92B 5AR1A 3AETA 4Z2AA 4XLAA 3TXYA 4YJ2A 4TRRA 1UPXA 1YCGA 2JI4A 4BWVA 4R2XA 4CU5A 2XKKA 1NB9A 2QUIA 3B1XA 1GRQA 1W9XA 2EBUA 3IMCA 4LFCB 3VTAA 1PLJA 3S0JA 1JLLB 3DHYA 2R4QA 5TS2A 2FJ0A 4BMDA 2G04A 1RLOA 3Q9SA 1NQAO 3HUDA 1CR1A 1E58A 2BFDB 4TLEA 2G80A 2ZTVA 4ZU1X 4OP7A 2ID9A 2XGOA 1UKBA 1RQNA 4QJ4A 4RSGA 1N3IA 3AUJB 4E22A 1EGAA 2WG1A 4ACAA 3CRQA 2PQMA 3OMWA 5H80A 1E5LA 1YDFA 5DH9A 3LXRA 4MV5A 4ZOBA 4BNJA 1C9NA 1DP4A 2V7PA 4QDXA 5HVNA 3ZQUA 4NKRA 3UG7A 1IDN1 1H85A 1GYRA 3ZWMA 1EXMA 1TXGA 3NALA 4NNPA 1KE2A 5CXQA 1KIFA 1LVHA 3NFYA 4NK5A 4FFBB 1Q83A 1BS1A 3OQJA 4ODIA 1ZOLA 5D3QA 5FWAA 3S7ZA 4NNJA 4EYOA 2I78A 3LQ4A 4INJA 5D1HA 3PUJA 3OU2A 4G26A 4BAGA 1QV9A 2VNSA 4DJDC 1ULBA 3CTMA 4OCZA 4GZ3A 3D1VA 2HC9A 4OK3A 5G1PA 2CRVA 3H87A 1S9DA 1HE2A 3Q1KA 1P1JA 1QWOA 1D0SA 1DTWA 2QNIA 4RYLA 3I73A 1Q7TA 1KJZA 1SCJA 2F43A 4PSVA 2CF4A 3P2YA 4E5MA 5I7OA 4K6KA 5KYGA 1ZAYA 1EH5A 5LXTA 1EK1A 1NR1A 1NJ8A 1V96A 2VRCD 2YXLA 3HUUA 3KEGA 3MJVA 4HDNB 4M3NA 3VOSA 5CUQA 5ELMA 3P2EA 1P62B 3O7MA 5LFAA 1E4YA 1RS0A 5GP1A 1TJ3A 2R7KA 1QIDA 1Y0BA 3BUSA 5CD9A 3KZKA 2VNAA 5HEKA 1RPAA 2DPYA 2JFHA 2VL7A 3AVWA 4TS1A 4Y6SA 4CT5A 4MW0A 1QLWA 4CL3A 1D3AA 1IXSB 1KSJA 1SIWA 2E48A 3IYLW 1JGTA 1Q7RA 3OY7A 4QECA 3SSOA 2VPPA 1PJ3A 4PPNA 4I8IA 5JZSA 1WU7A 4JLJA 2GHTA 1LPMA 2FZ5A 2OHJA 3UCXA 5A05A 5JUWA 4LJ7A 3PDWA 1QQ5A 5DTJA 3W3AH 2HUPA 4C14A 4GGOA 1VHOA 4P6VF 1BU5A 1H5NA 3FWYA 1IUPA 1JTEA 3H5AA 2FX3A 2Y0EA 1KI3A 3QV2A 2CHFA 3X0DA 3P0FA 2IFTA 4WVLA 3TD6A 1OTXA 1YB5A 4ZOLA 3WRWA 1V9LA 2PRZA 2XUQA 3I9MA 1L5NA 1E2JA 5AK6A 2X86A 5DTEA 2PKCA 1K6EA 3IP9A 2FFJA 3RKRA 3Q2OA 3U4DA 1U7WA 4CKYA 4ER5A 2WYVA 3NE5B 3OT4A 1RE1A 3IAEA 1IEVA 1RLTA 3RNLA 3LWBA 1O6CA 2HJRA 2LIPA 3GA0A 3BRWD 4PGGA 3SHOA 3STVA 5I7SA 4D98A 5K4HA 4JT4A 4H27A 2XMBA 5REQB 3T61A 4BVLA 1KKLA 3D3JA 2FQ1A 3J7TA 2PL3A 4BVBA 4ZCLA 4KUEA 3RU2A 2F17A 1LK5A 4P1VA 1JDVA 1C1YA 5KTRA 4MVJI 1KH1A 2G06A 3JASA 3W5AA 2YYZA 3ZWKA 1HKUA 1YJ5A 2W4IA 4XVCA 1QAMA 1WKCA 2A5YB 2RCNA 1XXLA 3CZRA 3DFZA 4CMEA 4TYPA 1E69A 3OQBA 1MCZA 5EWMB 5HXBA 4QNRA 3TW8A 4CU2A 4DAEA 1BE0A 5JCXA 2C1XA 5ALFA 2BYTA 3PL1A 3MT8A 1HYGA 3AUTA 2QE6A 3SQLA 1IXRC 2H6EA 3JQBC 1FFHA 3ABIA 5G3YA 3ADKA 5T8KC 8GPBA 5HIKA 4HDAA 4MO2A 3BGIA 1NOIA 4JWKA 2KW5A 5IAGA 4ZCMA 1QHFA 1YGYA 2ZJBA 2ZE5A 3DZJA 4IX1A 3HCBA 5EIFA 4KNWA 4N03A 3EGDA 3L7MA 3WB1A 1X7XA 3NWJA 1S3IA 4ETWA 4ZGNB 3GEDA 1XVUA 2X3UA 1NY5A 1XYGA 1U2SA 1YBVA 2RSLA 3B2QA 3PF9A 1X42A 4MLCA 5IARA 2R6R1 2ZIWB 5AVRA 1PK9A 3UJ9A 4NV1A 2Z5LA 1IC6A 5HJEA 2PLRA 3TMAA 1XMIA 1XN1A 1CUYA 2G70A 2BTQB 2V65A 2XKJE 2HXGA 3B8HA 4I99A 3AV0B 4NESA 2KBFA 2DWUA 4CGYA 2C9OA 1VC2A 3UAOA 5E9WA 1FYDA 1BDHA 1R0YA 4RV4A 1GA4A 4MV9A 4CFYA 4URUR 3T51B 4KB5A 1QDUA 4KCGA 4Y1RA 5JBIA 1BFDA 2AG5A 3QKTA 1C8KA 1KHHA 2HPVA 1NW9B 2PIDA 3EULA 3L8ZA 4ZAGA 1CY7A 4P35A 5A6SB 4ESVA 1UEIA 5FWNA 4P7BA 1NVDA 1MB4A 3BRQA 1Z8DA 1DCMA 2Y4OA 3JXEA 4UMEA 1O94C 2OY0A 4A15A 1Y1TA 1W5BA 1GU0A 1JQAA 1UKYA 1G4AE 2OFXA 2Z4RA 4G4SO 4HO1X 1A9SA 2B8TA 3IQEA 5LC1A 3F6CA 3AGQA 4F38A 1W36B 2FFHA 2ZITA 3PDUA 4ALJA 2WWIA 4TKVB 3WBKA 2IU6A 3VTZA 1I94B 1KWGA 1QANA 2AQIA 2IDKA 5FJIA 1N32B 3FNHA 2ZPTX 2C57A 3I53A 3BZWA 3WGOA 3AF6A 4RVCA 3U80A 5JEDA 3H2BA 2I2WA 4WOJA 3I56B 2OBBA 1XYVA 2C07A 2QZZA 2ZJYA 1WQ3A 1T0IA 3MTDA 2L69A 2O07A 1ZOPA 1MNAA 2OLKA 2VJQA 3UV3A 2YY7A 1VJ5A 2ZKIA 3MIZA 4OHCA 3T1QA 4OUDA 3X44A 4QG3A 1ODCA 5JATA 4EOGA 2IYLD 2PGIA 3PUWA 2FEKA 2IC5A 5KW9A 1P2SA 4XLCA 4JY7A 3E2MA 1JLRA 5HE9A 1NUPA 3EXG2 4FFLA 2WYRA 1HK7A 1KO4A 2MCFA 5LOVB 1PGPA 1PS0A 2J45A 2HQ1A 5I7UA 2ZBQA 4LXHA 4EHJA 1A1SA 5E38A 2P27A 3EUFA 1V4NA 3HJBA 1XTRA 1YDWA 1VMDA 5CW2A 3VSCA 5B7PA 1DZIA 3HGTA 3I2HA 3MM4A 4S1OA 4BU0A 4KNYA 4MS4B 3WGLA 4HDMA 4LSMA 3K9CA 4YMGA 2QD4A 1O6FA 2FPLA 3ZNQA 3ZWVA 1YZQA 3IT2A 5TC4A 4ND7A 2D2XA 4PHFA 1WR8A 3CUSA 2X4GA 3SNKA 2QRVA 3VR3A 4Q9IA 4JI0B 5KSZA 4Z4CA 2ZSBA 3KOWA 2JGAA 3HA5A 3NV9A 1G0OA 4UHJA 1QQBA 4ASUD 4FC7A 4C7VA 4QIHA 4FBMA 3P0RA 4DBZA 2UVPA 5IJZA 1OQAA 4XLFA 3TZBA 4EB0A 3CC4B 4LE1A 1Z4MA 4BZQA 2CZQA 1UWKA 4ITUA 1N2HA 4B4KA 1YCFA 3ESXA 3R44A 4QYIA 1ZI8A 3DOJA 3PQCA 4PZZA 3OCVA 4B4VA 1RXSA 4BX3A 4ZYZA 4KRXA 5IN4A 2PMEA 5H83A 3C14C 1EJ2A 4IV0A 1P1FA 1VLVA 2X6YA 1E2UA 2QI9C 5KNBD 3QKSB 4OB6A 4QATA 3W06A 2V9CA 2PAFA 2C0PA 4DS3A 2X0DA 3TS1A 4HNQA 1E3EA 5JASA 1JQKA 3BEOA 1ZUIA 2GK7A 2MYPA 2YX1A 4M46A 3CVXA 1ACMA 1SXJE 1I4OA 1MV5A 4BTLA 2G0TA 5FPKA 4EPVA 4OKSA 1L4KA 2V03A 4EKNB 3NPMA 4HGPA 3VHLB 1FFXB 3LHKA 3NBMA 4KQEA 3ROMA 4FPXA 2FMXA 2Z6QA 3FLEA 2QQ0A 2VT3A 4QODA 3OIDA 2XB9A 2XJ9A 2HD4A 4P25A 1XCOA 2FZLA 3SZ3A 2I7VA 4OHUA 1I6MA 3CKMA 5NULA 3FNEA 4B7ZA 4K6OA 2ATCA 4DIMA 3H9EO 3ONEA 1FP1D 1XWFA 3CF4G 3U56A 1VP9A 4D8WA 4EY5A 2G7MC 3AOEA 1PU2A 2RGEA 4TM7A 1P45A 1UDXA 2PSEA 1N75A 2OBMA 4IQFA 2BGNA 4XKJA 5FFNA 2EZ4A 2O7SA 3L1KA 5K3BA 3QVLA 3EAQA 1XEXA 2CMGA 2H2GA 4I1UA 4X84A 2BGKA 3EH1A 4TWJA 3R8CA 1V16B 1ZD4A 4FFDA 1K27A 2Q4BA 3B9PA 4NE7A 4ZEVA 3W5CA 2GM4A 4ARIA 2W2OA 4IVPA 3AMVA 2D4HA 1PIWA 3ZV4A 1FXSA 4NAUA 1GARA 2P9TA 1CK4A 1QIFA 1C50A 3THRA 5HJ7A 3BGSA 1BMFA 1U9IC 4N5HX 4RZSA 3HXTA 5FWXA 4LOJA 1D2HA 3DZDA 1SUFA 4HK4A 1PG2A 2D7DA 5H59A 2PCJA 4Y2UA 1QO7A 4Q4LA 4W1QA 3S29A 2ZUDA 3TGLA 1G5TA 3AL2A 5E6UB 1Z5VA 4G41A 4MV1A 3E27A 3VU1A 1I5EA 1IN6A 1BFKA 3ZHCA 3HYLA 1O8CA 4XLEA 4XM3A 5AI4A 1BCSB 1ZITA 3RYTC 4B7UA 2CUKA 3ACDA 3SC6A 3BL5A 1GA1A 4K9OA 1NFRA 3E5RA 3N58A 4D74A 1NXOA 4PO8A 1SVNA 1W6UA 2AOXA 5CT5A 2JFUA 3CPJB 4HEQA 2NVUA 3WGJA 4F91B 3I5MA 4WCFC 3SXUB 3SIWA 4YT5A 1OYOA 2JH3A 2VWPA 1RW4A 3QX7A 5LP6C 1FDSA 2NT4A 3E8XA 3HUTA 3OZTA 4KQ9A 4TSKA 1VKJA 5FAXA 3F5FA 2O5RA 3JYLA 1O77A 3UMMA 3ZBQA 2PJZA 2BWJA 3FPKA 3AEQB 3HZRA 5HJ2A 5IBRA 1FU4A 3HJUA 4O8CA 4XGQA 5D3ZA 4Q3LA 1Z39A 2JAQA 2YHAA 3VVBA 1WUKS 3LKBA 5G0UA 4ZCRA 5EZYA 2QZ4A 4TSFD 4NS4A 4MX8A 3GRRA 1TKBA 2O0JA 3U5TA 3GVKA 5ALGA 4ZV9A 2I6QA 5B1HA 2CXUA 2FXVA 8ATCA 4K1XA 5KOJB 5CFRA 3DPIA 4MI3A 5IHPA 5KMGA 5K8TA 1JFRA 1UWCA 2XDAA 3EGEA 1ITZA 3F1LA 1A4IA 2ZREA 4GKBA 4IIGA 4Y1FA 2YWEA 4A8JB 5CDSA 3S1AA 4QUKA 4OGWA 4ZHQA 1TMKA 1VSBA 2D0DA 3BIOA 1X7GA 1BVUA 4FWBA 4JLSA 4YUXA 1B2RA 3JQ8A 3QNUA 3KTAB 1TYZA 2D2VA 3BD6A 2RC6A 3LSTA 2H0QA 1YONA 1K7EB 2EQBA 1Q74A 4RHTA 1FP4A 3IP7A 3ZH9B 1HORA 4E2YA 3D02A 3MBIA 3OLYA 1D0VA 5D5QA 2IS4A 1O95A 5CBPA 3NIGB 1XVTA 5EJEA 3S28A 3VYWA 3VRHA 3GLIB 3O5AA 5GAJA 3IOBA 5G41A 8MHTA 3WGUA 1ZCFA 4GXNA 1YDHA 1B42A 3P4YA 2DFKB 3KYIB 2V7QA 2ERYA 1SQ0A 2GHIA 4WTOA 1L1FA 3WHPA 1AGRA 4WNIA 2ZAYA 2WM2A 3FVRA 4MS3A 1DADA 1GL6A 1Z8NA 3DZFA 5EG5A 2PZMA 2G1JA 2GVDC 2XTZA 4JLAA 4Q34A 5EHIA 2WHRA 4W5QA 3GEBA 2M6KA 3LY7A 2VDNB 4XWGA 2AOTB 3W9UA 4C01A 1D2NA 3NDIA 2VK8A 1Z15A 1S7CA 1I51A 2HF9A 2JI8A 1RHJA 2WP0A 3OM1A 5AW3A 3KR2A 5IT4A 4CKWB 2V74B 4WASA 1VQ8B 3DO6A 3ENKA 2IHJA 4KXQA 5NLLA 3CWCA 1CEXA 3VKWA 1G8HA 3RWMB 1T0JB 3UJAA 4DBVO 1E63A 2REXB 4BQOA 4DY4A 4YRMA 5K1ZA 3Q7TA 3ZNOA 1C5KA 4IHQA 4YLEA 2HA6A 3KOOA 3EBPA 1TCBA 3PFKA 4OSPA 1PSDA 4XQFA 5AJZA 2OV2A 1IYZA 1YJWB 2PEZA 4PX3A 3R76A 2BV3A 4J90A 1YKGA 2A0UA 2GEVA 5KVVA 3LX8A 3HU3A 3LF1A 4TX1A 1JNXX 3GFTA 3UTDA 2CJWB 4CM4B 5KQMA 5AK4A 3NIFB 2X2PA 3KQMA 3K9HA 3N2KA 5KJCA 3Q6RA 1H4SA 2FOIA 3CXRA 5CPFA 5PGMA 3C4JA 1H0SA 4JASB 2PD4A 5CNMA 3MWGA 1PUIA 1X6VA 4URXR 1FFYA 1SC6A 3BDVA 1UQTA 3O3CA 4IH9A 4XZ3A 3V6LA 2RHRA 4EW1A 2YZKA 3PBKA 1AT1A 5DLEA 2XJ4A 2C2YA 1KEZA 2EZTA 4UHKA 2RK4A 3HNPA 3DE2X 3GAFA 1BQ3A 5D87A 4EIWA 1JTVA 3GVJA 3WSTA 2DTDA 4YRIA 2Y1KA 3K9FC 3B20A 3H2KA 2GEKA 3S70A 5ARDA 3WGTA 2BEKA 2GWHA 4JCCA 2DPHA 3QY9A 4ISCA 4LZWA 3EDMA 4AJ2A 4BCCA 2J5KA 4DG5A 3E1GA 3EYAA 5DXJA 2C4KA 3MYYA 1ZRNA 3G23A 4FK8A 3CP8A 3MLAA 4UUPA 1ONPA 3NTQA 1CCWA 1OZFA 3F4BA 5CH5A 4JR0A 4ZMRA 4N3BA 4B17A 1E92A 2Z6VA 3L7LA 4TMZA 3OKFA 2ZL5A 1VMIA 4MQFB 3V3TA 1W4CA 1OFUA 4S05A 3K96A 2I8CA 3RT7A 1V3QE 1L9XA 4K26A 5K5EA 1S3FA 2AUMA 3JQRA 3PCTA 2V6GA 6REQA 2PGXA 3C85A 2G5PA 2JI7A 3BG5A 4FT2A 4L0QA 4MGHA 5AJXA 3OAAA 2E9SA 1F4PA 2MYNA 1GUFA 2BI4A 2E4AA 3KALA 3C3BA 3LQQA 3WGGA 1MJFA 2JH8A 4CUZA 4AMBA 4QXRA 3VA7A 3WWDA 4BNYA 3JAKB 1PWYE 4G4GA 4CG0A 1L5ZA 4XH9B 2PUVA 2XMPA 4O4HA 1LC0A 5L45A 3SEQA 1JBQA 2DECA 2LXNA 2XXBA 2QP4A 2Z4SA 3E58A 4V0NA 4WEOA 1GPWB 4HQRA 4PINA 1X1EA 4GQBA 4RVSA 1L8AA 3CX6A 3ZY3A 3GGGA 1NBMA 4R8RA 3B3FA 2LCIA 1P33A 3TD9A 2PNJA 2B30A 1PJCA 1IG0A 4LPSA 4G63A 1O97D 4W9NA 1NP3A 4BKOA 1D5CA 3OQMA 3CCLB 2CL0X 4GP6A 4MRAA 4OXIA 1LDEA 1X7ZA 4KE8A 3EIHA 4Q3CA 5IJXA 4AL4A 4IFBA 4EYGA 1Z62A 2QGNA 2XI4A 1JA0A 2ODBA 4RPBA 2VYVA 3PDIA 3C8UA 4J0DA 4QQNA 1DDIA 1G9TA 2BZSA 2FY8A 1QGZA 2X0JA 2AC4A 3G1TA 5EZQA 3FPJA 5LPNA 1NBIA 2GTHA 4LQLA 3D5QA 4E5DA 2ZM6B 1SWWA 1WM1A 2J4CA 3U49A 1YZVA 3WGHA 4QHTA 2XZPA 1M1NA 4WV3A 4EA6A 1VXRA 1VQ7B 2P0AA 3HJFA 1TT7A 1KMIY 1ZMTA 3C48A 1JDSA 1X86B 1LV7A 3RS4A 3TUIC 1I8TA 1FXUA 4FGKA 4MW7A 1XJWA 3TTYA 4AZSA 3P9YA 4R2WA 5EIWA 1EVZA 3HKDA 2WJ4A 3GMSA 3WRXA 3MGKA 3NYIA 2VA8A 1EUCA 2WFZA 2BFBB 1CY8A 3ROFA 5TMEA 4ESEA 4WSOA 4R5MA 1Z18A 1OX5A 4XOPA 1Y34E 1IU9A 1W47A 2APJA 4G1FA 2ZK7A 1MU0A 1V71A 4HDKA 4XQCA 4E4TA 2O3RA 3KAKA 1HC7A 1B00A 2K5UA 3B5EA 3RSLA 4LOLA 4GEKA 3TBHA 5C2JB 1B74A 3FUVA 4R1NA 4AY3A 3ZIDA 1ONNA 4MVXA 2IYAA 4G5YA 3RLIA 3C5CA 4CR8A 4NY1A 2NNLD 1YMQA 2FMFA 4PPYA 4Q7LA 2WF8A 1RZVA 5DLDA 5IYPA 4NBVA 3EZ2A 2FFBA 3Q98A 3UAVA 3W6ZA 3NX4A 3DL2A 4ID3A 4N7MA 1IY1A 1PR3A 2WRZA 3VC1A 4LTNA 4LA4A 2YRWA 2Y0BA 3DVAA 1JX6A 2O2HA 1R4NA 1V6CA 3GLQA 3IVAA 4NOMA 5FPQA 5J4HA 4HH3C 4US2R 1C7EA 2Z1NA 4HZUA 2QPTA 2AN5A 2G77B 3N1UA 4CYMA 1YIOA 1IHOA 2ZXEA 3HCOA 4DIDA 3OEWA 2QUHA 4FOOA 4D42A 3KJXA 3L1HA 2C31A 2WQ6A 1UBSB 4C1BA 5IH3A 5ALYA 4EI9A 3Q2KA 3ELYA 1C1DB 3ZW9A 3FWKA 2WJHA 1PLLA 3V4PB 2QA4B 2XUJA 3A04A 1IOWA 4IV8A 3OLXA 2FTKE 1NONA 1GN9A 4EB3A 4DTCA 2Q29A 3DDOA 2QQFA 2ET6A 4HEA1 4QPJC 1CUBA 4XR9A 1AGNA 1Q6ZA 2Q3FA 2XBMA 3ZHXA 1LLUA 3PD7A 1U2EA 4HQLA 4P32A 5JG7A 1Z73A 2ZWOA 1DAMA 4RXTA 4R6XA 3T34A 3UMSA 4OJYA 2GEBA 4ZI7A 3KJQA 2XB2A 3PU6A 2AJTA 4XIGS 2EXXA 4F71A 1GGJA 4LZLA 2PYZA 1TAUA 3HBFA 1UFRA 4JB0A 2QLLA 1B0AA 3WIUA 2FDXA 3IA2A 4I3HA 4A26A 3ZD7A 2LUOA 2NSJA 4MYCA 1K1EA 4QL3A 1MDFA 5KKAA 1TUBA 2RHOA 1U0RA 2F7SA 1TE2A 4ER0A 5JR3A 1KP3A 1X0VA 4I8XA 1GG8A 1LU9A 2TECE 1XCLA 4N01A 3SR0A 3AEKB 5IYZB 1OXXK 1SVLA 3SSAA 3L9WA 1TZ2A 4LXGA 1V5WA 4EGSA 1AN9A 2FG5A 1UT6A 2MYTA 4J4HA 2YNMA 3MCAA 1E1RD 1MFZA 4R8LA 4X95A 2B4QA 3IT3A 1GPBA 3FUWA 4QLOA 5H4GA 2QTGA 3PIIA 1ZK2A 1UBMS 2QRGA 4DREA 5GJBA 1D2RA 2VDWB 2UVDA 3JWPA 2IUFA 3EJ6A 3MERA 1ODKA 3QEMA 1FA9A 4MLPA 4ZEXA 5CFOA 1DG3A 4RV5A 5ICFA 1E4EA 3U6KA 4FCWA 4WLVA 2BJWA 3NNDA 4ALNA 1T3HA 4Y9RA 1ZWKA 2JKVA 2J5QA 3R7WB 1IHYA 1L5OA 1BXRB 2XUFA 4M0FA 3RR2A 2WHPB 2BBOA 4W7HA 5FUXA 4C4ZA 5JCOC 2HA3A 3NNSA 4Y98A 2XUAA 1M2KA 3C6QA 2I5PO 4WK2B 2Y0CA 1LF5A 1BDJA 1BCRB 1Z0IA 3OTHA 3PCXA 4H1UA 2BIFA 1Z88A 1GU1A 1TM3E 2H2WA 2W5UA 3A6DA 1QH8A 2BFNA 3WMXA 2EBWA 1UFOA 4UTVA 1S2MA 3AESA 4N6GA 1V45E 2NMVA 3E35A 4JVSB 2WJ3A 3UA3A 4EEZA 5JCZA 1EINA 2FDCA 5DBFA 4FZ3A 2BMDA 2ZR9A 3JYQA 3WR5A 4CQLA 1MHTA 3FR8A 4I08A 3FFTA 1E2MA 3I6IA 1B3BA 4R31A 2WE8A 3IEXA 5TQVA 1P9LA 1JIXA 4HTFA 5EIXA 1Y1QA 2RGYA 4JLBA 4RHCA 3DAOA 2ZSDA 3FR7A 2EDAA 2QRJA 3TNYA 4AO8A 4E13A 2FKAA 2QT0A 5F5XA 4OA5A 4G25A 3F3MA 4RE6A 2C9BA 3RUFA 5KTYA 4MRMA 2HV9A 4J7AA 5I9LA 3GJ3A 3O73A 3T99A 3M5DA 1ECGA 4PAGA 1NVMB 4NZYA 4QGBA 4EI7A 1NI5A 2OK7A 1GM5A 5DNUA 1R6VA 1K8RA 1Z6AA 4NBWA 1WMEA 4YWJA 1AS2A 1EWTA 1Y9AA 3IDQA 3I9V6 1M10A 1YR9A 1JV2B 3HGQA 1V9SA 1TGYA 1T1EA 1HF3A 2HLNA 2P5SA 3LIIA 3C7DB 1E2IA 1NE2A 2O2IA 1ZUD1 1KTVA 3AJ9A 4IFIA 4NOLA 4QOFA 5AJHA 1TYEB 5EIBD 1HMYA 5LL6P 2R86A 4JKOA 4U8GA 3SGLA 4EMBA 2BBTA 2WUGA 3U37A 2PVSA 5HPYB 5J43A 1AMOA 1P4HA 1BRMA 1E1CB 1NXQA 1TA0A 2FLWA 2VDQB 1WB5A 2VH1A 2ZRFA 1SD2A 3GXOA 3H65A 3AP2A 3H17A 2QS9A 4RPIA 4FD3A 1R0ZA 1U0TA 4KQXA 4DDWA 3H8WA 2CDCA 1ZC4A 4JJAA 1I0LA 1VPDA 4C4XA 5ENDA 1Z2NX 1PG0A 4RYDA 5DCYA 4HIZA 4ZXFA 2XMCA 3OJLA 1XMOB 1USIA 3D8TA 3G59A 4C7MA 3CPHA 2D3TA 3WHLA 1TTQB 4UDNA 2F8TA 3H94A 2GN2A 2PZEA 3I4FA 1KRXA 4FMBB 1GQQA 1W581 4N0MA 5CDHA 1CETA 2P79A 3HXOA 4BU1A 1AZSC 3GMIA 1FY2A 4HNSA 4UTNA 3NIDB 5A06A 1Q7BA 2X6TA 3AEZA 4OBBA 4FDLA 1PWZA 3EGCA 4KO4S 4E88A 2H29A 1QGDA 2X4LA 3G9QA 3KSZO 3V1UA 1SU8A 1YQUA 2YMQA 3GHHA 3WOHA 4Z4VA 1QS0B 2GXQA 3C8DA 1JZTA 2I03A 3OPYI 3RARA 3UFXB 1K7CA 4HL6A 2FPPA 3C7AA 5AKIA 2KLBA 5LOVA 2SKDA 3ZWQA 1KOGA 1U0NA 1R10A 2VF4X 2I62A 4QJIA 4CIWA 3FTPA 3A9CA 1F2TA 2Z08A 1RC0A 3D4OA 3DHVA 5BN5B 3A27A 4Y3UA 4A16A 1KZLA 4ZK2A 4GLFA 4N48A 3DBRA 1U6IA 4G4JA 3CRMA 3N74A 2A84A 3ZV3A 4I9UA 4BKRA 2R96A 4R98A 1JRLA 1LJUA 4GC5A 3EVBA 1UJMA 4JI2B 5HRAA 5DNAA 1BGWA 3B6ZA 3NM5A 3WLFA 5KHOC 2XOEA 3C1AA 3CF0A 4ES6A 4ND8B 2WICA 2P5YA 2YZMA 3ONUA 1NP6A 1NUQA 2WKPA 4YASA 3KQKA 4TMYA 3EPJA 4RLQA 1UK9A 3FXAA 1Z13A 2X40A 4OIFA 3ZPNA 5DHQA 3E48A 4J29A 2EFGA 4DLVA 1VCIA 3QF4B 2HLDD 4RDLA 4Q9NA 4M8KA 2MTBA 2OLEA 5BQXA 4YDQA 3VO8A 4ENTA 1VKHA 4ZT4A 4QJ5A 3SKXA 4QUIA 5IKOA 3O93A 1ZCJA 5IFKA 3W3ZB 1L5KA 3R9WA 5JNSA 3IXLA 4BPRA 1GKLA 2GJ8A 4N41A 1AQIA 1I9GA 5G53C 4X1KB 1R8QA 2FP4B 3UMYA 1Q1NA 3KYCB 1H6BA 1L9KA 1MB3A 2FF5A 2HMWA 2WF5A 2PX8A 1WCV1 2O23A 2QPAA 3CGWA 4R3UC 4E6EA 3OQNA 1K3UB 3MAGA 4CTNA 1TJ5A 1Y6GA 2JJYA 2ZRNA 1FL9A 3IO5A 2A9RA 2NU9A 1ZKMA 1DQSA 3EIXA 4UBKA 4BHTA 1V8BA 4QQRA 6NULA 2D1QA 3K0AB 4F8EA 1JZQA 5EN4A 2VHWA 5TF0A 4X6XA 3ABSB 1K5DA 3OWHA 1X1AA 5FPHA 2YR0A 3SOPA 1RXVA 3J7AC 2XDQB 5BSXA 1SR8A 2FA9A 3GQBB 2V5AA 4ZC8A 4PCLA 5GONF 3CG0A 4J8PA 1WKVA 3AJRA 1GO2A 4WI1A 4HSEA 4EY4A 3A32A 3IHWA 4O3FA 5CVTA 1VJGA 3KSAC 1KIMA 4TTPA 1FP7A 3FPPA 2X4DA 5KWSA 1IAVA 4FHDA 3CCQB 1IHMA 4MVJF 5AICA 5JFOA 3NC0C 5L7TA 3GAZA 3RBZA 2ORYA 1JIQA 5TMPA 3USCS 4JBWA 2QLNA 4D4IA 2AMJA 3FYHA 2PXHA 4P4GA 3PJGA 5IK2A 1H2HA 3PSAA 2LNDA 4WNYA 1P7ZA 2HBRA 4H3HB 4UZUA 1J8VA 3D0KA 2NOAA 3C98A 3EPRA 1X8JA 4XORA 1JFLA 1IM5A 4W9RA 4XUGB 5SV2A 1ID8A 2ZUFA 4HDRB 1W0JD 2ZJ5A 3BYZA 3DAGA 2ZZQA 4JU8A 3SXPA 3V32A 3M34A 2BFWA 1KO8A 4M60A 4I9HA 4GT1A 1BAPA 2P6UA 1HFEL 3FNGA 4P7JA 4UU0A 3TDMA 4OTZA 4ZFNA 5KYWB 2P40A 3SI7A 2HF7A 4UARA 3WBFA 4PYJA 3M6IA 1PDVA 3AM5A 3AB3A 4I4CA 4XGRA 4RCYA 1DJOA 4RM2A 3L8FA 2J3DA 5EGSA 5IF3A 1TOAA 2FPRA 2P35A 5HFNA 1A9XA 1W1WA 4QDZA 3LCMA 2BSAA 3C74A 3FMIA 3MBOA 4GNKA 4WESB 3V8RA 2WBLC 2R8BA 4MQ6A 1QGOA 4RU1A 5IYZF 4JLOA 3I2YX 2PKQO 4JBLA 2DMRA 4L8LA 2ZM5A 2OHIA 5CLQA 4LYEA 2DB3A 5IZCC 3EFOB 4INOA 5B2EA 3DV0A 2HR1A 3CXCB 4PONA 1E9CA 2CFCA 3CNBA 2Q5QA 3UHPA 3R7DA 1E79D 1IFXA 1QFXA 2H48A 3KZCA 3ZEIA 5CEJA 6AT1A 3PWTA 1WLSA 3U7QB 4IJWA 4URHA 3PNBA 1UC5B 5BMOA 3N3AC 1FZQA 1WG8A 3UM9A 3Q6QA 3HDVA 2FGKA 1JHYA 1QF9A 1R0SA 5IT0A 3FVTA 3HBNA 5EE5B 5LMNB 1RU3A 2CVHA 3IH5A 4FYMA 2E4XA 4JJ8A 2VPIA 3BCUA 4G0OA 3BJMA 3VPHA 3EEBA 1FDUA 4IWNA 2IEDA 1P6XA 3FCXA 2AR0A 3ADOA 1I3LA 4PLHA 4JXJA 3ZE9A 1Q84A 3I2FA 2N46A 4REMA 4E5SA 1KF0A 2JATA 2R97A 3VJLA 1DLJA 1WSDA 3CVOA 2B34A 1J22A 1UEJA 4MQLA 5THXA 4DDMA 1PS8A 3EXEB 2XT6A 3KPUA 5KYUB 2PKRA 4RTQA 1QOZA 2DFNA 1N3LA 1J06A 3GDFA 3HEBA 4MW1A 1DLIA 1XD8A 4FD2A 4OJKA 4KYTA 1A5BB 1EDEA 1JSCA 1UOPA 2J3HA 1Z0SA 4LYFA 3IVXA 1X13A 3K15A 1L7RA 3OD5A 1JFFB 1YQTA 4MCHA 3VUEA 1LLFA 3B85A 4PQYA 5ALIA 4ZRMA 3O92A 3HFGA 1ULSA 4M9CA 4L4YA 1TLTA 4RHEA 2X9VA 4UQLA 1G7SA 5A7HA 3EZGA 1HL3A 3AVVA 3IRVA 1OWLA 1PJ2A 3AI7A 1VQ4B 2Y66A 3PFGA 2VJNA 4C0BA 2PS1A 3D26A 2XA9A 4U00A 3UKOA 4E1VA 4GAEA 1B8UA 2PTGA 4X0CA 4QUHA 5J63A 3L4JA 3ASQA 3H9BA 3LUJA 2AW5A 1J07A 4M1EA 1M2HA 4MAMA 4MIKA 2JLXA 1KI2A 3TQCA 1SEVA 1DE0A 1QYWA 5I48A 1OWPA 2RH9B 5DT9A 4N8EA 5EIAA 2O3JA 1AGYA 2HA5A 3INRA 3TMYA 2LGJA 3HFJA 4Z51A 2D7JA 3K70C 1Z2DA 4UBNA 2Z5FA 4FI3C 2JFQA 4WECA 2QLBA 4KPFC 3I61A 3HLTA 1ZCBA 2IYTA 2PT9A 3TSOA 1Y6JA 1IZ8A 1CR2A 1Q7EA 1U2TA 2QLJA 2YHIB 3HA7A 1DKRA 3N6RA 3CV3A 3Q88A 4D9NA 3SEJA 1TEXA 2PX2A 1KS9A 1YWGO 3D2BA 3SHTA 3BB1A 3KWFA 3K8ZA 2Q9BA 1L5MA 2NAPA 2JN9A 1B43A 1Z2AA 1BIFA 4JIGA 4X92A 4E5VA 4UQOA 1G8FA 2WT9A 1GGKA 1H5UA 4BMXA 2ETVA 2QL9A 3QTBA 4UEKA 1QCZA 4AJLA 3ASZA 3U3OA 4OP3A 1CY0A 1A04A 1BZYA 2CDAA 4LNUB 5FI3A 2Q49A 3M6VA 3H84A 1PFQA 4DCSA 3CLSD 1ESDA 4AJHA 5DWQA 1B73A 3HR4A 4MP6A 4OMDA 2EIXA 1RQLA 3LWDA 1I7LA 3PR1A 1B93A 2SECE 2BGWA 4IDDA 3BE5A 3O38A 1NUUA 4AIRA 2C4UA 1FMTA 2KBEA 2VF8A 1T3TA 3R7BA 3R3JA 1RP7A 4EENA 3ROPA 3UYKA 1VXOA 2FJPA 2H7VA 2JJ1D 1C2YA 3B48A 1TQ6A 3V76A 3C3CA 3HA2A 1H05A 5CT9A 5HILA 1IBRA 1UZNA 3TTTA 2X3FA 3C4VA 3HEMA 3BH4A 1XTKA 3R3UA 1E2FA 1GNPA 3AG5A 5A89A 1VL1A 1T9BA 1ATZA 2WHYA 3QLUA 4IGKA 4J2TA 1ZVKA 5SYAA 3D6AA 4BJ6A 3M7IA 4UTPA 2WU8A 3DW1X 4WGGA 1GDHA 1T9GR 2FEXA 5AKXA 5A2GA 5LB2A 5ICMA 3V7NA 1BW9A 2R4UA 3PXBA 4FFVA 4QWMA 3VDQA 5K4AA 4KKSA 4Q1EA 1FQWA 2XNKA 5CH3A 5D3MB 3B2NA 3VDNB 5KOHA 1E1QA 4UZFA 3KOZA 1SKUA 1R88A 5AM2A 1EG7A 3ZR4B 3GLTA 2WSYB 2ZQYA 3MGCA 3M1AA 3OH8A 4KW7A 4MI1A 3ZWNA 4D26A 1JFSA 1MORA 2WIAA 2GR9A 4EKYA 2Y2UA 2PMFA 3FNIA 4OQNA 3MB8A 4PLFA 3CF2A 4WKNA 2Q2OA 3O47A 3FAZA 4TZ6A 5AVSA 1G5RA 1BH6A 2P67A 1DI0A 1A4UA 2POQX 4MGIR 4EG7A 2D00A 4TKMA 3R7NA 4RTKA 2OZLB 4LY6A 4F6RA 2XNCA 4XX0A 1Y8ZA 1VHLA 1JHMA 2EJUA 2Y4NA 1NULA 1YE5A 2VWHA 4LV8B 2DFPA 2HXYA 3ZQ4A 3TZ6A 1PZMA 2VJPA 2WTBA 2ZB4A 4P3IA 2WAXA 3ABZA 3G0OA 1KC1A 3LYUA 4LRTB 2OVFA 1AMNA 1DELA 2H92A 2P75A 1C1HA 3BL6A 4F60A 4X7DA 2IYWA 4HS9A 4RZHA 4DSNA 4TVOA 5BSUA 1BD4A 4JQZA 4WX2B 4KN6A 4YEDA 3IMEA 4PFJA 3UWOA 1LD3A 1EE2A 1ZR4A 2G09A 3HKBA 1LX6A 2DVMA 4REQB 2EQ5A 1VHDA 3DUFA 1THTA 4KYIB 5F3DA 5ADWA 1C8VB 1GYPA 1DZ3A 3OJXA 1IN5A 3GD7A 1JSZA 1S2NA 3H5RA 4OHXA 4Z5XA 4MUEA 3F90A 1ZGHA 1ZN9A 3B6KA 2VQEB 3PKZA 5AKJA 3OFJA 2OOKA 1QLHA 4PX2A 2P2GA 3FTDA 1P1IA 3G5AA 1R0BA 4D8XA 3L41A 4H3KB 1RXIA 4IIUA 4E15A 5BRJA 4RD3A 1SXJC 1V0FA 2Z56A 2AXQA 3G8DA 4G7XA 1CUSA 4IFEA 3QVXA 1W73A 4D56A 3GY0A 4FX2A 2O8DB 3U2QA 1BYIA 1NSTA 1WMFA 3BXXA 3HY4A 2G72A 5FO1A 3QI2A 1QP8A 4Z3KA 1TCVA 1ECJA 2ZVJA 3AOEC 2B0CA 3QWHA 1M72A 3LK7A 4B6JA 3K5HA 4CT0A 3BHJA 5AM4A 4FMCB 5G1NA 2QXUA 1MABA 1MO4A 2BM9A 2H57A 4F56A 2FW0A 4GU5A 5ALVA 3O9MA 1UBHS 2DULA 5BVGA 3QOWA 2BMWA 2RHBA 2Z3ZA 3N7TA 3ZY2A 4LJYA 4TTSA 3VKHA 4L4RA 3JRNA 2HMVA 4ZWNA 3KQNA 3R6DA 1K3FA 1LBSA 1Q0PA 2VHUA 3JAMA 3FPLA 4HLQB 2R65A 3COSA 3FKJA 4LRQA 5FR1A 3KPVA 5THQA 5EKDA 3HL4A 1E64A 4N5MA 1EJ6A 4RFSB 2DP4E 3STYA 1ZIYA 1FF9A 4X0EA 3FMOB 3SQDA 2HWXA 3ZD9A 3BGVA 3EPHA 1ZNXA 5CFMA 3EZXA 4E14A 3L7IA 2ZIZA 4NOJA 5CAEA 3VHXB 1QRTA 1J90A 2J0QA 2EDCA 1QNFA 2O57A 1FS4A 3MWKA 2V7VA 4BJ5A 4E12A 4KPEC 2OHHA 1UQRA 4UBIA 7YASA 2QNRA 1GP2A 1PT9A 4Z3DA 4GMKA 1MTOA 3FW1A 1KEWA 1DWOA 1TJNA 2VHTA 5AVTA 5AESA 5HS4A 1YS6A 3OOCA 1NVGA 2LZ0A 2KWIA 3HO1A 3DBLB 1PX2A 4BO0A 5COQA 2BFFB 4RY2A 4WCFB 3LOQA 4DHEA 3U1VA 1TX4B 1TQDA 5JAZA 1DAGA 2FK7A 1RIFA 2B4YA 3SU8A 3THXA 3OZRA 1GFIA 5LP6B 3ZVLA 5CCXA 3OKPA 4MUHA 5B2ZA 4FILA 1AHIA 4EPYA 5EPOA 4BKMA 3TD2A 5KSOA 3H4MA 4F7WA 1XVAA 2RH5A 2QK4A 3JYOA 1YCDA 1Z37A 5HMMA 3C8HA 4Q3NA 3S2UA 3SIXA 3VH2A 3UG6A 5LDHA 3P9RA 3MWEB 1UC8A 4MDFA 1MRNA 1KP2A 5ALMA 4OX9Y 4B0OA 5K8JB 4GGPA 4Z4TA 1LRLA 3W7BA 4YDSA 5CW1A 3WBBA 1ZH6A 7GPBA 1JECA 1X1DA 5HKBA 5DHTA 5JVDB 2ASEA 3A2NA 4ILKA 3C87A 1XE1A 3EAGA 3BVPA 2X0RA 4RIHA 1JR4A 5BMVB 1XROA 3PUVA 1G4HA 1O95C 4R69A 1KDZA 4UVIA 1G60A 1Q57A 3P9XA 2QU7A 2XLBA 1ESNA 2A14A 4E11A 2O1EA 4XPIB 5FLXA 1YUNA 2NWQA 1W48A 1EU1A 2BE7A 2JK0A 2ZWIA 4CLRA 5HTOA 4XMYA 2ZYHA 2Z2ZA 3O8QA 4NJMB 6GPBA 1U3CA 2YWBA 4O08A 4BCBA 3N70A 2BPOA 2UU9B 4P12A 5A4JA 1DIGA 4RADA 3ORFA 2O2JA 3LJKA 2WD7B 3SNHA 1ZRHA 3A1PA 1OFTA 3TRIA 5HZHA 1A9ZA 5I51A 2CNOA 3IKTA 2HEIA 4B45A 2WTUA 5SZIA 2I2CA 3T7TA 1CNMA 4I1VA 3DOCA 2DXIA 4ALMA 1WCIB 1QZZA 2FW9A 1R4AA 5EUQB 6LDHA 3C16C 3H0CA 2JG3A 2EAUA 2YXPX 4US1R 5KQPA 3FDIA 2XMSA 5IK2D 4COKA 2Y9PB 2C88A 3AG6A 1E6MA 4HX2A 3RYHB 3L6OO 2WJVA 3NVMB 3AXSA 4Q3BA 1XQ1A 1U1CA 1GG5A 1DXHA 4NU8X 4PGOA 4PZAA 4PHHA 4XVRA 2EJVA 5TT0A 4BX0A 3FCSB 3MGGA 1YDEA 4ZEWA 3B5IA 2REQB 3DTVA 3I9FA 3GI1A 1TA9A 3ND7A 4QDOA 2FFRA 5CHEA 4F2PA 5ELLA 4X7CA 1P4RA 3GMTA 1HQCA 1UM9B 3G2KA 4KJZA 2RDMA 2VCYA 4QJ3A 2GYYA 3LW7A 5JY1A 3THWA 1ZBDA 1SIBE 1ZGCA 5JZOA 3QVOA 3AF4A 1NW4A 1E62A 1Q0SA 2Q7XA 3E03A 4NPAA 5CA0A 3TCKA 5GWXA 2F9FA 1K0FA 3PNSA 3D6UA 2VS1A 1KOJA 1N1EA 1W8IA 3EZNA 2VK2A 1GKUB 2OCKA 3IOYA 3N07A 4MR9B 4HEHA 3OTGA 4HN9A 3B36A 2OXCA 1NNI1 4OJTA 3QMPA 3I62A 3OY2A 4KIUA 5J2UB 1T3GA 1JAYA 5GV8A 2BLNA 3CUWA 3OO0A 4D3XA 5DS0A 2A7QA 5AK5A 2UZ4A 3W1EA 1GHTA 1E6WA 4BUJA 2XB4A 4TL8A 1JIVA 1P0FA 3TLEA 3IQGX 2JVIA 4C21A 1M74A 1ZHFA 5AN9A 2BLLA 3OUZA 5CX1A 3RJ9A 3UMFA 4YP5A 1AQLA 4CHGA 4ILEA 2PSHA 3UW3A 2GAAA 4AYWA 1KK2A 1LTKA 3TZHA 4QBIA 5F4OA 4PFSA 4JYCA 3ILXA 3S55A 4GKVA 4YPFA 1FNCA 3DHNA 1KI4A 1K75A 3T35A 5EUCA 2O3QA 2HCJB 2V59A 2H2IA 2GPYA 5DVZA 5BNFA 4CIAA 4FBLA 4EY3A 3EN0A 4N3AA 1DG9A 1AKVA 3RV3A 3VYTB 5EZSA 1Q0ZA 2Q5OA 2FMKA 5KQRA 4PVCA 4CBVA 4BNDB 1ZNWA 3P9PA 2ZDQA 1ZNZA 3B52X 1TTHA 3S2FA 3ZGVA 1BH2A 1OI2A 3ZX5A 2UXBB 4POAA 4DQXA 5DX8A 2V3WA 5DBGA 2A8YA 5SY6A 3DKVA 5AI8A 4NE9A 3DA8A 2YWRA 1QTRA 3OU6A 4JBGA 5IJWA 1F6BA 1NBMD 4WWVA 1V1MB 2M6RA 4RKYA 1DEHA 1PJLA 1WX1A 2ON6A 3KO8A 1MW8X 1Z45A 4H77A 2HIHA 1CZRA 1QF6A 1ISHA 2N42A 1BN7A 3MPOA 1DXOA 2QG4A 3SKVA 3K4HA 4JSRA 2Y1XA 3A1VA 5A9SA 1MIHA 1E9VA 3LAWA 4X41A 1UJ4A 3BAFA 5KS2A 4BZPA 2FQQA 3HVIA 1J9EA 1NJ6A 4O1HA 3R7LA 3L0OA 2H4ZA 2Z2XA 5F3WB 4OSOA 4C4YA 3KHTA 3ZTTA 1VJ0A 3V7AA 2BUBA 3PSHA 1G63A 5K8CA 2CXXA 4Y2TA 4R4JA 4MW2A 4BUZA 4E2FA 2FP3A 3M4NA 4G1CA 3A06A 3KQHA 2YJ4A 4ZQIA 3ZUGA 4UOZA 3DAFA 3DDSA 3O2SB 4BQQA 3C8ZA 2K7ZA 4MUKA 3P19A 4H7FA 1EEXB 3W7VA 3HKEB 1OA1A 4OQMA 3WL3A 3VZBA 4XRRA 4C0AC 1WABA 1NFFA 1VKRA 4TT3D 3JQEA 2AOUA 4QYWA 3RREA 4CHTA 2IUSA 2NZYA 1U65A 3PXDA 5ULLA 4BBPA 4N49A 3JQCA 2XVAA 5LNK6 4JJEA 5B3KA 4U6SA 2GERA 3NW9A 4TYQA 4G1UC 4OY3A 3ZE8A 4QGFA 2EBFX 4G65A 3M1YA 1ETHA 3E0XA 1DFHA 3B7GA 1SCQA 3GGJA 4L3OA 4HWTA 4LQDA 1P81A 2O8BB 4WQMA 1ZGZA 4R9UC 2AFHB 2GO1A 4ZEOA 2EHDA 4M36A 4B6GA 5JARA 3GLGA 2IOQA 3M83A 1PDWA 1SKQA 3B6MA 5L3QB 3IP1A 3W5DA 4DR6B 4EITA 5JO9A 4LDNA 1CERA 4IICA 3ZUPA 3VAAA 1THGA 1WUIS 1Z33A 2J09A 3OICA 4PYQA 4ZTBA 1P2UA 3ND9A 4LZPA 3W34A 5IW8A 2WU0A 2XAAA 2GMWA 2H8KA 4I4TA 3WQZA 5M04A 5IS2A 3E9YA 3FHCB 5F64A 3W4JA 4C03A 3IE1A 1VMEA 2WD8A 1UZMA 4N6NA 3L6DA 2E49A 5BSTA 3VR5H 3ZHVA 2WAOA 2W2PA 4ZT6A 4F72A 1UZLA 5JTTA 3DVSX 3BTSA 2HIAA 3E7WA 2ECFA 4EJ2A 2BI7A 1WD5A 4LJ9A 1J5PA 3LVFO 4LX0A 5JH7B 2JD1A 3D0OA 1KYWA 5AM1A 1XCMA 2X14A 1Z6TA 2O2GA 1P1CA 3CCBA 2WUDA 5FTWA 3BMNA 4HP8A 2GJAA 3RFVA 4RTSA 1GCOA 2C4MA 2RJ3A 4TVBA 2WWWA 3OX3A 2ECOA 4PIVA 3SKBA 1P4GA 2YVAA 4PC6A 1OFUX 5LUBA 2GBPA 1DUVG 2WIFA 3N2YA 4D8TA 3RVJA 2GKOA 1OU4A 2JHFA 1GOTA 4BN4A 2G4VA 3H9QA 4U2CA 5CLLA 4RA6B 1E99A 1IZ9A 4BMVA 1DV2A 5C5EA 2HKIA 2OCIA 2XYGA 2HY7A 2Q3BA 3DF7A 3IC5A 5GM2A 2R1VB 2WMOB 4BNMA 5GJCA 1RCUA 2XZDA 3IR6A 3HCFA 1FUIA 1E8DA 3D6TB 4FS3A 4GF5A 1RRKA 5TSDA 3UCFA 1JE0A 1YNOA 2VQSA 2VXOA 3AF1A 3OWXA 4DYVA 4C0SA 3AHJA 4DSUA 4E6PA 5AVZA 1JQ3A 4G86A 1ZVJA 5HCIA 5IUNC 4JX9A 2ZSUA 4U02A 3I92A 3OW2B 1WVMA 1F7VA 4D81A 5BMVF 4BZXA 3INYA 4Q3EA 4D0LB 3K20A 3AVQA 4KHZA 1RAHA 3R0VA 3S1LA 4YJFB 3AIMA 1V0EA 3BCRA 1T8PA 3BJIC 4OB8A 3G0HA 5TGDA 3WNQA 4UVEA 3EVAA 3LPNA 4LBZA 1N7GA 1TVMA 4JBNA 3V46A 3DKPA 2A59A 4NXNB 3D3WA 4MEBA 1LW7A 2W6JA 2W2MA 3GC6A 1T26A 4M54A 1CVIA 5BSMA 1DC5A 3E1SA 3VJRA 4RL6A 3RUEA 1B76A 3AERA 3HP4A 4UTOA 1MTZA 3MPUA 1MT3A 1YRBA 4MW4A 1DC3A 1C14A 2YNMC 3DEYX 3PX3A 5DN9A 4FLFA 4KPYA 3A9SA 2I66A 3E9ZA 2JW5A 3GEHA 1Y4AE 1XYYA 4KSBA 4Q02A 3SXJA 4DJJA 3IIIA 4IDOA 3NBUA 4QUBA 3DL7A 2GBLA 1SVUA 4B6FA 3WO0A 1P5ZB 4CMCA 4MROA 4CKEA 3QBDA 4LW8A 3VXKA 3MT9A 1Q92A 1P7CA 4NYIR 4EJSC 1OB0A 1K8QA 1N6NA 2R6AA 3K5PA 2FV8A 3U4AA 4R41A 4F4CA 2IW3A 3JCZA 1JQ5A 5F9FA 5EP4A 3WNZA 4H08A 1A9PA 3D1LA 3MK31 1CYDA 3UH1A 1NMEA 1CR6A 3Q8MA 3A3OA 4LYDA 4A5OA 1Z4PX 4EZEA 1BWSA 3L18A 3FMPB 3AP3A 1QGYA 2IGBA 1T0HB 1GTVA 3ME5A 2QM0A 4BQSA 1T4CB 3N8HA 1V1RB 3STWA 4JC4A 3IIMA 4HNGA 2O8EA 3H9CA 4X1YB 3BK7A 4KGDA 4ZCQA 3V7FA 5CB0A 1TCUA 4ARCA 4OX9B 5JPCA 1YXMA 2D1FA 1BEUB 2A78A 5TMBA 3IKJA 1CY6A 1SUIA 1OOEA 3LDUA 4M1KA 1DPFA 2IDJA 1W5FA 4M88A 4U3JA 2IOFK 2EOAA 1ZK0A 3KOYA 4K0KB 2O2CA 3U19A 1VTKA 3V8EA 3OVMA 3MCTA 1LEHA 4RK1A 3AVXA 3DT9A 4IZ6A 4PG6A 5FOSA 1WOMA 2C9DA 3T3EA 1KH3A 1ZM7A 2EW1A 3NCHA 4NBSA 2A33A 3HDJA 3I64A 4QEKA 3S6JA 1KL7A 4J07A 2VN8A 4JMPA 2D3LA 1UXIA 2BEWA 3ICPA 3R3VA 4EVQA 4LMRA 1C0KA 1PKXA 1QZTA 2FSPA 3K1YA 4TM8A 1FRFS 3WC4A 3OZGA 4KZKA 5LZ9A 4ZTUB 2OESA 4JI4B 4BFSA 4F3KA 5A4IS 3G5MA 4PC1A 4C29A 5TMDA 3ESBA 3WGNA 3L1JA 1CUAA 2C98A 4TV9B 1XVVA 3MLEA 5J40A 4AECA 2CXNA 1ZSVA 3RAJA 1PZGA 3VU3A 3AF3A 3NORA 4LNHA 4NBUA 4X1IA 1CIJA 4U7TB 4NENB 3A3BA 1DS6A 2ZYWX 3KQQA 4J6FA 3TLYA 2GN4A 3AY0A 4MVJH 2RI6A 3RIEA 1JDJA 1AUPA 2UAGA 3EG5A 3GFFA 1PUXA 1YRAA 1QVWA 1XMVA 1USWA 1XZJA 2QT9A 1TU0A 2EP8A 2I1WA 1WSBA 3F7OA 2XCQA 3NUQA 2HPAA 4CDRA 3OJWA 3O03A 4DJ5X 3QPCA 3OUUA 5LZ4A 4RF3A 3D8NA 2ZBVA 3ZZ1A 5BWOA 4KREA 3A4YA 1UC9A 4XD7A 2I1VB 5H70A 2PX5A 1HLFA 1W5TA 2GX6A 2VAXA 3BHMA 1TZJA 3COZA 3MOSA 1XJQA 4QUAA 4BNTA 1OH7A 1T8RA 1Y6ZA 5UKDA 1MC1A 3WGMA 2XTMA 3D4IA 3HWSA 3OE5A 4B3BA 1DFGA 3TINA 1JWBB 3FWNA 3E9CA 3JALB 3WDSA 2CNWA 3HO8A 4BTVA 4RPLA 1WDMA 4EW3A 3G2IA 4IEFB 3TLGB 4PZLA 2ARKA 1OTHA 3IIKA 4CJXA 1U1IA 1XZQA 4PRKA 1XDGA 1Z4NA 2GEJA 3CEPB 4ERXA 1J42A 4X8LA 1VLLA 4R54A 4PX9A 1LDGA 1Q22A 1EQUA 1S01A 1ZWLA 3EZFA 3HB7A 4ADSG 5AM5A 4WDQA 1Q86D 1MJGA 4IF6A 3FF1A 4IX9A 3Q72A 1TU3A 1QSGA 2OFFA 3V8QA 3ETGA 2BTEA 2VNJA 1BQEA 2AG0A 2G36A 3CLTC 3LU1A 3P1JA 4M22A 4U7HA 2CNKA 2OZPA 3FKQA 3LA8A 4PANA 3T7EA 1WMDA 1OYYA 4D4MA 4WXHA 2KMLA 1CUIA 5KNCD 1G64A 1GXSA 3BGOS 1P91A 2OTLB 1B0UA 4LHEA 5CCEA 5ALOA 2O2EA 1BU8A 1Y3IA 4P0PB 4XDGA 1DX6A 1J23A 3GAAA 1TB4A 3MJSA 1H3NA 3CUVA 2JGDB 4X7RA 4N3CA 4YQEA 4I55A 3DT8A 2H4YA 3RJTA 4W5TA 3LTEA 2I3AA 3AR8A 221PA 1GUDA 4RJ2A 1IEWA 1HQKA 1JJFA 4K9SA 3KQOA 3N0VA 3LPCA 2XEXA 2WWVD 1ZMOA 1M5UA 2ONYA 3JYHA 3L82B 3ZOZA 4C5BA 3PUKA 4W8OA 3MN1A 3GVLA 1W0KA 3EGOA 5I7VA 1QQ7A 3S5JA 3AZPA 1I6LA 1DNPA 1I3OA 3JAWB 4K9LA