3W5HA

Ultra-high resolution structure of nadh-cytochrome b5 reductase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
272
structure length
272
Chain Sequence
STPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
molecule keywords NADH-cytochrome b5 reductase 3
total genus 71
structure length 272
sequence length 272
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w5hA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w5hA02
2YWGA 1QFZA 3B8HA 4BPRA 4PC6A 4ZGNB 1FNDA 2GQFA 4J0QA 1B2RA 3CC7B 1QGYA 4TMWA 1KRHA 4B44A 3AVWA 3CCLB 2QA4B 3CCQB 2QMUA 3B78A 3WXMA 1R5NA 1TLLA 1EFUA 5THXA 4DQKA 2BM0A 4ZV4A 1I7PA 1KTVA 2QEXB 1N0VC 2YWFA 2QDXA 4G5GA 2D74A 4P3YA 4ZCMA 4TMXA 4B4DA 3W5HA 4RD3A 2R6HA 1B23P 3CCMB 1KQSB 4PC7A 3W2IA 2QTLA 1K8AD 1KK3A 4LBYA 1FDRA 1YIJB 1Q7YD 3WY9A 4R71A 1M1KD 3ZBUA 1ZM3A 3QFSA 1QGAA 4FK8A 1H42A 4U9UA 4TMZA 3J81k 1S0UA 1YI2B 1QVGB 2PIAA 4PC3A 4LC0A 1QH0A 3CRZA 1S72B 1E62A 2BSAA 1JB9A 2PMDA 3I1FA 3OW2B 1BJKA 1JJ2B 3PENA 1R5BA 3CC2B 3LYUA 1QUFA 5FA6A 2CNDA 1OGJA 4P6VF 5KSWB 2BM1A 4PC2A 1VQKB 1XE1A 3E1YE 1JA0A 2QN6A 2DETA 3I56B 2BN4A 4M4SA 1VQ9B 3ZC3A 2BGIA 4B3XA 3G71B 1VQ6B 3ES9A 4G1BA 1A8PA 1M90D 4YAFA 1VQ7B 1YJNB 1FRNA 5H59A 4M53A 1GAWA 5DSZA 2YWHA 3CCVB 2GPJA 1ELOA 1IB0A 1CNFA 1SM4A 1U2RA 3AVVA 3CCUB 4Y9RA 1WDTA 3W5VA 1G7SA 5AN9A 1IJEA 1DDIA 4AF6A 2B7BA 3FPKA 4YAOA 3CCEB 4N3GA 1OGIA 1ZM2A 1EWYA 4B47A 1CNEA 4EH1A 3VMFA 1FNCA 3OJXA 1W87A 4N3NA 1W35A 1Q86D 1NDHA 1VQNB 3I55B 5TY0A 1EP1B 4MYUA 4QHYA 4G1VA 1NJID 1K73D 3CB4A 1KK2A 1SKQA 4WQMA 1KD1D 1VQLB 1BX0A 1D2EA 4RJLA 3CPWB 2B5OA 4C0SA 1F20A 4K1XA 4YALA 3CC4B 1GO2A 1OB2A 1DARA 1D8TA 3WNBA 1IJFA 1VQOB 3FJOA 1UMKA 3AGQA 4LBWA 3CMEB 2VYQA 2C77A 3CCRB 3W2EA 2EIXA 1OB5A 4RD4A 3QSYA 5TV2A 3WNDA 3LRXA 2RC6A 1GJRA 1W2BB 4M1KA 3CCSB 1JA1A 3QFCA 2BV3A 1QG0A 1GAQA 4UAJA 3CW2A 1G7RA 1QX4A 2OK8A 4NBSA 1H85A 2HMAA 1N8RD 2AHOA 3P26A 3QE2A 4ACAA 3JQPA 1CQXA 3ZZTA 1EP3B 1QGZA 3CXCB 4HE6A 3MMPA 1TUIA 1FRQA 4IW3B 1QVFB 2PLFA 3P27A 4AC9A 1DDGA 4YAWA 1VQ4B 4RD1A 4YAUA 2J7KA 5EMNA 2YWEA 1BQEA 1YITB 4ACBA 5JBQA 4RD6A 2VNKA 1G7CA 2X3UA 4TMTA 4C43A 4ZCIA 1EXMA 2VNHA 4Y7CA 4RD2A 2E1RA 4RCYA 3AGPA 4AF7A 1YHQB 2DY1A 4H9GA 3U2QA 1EP2B 1XB2A 1KK1A 3WBJA 3CCJB 3U6BA 4HE5A 1VQ8B 4FWTA 3E20A 1R5OA 1HA3A 1JNYA 1TVCA 4TN1A 4Q7JB 4TMVA 2BMWA 3G6EB 1KJZA 2VZLA 3CD6B 1FNBA 3LVBA 1YJWB 3MCAA 3WBKA 1AIPA 3WNCA 4RD0A 1EFTA 4F7DA 1TTTA 2OTLB 3U6KA 2FX3A 3VNVA 2DCUA 5GV8A 4RCZA 2OTJB 2DEUA 2QTZA 4DQLA 3OZVA 3ZZUA 2ZITA 3AVTA 2BGJA 3VO2A 3W2GA 1AMOA 1QUEA 3CMAB 1Q81D 2B7CA 4Y9UA 3G4SB 3ZZ0A 3WYAA 2BPOA 1ZM4A 1BX1A 1N0UA 4B48A 3OZUA 3MHPA 3AVXA 1J9ZA 3AVUA 3OJWA 4ZCLA 1VQ5B 1G7TA 3VNUA 3QFRA 3VO1A 5TR9A 4PGOA 3W2HA 2RC5A 3V76A 3JQQA 3QFTA 2DERA 2C78A 2VNIA 2BVNA 2BF4A 3W2FA 2CRVA 2OK7A 3W5UA 1D1NA 1ZUNB 1VQMB 1ZM9A 2XNCA 3OZWA 1YJ9B 1VQPB 3A1FA 3SJZA 1QFYA 1EFCA 1KK0A 2HCJB 4FN5A 2XNJA 4LBZA 1E63A 1Q82D 3LO8A 1GR1A 2VNJA 3AVYA 2HDNB 4YHBA 4PC1A 4ZGQB 4NCNA 5H5JA 5GV7A 4QFMA 1QFJA 3B82A 1E64A 4M2LA 1DG1G 1GVHA 2EFGA 1K9MD 4B43A 3JQRA 4LBVA 4M0LA 3ZBTA 1W34A 1FNMA 1KC8D 2NPFA 5HXBA 2XEXA 1F60A 4MYTA
chains in the Genus database with same CATH superfamily
1SD1A 1BWSA 2YASA 2HU8A 2J85A 1P4MA 2BFOA 2P27A 3M6WA 4UVDA 2ZB2A 3V8VA 4CM1A 3O7MA 4PC6A 4ZGNB 1OJLA 4D0LB 5EI5A 4Q47A 2XE8A 4BWGA 2COEA 4FYHA 4Y98A 5T6MA 3FWHA 5ILQA 5DNYB 2FMTA 1HYHA 1IM2A 3LQ2A 3P9PA 3U4CA 1G6OA 3QU7A 1AXRA 2Z8ZA 2F3PA 3ZDXB 1QGYA 1FS5A 3GT4A 1VHOA 1G2IA 3E5NA 2H2GA 3L6OO 2E21A 4FQ5A 4JJ6A 1SWWA 2HAEA 4TM8A 2OBTA 3HYTA 3ZUGA 3U4GA 1NVUQ 3G2PA 3SHQA 2FWIA 3G2NA 2PZKA 2NAFA 3VPSA 1IQRA 3EK2A 2B25A 1Y5NA 3G0IA 3GH1A 3KB2A 4N0QA 4X20A 2IV3A 5IXJA 2OG2A 4K6GA 1JJFA 3TTWA 4L2IB 2JFVA 4PPNA 3IPRA 4F9GA 2P40A 2HKIA 4XSHA 1LTKA 5AHOA 1SXPA 1O8BA 4UBJA 2BR3A 2CW5A 1BG6A 1QRUA 2X8KA 3BDIA 3OPOA 3P19A 4TMXA 1G16A 1J9GA 1X1EA 2OHHA 2R8RA 1YZVA 2WR8A 3W5HA 2ZTGA 1L5LA 1WSWA 2F3TA 2RBEA 2ZDGA 3DV2A 3NBAA 4TV8A 4YAIA 5I7HA 1JU4A 1SUCA 5EEHA 5K99A 4XSVA 1LBQA 1E5VA 4V1CB 2BR5A 3EGDB 1XTQA 2BZGA 2NO4A 3UMCA 3WAKA 4AICA 5HRCA 1TQ8A 2PRIA 4LF4B 1IY0A 1L4UA 1PZXA 1R0KA 3ZPXA 4E4TA 1MAVA 2PR2A 3E7FA 1P61B 4HPWA 3WQRA 4P4UA 2UYOA 3JASA 3O82A 3PXEA 4OEHA 1VCMA 2YOGA 5KHOC 5ISMA 1PKEA 2B9VA 3KYBA 4H35A 1NI5A 2YKGA 2BFFA 4Z4ZA 1PJ2A 2NACA 3EDYA 3B1XA 3HJHA 3K0SA 4XMYA 1QH1A 3CP8A 3BEDA 4P4NA 5KNCD 2VPZA 3HKEB 4HLDA 4E4RA 1L5VA 1EFPB 2YYYA 3AEZA 1C7ZA 1BIFA 4YT4A 2DWQA 2ROQA 4JSRA 2C1EA 5E3JA 1V0EA 1JEJA 5LYJF 2GYUA 1WA5A 2FG7C 1KDVA 4BASA 4BNIA 4DREA 5BV7A 1I3CA 2Q4TA 2QY9A 4YK7A 5JH7F 4A10A 1UKZA 3KHUA 2Z2ZA 5IKEA 1V43A 3V4SA 3OKPA 4JKIA 3GD5A 1A2BA 2R1TB 1Z82A 2M98A 4GXNA 4GDMA 2PIAA 3QRWA 4MROA 1ZN9A 1KU6A 5AP9A 5LYYA 3U7JA 5CT9A 4XEUA 5KSZA 1YS4A 4QUBA 1QQ5A 4WNAB 3CF2A 5LU9A 4E2FA 3FDZA 1S2GA 1PRYA 1QNLA 4P08A 4QASA 4OKIA 3IHKA 1W73A 4ZWNA 3SQXA 1JL3A 2B4RO 4EFLA 3TW8B 2C4UA 5BV8A 4GKKB 2O0JA 2O20A 5GVSA 2D00A 1GSIA 1Z18A 1DT3A 5DXJA 1FP4A 1CZUA 1GN9A 2JFGA 2O4CA 3LD9A 4PIVA 3OEHD 4X1IB 3CN9A 1R5BA 3S28A 1A76A 2FW7A 1QUFA 1M74A 1NYQA 4J2TA 5IH3A 1OH6A 1QWSA 1G38A 4RDKA 1UBJS 3BVPA 4J3FA 3KZVA 4C88A 2J59A 4CM8B 1MOSA 2D1SA 4JLKA 3STXA 3ASRA 3P0IA 4XGQA 3C3YA 4EPXA 3I5YA 1KBZA 4XN0A 3H13A 5BSRA 3K4QA 1KFKB 3OECA 1YR2A 2H1RA 2X6RA 3IV7A 3D8SA 1AURA 4Q3BA 3V7WA 3G5UA 4M4SA 1VQ9B 4LJRA 3WS7A 3OQIA 3UGQA 1N36B 2BJVA 1XYVA 1X7YA 3GPCA 1QOQB 4DARA 3KTAA 4M9XA 2G1UA 1T36B 2VJNA 1VQ6B 3GZJA 3IOCA 3JARA 5ARDA 3ES9A 1N9GA 1R2QA 2FA9A 2Q50A 3I9LA 4IDHA 2TRSB 1U4SA 2WVHA 3CX8A 3MJCA 4K88A 1A8QA 1AE1A 5CVUA 4EM6A 4Z4GA 1J56A 1JLKA 1QCZA 2Q7OE 3Q8WA 2OYCA 4PZAA 1VJCA 3RUIA 2OZKA 3BWYA 3OPXA 3PE4A 3CISA 1DC8A 1GP2A 2OAGA 5E3IA 2DSNA 3DBIA 2FPUA 5EZYA 4EK9A 3ZCUA 3VSDA 1BE8A 5ICMA 1YO6A 3U7EB 3ZKWB 4KREA 1V1RB 2WD7A 1V7ZA 2JVJA 5ALXA 5JTTA 1I2DA 4WECA 4H7PA 2P9HA 3OM1A 1T5OA 4G56A 1GYPA 1HTTA 4OY3A 2V7WA 2GPTA 2VNSA 4F3RA 3AVVA 4LRSB 4LXTA 4TVSA 1ZWKA 2PUHA 3H9JA 2WAXA 4HDSA 4D5GA 2Y1OA 5M2QA 1SU6A 1VZ2A 3E9ZA 1EM8B 1CDZA 1ORRA 3DEAA 3R5SA 1JEEA 1ZGGA 3HACA 2H16A 3JQAA 4UFNA 3B9PA 1Z16A 3EUAA 1E96A 1WWKA 1Z08A 3AHFA 3MINA 3EC1A 3VAYA 2VTBA 4CKEA 2NM0A 5AKYA 1M2EA 1LK5A 1GA1A 3WV4A 1Z07A 4PTYA 4B47A 5DLQC 5HKAA 1H1TA 4YRIA 5FYQA 4NFSA 1H1LB 3ZW8A 4OPSA 1RRVA 1U5BA 3JQ8A 1KIMA 5IHXA 1SQ5A 3DAGA 5TJ9A 3KETA 1VSBA 3RRBA 1BVHA 1EDZA 2QVXX 3EZGA 5CA1A 4QTYA 4K9LA 1K7YA 3NNDA 3PT5A 1KZ4A 2RKWA 3L49A 1PAUA 2JIBA 4XLEA 3EGWA 2YRWA 3B5IA 4GL4A 3ZNOA 3OJOA 4C4YA 4QEZA 1SU4A 1ZSYA 4EY7A 3G2LA 4P2BA 1J2UA 3AY7A 3L7BA 2MWMA 1GRCA 1LBEA 1KK2A 1KORA 3EXHB 3OEEA 3D43A 1U1CA 2QTVA 3DS8A 3FTPA 5IS2A 2XDAA 2NYAA 2ZFUA 3AOEA 1X42A 1N5DA 5G1PA 5JFGA 1QP8A 3NEJA 2Y0PA 3JQ9A 4OQXA 2HA2A 4HGQA 5J1TB 5CDFA 3KVYA 3TNFA 2ZZGA 4XLLA 3VQTA 4QDXA 4RM2A 3RFFA 4RTJA 1M0TA 2FHSA 2VJBA 2QSUA 1NWHA 1IRIA 1QH8B 2FWAA 3WTCA 4HG2A 4TZKA 5I4CA 3GPLA 3LQYA 4ZQHA 5DHUA 1L5KA 2AFVA 3T34A 1FNNA 1H94A 3RNLA 1RAIA 2AH5A 2D1YA 4EEKA 3FMIA 3GEBA 3KQYA 5CEJA 3OZTA 5A9SB 2WZPP 5DK6A 1TM5E 3R9XB 1NR1A 2I1QA 2DUWA 3RRJA 3DMNA 3VPDA 3T52A 1ZU4A 4URXR 5HMMA 4PN7A 4F60A 3KHKA 1YRWA 2X5KO 2BM9A 5ICEA 1QRSA 2PUFA 4LF7B 4KXUA 4D92A 2Q0QA 1W4AA 1FSSA 4INJA 3GGDA 4DTCA 5L6MB 4M36A 1GSAA 2ZSAA 4CI0B 4ITUA 2I1WA 1U2EA 4E5UA 4WLUA 3UAYA 3WNDA 5C5CA 1FW8A 2NXCA 1IAVA 4ZOBA 4A9AA 2OV6A 1B0AA 1I7NA 1U2PA 2H0AA 1AKNA 1MP0A 2VPXA 4AMZA 1PJAA 1LK7A 4Z51A 3GFFA 2AKEA 3VO9A 5ALRA 2Z09A 5KREA 1JT9A 1UL1X 1G8KA 3L4KA 1GRNA 2BLNA 1SBIA 5CCDA 3UXEA 2GILA 4ESEA 3H4MA 2H4HA 5F1YA 3Q3GE 1ADGA 1U7OA 2OV1A 1L4GA 2IHYA 3EVCA 1N2OA 3KZMA 4AIIA 5EE0A 3OTGA 4LDJA 5KKAA 4RHUA 4GR9A 4PANA 4CU2A 1I1OA 2ID9A 2XW6A 4AVYA 3O74A 1ACLA 2W6PA 5AJVB 2QAGC 1NYRA 4OXXA 4YJGA 1DMRA 1L1QA 1PJ8A 1D7AA 1F6WA 1NR7A 1RBMA 2E55A 2I55A 3KUUA 3ROGA 4ACAA 4GQIA 1IHXA 2VSNA 4I4TB 4JLMA 4IZ6A 3OWOA 4B85A 1JR4A 2Q21A 3T1QA 2IYAA 4Q4AB 4JYAB 3PZRA 1GPNA 3IDFA 4CEIB 1OD6A 1P6XA 5C34B 2G77B 3L6RA 2Q3DA 3EUFA 1QGZA 4JMPA 1DELA 4M0KA 3D02A 3V4ZA 4GLOA 3CVWA 4Y6QA 1C7IA 2GT1A 5KTRA 4I4TA 1NJ5A 4JUCA 5CB4A 1T1JA 4WHMA 4GC9A 5AFSA 1OBOA 1TZBA 3SYNA 2PS0A 1CZOA 3P27A 5EXEA 4X24A 1FFHA 3GYGA 3JRNA 4MKHA 3TD6A 3HDHA 3LXXA 1RJGA 5AVQA 1E18A 2WVAA 4KFCA 2D1RA 3TO5A 1CYEA 3X43A 5GP1A 3GQVA 4CETA 3UGJA 1N2JA 3PXUA 1GTRA 4ENVA 4IHAA 1A27A 2ZSJA 1KBQA 1VA5A 3EVDA 5CFLA 4Q9NA 1ECCA 1IK4A 4LOLA 1WUIS 3DB1A 2ZI9A 4FP9A 3AF0A 4FC6A 3I61A 1LBSA 4LMPA 4AG6A 2H52A 4MYDA 2XMPA 2PGAA 3ILHA 3L46A 3MNFA 4WADA 4A73A 4DXAA 4C43A 1WSAA 2XYRA 3Q41A 3IKTA 3QU4A 2GR9A 1XQYA 3O31A 2P6NA 2C9ZA 5F2OA 5FF9A 2E1RA 1EFHA 3BD9A 4G84A 3SSNA 5K8CA 4ZQIA 2WKQA 4H3KB 5FDFA 3PE6A 4IQ8A 1IK6A 3WIBA 4IXWA 3JZMA 2IF0A 4OHZA 3P45A 2WHXA 4ZQBA 4DKJA 1KRWA 5FBRB 3ROEA 3ONWA 1FMFA 1BCRA 1Y80A 3VPCA 5AW4A 2AN1A 3DBRA 3MJTA 1LPNA 2PXCA 3FOWA 3A05A 3HUTA 1E0JA 1R0BA 1SURA 5L9AA 2M1ZA 4HPXB 2XMBA 4A1FA 2GARA 5DCWA 1D04A 1VKNA 4Q7JB 4MHTA 3VISA 3V4VB 3AILA 1GZHB 1LDNA 2IL1A 1GCIA 2ZBFA 1ZVJA 4GX2A 3OFNA 4D99A 4FW8A 3ILXA 3VZRA 4GMDA 1JAXA 1XSEA 2OFOA 2MHCA 1I3NA 3EZYA 2L69A 4DRXA 1C7FA 3PDUA 4KFSA 3OW7A 2PMKA 4RDHA 2LZ0A 1XL0A 3F1LA 4I5GA 3WBKA 4I2VA 3SEZA 3A0RB 4FB5A 5DTJA 1RXCA 1XCLA 1FUUA 3WNCA 2AOUA 4K9QA 5H02A 1JEQB 4B7AA 3HJNA 3Q8MA 1WCIA 3CH7A 1WX1A 3QVOA 4ZARA 4B3SB 1E9EA 2GO1A 3Q8KA 1T8WA 3L7DA 3MOIA 1DQPA 2D2IA 4N3CA 2XSZD 4HMPA 4H59A 4XR4A 4H7EA 5CD9A 3QXJA 5GV8A 5KW9A 4A92A 2PX8A 5JXHA 1XTSA 2B4TO 1L6RA 1LJUA 4L73A 3BJZA 5KO2A 3CVYA 1TKCA 4JYMA 1VLVA 5LUBA 3MMSA 1YZQA 3A6HA 5BN3B 3ZZUA 1LY1A 2EBUA 4A4DA 3IEXA 3AV3A 3A2KA 3T3IA 1EFRD 1L1EA 4L8GA 5BW6B 4RKEA 1DKLA 3I0MA 4LQLA 4QYMA 4ZEMA 2B20A 1AMOA 3IBTA 4URYR 1CS4C 3CMAB 1PUXA 2CJFA 4XAQA 3H5VA 3G17A 3G2MA 4OI1A 4OBWA 4YP1A 4Y9UA 3LNNA 1O6ZA 1ULHA 4P84A 5FPKA 2BOVA 2ZRLA 1NI3A 1VGQA 1NJSA 3QZUA 5FUBA 3UJAA 4HEHA 2N0SA 4BX9A 2KMLA 1JPVA 3RADC 5JBNA 3RRZA 4YT2A 1JPUA 1EH5A 3NRBA 1Z6PA 1XCOA 3OF3A 4IVPA 4C3OB 3BRSA 1LW7A 1U5CA 4IJWA 1SD5A 4Z4CA 4BMXA 4MQLA 4PS0A 3QEBZ 1S4MA 1T0UA 3H2KA 3C87A 3V42A 1SXGA 4QUKA 1X87A 2ZRQA 2QW1A 3E9CA 4NFLA 1NV9A 1GNVA 2A1TS 1PW5A 4U39A 1UJCA 4O63O 5B3JA 4F2PA 1P74A 3AHIA 3AIMA 1L5WA 2ZUDA 1DT5A 3THOA 1Z4LA 1HX7A 3K9WA 3L1HA 2PH7A 3F7NA 4B3JA 1T9KA 4UE3S 3LBIA 3S8EA 1H6DA 3OY7A 1TRHA 5IAAA 3FWKA 3W04A 3GLQA 4JX8A 4MWGA 2GB4A 2ZUEA 1ZKMA 4PO1A 4LZLA 3OQJA 2GUWA 3P9ZA 3V55A 2JN9A 4XLAA 2V96A 2Z3ZA 1SHJA 2JAQA 4LBZA 2ATIA 4Q37A 5GIOE 1TAQA 1QZZA 1KNXA 3N8NA 1CRZA 4YRQA 4EB3A 4PAGA 3B1JA 4Z49A 1ACMA 4Q9KA 3VHXA 4DMLA 4QA9A 4OPVA 1NVAA 5ILOA 5BSTA 3G8DA 3AFIA 1AUPA 2SBTA 3IYLW 4POAA 1PX0A 4ZVOA 1SXJB 3TUIC 5HIKA 4AKHA 5BPHA 1UBHS 1LB1B 4XSGA 2XT0A 4ETMA 5K8TA 4YJDA 3JD0A 4ZVSA 2FW1A 2KE5A 1XU4A 3BWXA 3VGJA 2IZ1A 5G1OA 3DM5A 3IXMA 1W6UA 3C8MA 2FR0A 4G0PA 1QBGA 1GGEA 5KB3A 3O90A 4CMIB 1FSFA 1CFJA 1IFXA 2K5UA 5FFNA 2NQ2C 2Z4SA 2QVYX 1FMJA 1CRLA 1WRBA 4IJKA 4UM7A 3FB1A 4V03A 4IMIB 3A6KA 3FDZB 5F52A 2FGJA 4ZAYA 1WXFA 2B7LA 4WKBA 4I50B 4H0CA 1H8HD 3EBOA 1XTBA 4N9QA 4NXMB 3IPYA 1LDMA 2JW5A 5TMDA 2ZM6B 5A05A 5J3OA 4AN1A 2VUTA 2GAIA 3PIRA 5EUBA 2XEXA 1QORA 1E7WA 1PWEA 2QUJA 4S1NA 4RIFA 3NAMA 3HKBA 4MQ5A 3E3MA 3EH1A 5M3BA 5A89A 3B8HA 3GPIA 3UAWA 1ICEA 4AG5A 3D2CA 1YQGA 3D5TA 3K1TA 4NL4H 1XZQA 1XNRB 1FNDA 2Q41A 2YRFA 3K20A 3N0TA 1EAMA 1V41E 2BSXA 2I6GA 3ET4A 4RZQA 5CPBA 3RBVA 2C04A 2HU2A 3I9FA 3MTGA 3FMPB 4BMCA 4DLVA 1KS9A 1T2DA 4X97A 4HB4A 2DT5A 1NRIA 2O2JA 1NMSA 3W3AD 2C4TA 2R7LA 1UFQA 2Y27A 5E8JA 1OGYA 2EZ4A 3B1YA 1DC6A 1GADO 1TC1A 1R6BX 2ET6A 2WA2A 3JATB 2AOXA 1XZBA 1EM8A 4MR8A 4PZ9A 1QGDA 3B78A 1VHJA 3IQHX 2BY4A 4PQGA 5H4HA 1BDIA 3HJFA 2PQMA 4BQIA 5SZHB 1HLPA 2V4ZA 1MD9A 1I7PA 1HT3A 3FGZA 1QIJA 3K0AB 1Y1TA 4LGCA 5ALWA 4DPKA 2WD8A 1TEZA 2XXAA 4KYVA 2KS6A 2QRPA 5EJGA 4QAQA 5T4BA 3SNKA 3K32A 1QONA 4ARVA 3JATA 4ZC8A 1F8GA 1U63A 3JXEA 3H6HA 4MYHA 1G18A 1BW9B 1HG1A 1QWOA 2JAXA 3N8GA 5EIAA 3ROQA 4N76A 5IKPA 4GPTA 3NBZC 5AVYA 3KWJA 3NVMB 1PJBA 3R76A 1PG5A 5EP3A 4C9BA 1W0JA 5JZOA 3GROA 3WLLA 4XJTA 2V4MA 1A5AB 1J5PA 1Z3IX 2YYZA 1Z4IA 2F1KA 3Q5EA 2QSJA 1FYEA 4MUXA 4EX6A 2Q4BA 3P8ZA 16PKA 5J5CA 5AKKA 4IJVA 2BW0A 3L8FA 4DBLC 2VPYA 4LRWA 2HU7A 1ZS9A 4IY1A 1T8YA 2RGXA 1EUCB 2PZFA 5FLKA 1Z2DA 1SVOA 2Q4EA 4CL8A 3R9IA 3ID6C 2C3OA 2R6CA 2QRJA 3K9CA 2CF4A 1Y6ZA 4JP1A 2IS4A 3LNTA 5C7IO 3KSUA 4BFUA 4N5HX 2R85A 3BE6A 1UBNA 2XCQA 1DTWA 3PCRB 3VYSB 2FN4A 1A9XA 1ONSA 4RM0A 4FK8A 3VJMA 3EPJA 1JMVA 4M89A 3IP9A 3KLOA 1EMDA 1THZA 4PZEA 1AGYA 5DYWA 1PFWA 4ZT5A 3TINA 3ZKAA 4K0RA 4YR7A 5I51A 2V59A 5IJXA 1PGJA 1CUCA 1DEOA 2GD1O 2JFYA 2NQTA 3MUOA 4JQCA 2PBLA 1TGYA 3KJQA 3VC3A 1GLVA 2A92A 1RRFA 3CR3C 3D3WB 4EECA 4CXMA 4MR9A 4UHDA 1FYXA 2ZRGA 2GKSA 3ZXIA 1XLVA 3VR6H 1PZHA 1CTQA 1RADA 4YJHA 4BQQA 3C6YA 4AY6A 1TMKA 1U4OA 2LUOA 3ZCSA 1NF3A 2J67A 3I01A 3KKOA 4H60A 1UZNA 1W5TA 1MAUA 1WBJB 3ZH9B 5DBGA 3O3NB 4XPZA 4O5AA 3G2HA 5IMSA 4KWIA 1H4TA 3CTAA 1JZTA 1OGJA 4YJHB 2QTCA 4RADA 3SC6A 4OYYA 4W9NA 5CCXA 5C7LO 2ZSEA 5K7SA 2ZATA 3MGGA 2CZQA 5DF1A 4PC2A 1UBSB 3EFBA 1T5IA 5D5PA 1YVUA 1N2ZA 3RRNA 3FUWA 1ODJA 5B3JC 4BVKA 4IHQA 4OHWA 4RVNA 3IOEA 5LMZA 2XTZA 4PINA 4MUYA 4YC7A 3VMMA 2A0YA 4YCSA 1OFUX 2VTKA 4LC1A 4EGCB 4P9SA 4A8JC 5IYRA 1C3LA 1KIFA 1UF9A 3C48A 3G0BA 4JKOA 4F2DA 3HFGA 5ADHA 1IZ8A 1SKBA 4CLRB 1UXHA 1LS6A 1LBTA 1UOOA 2IXAA 3RSQA 4DCPA 1SMKA 1RKQA 4PG7A 3ZOZA 4LY9A 1G8JA 1GAWA 1FTSA 5EZYF 4CEIA 4EITA 5LMNB 3TRIA 5GJBA 3UJ8A 3OQNA 3OZAA 5EJ7A 3MC1A 1PUIA 4RM3A 2VZEA 3BC9A 3GJSA 1QXSA 3IULA 1KJ9A 3R0ZA 4CGZA 2JANA 3D8HA 3LY7A 1H2XA 4K9RA 4DEXA 3EXFA 1GPBA 5CBKA 4RPDA 4JBNA 3BWDD 4I50F 1T8TA 2YV1A 3BWMA 3FIUA 5H0IA 1T5BA 2OORA 1KZHA 3G8YA 3TTSA 3LQ4A 1YUNA 4EBBA 1TUEA 3R5TA 3I05A 1DDIA 5JS7A 3OJ0A 1NLFA 3K73O 4GKVA 3BY2A 1NY6A 2GHQA 1E8DA 5LKAA 1IN5A 2EJUA 1V2HE 2IDKA 2OO3A 3I9NA 3ORHA 3GEGA 1L5HB 3OCCA 4OXYA 4Q7KA 4XPIB 2QN9A 3FBTA 4BX2A 2QVBA 2ID7A 2WC1A 1R0SA 3OEYA 3U40A 3RJTA 3IE0A 4MQ4A 1CNEA 2WAYA 5DX1A 5FR2A 1C7JA 1NFQA 1N6IA 4NZNA 1QGUB 1ULTA 2CY0A 5IVPA 2I4RA 4L8LA 3SGLA 4YN3A 4AZSA 2YH2A 3NE5B 2Z4TA 5DNCA 3UEOA 1Y3BE 2A67A 3HJUA 2C7RA 5TJHA 5JNSA 1K8ZB 3F8TA 1J0EA 2Y1WA 5GQSA 1UWCA 4LDAA 3HFSA 5DWQA 1LLUA 3FTNA 3LY9A 2ZTNA 2B8WA 3G2OA 4C07A 3AFHA 1XVTA 2ODTX 4GZMA 5SY9A 2GD6A 1G6Q1 3BX1A 3CPWB 4RA9A 3QFHA 2QM7A 1W85A 3FBWA 3ZI0A 3OT1A 4IM7A 3WRWA 1XLWA 5FNVF 5AVZA 2WKSA 3AIOA 3NP9A 2VJKA 4WL0A 3Q9LA 4QXMA 3S68A 1O58A 2GSWA 1J2YA 1L5NA 3MXTA 5TMPA 1Q1EA 2HQ1A 1T9BA 2WF6A 4WJZA 1Z2PX 4B71A 3TLBA 5CH3A 1KY3A 3T1NA 1K9SA 3EIQA 1NASA 2HK8A 2WOJA 3IT1A 1MC1A 4CKXA 4R2KA 4WCVA 4C4TA 4DDTA 1BCRB 5AVVA 3S8YA 5JLAA 1XZJA 2WF7A 2IGTA 3GFSA 4MGYR 1VJGA 4OQZA 4OHKA 5FPQA 1RJEA 2C03A 3RSZA 2OR3A 4W9NC 2R1UA 3I5XA 2CXQA 1WR8A 1XUOA 1Z0UA 2XJ4A 4FFLA 1TYEB 1ZVKA 1H3NA 2RBGA 4MRRA 1BWQA 4GXTA 3SKVA 3EWAA 2D7CA 4RD4A 1EU1A 1Y34E 5JZVA 1AB5A 1JXMA 5JAPA 4BB9A 3L7NA 1GJRA 3GA0A 3AZQA 4H7FA 4INAA 5ALOA 2HWYA 1XTPA 2OE2A 1RAGA 4M1KA 2P4UA 2HF7A 2CXOA 2X40A 4XJSA 1F0PA 4XQ0A 4DBZA 2X53S 1L1RA 2OMEA 4LYFA 3NNSA 3KSAC 1GVNB 2I2CA 4M1TA 4CEJB 2REXB 1SCQA 2FQXA 3GNTA 1K06A 1Z33A 4ZKEA 3LW7A 4RPCA 5KNBA 3K70B 1PI3A 3WGJA 3I32A 3FNEA 1OAKA 1B3BA 5J2UB 4D74A 1U3VA 4XQFA 4FX5A 4TKVB 4DIKA 4ZI7A 1KVQA 2MYPA 2OBXA 5FEUA 4ZK2A 1LZKA 2VA9A 2ORWA 1F4VA 3R3HA 2A1TR 2B61A 1RAFA 2IS6A 3OSZA 1QYRA 5DW3A 2WTEA 5LA6F 3HFJA 3CLVA 4X8LA 2BGMA 2JLZA 3LQ1A 2C31A 1QAMA 1O08A 1IMOA 3L01A 4WIAA 1YBFA 1MXFA 1ZNQO 1KEUA 2FPWA 2VAWA 3HDTA 1XJCA 4RHEA 5IJAA 5HQ3B 3WRXC 1AVTA 3NVAA 1M67A 2ZTSA 2J0VA 4GOLD 1CQXA 4S1VA 3U60B 2YYSA 1P9LA 4D0NA 5AR1A 5JAQA 3A4NA 4B33A 4B31A 3FUTA 2Y67A 5JDIC 3C6XA 5A5DA 1QO7A 5JXJA 3QMWA 3B5JA 1K6IA 1DMSA 5KINB 1XJ0A 3G9QA 3K0HA 3NHMA 4WK4B 3TRJA 1K8YB 2WJ3A 1KOLA 2F4VB 1TW2A 2VP3A 4JR1A 3LK6A 1DDGA 4YQYA 3W4IA 1NC3A 2AD1A 4BQSA 1UINA 4AZ3A 2GASA 4OHPA 3I04M 3MGKA 4YIKA 4GWKA 3AFOA 1PJ3A 1RHQA 4EUNA 3GLIA 4ACBA 4FYXA 4F8EA 3EZLA 4AJ4A 2UXCB 3GAAA 2FJPA 3NBMA 5DM4A 3KJNA 4KWTA 3DOJA 4FXUA 3AUUA 2OAEA 2X3UA 2C0QA 3W5CA 1KAHA 5IF9A 1RACA 3HKCA 2BELA 2ZYDA 3SZMA 3CE9A 4IH1A 1QPBA 1MA0A 2UZ3A 4W6QA 5BSYA 4K9OA 4NYMQ 4OBBA 4P80A 4W63A 1ZVMA 2PT6A 2WWRA 5JQWA 3A9SA 2O2CA 4YVFA 3SE0A 2XGGA 5EMMA 4ND7A 4BFWA 3EF0A 1M0SA 1XB2A 3HGQA 4F6LA 1WUJS 3QXSA 3SXUA 3TR6A 1OROA 1G41A 4TN5A 3V7UA 4HZGA 4W5TA 3VV2A 1KP9A 4PO9A 4JLUA 2PH1A 1WG8A 1E59A 2GCOB 3GLTA 3HR7A 2NU8A 1LPPA 4Q1FA 4E94A 4F4IA 3DAYA 4XUGB 2O3JA 2I2AA 4PTZA 4P4LA 1MGPA 3SR3A 3WB1A 4D9MA 2W2KA 5LBIA 3TQQA 1YZLA 1E8MA 2FY8A 2WAOA 9ABPA 3DEIA 1QNFA 1ZMTA 3HR8A 2R1TA 1XR3A 5ALQA 3I4FA 3IDQA 5EFZA 1R1DA 3UF0A 4UPEA 3H5TA 1ZC4A 5TB5A 4JLBA 1FNBA 1KI2A 2XVZA 1ZCZA 1R9GA 3BKWA 1FS6A 4EJ6A 1TM2A 2H5IA 2LNDA 1Q95A 2R84A 2PQ0A 2ZXHA 3OKAA 5LZ5A 3K1JA 4WKPA 4ZO7A 1P7CA 2BFBB 3AR5A 3MGAA 4Z1OA 1GDTA 3CUTA 1U94A 1Z4PX 2XYQA 3HZRA 1N5IA 1L5RA 4OYLA 4DLTA 4GSKA 3TJZA 2VR1A 1C9MA 1HE4A 1P3DA 3DV0B 4W1RA 1TO1E 2WFLA 3FX2A 2BD0A 3WLFA 1CVRA 4N7JA 4PSKA 1RI4A 5C1BA 4LWZA 2QWXA 3OTHA 1NHWA 1U9YA 2WZDA 1Y8AA 3MZ0A 1WMEA 3C97A 4TLMB 3D2AA 3UJCA 1MPTA 1OXMA 4LGVA 2XTMA 3G5TA 2E4UA 3CPSA 3DULA 3I72A 1OXKB 3C70A 4ZHSA 3HYSA 1TYZA 2NVOA 4HR7A 3HDQA 2PE5A 1D03A 1TJNA 3T5DA 4GYWA 4DJEC 1XMQB 5DM60 1IHDA 2F8TA 2XR1A 4WBNB 1PWZA 3NYIA 5BQ5A 3A2LA 1YTLA 2P2YA 1MKYA 4DG8A 3FBGA 2RG7A 3BE5A 1DKMA 3QEMB 2G6BA 3QEAZ 1T4CB 4B6GA 5A03A 4XX1A 3TQSA 1Z2OX 2E37A 2D62A 3G0OA 4O4JB 2PCJA 3OEWA 5EQTA 4J4BA 4QG3A 3LCMA 4ER3A 2G88A 4C5CA 2JJ2D 4FR0A 1KEEA 4XDGA 3EQZA 4W8OA 3TFWA 4LXUA 4RSGA 5DGHA 3W4KA 3WRYC 4C89A 1EX9A 2P3QA 3DE2X 4FHCA 1Q7GA 4BRUA 3PWKA 3QPWA 2QPTA 1NXQA 3JQQA 2HFJA 3DDWA 4EI9A 1QRRA 1K88A 1T91A 4PBSA 4G8BA 1KP3A 4EZEA 4B74A 2XA9A 3CEJA 3DMHA 4E1VA 2FZVA 1R6VA 4DB2A 2JCXA 3X1JA 1KI1A 3AM4A 4X00A 4U1RA 2GEVA 2I3ZA 5GADl 1R37A 5L4LA 1UPUA 3K31A 4Y6RA 1LRJA 5HKOA 2DTXA 5HEKA 2JFPA 5HKBA 3TTXA 2XNCA 1Y7LA 1FLVA 5BYKA 4ZOLF 4R1UA 4KYTA 4BNJA 3U09A 3AVPA 3KV1A 3KSDO 4HLNA 1G5IA 4Y6PA 2YIVX 1Q44A 4XM1A 4MRMA 4FZ3A 1UDBA 3IXLA 2WVJA 4Q1CA 4QSHA 2GF0A 4XORA 3HVHA 1R8JA 1RFLA 1UPFA 2FFRA 2AX3A 4JT9A 4EKDA 4MYRA 3PVZA 4PYMA 3O8QA 3JS5A 3ZJ4A 2J3EA 5FH9A 1L4NA 1K6JA 4DLKA 4N6OA 3GLIE 3DAPA 3W77A 4LDQA 3EGOA 3NTXA 4QJIA 3SC2A 3DTVD 1VGVA 1K4YA 1EQUA 2J9ZB 1MBZA 1ZJ4A 2QI9C 2WK1A 3A4TA 4FBGA 5IAEA 5G4LA 5SZKB 3UZUA 3KJEA 3K70C 3ZDBA 2WF9A 4Z4QA 3W7VA 2IYNA 2RSLA 3NWEA 2QMEA 4CM4B 2OZPA 1CT9A 1HO3A 5A02A 5GJVC 3TRHA 1XDGA 2AQKA 1PSDA 3ZZNA 4O4LB 4CR8A 4AMYA 3SC2B 2R7KA 2F90A 2DBVO 4RV5A 3PDIB 2RGAA 1NM5A 1WTHD 1FSZA 1ECLA 1K9MD 5J4KA 3CYFA 3RAGA 4TRJA 4BJHB 3PHLA 5EJEA 2G0NA 1PJZA 3AR8A 1ZK4A 4J91A 2VTVA 3P0EA 5E95A 3V9PA 1UZMA 4DLUA 2H2FA 1XDSA 2NPFA 2PZGA 3IUQA 4RETA 4YCBA 2HIAA 1ZL0A 4OSPA 4QJBA 4UFOA 3T9BA 3PTAA 4H1VA 4PLTA 4ZD6A 5GZ3A 3HUUA 2ISSD 1BGVA 1R0WA 5ALFA 4LHZA 3K2IA 1V47A 3AUYA 4ZI3A 3U4MA 4Y2XA 4DS3A 5KPDA 3ZZ1A 1QTRA 1XEFA 4PZYA 3E5HA 3V2IA 3SWWA 1ZITA 1SXHA 1THGA 2ZUVA 3HY6A 3K05A 2R62A 2G9ZA 3TSAA 1B2RA 4LCJA 1KJ8A 3GDOA 2QSZA 2P6RA 5IPFA 5HSGA 7MDHA 2O7RA 4LSGA 3GUHA 1Q1ZA 3HWRA 1KRHA 1E3WA 1AUOA 1JTVA 4FHGA 4K05A 1NN1A 5K6RA 2WG1A 1R8SA 3CCQB 1KFJB 2B30A 1KHHA 3CW8X 2Y9PB 3QUAA 2ORED 1U3TA 3D0OA 4WBSA 5EJMA 4NLLA 4YRJA 3HP4A 4DCSA 2XZOA 4WZZA 2WNHA 5KC8A 2H7XA 4N41A 4CDRA 4BNFA 3TSOA 4GX1A 5AM4A 4H6VA 1EYZA 3ZE7A 4DQKA 3EQ2A 3PP8A 1XC7A 1OAAA 1WORA 1T1EA 2O1XA 3CTPA 1SR8A 2VJMA 1W7AA 4WK0B 5AXCA 1FXWA 1Y1PA 3ILYA 4RWEA 3ND9A 4B7ZA 2Z6QA 1RBYA 2VXOA 4TYNA 1GT91 4PLYA 3R4CA 4X9XA 4G41A 4FZJA 4DNFA 3TZEA 3O84A 1WULS 3ZWNA 1ZRSA 2HNAA 3OLQA 3GLRA 1Q57A 3G5AA 2OA0A 4GMGA 4ZDJA 1WW8A 1K6XA 1LDGA 5ADVA 4UNNA 4L85A 2QG9A 3KXLA 2AHRA 2GHRA 1NLYA 3AW9A 1CETA 2EX0A 2JFHA 5IUNC 2ZOSA 1E9FA 1G66A 1XTVA 4MKXA 5FFMA 4WN9A 3ESCA 3F46A 3DF9A 3PFGA 4OQLA 5HF8A 2B1GA 1SH7A 5AI8A 3ZHXA 1KK3A 1O9BA 5DHQA 1G8PA 3NV9A 2CDCA 3A6LA 1FDRA 1QV7A 4AY4A 4E88A 1F2UA 2W6OA 4EJ2A 1YFLA 4YQZA 2ZEJA 4Y6GB 4R71A 1VL8A 4QTTB 5BUSA 4H1WA 4QNRA 1OXSC 4L15A 4P53A 3SYMA 4EAAA 2EKBA 2FFJA 3PJDA 5C8VA 4OK3A 1T6YA 4DV5B 1ZWLA 1NN5A 4DHWA 2BT4A 1P0CA 1O97D 1QGAA 3ANMA 3WMFA 1K66A 4F8YA 1AMNA 1ZR2A 3HXQA 1Z74A 4KAFA 2G83A 4A2CA 3TD2A 5L40A 1ONOA 4F85A 1Z5NA 5CX1B 2CUZA 4D4GA 5BT8A 1XK6A 2TMGA 4ZCSA 1Q1BA 1L7NA 1KYYA 1B0PA 2PY6A 3ZWWA 3IA7A 3AF3A 2OC4A 5JZ9A 4TV8F 4BRWA 2OUIA 1EE9A 1QYVA 2FLVA 5EP2A 2AJTA 4H6WA 2XT9A 4B3DA 4EHAA 2FZKA 2W9XA 5B4VA 5C8YB 3KZNA 2Q3LA 2IZZA 2VT3A 4DZTA 1OXBB 4P32A 1X0XA 2FGKA 2GAAA 1W9MA 4NZMA 1EE2A 3PPVA 221PA 4LTNA 5AKLA 1RYFA 3C8ZA 3DO6A 1INLA 2WFMA 2GFQA 4ZT2A 4ZDWA 4CMHA 3QNWA 3QSGA 4Q4JB 3BDVA 4J7AA 4ALJA 3X0DA 3G0DA 2OO5C 2CHGA 3RHZA 2PANA 5BR8B 2PUJA 2HWUA 4WOCA 3MTDA 3AFNA 4ZCTA 5JY1A 1IBMB 3ZGLA 4CKWA 3THXB 3CMCO 3LY5A 4KRGA 1TYCA 3IT2A 4MO9A 5FBZA 4BDSA 3N59A 4XGKA 3CWZA 1XJQA 3BXPA 2C4WA 1USVA 3FLAA 1V5EA 3SDBA 1T2FA 1ZICA 1R74A 2NZWA 3IAS1 3HCDA 5I4BA 2J7PD 2YHAA 3AR9A 3JV7A 3C74A 3EGIA 4DKXA 1WCV1 1UM9A 2BGIA 2BGTA 3UCEA 4RU1A 1SY7A 5AI4A 5CYGA 3CONA 5ECGC 1N3BA 4G1BA 3AHCA 3RTAA 3E5MA 1P1BA 4MICA 3D6NB 3JR3A 3TW0A 5B12A 4L4XA 1UBEA 5IG2A 2XHZA 3QX8A 4M53A 3LDUA 4JJGA 4P3XA 3AOEC 2Z1NA 4FDTA 5DTEA 5HTOA 1U3GA 1RHJA 5F77A 5FBHA 3SAJA 4B6EA 2ZSKA 5JALA 4DUPA 3WL5A 1KQGA 9GPBA 4KXFB 2EG5A 2JHGA 4MULA 4ZRNA 4BKRA 4TTSA 4II7A 3QVKA 1E6UA 1XL1A 1MG5A 2C2ZA 3EGVA 2PWAA 2EW1A 1Z3CA 3MOGA 4FBLA 5KX5A 1DHTA 1EWVA 1FYVA 4R16A 2UZ4A 3MQFA 2WI8A 4JYZA 1A9RA 1CQPA 4Y9RA 5HILA 5HM6A 1QH9A 2V8BA 1WP9A 2O7VA 5IVKA 1VMEA 3PYMA 4FEEA 1ABFA 4IDGA 3G0HA 4FOOA 2O07A 1OUMA 1P4AA 4NNJA 1T3LA 2X5XA 1FQKA 3ETCA 1Q3TA 3I9KA 3IMGA 3L05A 3MTIA 3OBBA 1E2MA 3RTGA 2W0SA 1NRJB 4FNOA 1U8AA 3A58B 1Z38A 2NO5A 1XZPA 1WXGA 3PRJA 4L3VA 1BFUA 3JSAA 3L7AA 3VZSA 4Z4EA 1GG2A 1EWYA 4L5CA 4U63A 1QGED 3DBVO 4KIUA 1AGRA 5K6TA 4DNRB 3WK9A 4B0OA 1A71A 2H08A 3M3DA 4Q4CA 1BGWA 2PUVA 3MPOA 2V7TA 3NBQA 3ESQA 3Q0IA 5F3RA 1F51E 2I2XB 1P9NA 3PEFA 5EERA 3HL0A 5BNIA 3OEED 1A4UA 2D4HA 2JBAB 5GM2A 3RVLA 2P65A 4AIRA 4QOSA 4DSOA 3BRQA 1VMKA 4QUZA 4QRIA 4BNDA 1NJ1A 4V2UA 2WTBA 5I5GA 5DRTA 1C4WA 2XUOA 1XRQA 3GLSA 4CN9A 3COJA 2HEIA 3LJKA 4P3NA 2PBRA 4AJOA 4IH4A 4RQUA 4DFDA 4I6EA 3IEVA 2HJSA 2ODWA 1QAQA 1LK0A 2FH5B 2OD7A 5BUCA 1FCJA 4RJLA 5JNTA 1XU7A 2PMFA 1YCDA 2MCFA 4FE3A 4EZBA 1J1UA 1TVEA 4HOYA 4KN8A 2Y6VA 3G13A 1XNQB 3H2YA 2P4SA 4F6RB 1RTKA 1ZW1A 3O93A 1IRXA 3S2UA 3W8EA 4W6ZA 2YC4C 3WAGA 1Q0RA 5KQGA 4DBVO 4RZHA 4XEHA 4K3VA 2L0XA 3HJRA 3TLKA 3TTTA 2Y1CA 2Q46A 4H7JA 1K75A 2VHVA 1C30A 1IJFA 1WTCA 4OQPA 3RS3A 4BVEA 1B76A 1E5XA 1E8NA 1RI2A 2FQQA 3PV0A 3WZ2A 3BNWA 1AK1A 4QV2A 1P5RA 4GOMD 4UUNA 2ZIFA 4FYVA 4IX1A 2ODPA 3N3BC 1WIWA 4RELA 3M6XA 1JDUA 1C0PA 1Q1GA 3CNEA 1WQ1R 4C0QC 4YNBA 3JZIA 3FAZA 2YQZA 1MEOA 4NFYA 3WB0A 3MJHA 2NU6A 1N1DA 2G06A 3JWJA 3FYUC 4AQ7A 4J0KA 1LWNA 3NHRA 3TB4A 3ZX5A 4BYGA 3TK1A 3WA6A 4XE5A 2B8TA 3SJPA 4YHHB 2XUKA 3AY6A 2R2AA 4HN4B 1CSEE 9ATCA 1SIWA 3KEFA 2WHPA 4YMUA 2WTXA 1GKIA 2WSYB 2GO7A 4MARA 3ZLUA 3KTFA 4XOUA 4MQFA 4ZQCB 1N07A 3IEMA 1KYTA 2VDVE 1TQDA 4RHYA 2QJRA 5HG0A 4U0JA 3LYHA 1BGXT 2MMCA 3GJ3A 4G9GA 3ZE0B 3HJGA 4R68A 1MFPA 3CX6A 4IR7A 3ZW9A 1CEYA 2QE6A 4IVRA 3ZE9A 2NO9A 1L7BA 5DX8A 3Q9UA 1HKHA 4ASUA 3IQDB 3ORFA 1LSUA 3VUEA 3DAOA 4H1UA 4BLTA 1RHKA 2W6MA 1GQSA 3DZCA 4KE8A 4C03A 2V54A 4HAIA 2P67A 2W98A 2OGUA 2FLKA 4ZANA 4CV1A 4D9KA 3DE3X 5MGBA 3QELB 3KKEA 3ADKA 4PN3A 4QVKA 2R79A 3L7YA 1VL6A 2ZZFA 1CHDA 1DCFA 3D4IA 2AFHE 3UQZA 4A15A 5E4YA 3HMKA 1TEVA 2PX5A 3HO8A 1PT7A 4QBFA 2CFTA 2XHEA 4A91A 4BNWA 2C99A 3QPUA 5DHFA 1I7SB 5KEIA 3GDGA 3IJEB 1BZYA 1X9IA 3PUYA 2O23A 3RC7A 2Q1XA 2XDWA 3FYSA 3L2OB 4UNPA 5BO5A 1UBRS 2OGSA 4G0XA 4Y2QA 3SBEA 1JAZA 5EMNA 1T3SA 1TLTA 1EDOA 2BFCA 4I1VA 2LGJA 4P5EA 1PL6A 2Q1WA 4RD6A 1IY1A 2XUZA 4ZOLA 5HUJA 4WOBA 1GXSA 4LX0A 1UZAA 1NXOA 4E15A 3DZJA 1G3RA 4TS9A 1RU3A 4DWJA 3PUJA 3HZOA 1N7GA 4PLFA 3CRQA 4O2BF 3QF4B 5GINE 3D4OA 3P2KA 2Q1SA 3HXLA 2X8JA 4Y7CA 3HHEA 4RCYA 4FJ1A 4QDUA 1USWA 4ZCQA 3EA0A 4AF7A 1SK8A 3TLCA 3GOHA 1XF9A 3FDXA 4YRMA 1ZR4A 3NM5A 2ZGVA 3LX5A 3CKMA 1Q15A 2C7QA 2UYCA 4KN6A 2AJDA 4KKTA 2XMDA 3OPMA 4Q12A 3RTEA 4E70A 2ZIEA 4RIIA 2RIPA 4HYYA 1HEYA 4I14A 1XEXB 3M3PA 3JWPA 4AN0A 1I4EB 1L7OA 3QQPA 3ASZA 2VI5A 3BSSA 3ETHA 3PT9A 2HF9A 4DCOA 1VQ8B 3QKRA 4X41A 1CRQA 1YKGA 3ZCPA 4B32A 4JJIA 3VHLB 3T3EA 2EARA 2ILTA 5EKUA 2ZU6A 3R0XA 2JH8A 2ZUTA 2GF9A 1PGOA 5B30A 3U9SA 2OBMA 2GWHA 1TVCA 1NQAO 1SVKA 1DHRA 1JEDA 3SX2A 3M1AA 3OM8A 3AEUB 1E3DA 4BU0A 4F91B 2RE8A 1D0VA 1XT6A 1IEQA 2MINB 3HN6A 1FFCA 4YBZA 2VH1A 3R3XA 4R1MA 1Q17A 5KSOA 1XXHB 1NJFA 2L2QA 2JD2A 3M9XA 4WNIA 3M33A 4TKOB 5ALLA 1AZWA 4P33A 4KG7A 2B21A 1YJWB 4TXJA 4EX7A 1OWOA 3UJNA 2V6MA 1I7DA 2YMPA 1TF5A 4WNCA 4CF5A 5KTMA 5F51A 2BHRA 2CSUA 1RRKA 4G85A 1QGOA 2HT6A 3RK0A 1EUZA 3ODGA 4ZYUA 2GLXA 1XQ9A 2JFBA 3UJDA 5I7WA 3LM8A 1Z35A 3VKWA 4BBZA 1KSJA 1JLRA 4FLFA 3ZVLA 4AECA 4H3VA 1N57A 3IKMB 5JC8A 5IK2A 5KHLB 3AFMA 4N0PA 3U6KA 2I78A 4JQYA 5JO9A 4YQEA 3A2MA 4K9DA 4NONA 4I3FA 4RDCA 4DSAA 3VR5A 3B1FA 4RPIA 2PWYA 1A1SA 2IDJA 2ZJ0A 4FYYA 4KWEA 5BOVA 4COOA 1B6RA 2FUCA 1EXNA 3KD2A 1JIXA 3KQOA 5B58T 1H9BA 1ECGA 3HR4A 3TF5A 3H97A 4GOOD 4AB1A 1SBTA 1E3MA 1WB9A 5F9FA 3EA4A 4MCAA 2D54A 4N0MA 4OHCA 3V1NA 4NVRA 5KVSA 1Z5WA 3CPHA 6AT1A 1LFDB 1NW5A 3MMZA 4QBKA 1DO0A 2OBFA 4JI4B 2WIDA 6LDHA 2Q8NA 1H6CA 4CQMA 3HTXA 1SB9A 4EEZA 2BPOA 2EGGA 4HBGA 4J7XA 1I5RA 3PDJA 2D8MA 4OGLA 5K3SA 3V34A 2IBTA 2OCXA 2W8BA 4ZVLA 4DQDA 1N0UA 1Z73A 2ZT7A 4LZWA 3NWJA 4UBOA 4F71A 2D2XA 5AJUA 3TX2A 2D6FA 2OKGA 4AXXA 5ES3A 2UZIR 5CFOA 1DRWA 1QS0B 3ZXSA 3FTQA 3IHTA 4OGFA 3S2SA 1QGUA 3MQ4A 1V16A 4XQ9A 5TR9A 3W2HA 4RF3A 4B81A 4H0NA 2FPGB 2WQ6A 3V76A 1UFVA 3DTVA 4EO7A 3TCXB 1EE1A 1GIAA 3QPBA 3WHKA 2BVNA 3ZY3A 1KO5A 2F1HA 2Y1LA 3R7AA 1QS0A 4ND6A 4MUEA 3ESZA 1OJ7A 3K2EA 4QSMA 3OA0A 5HPYB 3VPGA 2OK7A 1WKBA 1KJQA 3W5UA 5JDCA 2JFOA 2EC5A 3B7WA 2I91A 2Q1YA 2ZQYA 4AFNA 4HT3B 2ZS7A 1NMZA 1ZM9A 3CCFA 4GG1A 4GZLA 4DIMA 3TJMA 1W5SA 3OZWA 4NE7A 1BS1A 5J2TF 2G7ZA 1JH8A 3S4YA 4D9GA 3HBFA 3K9QO 4J0JA 1H2AS 1Y8QB 1B43A 1JHYA 1OHHA 4BFTA 1IN6A 3FWPA 2BMVA 1HSOA 4DWWA 1PV2A 1X2BA 3S2GA 3T5CA 3DNFA 5JH7A 4KXMA 5FBWB 3GJZA 1DQSA 1JDVA 3C1UA 1QK3A 5JXIA 1E63A 3Q1KA 5CD1A 2VC2B 5AW9A 2O8BB 2FN8A 5IFKA 3A1PA 5A4IS 1QK5A 2HDNB 5CEFA 3ND7A 1YCGA 4MDYA 1EQ2A 1JLSA 3G89A 3A26A 3AYXB 3R41A 2Q1UA 5TRTA 4RPJA 1GZDA 4G8JA 1Y9ZA 1MTOA 4I9UA 2B1RA 5HZAA 2R8EA 2Q2WA 3HP7A 2F3SA 1Y82A 4FOLA 5DM0A 3X1WA 5LQKA 1Z83A 1TT5B 1XDBA 1NIJA 1XA3A 3BILA 3R6LA 2GFHA 2XY4A 1MJNA 1NOIA 3CNQS 3EB9A 3OPVA 4MPPA 4PAOA 1TK3A 2FYTA 4MS4B 1GVHA 4BZQA 2VJCA 2EQBA 3ZK7A 4D7AA 2EFEB 2JH9A 2XA1A 3JAMA 4D25A 3WYBA 4QE3A 5J58A 3RODA 4V1CI 1V48A 1SXJC 3GJYA 4LOKA 1C81A 5LQDA 1W34A 4G86A 2XMSA 4BFSA 3M9LA 2V45A 3FD8A 3LL7A 2O8DB 4LI3X 3AMVA 4FSXA 1J8MF 5HIAA 1XVUA 2NYRA 4QHTA 3RK4A 3T12A 3LDGA 1TMYA 4BL5A 3BAFA 4Q1AA 1V4NA 3HPRA 5DT9A 4RLZA 1TJYA 2DPMA 1DZIA 3H83A 3GRVA 3NOQA 3QVGB 1YKFA 4NYJQ 4C0AC 1QE3A 3SHVA 3O4RA 1T1IA 3HU1A 2CMGA 3JYNA 4LY0A 2Y2VA 4BZZA 5J5AA 3H9NA 1X9GA 1Z2AA 4PHFA 5A88A 3NG1A 3U3ZA 2EV9A 1Y6FA 3BZWA 5L3RA 2Y4OA 3Q8XB 5EOVA 5IKMA 3SJ7A 2VCHA 4EY8A 2HRRA 4OLHA 2X41A 1E3ZA 3L6CA 3NRJA 1XZEA 4IIVA 4A36A 4XL9A 4MDEA 1L6IA 3LTEA 1UK9A 1IXRC 1BEUB 2ZIXB 1GPH1 4HDOB 2ZIZA 4LE0A 1PSWA 1NA5A 1C50A 3D3QA 1AUXA 4AYTA 4EUEA 2QMHA 5J4YA 4TKVA 4EFNA 5FI5A 1T9GR 1R5NA 1BXZA 4TKLA 5K9ZA 2GXQA 1I4OA 5KVCA 3FN4A 3EE6A 3KKPA 3AERA 3NOXA 4IIXA 2HFKA 1E9VA 4YDHB 2IE8A 2VTDA 3HYRA 3W4JA 5ADWA 3ZI7A 4K9KA 3PQ2A 5GOTA 4AZ3B 1Z5OA 3VKHA 3RF6A 1GAEO 4LNUA 4B80A 2LP4Y 1QHNA 3A4IA 2NUBA 3CZPA 3RVKA 4LRUA 5C4GB 4IGIA 1KDPA 3QU5A 5F21A 4LJ4A 3SHWA 4CL2A 4I55A 2CUKA 1SCIA 3AYZB 2JBAA 3QXXA 1ZISA 2PFSA 2JJ2A 3MS2A 1V8ZA 4KH1A 2Z5LA 2AC4A 4HQOA 4UZEA 2ZRMA 2O5RA 3W2IA 3M4YA 4BNDB 3Q6NA 2VHCA 5CFPA 4ZTUB 1N8NA 3ZD9A 5HS6A 3GNQA 3U7FB 2ZSBA 1UM8A 4OMCA 1VHTA 3CCCA 2VWGA 1T4GA 2JLBA 2Q62A 4KE9A 5AVKA 4BO5A 1KDZA 3DC7A 3JU3A 1Q7YD 2FZCA 2JZNA 1YIDA 1ZYUA 4PG5A 1DC4A 4U3JB 4DV7B 1VJRA 2QTWB 1O95A 1XOIA 2WT9A 3G8CA 1SEPA 3MW8A 4MWCA 3CNHA 3ZDQA 3S2EA 4ND5A 4GOND 2A88A 3EUEA 4IF4A 1FTYA 3IO3A 2IH5A 4ARCA 1B8VA 4E0FA 3GU3A 1JKJA 1SB8A 1UOEA 2PV0A 3PUWA 2ZYWX 1VYUA 1UK7A 2EHDA 1FX0A 2RH4A 3IBSA 1YR1A 3NGXA 2GJ9A 4WZLA 4UM8B 2JKZA 2YXLA 4WEQA 2H4FA 4NYIQ 1CY7A 5PNTA 3LUBA 3O26A 1NDUA 2JI4A 4C3UA 3WFZA 2Q5JA 3KXIA 1R0YA 3VJLA 3E23A 5CG1A 3CUSA 2PH3A 1L7DA 4I4NA 4LC0A 2G3YA 4MPRA 5EXSA 4AJJA 2H8KA 2EKLA 5EMHA 3UXYA 2PMDA 1N7JA 1GPJA 4PYIA 4BNVA 3ZXXA 5DIZA 3B5EA 4HK4A 1VDMA 1OE0A 3F6YA 3GW8A 3PUVA 2VHEA 4G1MB 5CU7A 4QQRA 3R7WA 4DIFA 4D9CA 3CC2B 4FD3A 4NE2A 1E60A 1XDZA 2VHXA 2CNDA 3UHOA 1MVNA 3UOGA 3WSWA 4FGKA 1SA0A 2BZSA 2ID8A 3UC9A 5MFPA 5EKTA 3ZEAA 1TM3E 1ZJ5A 4IXDA 2WHPB 3IMFA 1HNNA 2D0PB 1EBUA 3MT9A 4GMHA 4IDNA 5LC1A 4RABA 4CMIA 5ITWA 1E7YA 2H4YA 4C05A 2QN6A 2QV0A 2C58A 2VDPB 1EINA 2PZLA 3GT3A 1NAIA 2WY2D 2I8AA 1W0CA 4ZI5A 4ND4A 1GZ6A 3IX7A 4KBFA 3VOBA 1I7LA 1VIMA 1M6EX 2DR3A 2IIVA 2V9CA 3K8ZA 4REMA 3ICQB 5DNAA 4US2R 1KI7A 2FSVA 3OQHA 2XF2A 4U4AA 4H2DA 2BH9A 1CVLA 5D3QA 1BHJA 1KR5A 3LCRA 4YUYA 5CJ2A 2FUKA 4PRZA 3HV0A 5I9LA 5E8RA 1Z2CA 1T4CA 3A1CA 5JRZA 2J0UA 4F5YA 1A5TA 1PQ4A 1UODA 1T36A 2F17A 3FPJA 3I1IA 4L4ZA 1L7XA 4UNSA 2NUAB 4LEIA 1OFHA 2X2FA 5FWYA 2R6FA 1LA2A 3ZLTA 3WGVA 2P5YA 2JLQA 3EULA 2VPWA 3I76A 1KDOA 1X86B 3KPVA 3LDHA 3NHBA 5U4QA 4EMSA 7REQA 5AW6A 2UKDA 1IUPA 2GJ8A 5EYPA 1G7SA 2VJDA 1OXXK 4WZTA 5AN9A 2DWOA 4W9RA 4EJSB 1WOSA 3NX4A 1RRMA 3TIGA 1QVRA 3Q72A 1O3YA 1WOMA 4QFCA 3EX7C 3KLPX 4EAQA 3URKA 3E7DA 3NVDA 3SHOA 3CUEF 3D4LA 3L9WA 3ZQJA 2IH2A 5CR9A 3FYUB 4P3OA 4CFSA 4GIBA 2ZSIA 4IS3A 3N76A 4LQDA 1PFQA 1OAOA 3BL6A 3W9UA 4ZN6A 4W5RA 5DULA 2RHHA 1JHOA 1NDHA 4EWLA 1A77A 5IX8A 4BO3A 2XUJA 5E38A 3HCCA 4XWOA 1JG1A 2ZYGA 3G2QA 3NDBB 3F49S 4O2AA 4Q7LA 8ADHA 4ILEA 1XKXA 4FNMA 4QGHA 4CMBA 5HQTA 4FFWA 5J43A 1GCOA 5CVJA 2XB9A 1DX6A 1G3IA 3FCOA 4IGAA 4LYYA 2FR8C 3PVSA 1GOTA 5F73A 1RI1A 2YHIA 5B58C 2QRNA 1P3Y1 1Y4AE 3CLSC 5CCEA 1D2EA 3A3OA 2WPDA 5FWDA 4QYWA 4KSYA 3JQGB 3SBXA 4R9RA 4RK7A 2PCLA 4F38A 4ZTBA 2ZYUX 1XGKA 3N28A 1Y48E 1RE1A 1X7WB 5B2ZA 3GVKA 3NV7A 2B8JA 2ZAMA 4ARZB 2CHVA 4IVNA 3RRYA 2JARA 4BVJA 1F0NA 4UQPA 5DI9A 2PZMA 1EP9A 4XZ3A 3DLAA 5EFOA 3A8IA 1T35A 1GZ3A 1YVRA 2IHKA 1L5ZA 2IYOA 4IIYA 1OFIA 5B1YA 3U7QA 1M10A 3DO5A 1MIOA 2ZKLA 1E9CA 3HDGA 4F2HA 4LBWA 1SKAA 5K0NA 3WSTA 2GJRA 5IT9A 1PUJA 2CFIA 4FR2A 3UAOA 3CCRB 2UU9B 4R1SA 5E1BA 2IYVA 3MD9A 1G2PA 4P81A 4XGIA 1S8NA 2OQ2A 1THMA 5HP4A 1RAHA 2GEFA 3A1TA 2JK0A 1WZIA 2OHVA 2OLEA 3GL9A 4O29A 2DWCA 3C41J 2RAPA 3PD0A 4X06A 2VZ9A 1NXPA 5ENVA 1WPCA 5GAJA 4AKSA 1DCMA 4JIMA 4X8MA 4GPIB 4HTFA 3TTUA 1O4VA 4B3FX 5C1OA 3SIWA 1QG0A 4OJKA 1DTEA 1PZNA 5CTAA 3VNRA 1L7MA 2JIDA 2C54A 4RY0A 1DQRA 5CX4A 3G6KA 3N07A 3HNPA 4I4IA 2CMHA 3B48A 1LI4A 1HFWA 1XRSB 1FPMA 3CSSA 3TL3A 5KBYA 2OV4A 3D4PA 1CLUA 1BVUA 2HSZA 5CM8B 5ARCA 1CUXA 4MVJM 4DC9A 1L8XA 3BQNB 1PDVA 1Z26A 2RJ3A 4L75A 4RY9A 3RU9A 1JHZA 2O54A 1XF1A 1VE9A 4H0FA 1EK1A 1BKYA 1RWXA 1SC4A 4JT4A 4QEKA 4WCFB 2SHKA 4XOIA 5F1PA 1W47A 5KYYA 5CNJA 4EUSA 1NU6A 1KYXA 1ULZA 3RM3A 1B0ZA 1F0KA 1AV6A 1JE0A 3IUMA 3KC2A 5D3MA 5A6SB 3T1YB 3D8BA 1ZI6A 1H2WA 4MZDA 1NKVA 3ZLJA 1ZSNA 3USES 4NJEA 2CNOA 2G8LA 2HSGA 3T3HA 2CHUA 2OVBA 5I9NA 4Z4HA 1CK4A 4V0MA 4W7SA 4HUQA 3WRYA 3EPLA 2HIGA 3RPEA 2CLMB 2RHDA 3ZXYA 2W71A 2IP4A 3WVNA 1RJ9B 3OE7D 1RJFA 5I7EA 1JQAA 2FPKA 4GP6A 4HDMA 1Q6YA 4WBXC 4OREX 3KQMA 1FDVA 2W6NA 3LWBA 3NJ8A 3X44A 4YRBA 2EKDA 1ESNA 1GNTA 1VZ3A 5K8VA 5EHQA 3TM4A 1BQEA 1ZJYA 2KSQA 4DIOA 1C14A 1Y3DE 1J33A 4MP6A 4B83A 3ZY5A 2FEOA 1D9XA 3GFRA 3LT1A 3O8OA 3S5UA 2JRCA 5K0CA 1L5HA 1ZIOA 1NJ2A 2QW8A 2AIRA 2Y76A 3ASUA 1R4MB 1P31A 2FZ5A 4WUVA 3NDPA 2HI0A 3UW1A 5BUZA 4ZCIA 2FMUA 2VK8A 4MI6A 1YCHA 1U8ZA 4HQ0A 1EXMA 4BU1A 3CG4A 1ZUNA 4FMPA 1NBAA 2YHBA 3F3YA 2FOIA 3TXAA 3WWDA 4D5EA 4RPKA 2YCLA 1QC5B 1K27A 3F5DA 4CKBB 4TUYB 4PAAA 1N4AA 4G7WA 3WGMA 4JQOA 5AVSA 2QVGA 3CCJB 2GDJA 1ES9A 2A9JA 3NUQA 3LWZA 3U6BA 1D2HA 1SK9A 3AB3A 3E9NA 2CD9A 5JNUA 3IUJA 5F3DA 2MYTA 2BKLA 1AOXA 1HT0A 1CUGA 4C0HA 1NVMB 4KX5A 1DKUA 4CMEC 2VXBA 1W85B 4RV4A 2QGGA 1NTRA 2FPMA 1R7RA 1JNYA 1AGNA 3OZGA 2J9FB 2D3LA 3NEAA 4AM8A 3WJAA 4BUZA 1KKMA 4F9TA 2GREA 3DC2A 4TMVA 4OD0A 2IWRA 3W3ZB 4ETIA 5K03A 1NVEA 2I7TA 2OZEA 4FDAA 2AXQA 3G6EB 3NJRA 4XJVA 2JEOA 2X0DA 3LVBA 1UD8A 1VDZA 4HNAA 1FU8A 1E6LA 4ARZA 1Q9SA 3G68A 3H2HA 2NXNA 5CLLA 2O2HA 4M0MA 4RD0A 3OC6A 4XCQA 3T61A 2RB5A 4F7DA 1QV9A 1GGNA 3DO8A 3G2KA 1YA4A 2WIFA 1YTUA 2X22A 5ESDA 2YICA 1RHUA 2XGSA 2E4VA 3F71A 1LFAA 1FB5A 4PNEA 2R9VA 2FW0A 2FQ1A 3N75A 5HF5A 4JLWA 3SIRA 4B5LA 4BX8A 1FZQA 1ZBDA 5IBRA 4I66A 2AE2A 4OP7A 4BUJA 1XKLA 4GRDA 3K9GA 4D4IA 1NQWA 2Y71A 2G08A 1SBCA 4IG4A 4YS6A 1K2VN 5JXWA 4AJ9A 2QIOA 3NEPX 1D2MA 2Q2OA 5CT4A 1YDHA 3WDLA 1XZKA 3IDSA 2OCAA 2ZITA 5FUXA 1E3XA 1JGTA 1RZRA 3COWA 3F6RA 4QUGA 3LQ6A 1TEHA 2R2GA 3EQ9A 3OG9A 3LDFA 3F7MA 5LXTA 2P6OA 1JR3D 2WQZA 4B3HA 4JASB 5BN3A 1XMVA 4NJMB 3V48A 2WLTA 1K89A 2ZUFA 2XADA 5IDYA 4LXYA 4PYLA 5TF4A 4EG8A 4NXNB 2G80A 1L4LA 4NEQA 3ZHZA 5DS0A 1XTRA 5LA6A 2UXDB 3SYKA 4DHEA 1GFWA 2YFQA 2QLFA 4FFRA 4GUAA 4L8YA 3GB9A 4QYIA 2OXTA 5AVWA 1G21B 3UKDA 4ZI7F 2JFXA 1JZQA 1KQ3A 5DCYA 1I9GA 4I4LA 3DBOB 4C22A 2C7OA 1U0GA 4D02A 2QOEA 3I5UA 1UBMS 4DT1A 2PNJA 1TZCA 2WJPA 1MJHA 3OIUA 2AG0A 1WXIA 4BO2A 1G5FA 2DBYA 2DFDA 3UKJA 3Q10A 1G8MA 3F9CA 3STUA 3PWZA 2ZB7A 2CLCX 3GRUA 2DSTA 2KX7A 3DQPA 5ALSA 1W8IA 3TZCA 4KUHA 1I1QB 1ODCA 2YTZA 2JZOA 2VK4A 1XAIA 1A9YA 3A0UA 3QF7A 4NBRA 1HVXA 1TEXA 5B6IA 4PFJA 3GVJA 1I8TA 3N2IA 3SLKA 3HUDA 5EJ4A 1GARA 4WKOA 3ERCA 4MV4A 2NQ8A 1XDUA 3CNBA 1PTJC 3B2EA 4TV9A 3NBYC 3CJTA 1TO6A 5C5EA 3JPWA 3QTLA 1RXUA 2BEWA 2C98A 3B1ZA 4LWOA 4L9WA 2CDAA 5D7BA 5HRAA 4R3WA 1EFDN 1W46A 1W93A 3DDNA 4RF2A 3W6NA 3RTDA 2J87A 2W6ZA 4P5PA 421PA 2RARA 3IAAA 2ZS8A 1AKRA 3Q3EA 3NWPA 4MH0R 3PPYA 4ROTA 3VHQA 3W0LB 1CE8A 1RWKA 1CDOA 1JYSA 3GP3A 1GLGA 5EJ8A 2GTPA 3LE8A 5J40A 3TVTA 1YOVB 1AD2A 1N32B 1R0XA 2JVIA 5AXBA 1IN1A 3LC0A 2N3ZA 1P4RA 2VF8A 4JQZA 3QENA 3ICOA 1QJ4A 4IDAA 4YWHA 5IDVA 2HD4A 3PDWA 4RSHA 2W2XA 4O0LA 3OQ1A 3G1TA 4HMOA 4YROA 1RIIA 1GYRA 2PL1A 2XCLA 1RKVA 3L0SA 3KOXA 2RGGA 2OHIA 4IO0A 1AKTA 2KW5A 1AM4D 1HT1E 3H9GA 3E1SA 3ZQKA 2H1LA 2FSVC 4DXHA 3FRJA 4B6FA 3CH6A 2CKMA 1FP4B 1I2MA 5EC8A 4LS3A 1O77A 5HGXA 4WESA 3PNYA 2QUKA 3GIWA 2OEPA 3ECAA 3P2JA 4LJLA 3ND8A 4YRNA 1LDBA 1SHKA 3KYDB 3TVDA 2J3IA 1W9HA 3E27A 4D8VA 1RI3A 3E05A 3HC7A 2P6MA 2XSZA 4C21A 2BKEA 4XQCA 4QM6A 2CVFA 4BNHA 4RE5A 2Y93A 1PT8A 2PGLA 4ICIA 4CF4A 4L6AA 3R5FA 2WWHA 3OQIB 2DYIA 2POQX 4TMWA 2P41A 2VBCA 4I3GA 2C5GA 4Z86A 4F84A 1FVOA 1JWAB 1NATA 1V7PC 2A9QA 3F9RA 2G40A 3KTAB 4GO1A 4JP3A 4URHA 2G5TA 4ZZ3A 3EVFA 1SVUA 3UHPA 3OT5A 1PJQA 1CUYA 3IC5A 3W05A 2ZBGA 3LL4A 2NSHA 2I62A 2G5GX 3ANSA 3HCOA 2IX9A 3SKBA 1JDBB 1SBQA 4GPZA 5CJPA 3BRWD 1KI8A 2QEXB 3PL1A 1KR2A 1ZC3A 2ECOA 1D8AA 1L5QA 4ER5A 1JPNA 3PX7A 4P3YA 2EIHA 2O7SA 2YYAA 3HB7A 3MTEA 3H0EA 3R6TA 4ZVUA 3RSHA 3LS2A 3MLAA 2DBQA 3RREA 3GCDA 4RPHA 3VU3A 2IS1A 1II8B 2PRYA 4BP8A 2QRMA 4HGRA 1DX4A 4PE5B 2OORC 3VPAA 3VXKA 2DFVA 5IWAB 3L0ZA 4UDOA 2YHSA 3WL7A 1PVOA 3KJGA 3ISXA 4HAOA 2CEKA 1K6MA 3D6JA 1ORTA 2I4OA 4G2TA 4K8OA 3W8NA 3A8TA 5TE9A 3WKDA 1U0SY 1T1GA 3LCVB 2QTLA 1KMMA 4MNTA 4TSKA 5MHTA 1OF1A 2XB6A 2VZ8A 2A1IA 2HMUA 1CY8A 1XKTA 3CLRD 5JSUA 4XLFA 4MA0A 1I8DA 3AY3A 4MQEA 1T26A 4YAEA 5C3MA 1MG0A 1EK2A 4HWRA 5A0FA 2H3HA 1E5TA 2XIQA 3DMDA 2HBYA 2H1FA 3B7PA 1EGHA 3DKPA 3KKMA 3NLLA 3TBKA 2W4MA 4BQEA 4LVOA 4BBAA 4ZEVA 2C2BA 4CGYA 2HHLA 4FLEA 4FYIA 4DABA 1JDZA 3T7IA 4IVQA 4ECAA 3ADDA 1BJRE 1MPXA 3EC2A 3QU9A 3HLYA 1S8OA 4QHSA 1NUAA 5A0VA 3DMYA 4EVQA 1EJ0A 2PGIA 4M9CA 4V39A 1V9CA 2FPSA 2PYIA 1YI2B 5BOSA 1J8QA 4FFSA 2B94A 3CINA 5JJKA 2O06A 3PNQA 4KIFA 3F97A 5E6UB 3W8FA 3ZIAD 5J9FA 5JQGF 4IHJB 2JFQA 3OZEA 4NQZA 2G82A 2X4DA 2O3TA 2ATVA 3KXDA 1VJDA 2O0KA 2BP7A 2K4MA 4YBRA 1E9AA 2BMAA 3OW2B 2FW8A 4XDZA 3V00A 1N33B 2P90A 1K28D 3NHWA 1ZJJA 1X7WA 3M7IA 1UJMA 4WA8A 2FRDA 5REQB 4AZ0A 1MF7A 1Q0PA 1W4BA 2UYQA 3NIDB 4UTVA 1BXRA 1O0CA 1WY7A 1NX6A 2VJQA 3GEIA 3UMSA 1HDYA 4HXFB 1OWMA 2UV8A 2MSEB 1Z6ZA 2ZCUA 1EDEA 5CBPB 3C5VA 4OOXA 2J45A 1EVJA 1HRDA 3Q3IA 1DBRA 1XE1A 2Q5HA 4ZVVA 2OQRA 4X71A 2QR5A 2G9VA 2ZS9A 2DETA 4TKZA 5DM70 1NXTA 4XIFA 3RUFA 3KYCB 1F7UA 2VF7A 4K2HA 2IUEA 1QFMA 3SFTA 3TR0A 1IWOA 4W7IA 4BMSA 2W2LD 2HXYA 3DL7A 3GY0A 5AD1A 1LQ2A 4R01A 4Q1EA 4B3CA 5IZCA 1M90D 4RPLA 2CDRA 1GG9A 2YY7A 3BHNA 5IVIA 4ZKDA 3KB1A 8ATCA 4UNQA 2NZ8A 2VSFA 1FRNA 1WOPA 2WWWA 3R7NA 2BDEA 5C5IA 1I2CA 1LKZA 1OPRA 3CH4B 5FTMA 3RO7A 2IEZA 1UMCA 1ZU5A 1F8FA 1UBGA 2PH5A 4HWKA 4HY3A 2QL9A 1IC6A 4DOMA 4EYOA 3I83A 1GNLA 1S7GA 2XOKA 5JG7A 2EWWA 1DNPA 4LE2A 4KC0A 3N74A 5AXAA 3MAAC 3QA3E 3ABOB 3THSA 2PZBA 1QRTA 1NVTA 4BCDA 3RC2A 2P91A 3CCUB 5SYAA 2VJOA 3SQLA 3WHIA 3K1ZA 1K5PA 1P1KA 2R87A 2AFIB 4F2WA 3AJRA 3I6ZA 1KVUA 3F1KA 1W25A 3HB1A 4X05A 4WK2B 5H9VA 2V7GA 2OZLB 4LJ5A 6GPBA 3EGXA 4Q4AA 2FRXA 1Y7IA 3FTCA 4BEWA 4Q6BA 1N2EA 1QCDA 3AZOA 1JDNA 1G9XA 4EHDA 4U6SA 1XX6A 2ZPUA 3SEQA 3I64A 3O2JA 1WDWB 3ZHRA 2P5UA 3RVSA 4RVHA 1WKCA 4PZUA 1XDWA 3KE9A 3R5XA 1TVKB 2CBGA 4KNYA 3Q40A 1EFPA 4QVAA 1HFEL 4UPVA 5LOVA 2YC2C 4LGMA 4ENRA 2X6YA 1BN6A 2C3UA 2O3RA 2DAPA 1RPZA 2PJDA 1SG0A 1WPQA 2IW1A 2FP4B 3PA2A 2G76A 2J07A 1JP7A 4CLOA 1TVKA 3VR0A 2P79A 5BRAA 4P93A 4Q3EA 2J5XA 1E2QA 4TRRA 3S1AA 1RPNA 1M0WA 1KD1D 2AR9A 4JOSA 2M5SA 1YQ9A 1QYXA 3VJRA 4PGAA 1RC0A 3EOZA 3D1VA 3P9KA 1E0SA 4ZJPA 7AT1A 2L19A 5DB4A 5IVHA 2IP2A 3F2VA 3P9CA 3KD3A 3LPMA 4Y0AA 1BHO1 4J8PA 4C7OA 1GKUB 1GSOA 2HF8A 3BWCA 4BDTA 3D5QA 2OCBA 4LTMA 3ZG6A 4GMXA 5JPCA 1FFEA 2JLAA 2X2EA 2O2EA 3LLSA 2VATA 2Q5OA 1ONBA 2WABA 3P2IA 4G65A 3ITNA 4QBGB 4ZT7A 1X7HA 1UXIA 2Q5QA 3NALA 4UZSA 3WYDA 4YUAA 3FKQA 1F5SA 3A27A 3ZHOA 4CM8A 1IBSA 1R3DA 2C84A 4X54A 1N6KA 1Y3FE 3CT6A 3MT8A 4DTIA 3HBJA 1J21A 1G8FA 2AG8A 4OFXA 5LP1A 1PBNA 2QU8A 3AI3A 3VV3A 4ZJYA 2J9FA 4JROA 2JLCA 1XTIA 3BHMA 1OB5A 3OP4A 4PIMA 1C0KA 4Y2SA 1G8AA 5A1TA 4DQVA 5BWMA 2C9OA 3IQWA 4LYGA 1LJLA 1ODLA 3TXXA 2NO0A 1HGXA 1QRAA 4BKUA 4Z7QB 2I03A 4HVTA 4I5FA 5L7YA 1PX2A 4G4JA 4CYMA 4DG9A 5LM3A 3PNLA 3L18A 5ULLA 3TSYA 1KTIA 1Z2EA 1FFXA 2G17A 1O57A 1C3JA 4W5OA 5TGZA 2FR8A 2JASA 3CZ9A 2ZTHA 3KNZA 4XFKA 4AI6A 2ZJFA 4JBXA 4NJMA 4BRSA 3NHUA 4H6XA 4N82A 2BUAA 3OWXA 4NNPA 5ALJA 3ZY6A 3TZBA 5JI3E 4IOKA 4YCNA 1HZJA 4F6CA 2OHOA 1DAGA 2CMFA 5JCOC 2UUAB 3PEEA 1NBMA 3R3JA 5JNVA 3L1JA 3GV0A 2F00A 3PE3A 4II3A 1E58A 1F17A 1WZUA 3CLTD 3DOIA 4E46A 1SUFA 1GFZA 2V3VA 3ED5A 4MTCA 4UNRA 4MS3B 3D4NA 2IYSA 1QR2A 4Q39A 5BY2A 1I94B 4P25A 1W75A 1YZNA 2VCEA 3B6KA 4MJ3A 2JI6A 2ZIXA 4NY1A 5A5EA 5C81A 1I0ZA 4CKYA 2X6TA 3NS7A 4C7MA 3GEEA 5FR1A 2PS3A 2QSYA 1LEHA 1A9QA 3PL5A 3EEIA 1C9JA 1O6CA 4PTLA 1KAQA 5FV7A 2P2SA 1KFBB 3TS1A 2Q1TA 3V7FA 3VR2A 1X7XB 1L7PA 1AKEA 3H7IA 2PUAA 3F0TA 2HNBA 4CMCA 1AHPA 2YY5A 3U4QB 2ODNA 2WZBA 5BXYA 5ALHA 2VF2A 1RHRA 1VBFA 4WACA 1Q74A 4TRMA 4GL2A 4GX0A 2RH5A 4YP9A 2BFWA 1XTTA 1M2VB 2PKRA 1SU7A 3ECCA 2LZJA 4QJ4A 1W1IA 1MOZA 4GSLA 4W4TA 5A71A 2HEGA 2KB0A 5I8WA 4QAJA 2D2EA 1FBTA 5DGTA 4E22A 2JLXA 4ND3A 4DN6A 4O25A 1K1EA 1QE5A 1B1AA 1XHLA 3ESXA 2M1XA 1PWHA 1ZOPA 1DZ3A 1JH9A 3C7DB 3W1WA 3HABA 4B4VA 3VDRA 4DR7B 4Y0VA 3NFRA 1Q1QA 1P9OA 2IP1A 1UOPA 4H9GA 5IYPA 4U2DA 4U5QA 3HCEA 3L7MA 3WNZA 4D2IA 2HXSA 4H77A 2G4CA 4U2CA 5HIIA 5CNKA 5A3VA 2MMGA 4FFDA 3FKSA 5FPTA 4FWTA 1HE8B 2PT7A 3WYCA 2A35A 3P1JA 3PITA 1JSLA 1TM1E 1E4EB 4HH4A 3SR0A 1VBNA 1JKJB 2GZHA 1X94A 2QJFA 2ZBRA 3NBUA 1V1MB 3UJ3X 4WDQA 5DNWA 4NG4A 1QK4A 4IRUB 3KJXA 4XRGA 2ESRA 4NU0A 2FPPA 4Y1GA 3D6VA 4ER7A 1NKSA 3GUUA 1Z0JA 1R10A 1P1FA 2VTEA 2XQKA 3BSWA 2B8EA 1KJZA 3ISVA 3M9WA 3P4XA 3Q1LA 4E2WA 1T9HA 2AQIA 3ABQB 4JEMA 1Y8CA 4G0YA 3SY8A 3TKAA 4GF5A 5KHAA 1DJMA 5FA5A 5LP6F 1NM5C 1LV8A 5JEEA 1PCXA 1N6OA 2ZYSA 1SCBA 1R9NA 5ED0A 3OOJA 2FLWA 5JRDS 4IDEA 4I1RA 4FMCF 2CK3D 3CV3A 3R7WB 3O4GA 3KLNA 2CJYA 4DM7A 5F2EA 5LZ4A 2GCIA 4EKIA 4XONA 1DV1A 4E1AA 3DDUA 1U0EA 1X1CA 4MYCA 3Q38A 4PXAA 1MCZA 2V7VA 2EF0A 4HZUB 1CRWG 1HDGO 2A5GA 3B1KA 3GAMA 4F9EA 2I8LA 4HSEA 2ZJ8A 4N7RA 4X1YA 4CCYB 1RLIA 1RWVA 3ME5A 5DDIP 1A8HA 2WT8A 1KC3A 4QUDA 5TLSA 1FC0A 5IKXA 1EX7A 2BHTA 3BFJA 4KHZA 3U48A 4XB1A 2YMMA 5FAKA 1UDCA 3VOSA 4E7PA 5BMOA 3A6GA 4WWHA 1OWLA 3W2GA 3UO8B 3VYWA 4IKPA 5J2TA 2DF8A 3M4JA 4MHOA 4XX0A 4N8SA 2M6KA 1RPJA 3CZAA 5D5HA 4BLRA 4KAAA 4MWZA 3H84A 4M49A 1Z9BA 3D26A 3KEOA 4PNZA 5AKGA 2AOVA 2A5JA 4F96A 3H5NA 4QXOA 5B1DA 3TL2A 3SQOA 4QYSA 1V8OA 4RV9A 3OPYI 1G0OA 4B48A 3T7TA 4BHTA 4CUKA 5KKCA 1J9ZA 4QEDA 1Y7HA 2WICA 1I3MA 1ZNZA 3AL3A 4XIIA 2VPPA 1G7TA 1YNSA 4Q02A 5I7AA 2JGJA 3GFGA 1E79D 2AEMA 4NYJR 4EJSC 4KGZA 3QEMA 2I3AA 2P2NA 3ML1A 4S0ZA 1J7JA 4HDKB 4JITA 4BNUA 4FOPA 5KJ1A 1RXVA 1UKBA 4NEHB 2AZXA 3VX4A 2Q3FA 1LLCA 4UHHA 2DP4E 3C3KA 5LD2C 2SECE 3MBOA 3H8VA 1D1NA 1G3UA 2VJYA 1MLDA 3AU9A 1TB4A 3C1OA 4UDXX 4NHEA 4EHNA 4I1YA 5CXUA 2QYHA 3BZUA 5DGCA 1XZNA 2OO7A 1G42A 3S1SA 2XJ9A 5E4TA 1Z7GA 2QT1A 4TT8A 1LCIA 4ZCPA 3LUFA 1YDWA 4KLCA