3W5HA

Ultra-high resolution structure of nadh-cytochrome b5 reductase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
272
structure length
272
Chain Sequence
b'STPAITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NADH-cytochrome b5 reductase 3
publication title Elucidations of the catalytic cycle of NADH-cytochrome b5 reductase by X-ray crystallography: new insights into regulation of efficient electron transfer
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
total genus 71
structure length 272
sequence length 272
ec nomenclature ec 1.6.2.2: Cytochrome-b5 reductase.
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
A PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3w5hA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3w5hA02
1XB2A 3LVBA 2X3UA 4YAFA 1FNMA 4G5GA 3OZVA 5TR9A 2ZITA 1UMKA 2BVNA 3B78A 3WY9A 4IW3B 1ZM4A 1GO2A 1VQ5B 1QUFA 1YJ9B 2C77A 1Q81D 1K73D 1QG0A 4EH1A 3QSYA 1E64A 3W5HA 1JA0A 1DG1G 2EIXA 5GV7A 1S0UA 3ZBTA 4MYUA 3JQQA 2OTLB 5KSWB 4ZCMA 2D74A 1R5OA 4M1KA 3ZBUA 2YWFA 3OJXA 1TTTA 3I55B 3CXCB 1YIJB 1G7CA 3PENA 2XEXA 1EXMA 1ZM3A 4DQKA 2XNJA 3MCAA 1YHQB 1ELOA 3QE2A 4HE6A 3CC7B 2BSAA 5H5JA 2RC5A 4LBZA 3WXMA 1EFTA 5GV8A 1TLLA 1VQ8B 1CQXA 2OK8A 3AGQA 2HCJB 4N3GA 4ZCIA 1AMOA 2PLFA 3CW2A 1BQEA 2NPFA 2PIAA 2BMWA 2BM1A 4P3YA 3AGPA 3OJWA 4YAUA 3I56B 3MMPA 4K1XA 4RD6A 2J7KA 4PGOA 1VQ9B 2BPOA 2E1RA 1QX4A 1W2BB 3G4SB 1YJNB 2AHOA 3I1FA 2GQFA 4PC2A 1JJ2B 1QFYA 2BGIA 1VQOB 1A8PA 1KQSB 3CD6B 4LC0A 1U2RA 4M53A 1QVGB 2QEXB 4M2LA 4P6VF 3W5VA 5THXA 3SJZA 2XNCA 2CNDA 1W87A 3E1YE 4AC9A 1E63A 4YAOA 1ZM2A 1IJEA 4HE5A 3WNBA 3P26A 1KK3A 1DARA 2OK7A 4M0LA 3CCSB 1F60A 4DQLA 1D1NA 2VNJA 4NCNA 4R71A 2EFGA 1EFCA 2BGJA 4RCYA 2OTJB 3CB4A 3W5UA 1KK1A 2CRVA 3U6BA 3U6KA 3MHPA 2DEUA 1BJKA 3LRXA 2BF4A 1QUEA 3B8HA 3AVXA 2BM0A 1JB9A 1QGYA 1QVFB 3ZZUA 3U2QA 1GR1A 4AF7A 4LBWA 3V76A 2QTLA 4B43A 5FA6A 2PMDA 1KRHA 4ZGQB 3VNUA 2YWHA 1Q82D 3B82A 3CCJB 1GAQA 4QHYA 4N3NA 4UAJA 1IB0A 1KK2A 1KD1D 1FDRA 1SKQA 4B48A 4ZGNB 3AVWA 3G71B 2VNKA 3ES9A 4F7DA 3OW2B 1K8AD 1M90D 3AVYA 1YITB 3OZUA 1VQNB 4ZV4A 1KTVA 4MYTA 4B44A 1FNDA 4M4SA 4Q7JB 5HXBA 1EFUA 2RC6A 1KK0A 1I7PA 4RD3A 5TV2A 3CCRB 3WBKA 3CMEB 4FN5A 4PC7A 3W2IA 2VNHA 3CCLB 1QFJA 3WNCA 5DSZA 4YHBA 1J9ZA 3QFTA 3W2FA 1GVHA 1VQ7B 2HMAA 4ACBA 1OGIA 1YI2B 1GJRA 4WQMA 4C43A 4TMWA 2DETA 1VQ4B 2VYQA 4J0QA 4G1VA 3ZC3A 4YAWA 4QFMA 1NDHA 1B23P 4AF6A 1VQPB 3VNVA 4TMZA 2BV3A 3QFCA 5JBQA 1R5NA 4LBYA 3CC4B 1YJWB 1CNEA 1FRQA 2B7CA 1B2RA 2QDXA 4PC6A 3CCUB 3J81k 1G7SA 1Q7YD 1DDIA 1H85A 1VQ6B 1TUIA 1H42A 4LBVA 1FNCA 4Y9UA 2VZLA 1K9MD 3CCMB 3AVTA 1EP1B 3FPKA 3W2EA 1BX1A 2BN4A 2FX3A 3CCVB 2B5OA 3W2HA 4TN1A 1QH0A 1QGAA 1Q86D 4RJLA 2DY1A 4TMXA 4RD4A 1CNFA 2YWEA 1OGJA 4TMVA 3FJOA 1ZUNB 1XE1A 3CC2B 3WNDA 1G7RA 4C0SA 3CPWB 2QA4B 1HA3A 3CMAB 1FRNA 1G7TA 3VMFA 4NBSA 3ZZTA 1JNYA 1S72B 1VQKB 1FNBA 3OZWA 3CCEB 1E62A 3A1FA 4FK8A 1JA1A 3QFRA 1KJZA 1R5BA 1D8TA 4G1BA 3LYUA 2VNIA 1BX0A 3ZZ0A 4BPRA 4PC3A 1EWYA 3W2GA 3JQRA 4B3XA 4B4DA 3AVUA 3QFSA 3LO8A 4YALA 2DERA 5H59A 4FWTA 1VQLB 2C78A 1D2EA 1ZM9A 5EMNA 2QN6A 1NJID 1DDGA 4U9UA 3VO1A 1IJFA 1WDTA 3WYAA 1F20A 4RCZA 4ACAA 4Y9RA 4Y7CA 3WBJA 1EP3B 2R6HA 4ZCLA 1TVCA 1N8RD 4RD0A 1VQMB 1M1KD 2B7BA 1N0VC 3E20A 3CCQB 4B47A 1W34A 1SM4A 1EP2B 1W35A 4H9GA 2HDNB 1AIPA 2GPJA 4RD2A 3JQPA 5TY0A 2DCUA 3AVVA 1QFZA 2QMUA 3G6EB 3CRZA 1N0UA 1OB2A 2YWGA 3VO2A 3P27A 1QGZA 2QTZA 4RD1A 1KC8D 1GAWA 4TMTA 4PC1A 1OB5A 5AN9A
chains in the Genus database with same CATH superfamily
3O95A 3DEFA 3QVWA 3H2BA 2PRZA 1HFKA 3REQB 2X3UA 4DZRA 4PG6A 3SBXA 2VWPA 1ANKA 3LPMA 3AU9A 4L74A 1OILA 1U7XA 2QLMA 4LZZA 1ORVA 1XZPA 3DT6A 2Q9BA 4JMPA 3NTLA 4Q01A 5ITWA 5TMPA 1PNRA 1EDZA 5CT4A 1U6JA 2DWUA 3QY0A 1BPLA 2O8DB 5IYWA 4LF7B 4D4HA 2GLTA 3GLGB 5AM4A 5DLYA 1U7WA 1O57A 1XXHA 4XTRA 3A8IA 1H1LB 4DC0A 2HSEA 3AR2A 3F74A 5IP5A 3PFKA 4QG7A 2DPMA 3G0DA 4NBKA 5A3JA 3D2BA 1L5FA 4J29A 4N82A 4YRMA 1PJCA 3U4MA 1AS2A 4HDNA 3EISA 1YKFA 2DBRA 4ZVOA 1PR2A 3TQIA 3U3ZA 3UKOA 4Q4JA 4JLOA 2PX5A 4RETA 4EHDA 2ZSUA 3TEJA 1HNWB 4CQMD 3IURA 3NAMA 4N4AA 1YQQA 4PSKA 1NI4B 3WGQA 4C78A 3KEFA 3RHSA 3WYDA 4MW9A 3LUJA 1NVFA 3G5LA 3PITA 4C6RA 2R68A 4ZOCA 3LBFA 2QTBA 1IHYA 1XZMA 1AK1A 1OJ7A 3G9TA 3OZEA 4DLLA 3AEQB 1VDZA 4V1CB 2IVFA 4DANA 4DMGA 3NBMA 1UBLS 4JQSA 4KQCA 2YJ6A 3EIOA 2WSSA 3G2JA 4N40A 4BV9A 3KFXA 1Q3KA 4RKEA 4JJEA 1TC2A 1C3XA 5CA1B 4UM9B 5KNBD 1RMYA 4KJZA 1CPYA 2CD9A 3ZGYA 2P35A 2Y6UA 3KQPA 2IXEA 4WN9A 3K16A 5EE0A 4XFJA 4ROSA 4XX0A 1X1QA 4U2CA 3ASQA 3X1ZA 2UYYA 2XA9A 1ECCA 2X0JA 2VJIA 3PDCA 2JK1A 2E4ZA 2JW5A 3QTBA 3MTBA 2WJ6A 1JXQA 2ZT5A 1P2VA 3ZEIA 2CWDA 2B0JA 2VEOA 4AJEA 9ABPA 1KEUA 2XBLA 1LBHA 2PZLA 3MTIA 1YQ9A 3LKZA 1E6WA 1QAMA 2AQ8A 2OBTA 2FWRA 4KQ6A 3UA3A 1R6TA 4BDTA 1OB0A 1GUBA 2ZPTX 5BVGB 1KA9H 2BBSA 3PQ2A 5IK2D 2C57A 2W6ID 1V8ZA 3AEUA 5HMLA 1O0SA 2IY9A 3DDCA 1ISIA 4ER5A 4TL8A 1DELA 5ALQA 1ADFA 3ME5A 2ZP1A 5BUCA 1T3LA 5FTNA 3G8AA 4YRJA 2CW5A 2WF8A 4FCCA 1W30A 2PIAA 3UC9A 4MUIA 4HAWA 2XZPA 5U4XA 2CHVA 3RRYA 2WAOA 2JLUA 4QDXA 2VPZA 1WZUA 3AKDA 3L3BA 4YAUA 1Z12A 2CLMB 2P9FA 3GK3A 3OAAD 4WHMA 1XCPA 3AZPA 3G23A 1W581 4WZBE 1XU7A 2AEFA 4UM5A 2OLKA 3CNOA 2ONYA 4I9HA 4IRUB 3ZU5A 5AOVA 3NHZA 1S89A 3HADA 2YXEA 4H4CA 4FXUA 2WJZB 3DQQA 4CR7A 1BRTA 2GKGA 2Q27A 1HZJA 4TTVA 3H6HA 1FTQA 4JVOA 3NVDA 4Y7DA 4NBNA 5I7EA 1EVEA 1Z5UA 2O50A 3IP8A 3JTMA 4PC2A 4JUIA 1XCBA 1YHYA 5HG0A 2UZ3A 4OQMA 4IEIA 3V8MA 4L75A 1JE0A 2VJYA 1Q6YA 1KZLA 5H3CA 5KYGA 3DULA 1IL0A 1RYMA 4Q48A 2IYLD 3IXLA 3LBYA 3LRPA 3ZWCA 5FHRA 3HDVA 3COJA 4H77A 1PL6A 4N9WA 4M2LA 3L7DA 4HDCA 3VSDA 2FWIA 1D03A 3GUUA 2VJPA 1WSRA 4NZNA 1FYFA 1OC2A 2A0XA 4ERNA 2OV4A 3DBIA 5F3RA 3W3AD 2VJDA 5JMOA 1CY0A 1AB6A 3VBCA 3UHPA 4FR5A 4B8ZA 1JU3A 2V7TA 3L8CA 4BB6A 1XR3A 1P1HA 1HLDA 2ZDQA 3CVOA 3DOOA 3JRXA 4G5XA 5TRTA 3VR4A 4D6XA 1QPBA 3GEDA 4Q1VA 3H42B 4M8NE 1O5TA 1B8OA 1N5MA 4PNEA 5K09A 2B61A 1PZFA 4ZVLA 4PO9A 3K1AB 3BFVA 3OPOA 2NXCA 3PPIA 4QQNA 4YECA 4QUDA 3FYDA 5EP3A 4Z3OA 2VA8A 3HDGA 5CYPA 2DJIA 3TDKA 2WHPB 2ILVA 2ZCVA 4E2ZA 1QTIA 4MUBA 4ZQFA 2VJOA 2V58A 3VC3A 4YJFB 5E2BA 1FL9A 3KKNA 4R71A 1ZONA 2BI8A 3RYHB 3KZCA 5K0GA 2B6HA 1A5AB 4D46A 2PIDA 1OW3B 4KAFA 1ISPA 3WKDA 4J16A 3CB4A 2ZCJA 4PLYA 4BLTA 5LZ7A 5FWNA 5JZOA 1O58A 3HN6A 4EQ6A 3TZKA 1UXJA 2CUKA 3FZGA 1DRJA 3SC6A 4J0DA 3THWA 2WA2A 1SD5A 4AP6A 3E3AA 2QAGA 3I2IA 1M2VB 3TG8A 4PPQA 1LU9A 4PZYA 1QRSA 4DR4B 3ZLUA 3AVXA 2DWQA 2FPWA 1UUFA 3E0QA 4Q9IA 2WVHA 3D7KA 3VO8A 3ZGZA 3U31A 1V0JA 3FH0A 2BSQA 4NECA 1JWLA 1ORWA 4P5EA 3DS8A 5FDFA 2PRKA 5LWHA 1CF4A 3KUCA 4AF7A 1G3IA 3KZKA 4MV3A 1YBHA 5IAOA 3GD7A 1DBQA 1E4YA 5A0TA 2PMDA 5E9QA 1M1UA 4IVNA 1SOUA 2B8WA 2XAUA 2V4ZA 2FFBA 1XTZA 1U0GA 3N3BC 4JMLA 2OAGA 5ECGC 3V6LA 3ZU3A 2C5GA 3I32A 2PS1A 3CCJB 1GRQA 2WZDA 4AY6A 3SFZA 1TPYA 3HU5A 4ZOBA 5IDXA 1YDMA 1FUUA 3QF7A 1Z73A 3WGGA 2F00A 4X1YB 1W2HA 2V45A 3LECA 3GH1A 1BYUA 3KV1A 2YV4A 2BMVA 4J1SA 3H3XA 3PD0A 4JGBA 3IOYA 5LYJB 3D3KA 3EXIA 4DFDA 4BKPA 3SYLA 4JNKA 4EM6A 2Y2VA 4IGEA 3BILA 3ZDQA 4EELA 4I36A 2IBSA 1MO5A 3CKYA 1HT2E 5HJEA 1L4LA 4MYDA 1UWLA 1S3SA 1NXTA 2E89A 3B3JA 3ORRA 2QF7A 1ISJA 3E4DA 3IQWA 5IDYA 1U7TA 4L7VA 1BW9A 3KSBC 4OP7A 3JR7A 5FTJA 4C2TA 1QDUA 3ELDA 5DM60 3QUTA 4LW8A 4B8YA 2WTBA 3EY4A 4MVJI 4TKVA 1XROA 2P2LA 1W36D 1OXSC 1QF7A 5HEKA 3OT1B 1WSVA 1BEUB 1N5IA 4ZQGA 4EDFA 1CS4C 2G40A 4YRGA 2HXGA 4FI3F 4AJHA 5LN1A 3BL8A 1B2LA 3ORFA 3ROFA 4I5DA 3HJUA 2JL1A 5B7GA 1CUJA 1ULTA 1ESZA 3GJRA 2W48A 2OGZA 3U0BA 4D9NA 4KXMA 3CMEB 4EL0A 3ZW8A 5IVDA 1GDDA 4TLDA 4TSFD 1Z6ZA 2OV3A 3PUHA 4YNBA 1MFPA 4HT3B 3DZBA 4YRZA 2V4DA 4YVFA 5I7OA 3I61A 1BXKA 1VKOA 3FHOA 1RYZA 1Y9EA 3IPRA 4KN5A 2ZRCA 1E5TA 2YVUA 1RJ9B 5HIKA 4S0ZA 1XCGB 1YQWA 4RXUA 2PD4A 4ARUA 1CVRA 2P68A 3EGOA 3ND6A 4NBUA 2BH2A 1Y5LA 4Q34A 1YI2B 1ZK0A 3HXMA 1XZDA 3P9YA 5DE3A 2IPNA 1PYOA 3T9AA 4XUEA 3DWIA 4JP3A 5A9RA 4G1VA 3NE5B 2BFMA 1S6YA 3HSSA 3C6MA 3WRXA 2Y1FA 1AN0A 2RE8A 4MS4A 1OXVA 2O14A 2NUTB 1P72A 3SXUB 1S9HA 1X7WA 3OEEA 3LSYA 3M4ZA 4JKOA 3C87A 5BRJA 4DMMA 3P0FA 3I62A 1M33A 1VKHA 1QZZA 1U81A 3QK7A 2H2AA 3WQBA 3AESA 1EX9A 2VXOA 4JZYA 4N65A 4QQRA 1A9SA 4XR4A 5GY7A 3TL6A 3EGVA 2N0SA 4PABA 1E8DA 4IDDA 1DAHA 4JBGA 1KSGA 4Q9HA 3WL3A 2QDXA 1W0JD 2D62A 3QKRB 3J81k 4OSEA 3S8MA 4C89A 4DNRB 1U3UA 2OZPA 1NJ5A 1MR3F 4A2QA 3TM5A 1BDHA 2XYRA 3HN2A 1Q7YD 4V0MA 3DONA 2GCNA 4GIBA 2GN0A 1NV9A 1KO7A 5DO9A 3KL2A 4NDAA 5FO0A 5CURA 1N57A 1PX0A 1YASA 1TUIA 1VSUA 3FNBA 5AKZA 3V7UA 4C4PA 3HXOA 3DEIA 3IMEA 5BXYA 2PKQP 2OYSA 2Q3MA 2FMKA 4HQ0A 3EWSA 5EJMA 4X95A 4H6PA 1EPUA 1J7KA 3A11A 3EN0A 1EDOA 4K87A 1XRJA 1BX1A 4PR0A 2D7DA 3W2HA 4S05A 3PNKA 1ZI9A 2JH3A 1G64A 4XWAA 2F1JA 1HDYA 1M1YA 2JIDA 2GRJA 2P9CA 4J2OA 4YRBA 4Z99A 2BC9A 5FPYA 3CR7A 4FGUA 5LWQA 1T4MA 1NYQA 4HO1X 4IZ6A 2VT6A 5G0WA 2YVKA 3RTCA 3V8VA 2PKCA 3BAZA 4DDUA 3VX3A 3EPHA 3QXHA 4HADA 1PJQA 3VJKA 2VDWA 5J5CA 4NY1A 3FR8A 3ZTWA 3T3HA 2GILA 1XE1A 4CG1A 4CLOA 5HQ3A 2JB9A 1XZFA 5LSAA 1E2GA 1E4OA 3ZCTA 1KI8A 2P2ZA 2ID9A 1B73A 1ZM7A 2CDCA 3H2KA 2XRMA 2NVWA 5LLTA 1ZJYA 2DQYA 4P7JA 3F9IA 1IONA 1ZCZA 2WHYA 4LZNA 3RG2A 1BH2A 1C7ZA 4O4JA 3TR6A 3QU7A 2CJYA 1I6LA 2W90A 3ROKA 2ECOA 1BXGB 4JVSB 4OP3A 3MWLA 4LF9B 1E58A 2FPIB 4DCCA 3U7FB 2UYQA 1JVBA 5LZ8A 5I9SA 5JJIA 2X8KA 1G38A 5I3ZA 3NQ41 5EMLA 4JH0A 1PS0A 1YI8A 2ZSFA 4MPDA 5KVAA 5JC8A 1USVA 1ML4A 1SC6A 3CO0S 5EIHA 1P1JA 1W4RA 5JISA 3H8WA 1UWCA 2MR6A 2W8BA 2N1BA 1R5BA 3F8WA 3OPNA 4NR0A 3N0TA 4RGVA 4NLLA 4NG5A 1BVUA 1RXEA 1XFAA 5L46A 1XU4A 1AHHA 2FHSA 4LG1A 2XVXA 4M1OA 4U2BA 4C1NA 4RLHA 4AY3A 2EOAA 3CF6R 5E8JA 3IVMA 1PT5A 3A6LA 3B1ZA 3TX6A 4HGOA 2V7UA 2UXBB 2GHQA 4W9RA 4UE6A 3FTEA 3RVSA 2FB9A 2JLAA 1ECPA 4KACA 3CN9A 1GR0A 2O4UX 2C2BA 4HD8A 4EW3A 2ISQA 3IEVA 2C99A 4DM7A 1ZSYA 2VEDA 3T3EA 1ZMOA 4Z9XA 5JDCC 5K8CA 3GARA 1N32B 4WAUA 1X8LA 2PKEA 2QRKA 2WU8A 2XYQA 4JLDA 1GZ4A 4CMIB 4NWIA 1EWQA 2LXNA 2IA5A 2DX7A 3E9MA 2IUUA 2R1TB 4IXNA 4LX0A 4TM8A 4O3FA 2OBRA 2YN4A 4IDOA 3HVHA 1AQUA 5EFZA 3DOIA 1KQFA 5DOVA 1MXFA 2X2OA 3PTZA 3W04A 2IP4A 2R5WA 2FEAA 4ZU1X 4IS2A 3ER9A 1DPFA 4L28A 2A0KA 5K8JB 5L3QA 1V0FA 1GYRA 1WDTA 5B1EA 3EAQA 4I50B 1MPTA 1TIKA 1UQTA 1X0VA 4YRRA 5AW0A 4CWAA 4M1YA 5JEDA 3U16A 1QS0B 1JG6A 1ZLXA 3D8NA 1NPTO 3JAKA 3FPAA 1PWHA 4WESA 1E79D 3M1LA 4X71A 5C4GB 1E66A 1OTHA 1V3UA 4MVJF 4R1SA 5T4FA 3C48A 1OPRA 4TS3A 4GHWA 1NE2A 4HQ6A 1PBNA 4LKOA 2IYVA 2WFAA 1EUCB 1N5DA 2BEVB 4IV5A 2G6BA 4QX6A 4CTJA 5IJWA 1RT9A 2C92A 3MJSA 1FFWA 4IQ0A 4I6JA 5HW0A 5JAQA 3WGZA 1S5PA 2EZ8A 4K6FA 2V9PA 4NYMQ 4DQ0A 4MVJD 5CH3A 3UANA 3WLEA 5FOTA 3K5WA 3UMSA 3OOJA 5BOSB 5E7MA 1V11A 4IZIA 3VR5D 1SHUX 3TIVA 2VBUA 1KY4A 1AUQA 1DEOA 4O8CA 3W7AA 3QF4A 3F7NA 3WGKA 4ZV7A 5SY6A 5BSWA 3U4QA 2YWDA 2ZBGA 3PGMA 4C20A 2OYRA 3WFIA 4WCVA 5CT6A 1EIZA 1LDMA 1PF7E 2VQ6A 4AJ1A 4YV0A 4FFSA 2G71A 1RWBA 2YWGA 2VKQA 1JT2A 1XKQA 2XMQA 4IOJA 1AGNA 2Q07A 2OO5A 1W88A 2FFJA 2XT9A 1P7CA 5DXAA 3IILA 1JF8A 1DRUA 3X44A 4RTKA 1MZPA 4JV5B 4TMTA 3BJEA 1SEPA 3GJQA 4YLGA 2ZUSA 1HE3A 2HTFA 2FSHA 3CJTA 4OHPA 1AJEA 1XB2A 1DT5A 1VLZA 3ASUA 3OQVA 2BW0A 1DUSA 3MC1A 1T29A 4POAA 3OPMA 5HM6A 2QKYA 3O8DA 2JI8A 2PGAA 2XPCA 3FAZA 3AY6A 4V03A 3ZZ1A 4NZ9A 4CF3A 3A4YA 1SMKA 1SVWA 2WWGA 4TS1A 2Y1WA 3NAQA 4FR0A 3SYRA 2HIAA 4J8PA 4GI5A 4KXNA 3VKWA 4RLQA 4OHVA 1CEXA 3TW6A 3QBJA 1IG3A 1B6TA 2XB6A 3V4SA 1KETA 3H4MA 3G13A 3EVZA 3GBPA 2GPNA 2LV8A 2WPDD 3A36A 3HN7A 4JQZA 2C9BA 4R8RA 1Q83A 1XJQA 3H5NA 4J94A 5COQA 1NWHA 4L76A 3M9XA 1QU2A 3QG5A 2QVBA 3W79A 1VL8A 5J47A 1JSCA 1P61B 3GLHE 4Y6QA 3TNLA 2AWNA 4BB0A 4DL9A 2Y2UA 4E3WA 3OCWA 5JSFA 1E64A 1GGMA 2OCGA 1JA0A 1MORA 1TTPB 1PFVA 2GBIA 1MX3A 3P9PA 1DLIA 3PFFA 3R23A 1JKJB 2CE7A 1I5OA 3AUJB 3HA7A 3HJNA 1T0BA 4ID3A 4E5UA 1U0BB 4I5EA 4AT1A 1Q7GA 1X7GA 2A1IA 2AQKA 1S0UA 2DFDA 5A6VA 2O2YA 3PJDA 3F67A 1FS4A 5ALKA 3GG2A 2XNDD 3SJCA 1WVMA 1AV7A 4KQMA 4ED9A 3W3AH 1DCFA 3JQFC 2CYAA 2E5FA 5DCUA 1HGXA 3EC7A 4GLFA 1XZEA 4IUYA 3GV0A 2OC9A 3ANYB 3DE5X 4FYYA 5E0KB 3ZLVA 4QTUB 1DAEA 4BWVA 2W9XA 5K3SA 3N6XA 4QDUA 3PHIA 1X2EA 3WJ2A 4YV2A 1ND5A 3EVAA 4GOXA 1NBWB 1JXOA 1R00A 1VA4A 3IQEA 2EERA 4C6TB 4YAGA 3N2GA 5AM2A 1I1HA 3Q8LA 4MA4A 5E9JA 4MKZA 1IFXA 2YL2A 3CWZA 3JYHA 2X0DA 2GZ3A 4P36A 3U7EB 5P21A 4RQAA 3JQAD 4D8VA 3DDYA 2SKEA 4OJQA 2E1BA 1H5QA 2GK7A 1UBKS 2XUFA 3Q3HA 4V0SA 4YJHB 4C4ZA 3I2YX 2DRIA 3DEZA 4WY5A 3T99A 3NHWA 1I0IA 5KDLA 3ZX4A 3MLAA 4FGWA 3VSCA 5KC8A 4IUBS 4QULA 4A1OA 4CI0B 1H8HD 4TYWA 1BGWA 4HGYA 1QG6A 3AHJA 3L7NA 4HE6A 4UAGA 1U2DA 2B1GA 1JW9B 2XF2A 1DTWB 5H5JA 1J8YF 1KFCB 2RK3A 3B36A 2JGMA 3C97A 3EVGA 4FD2A 2W8ZA 2X23A 1UBSB 4RXMA 1M0SA 4ZEVA 2WSBA 2IXFA 1SPBS 5BUZA 1L1EA 4KZKA 2KBEA 3BSWA 1ULUA 4NOMA 3WWZA 2I1LA 1IEVA 4FP9A 3VPCA 5LXTA 3DPUA 3IE1A 3GWGA 4BQRA 4BYGA 2M1XA 3U3KA 2NPFA 1EFHA 2IEGA 1KAGA 3VOSA 1N1EA 4XB6B 4KV7A 3UJ7A 1O97C 1CZKA 1RPTA 3F9CA 1LW7A 4JOCA 3VR6A 1DIAA 2Z2ZA 5I8PA 1Z33A 5EMJA 1LRLA 2XYPA 4PGOA 3HBFA 3BH4A 4LY6A 2IT1A 3H5AA 4GR9A 3OTQA 1C30B 4JK3A 1U1IA 3N87A 3T3PB 5K6TA 2GFQA 4YDSA 5JJKA 2A9JA 3CNEA 3C5CA 4DNQA 1TF2A 3KQUA 1EZZA 2FK8A 3HMKA 5EXEA 4X6LA 2AHOA 3OZDA 4FD3A 4MRVA 4PW0A 5HDQA 2VPWA 2V7GA 1CUDA 1RU3A 1YQGA 3E2PA 4TXMA 2OCKA 5H70A 5G53C 4BC1A 4OX9Y 3FLBA 1O94D 5FFFA 3CS3A 1YVRA 1A8PA 4U1RA 1L4EA 1YS4A 2YQ4A 5EE3A 1Y1TA 4DUGD 4LC0A 3WLSA 1WKBA 4V0NA 4K46A 2W43A 1M6VA 4LJKA 1U2RA 3G0IA 4MB2A 3BHJA 1LWOA 3IAFA 1OX4B 1YB4A 3L8ZA 1ZEJA 4MAFA 2A84A 5E6RA 3AI3A 1ID1A 1AKRA 3K30A 4R41A 2XNCA 2ZREA 5EWMB 3KU1A 4WWHA 1IHOA 1R50A 1CVLA 2HB6A 1MW9X 3CR3C 4H1TA 1IIBA 3L6BA 3W9UA 1L7VC 5HE9A 4EVSA 4Q1CA 2I4OA 1Z0FA 1XX6A 1ZPDA 4M38A 1IHDA 2B5VA 1IJEA 3GH3A 3H5RA 1Y1SA 1TM2A 1MAHA 2IZZA 3IAUA 4B0OA 4RWEA 2OAQ1 3M3DA 4LXTA 1PN3A 4OP2A 5D7NA 3DLIA 1O8CA 4TYQA 5AWFC 4TX1A 1L5RA 2RB5A 5IDQA 2ZBPA 1T0JB 4JYMA 1E2FA 3CX3A 1OHHA 4RK7A 4W6QA 1XEWX 4II3A 5A5GA 1G5QA 1ONOA 2VNJA 1P7YA 3OM1A 4XSGA 1PHRA 4YRPA 4CIDA 3SQXA 1JDVA 2GN6A 5EJ9A 4IDPA 1CQJA 3O8NA 4NPAA 1XJCA 3KKQA 1QG4A 3R3YA 5CRIA 3X1DA 4EEXA 1YF3A 4OYRA 3WYGA 2KQUA 3KPJA 1IQRA 5JCOA 2H85A 1P5FA 5K8UA 3GDHA 1EXWA 4G2NA 1V26A 3HNOA 3FTFA 4Y2QA 5HS6A 2AVNA 4N41A 4K88A 1QMPA 1T36A 3TVYA 2P1RA 3QBTA 4Y6LA 1SZCA 2X53S 1GGKA 1OX5A 1D2MA 1ZN9A 4OK5A 4DA9A 3MLBA 1QHFA 2ZUTA 4LN1A 2PX4A 3JZIA 4FIDA 4B2LA 1H9AA 2VJLA 1SZDA 1Y4UA 1JHMA 4WK2B 3VU1A 2FMTA 1FJHA 3IO5A 2ZULA 1U3GA 4KL8S 4KWHA 5DIZA 5TPWA 3V8NA 1VSTA 2NO7A 5CLQA 4GOND 1MQSA 1Q12A 1NI3A 1V9CA 3KSZO 3N75A 4CLXA 1E9CA 2JGFA 4G4SP 3B8EA 4CIBA 1RYEA 2O8FA 2HWWA 2LD4A 4AKSA 5IXSA 2HCTA 1RE0A 2OWEA 1Z07A 2HZ7A 4NICA 4KHPB 5FA6A 1A96A 1ZCBA 1VZ3A 1BMTA 3AXSA 1UBCA 1R9GA 2FPPA 2NQTA 3G6WA 2DKOA 5C35A 2CD7A 3CLKA 2Q1UA 2W2LA 2EVWX 5IVPA 621PA 2GCPA 3HRKA 5JAOA 1X38A 3A1CA 4S1PA 1GAQA 4HNVA 2WJJA 2XWSA 1A9PA 1KK2A 1P9OA 4LHWA 4AKTA 3B9RA 3MYRA 1ESMA 4QARA 5D3MA 1IQPA 1S9DA 1KBOA 3T7EA 2LCFA 2GAIA 3RQSA 5IW8A 1R0YA 4PG8A 1JR4A 3OPQA 2Z3VA 4BMOB 4KRFA 2EKBA 4BCCA 1IH8A 2CHQA 4D6YA 4EZEA 3GJ5A 3HUTA 3S70A 2GO1A 2DSTA 1KSHA 5DHUA 3M5DA 1RXYA 1JSLA 2I2CA 1HRKA 3CEPB 4ZAZA 4QDJA 1VCOA 1K9SA 5BN4B 5PNTA 2GA9A 1A9ZA 3NHBA 4L6IA 1SC1A 2RGDA 2OFOA 5LOVF 3KQOA 2WYVA 4HGRA 1L5GB 4MHTA 4ZT6A 4OX9B 1MAAA 4MYTA 1GGHA 3AW8A 3NT2A 3BXXA 3ZTTA 4EGJA 1JPUA 1IMOA 1V45E 2W4QA 4JQOA 3VMMA 3O90A 2RHGB 1D5WA 3LH5A 1Q91A 4HFMA 4Q3OA 4FOTA 5AW3A 4RY2A 4YMWA 1AKMA 3F98A 3E03A 5GONF 1SC4A 1F0PA 2WJIA 3S7ZA 3N2KA 1AURA 1ONPA 3AHEA 4OBWA 2ZAGA 1KK0A 4CR8A 5LU8A 3JARA 5AKKA 1P2GA 3N05A 4R8VA 1IZ8A 2B1RA 3W6PA 2JHFA 2VZ0A 5KWEA 1E3XA 1W2GA 2CNKA 4PC7A 2VDVE 3NBXX 3IGFA 3KZMA 1M73E 3LF1A 1VRCA 3CTAA 1TUBB 1B8VA 1GXSA 4WOPA 4EMTA 1ULZA 2Q4EA 3ABQB 3B7WA 3I5AA 1I51A 1PV2A 4UBNA 5KINB 3VH2A 4QYIB 1PEYA 1U3DA 3HKEA 2HF8A 3W2FA 4AX4A 1ZEMA 2BRUC 3UV7A 3ZLJA 2IGBA 3DBLB 1AM4D 4IJMA 2IWHA 3U3RA 3F6YA 4MK4A 5AESA 5LZ2A 1J5EB 1ZIPA 4AS3A 4BTEA 1CS0A 1MG5A 2C3UA 2LTAA 4FSXA 4Z0TA 1GV1A 4AZVA 1RFLA 2A5JA 2CJXA 1JR6A 1VQ4B 4LOAA 2PS3A 1UQUA 2J07A 2VJMB 3ZC3A 1SUAA 2YRWA 1IRXA 3CLUD 1RZUA 1XMPA 4OPMA 3FVRA 3LHDA 4R69A 3W8NA 5AO9A 3E9DA 2XUDA 1Y8CA 3UMYA 1PS8A 2VT3A 1KEWA 4BO0A 1VQPB 2BR5A 4NU6A 1B16A 1Z36A 1GTZA 1I4LD 3NEYA 1U0NA 3P0IA 1R0KA 2JIPA 4L4ZA 2NSHA 2I66A 3I30X 4LDRA 5ALJA 4DG8A 3PQ3A 5ECDA 1QR6A 1CYDA 1U9CA 2VF8A 5K4GA 5AJXA 5ECWA 4KB5A 2E85A 2PUDA 5E2IA 2B7CA 3RCBA 2R5NA 1T3ZA 4LJAA 1YU6A 2J7PD 1C0EA 1VCIA 2YHIA 2XAAA 3FWHA 3IAM6 3O92A 3DYIA 3M1AA 3VNQA 2I9PA 1ZOIA 2UZ4A 4KNYA 2G1UA 1C80A 2O7QA 2JD0A 2G07A 2ATVA 4FHCA 3L6UA 2IYPA 3RYCB 4JEHA 5F4OA 5HIAA 2ZSHA 4KI7A 5CD1A 1DQYA 3IRVA 4DJDC 3UJHA 5JT1A 1NP3A 1R5JA 4BNLA 1EVLA 4IIYA 4L4YA 1V1RB 1A69A 2Q28A 1RACA 3EXEA 3E1KA 4GL2A 4LYHA 2GERA 1KI6B 3LW8A 4LHVA 4UW9A 3WMRA 4CM6A 2BY4A 5AW8A 4ZEXA 3RWMB 1ZD3A 5DM2A 3DTVB 3QBVA 4UCXA 4QNNA 1T26A 1R4AA 2ZT6A 1Q86D 1QXSA 3BULA 5BSXA 1QYCA 5FWYB 4WPGA 4QG3A 3INGA 1WVIA 1BQ3A 5A0FA 3QLEA 3B48A 1W5SA 2YMQA 3ZY6A 3TW0A 1JJAA 4BQFA 1H6BA 2Y9MB 4MRSA 1OR8A 2P5TB 5E3HA 2O52A 5FL7D 1Z88A 4L95C 4MVJH 3C3WA 4GFDA 5IYNA 1P2TA 1YZLA 1BYIA 1S4QA 3B70A 2PL9A 3C3XA 3VR5H 2BMJA 1N2CE 4JITA 5DFAA 1IDN1 1SIWA 3FZNA 5AHWA 1HPLA 5CA0A 2I33A 3UPUA 2VBVA 4PIPA 4G4GA 4G1FA 1SU7A 3KJZA 5FUMA 1GNSA 3PHJA 4RADA 1Q6ZA 4R4JA 3KOZA 1FZQA 3F4LA 3QQ5A 4ZOEA 5C8YA 4DJTA 2JCSA 4F6RA 2DUMA 1MNAA 4H7HA 5HQJA 2ZRKA 1N5OX 2XQFA 3EVFA 4MULA 3QX8A 3ADOA 4XX0B 1YUNA 4Z3KA 5JRJA 4NOKA 2QXUA 1DX4A 2A0WA 3V4ZA 1RYDA 3PP8A 4J1TC 2WJVA 3LY7A 5BO5A 4B4OA 2IIVA 2NADA 5FBRB 3UB2A 1OD6A 5DTQA 2F1RA 2BTEA 3FWZA 1E62A 4BP8A 3MT7A 3VTKA 4CPDA 3EHDA 2WLTA 5AK3A 3IOMA 3LRTA 5FRDA 3H86A 2J5RA 3HB5X 2R87A 3OA0A 3OEYA 2BE7A 1YOBA 4PVDA 3A4NA 1TLFA 2WKPA 1NUAA 4LYYA 2FLWA 4PX9A 4QFCA 4L4XA 1ZU4A 5HJ7A 2ONZA 4KPYA 2PH1A 3GLVA 3MBKA 3GFTA 3NU1A 1YRBA 4H16A 4HZUB 5FF9A 2J6HA 3WGVA 4CKCB 5H7XA 1P60A 1OFIA 2JS7A 1MRSA 3T5PA 3LTNC 2C2YA 2Q4RA 4IZOA 3RS2A 1YZHA 3GZNA 1OROA 3QJ5A 3A14A 4PAGA 5BSHA 4RVUA 1CZOA 1UMCA 3KQVA 3AM4A 3L79A 4WI1A 5KKCA 4X07A 3LDGA 2WYIA 4NOJA 3L7IA 5I5EA 2DHQA 5CW2A 2DB3A 4ER7A 1DXYA 1JECA 1XZJA 1HK7A 1BVYF 1VL1A 2P9ZA 5E7QA 3FOZA 1AKUA 4P3PA 2J08A 4QRIA 4R1QA 2ZJYA 2DFPA 5IT0A 1BMQA 1MMFB 4ZAXA 1DLJA 1G42A 4GX5A 4NENA 4JJ7A 2O8VA 5EUMA 2O0MA 2Y4NA 2AT1A 4A8PA 1IATA 2WM3A 1TQ8A 1N4DA 3I2JA 1T0PA 2MTBA 3GVPA 4O59O 1VB5A 2G9NA 3UIEA 4MMYB 3PFNA 2BGKA 3W9BA 3KX2A 4FQ5A 3WRVA 1C8VB 2BCEA 1UD4A 2D2XA 2WJWA 3FGOA 3A2KA 2JDIA 1VQMB 1SKYB 1M1KD 2HIMA 4LVNA 4P4GA 1N36B 3ZQ6A 1Z38A 4CMEC 4YRSA 3WWYA 1E32A 4PZZA 5FLXA 2FPMA 5D6OA 4E6EA 1MA0A 3COVA 2DBQA 3SEZA 4CL2A 3ESXA 1LQUA 2ZR8A 1Z2OX 3BEOA 2VJBA 1QFZA 3PCTA 4QGBA 3W4IA 1M34A 3V55A 2IW3A 1VHWA 3GJ7A 3RWBA 2OBBA 5G0VA 1G0NA 3QPDA 3SG0A 4B75A 4R9NA 4EY6A 5AKXA 3VU8A 3WKEA 4MRMA 3QLTA 1G8KA 1H65A 1PKEA 2BKAA 2R00C 3IULA 3O8CA 3EVBA 1YRAA 2QRNA 4GPZA 2F8SA 2JGNA 2GEJA 2WD9A 3COYA 2ANCA 3ENNA 3IB6A 4NCXA 1OLSB 2GCOB 3M49A 3PG5A 4HUQA 4Q7EA 3QVTA 4XE5A 2BFFB 4B1FA 4BX0A 1AQLA 4FX2A 3T53B 3VYRB 3FNQA 5CCXA 1SC9A 1PE0A 2ASEA 2IYQA 2K4MA 1TQHA 4DE5A 2BTOA 4ARIA 2CY0A 1RS0A 3CPHA 4C3UA 2YWCA 3COZA 3WZ2A 3KTDA 4R1MA 1UC9A 1E1RA 1I7DA 3BE5A 5HTOA 2PE3A 5CDUA 1FSZA 2O9JA 3OZFA 2VC2B 4Y2RA 3D7LA 1DKPA 4MS3A 1LPSA 2DHCA 1N6KA 1X70A 2QMEA 1EHYA 1WSAA 1PL8A 4PFKA 2BKEA 2H29A 4PYIA 1MDBA 3RVPA 1OTXA 1FMTA 3KHTA 4B6GA 3HCPA 1QV7A 2H31A 5KTRA 1G21B 4E51A 1WUJS 3IXMA 3WDKA 1U7DA 5EZYF 2OECA 5BN3A 5JZBA 1GHTA 2GREA 1MH9A 1XJ5A 2GM9A 4KDFA 1XXHE 4J7AA 4AUMA 1FUYB 3EG9B 3U4GA 4B83A 4Q1EA 3JASA 1VJRA 2VJKA 1Y5IA 4IV0A 3KHUA 1QU3A 5AOBA 3BH7A 4AZ3B 2XHEA 1F0NA 3DMGA 5FHQA 4NEHB 3V4RA 2VA9A 3FHCB 1GITA 1KE1A 4JYCA 5JD4A 3QW4B 1N05A 3TOCA 3TPFA 5JANA 3L0CA 3WNVA 4XKVA 3K05A 3ZDDA 4UM8B 3WLOA 3V1UA 5EG5A 4G36A 4JEUA 2PL1A 4MYSA 2X4DA 4CETA 5H9WA 3ZE0B 5K9ZA 4PM4A 4CCSA 821PA 3DM9B 4DUYB 5F2KA 1ADCA 3KVVA 4RHFA 3CUSA 4EX7A 4K03A 4M3NA 4QJ5A 4C29A 2UUCB 1XZQA 1LJLA 2UZIR 2WMYA 3TR0A 3NS7A 1YIJB 3O0TA 1PK7A 5K0EA 2OTCA 2R6ZA 3P71T 4P54A 4MCIA 4CU5A 1N6OA 5JSHA 2DPXA 3F7TA 5EWJA 1P45A 1R8SA 3PUMA 3R3VA 4NL4H 4NBWA 3G5TA 2B1IA 2JIOA 2N1MA 3UAXA 2SICE 2R25B 4V3BA 3NHUA 4CKEA 3AHGA 3FPLA 4QLBA 1BW9B 3BDIA 1UKYA 1Y4DE 3T56B 4E5NA 3NV9A 4E4RA 1PR1A 5JR3A 3GLFA 1Z7GA 3R0QA 4KLZA 4N5MA 4FOSA 5K0LA 1YJ5A 5LA6F 2NP7A 1CHDA 3GN1A 2Z2YA 3KUKA 1ECBA 1M7BA 2IS1A 1YACA 2GZRA 3UUFA 2UVPB 1KH3A 3KOMA 2CF6A 2WWFA 1W9XA 2BKLA 3D6NB 2JHGA 1DS6A 5EA2A 3KQHA 2VKTA 4CIVA 2GSDA 3N28A 4F9TA 1QONA 3OTOB 1ODLA 4R81A 1KAHA 1KGDA 2Y3IA 4Q37A 3ZGXA 5IULC 4JBLA 3AGQA 3EH2A 5EPOA 1FDWA 2VK4A 4D7AA 2P4UA 4WKGA 3HJRA 4MR7B 9MHTA 1QF9A 3PQFA 2OYNA 3LQQA 1VJGA 5AW1A 1HE5A 1KKLA 1SKAA 2R47A 2VCHA 1P9LA 3VOAA 4EMSA 5BWMA 2FFRA 1Z0JA 1T2DA 4UVHA 4X6YA 3RW9A 3KE8A 1GIAA 1GKLA 4OI0A 2A1UA 3EIXA 1OA1A 4J07A 3U48A 1HDCA 4J43A 3AJRA 3MSXA 3SICE 4MQBA 4JXXA 3DV0B 4ZIRA 4RLSA 4RY8A 4X20B 4PZEA 4BVJA 2CLLB 4JT8A 5K3OA 2VDLB 4M37A 3T7CA 4OSOA 2BJWA 4ARAA 1VMIA 3F6EX 4Q15A 4IDQA 4IIXA 4J03A 3SHOA 1C4WA 3HP1A 1MJ5A 4UKDA 3R8CA 4MS4B 4A6XA 4AXBA 2WM8A 1C9DB 5F1YA 3Q40A 5IBRA 5A1JA 1J22A 2JVJA 5CBPA 1X7WB 3OZXA 4CUZA 5IAJA 2XJ4A 1MEJA 4M55A 4DREA 4MKHA 1DQSA 4F5WA 2ZL6A 3GJYA 3F1LA 1J1ZA 3AI7A 3AKYA 2ZKIA 3EJ6A 2NO9A 3LPLA 1M9NA 4X41A 4Y2PA 2Q2NA 4LHSA 4GWLA 3SS9X 4LA4A 4AMUA 4P6VF 1M76A 4HYQA 3ZE1B 1UKZA 4RJTA 3F46A 3GCXA 4IIJF 3FCOA 3FVVA 1QX3A 2BGRA 3OQIB 1SHJA 1GQQA 4KO4S 4OHRA 3ZI0A 3ZQUA 1MVOA 2KW5A 1J09A 2QLNA 1L7BA 4RJJA 3WLKX 3VBEA 4HR7A 5LYYA 3TAHA 3CEMA 4R2KA 1U9JA 3LXUX 1DAPA 2FZEA 3EIQA 3PRYA 6NULA 3QEKA 3ANTA 1QZUA 3OPYI 1MBZA 3G82C 4IGKA 3TLGA 2HMVA 4M87A 3GHYA 3IOEA 1CJKC 4MS1A 4BCBA 4AIIA 1RBQA 2C1XA 2ZJ2A 3NBFA 3K8YA 2R86A 3NIWA 3TKLA 3U37A 4EJ0A 1S3IA 4UE3S 4WEQA 3CX6A 3P97A 1XOIA 4Y1GA 5ALWA 1P1BA 2Q7DA 5AD1A 1N08A 1GPH1 1KIMA 2CF5A 1GZSA 2ESRA 2GEFA 1ZOLA 2QZSA 2ZQYA 2FUNB 3FMFA 3A25A 4HATA 3IR7A 1FSPA 2BBWA 5A9SB 3HUUA 1T3GA 4QTXA 3ZH9B 4U7PB 2DFLA 1Q50A 3OIWA 3RVRA 2F3TA 1GVNB 2EFDB 4JXJA 2OUIA 1DOHA 2C31A 4EYSA 4IYJA 2Q2QA 3OEHD 5DM1A 1OYYA 1YZGA 2DEUA 1OT5A 1E99A 1DKLA 3O21A 3U13A 4EFKA 5BQXA 3DZ8A 5AW2A 3QELB 3OCVA 5ARCA 4DXDA 2HN9A 1XLUA 2Y1XA 1GEGA 2EJCA 4PPGA 4XKWA 2YXBA 4B74A 3ETJA 1JB9A 3G89A 1DKNA 2DH5A 5JD6A 3VVLA 2DTDA 3GJ6A 4O4JB 3JQ9A 1N5JA 2QP9X 1DRVA 3ILVA 1G4HA 3V32A 1QTNA 2QMOA 5IHXA 1DWOA 4Q24A 4QLOA 1FDTA 2JFOA 4BLOA 2A94A 3JAMA 1NJ2A 2PCJA 1UM9A 2ZRPA 3FPSA 4HAOA 1XQYA 3KUDA 2ZVDA 3WIBA 1T1GA 1AOXA 1E89A 1B6SA 1MB0A 1M72A 4QAJA 1SAYA 2Q21A 3OZRA 3NOVA 1KD1D 1VBMA 2IGTA 1E9EA 2X2PA 3QP9A 4BDSA 4UXIA 4BMNA 1WCV1 1FRFS 1BDBA 4FHDA 3LQEA 4L57A 2J85A 1PJLA 4X91A 4FGLA 3V3TA 2GK3A 3ZCPA 2ZG6A 2H2IA 3G71B 1G4UR 5TSDA 2PZKA 4OHBA 3LY5A 4OB7A 1PJTA 2UUOA 5E6SB 1J0BA 2BHTA 3W8FA 1VXRA 1W6UA 3OO1A 3V8EA 1ZWKA 3RRZA 1KDVA 1YITB 1O6BA 1T5LA 2IE0A 3ID6C 2Q5CA 3K9BA 2IYYA 3D0KA 3EQ2A 5KPDA 4AS1A 3D3WB 3IV6A 2FQXA 1G17A 2PK3A 4I9FA 3FCEA 5FADA 5KJFA 2A4KA 1ZK3A 1Z75A 3NXSA 4UFNA 2Y0BA 4Y0NA 2H4FA 2J3HA 1TM3E 1EGVB 1FC0A 3RQIA 2ACVA 2JJ1D 5EWLB 4LNAA 5SZKB 4XYBA 3IEPA 2YDYA 5GZ6A 3MT9A 2TMDA 5CB4B 3RFFA 4EY8A 2OCXA 2W6JA 1A88A 2D1YA 4IXWA 3GZ4A 3I4LA 4JY7A 4AO8A 2R8XA 5DXFA 4QODA 4A6DA 2ETVA 1EZ4A 3NAZA 5IPFA 1OLOA 2PE5A 2AOTA 1VMAA 5D5QA 2B99A 4ITUA 2X15A 2XVAA 3BGSA 4URFA 3TCNA 2FEKA 1M2EA 3C24A 4JENA 4WESB 2C3YA 2WE7A 5DISB 3OFKA 3AJEA 2Q2OA 4AU1A 1TD9A 2FEOA 1FVXA 1TDJA 4X84A 1GAJA 1BCSA 1J4AA 1Z5VA 4BKOA 1CP2A 4ZTUB 3BRWA 4XQ9A 5ARDA 5FQNA 2K2WA 4H7FA 3FFAA 3CVVA 1WL8A 2PT6A 3D4BA 3QYJA 4FHGA 4NONA 3VDRA 3QFTA 4DYHA 5KHOC 1IN1A 3MTQA 5FA5A 4N8EA 1T24A 1JLLB 2ERYA 5CPFA 5DCLA 2XEDA 4ZQCB 1TOAA 3SAJA 4LE0A 1SQ6A 2CHGA 2G70A 1WU7A 3D4PA 1AGYA 3IPXA 4NE2A 4X8HA 3UW1A 1PZHA 3KUXA 3MRXA 2AR7A 3WI7A 5BNIA 1UBNA 5DYIA 5I4IA 3BPSA 4HX9A 2O6HA 2NVOA 4TKUB 5FYDA 2VYQA 2YXLA 2ZSEA 1QIGA 4Y2GA 4PHHA 3TRHA 3ZQJA 4TVOA 1ZOSA 1JBEA 1ISGA 3RYIA 3NORA 4FX5A 4UBLA 3K1TA 3ND5A 4MGKR 1JAIA 4AXXA 3DR5A 1GSIA 1EHIA 1VPVA 4RPCA 5DYTA 5H68A 4UHKA 3E2MA 5AJUA 5ETJA 4KR2A 4FHFA 2JNWA 1R0ZA 1QNFA 2N9UA 2ZRFA 1VJ1A 5L7YA 2QTFA 2YOFA 1VLVA 4CMKA 3E84A 3PGLA 2Q1XA 4G1UC 2NV6A 2GJAA 4QVKA 5HTKA 1I6MA 2BFEA 4JUDX 1OUMA 4NMXB 1FBNA 3NUGA 2AF4C 2P90A 1QHXA 3DBRA 3CRW1 1MZVA 3QKSB 4MQEB 1XV5A 3RI3A 5EAIA 4C08A 2C5LA 1OIWA 4YLYA 3ZHTA 1ZCFA 3Q88A 3UKDA 1E9BA 4DA4A 1ZKMA 3PR2B 4Y9UA 4LGMA 1RM3A 3VYTB 1E3EA 1PJ8A 1OWNA 3ZDYB 1NU6A 1ZNXA 1RM5A 2HSWA 4Q9LA 3QNMA 1QP4A 3B7PA 4MUYA 3NNNA 3VVBA 3NTOA 4MQ5A 3PVDA 4HDMA 4PO8A 3K8ZA 3VPBA 1KEZA 2CK3D 4AO6A 2X76A 2R2AA 3GLSA 1QCZA 1UJ6A 2PBRA 4HX2A 3AF0A 3HHEA 4Q4AA 1VE6A 2PSDA 4OJMX 1OI3A 4MR8A 1B15A 4GBJA 4NMHA 2YR0A 3QPVA 4QUIA 3LVFO 1KF0A 4IAOA 1E1CB 4I19A 1G1MA 2A9RA 2BONA 2Y76A 1C9EA 4M54A 3RU2A 4YWHA 5KNCD 1GNVA 3D0QA 3ZHVA 2OHIA 4L3WA 1T9AA 5A89A 2K7ZA 2FZVA 3MGGA 3O8OB 1RWKA 2PS0A 1WBDA 2G0NA 3PPYA 4ATNA 1SZJG 4TVSA 2YW2A 3PYMA 4GEGA 4XRGA 4E5DA 3PJEA 1ZN2A 3UB4A 4YT5A 3KO8A 4CDNA 5E38A 2X9GA 5A06A 2QA4B 1Z2NX 4OD0A 1FLDA 1XQBA 1FSSA 1JXAA 1C3OA 5EIXA 1II8B 2I29A 2ODEA 3N2ZB 2CVPA 1XMVA 1ZHHA 4F38A 5K03A 1G4AE 1MB2A 1RCUA 4M1TA 2FSIA 3KXIA 3F1KA 5EHZA 2OZVA 1QB7A 4EEKA 1JPJA 2ZXEA 4FIZA 4M0MA 3D2CA 3HKCA 3SQNA 3TG2A 2KWIA 3KSMA 4MWSA 4PBTA 2ID8A 2F9FA 1O08A 3KL4A 3OO0A 1P0PA 2GJRA 1NZDA 1UPXA 2DUWA 3SQWA 1OGYA 2EWMA 3WIDA 4XMYA 4R68A 3NJ4A 1C41A 221PA 4WLVA 3DW1X 4Q19A 2EJWA 2VR1A 4OL9A 3T7TA 1XTJA 2F3PA 1N9ZA 5JQGF 2QX8A 5EP1A 4OPOA 1K5GA 3AERA 3JVUA 4I4CA 4FYPA 4JX9A 2FP4A 4TQGA 4HLUC 2VTBA 4GD3Q 6PFKA 1FFXB 3ZWOA 5IUJC 3DVRX 5KVSA 2H5LA 3IS3A 3N58A 4YJ2F 3BN3A 4QATA 2JRCA 1LH0A 1BWQA 4TROA 5LXTB 3NOXA 2AFHB 5GM1A 3E35A 1DIBA 2GF0A 3AVUA 3QFSA 3LK6A 5IWAB 2ZDHA 2VH1A 1H93A 4BV2A 2FVXA 3UK6A 5BURA 3IMFA 4HWKA 1ADGA 3AY3A 1TD1A 2VFAA 3OOHA 2H7CA 2ONCA 1NW8A 1SJ9A 1AUPA 1DEXA 2HADA 3L1VA 5HF8A 3IODA 2G7ZA 4DZZA 1TA0A 3QVLA 1XDGA 3ILYA 2CBXA 3OLQA 4M0CA 3M70A 4RGYA 5GJBA 4AULA 2QUAA 3LDFA 4M99A 2YC4C 4U9UA 1UXHA 2V7QD 3BDAA 4NMMA 4RYLA 2F9MA 2GR9A 4BQNA 2Q0XA 1NBIA 5CFQA 1PP4A 2BF7A 1I9CA 2BD0A 3GVCA 3HWWA 3DP9A 3IQXA 3ET5A 3PK0A 4DIFA 3J80A 5EQTA 4LF8B 5EHNA 4Y7CA 1XF9A 4PG7A 1WMAA 1SCUB 3JQAB 2P4EA 1DPGA 5ALLA 2H1IA 1PR6A 4WLFA 4H7EA 2IPMA 4AYTA 2H9YA 2YNMC 3OZGA 1UBRS 4MIKA 4ON9A 4BLPA 1KO4A 1OYVA 3VHLB 5JXIA 5K8LA 1N0VC 3NHPA 1FVFA 3R3HA 3ZD8A 4U2GA 1RCTE 1L4HA 2G9RA 1SXHA 1SWVA 2FG6C 2Y05A 1ZN8A 4Z9FA 1JQLB 1LTKA 2F8MA 2Y4OA 3LCCA 3KDPA 3SY8A 3ZDRA 2NZ8A 1KZGB 2QMZA 1C29B 1QVRA 1Y3CE 1XA4A 1I2CA 3M1YA 4PY2A 4WCFC 4ETIA 5C80A 4RELA 4D57A 2XOKD 1RTKA 2YJNA 2ODQA 3NETA 4S3MA 1Q3HA 3RPEA 4D8YA 2VP2A 4JVNA 2CZCA 2NUPB 1MHPA 1A5BB 2VRCA 2ZJ5A 3PRJA 1WA5A 5BRNA 1U2ZA 1NY5A 3MTGA 4OTZA 4PAQA 1VLHA 1XVTA 2EX1A 3IT2A 1NIJA 1T3SA 2DUUA 2VCYA 1A9TA 3TUZC 1R9JA 1OXUA 2A67A 2V6BA 3NALA 4ZQEA 4ECAA 5B30A 1M0WA 5AW7A 3ZDBA 2Y0PA 2NXNA 1CZNA 2POCA 2PTHA 4LVOA 2WWYA 2SECE 1B26A 4P53A 2AE1A 4C76A 3M82A 4CL3A 3LTEA 4KVZA 2XCTB 1KQ3A 2FYTA 4PU0A 4ZT7A 5EXDA 4KODA 4BQSA 5BWBA 1J5XA 3H0CA 4GG1A 4O4LB 3WVNA 1GZ6A 5BR4A 4H35A 3O1JC 1YCFA 2MSEB 4P98A 5FWXA 1OJLA 1CU1A 1L7AA 1T8TA 3LBNA 4TL7A 4WK0B 4ODIA 5HKKD 5KYWA 3LL7A 1JHDA 4Z51A 1IVYA 4DT1B 4ZYWA 5E4TA 2HQRA 1B74A 1TK3A 4JL8A 5JH7A 1CUWA 3A6HA 4JR2A 4YQEA 3QPUA 1DWUA 3O4VA 2QV7A 3D8RA 3H2ZA 3IP1A 1ODSA 4TMYA 3U3DA 2BFAA 4ENRA 3JVIA 4EHHA 3QXXA 1U4SA 1D1TA 4G56A 1YJ8A 1QG0A 2XDAA 1DG1G 1B6GA 3R5JA 4HQOA 1J1IA 3T51B 3O9MA 3W8EA 1NYRA 5K3CA 1OH7A 4CLRA 1UPCA 1KR2A 2ZRLA 2YJZA 4DR2B 1AZLA 1PWXA 1SIBE 3AB7A 3AI2A 2F1LA 2FJ0A 1OZ0A 3MIZA 4ZQBA 3OOCA 2NNWB 2XMDA 3H1BA 2CFTA 2QNRA 2C9MA 1PL0A 2PZGA 1H5UA 2WMOB 3OFVA 1PZEA 4LPKA 5JFTA 2B8JA 5FOXA 4WBNB 4ZZIA 2O8NA 1RPJA 1M67A 2JLQA 2WICA 5D3MB 3VKVA 5ALGA 3UOAB 1HYQA 4P4LA 3ESCA 4C4TA 4KQWA 5LQJA 1PVDA 1L7XA 1Q0HA 1GA6A 1UIRA 2BR4A 4LHXA 2ZTSA 4TV9F 1DIOB 1FU7A 3O2JA 4S24A 1Y4ZA 4YRCA 4WMLA 2AC2A 4JI6B 1BEEA 1IZYA 2WSLA 4NCBA 2YS7A 1ZL2A 3CXCB 3K53A 3RJZA 2F43B 4KXVA 1B3RA 2XGMA 2PV0A 2Q7OE 5KYNA 3LSTA 2ZJZA 2WILA 3A9UA 1KC1A 1KDTA 3AJ9A 1D0SA 2CUZA 2G77B 3QWBA 4NDNE 2V3VA 1BJTA 3C3KA 2PUAA 1RKVA 2VHEA 3JQGA 1KFBB 3N8IA 3ROMA 1YRQA 3G2KA 2IVZA 4CIXA 5HK9A 2J0VA 4ENVA 3LWNA 2C4UA 1EU1A 2DPLA 2Q6LA 3SC4A 2ZRBA 4ENPA 4DSZA 4GXRA 4ZCPA 1ECGA 2ORIA 5BT9A 1L5HB 2K87A 3N2KB 1P7VA 5IFLA 3NG1A 1AF4A 1R66A 3B1FA 1F8UA 3NVAA 4OO3A 1ZICA 3SHFA 2QT9A 1RQRA 4S0XA 5EXXA 5GV8A 4UUPA 2WSMA 3P7MA 5K7SA 2BFOA 3OQOA 3DCIA 4KE8A 1IHXA 4RQBA 4ZCIA 1ZH8A 5ALDA 3TXXA 3WBFA 3P9ZA 4KO3S 4ZVPA 3TR5A 4GPIB 4B32A 1GXSB 1N7IA 4DIBA 5A5EA 1T5TA 1HY3A 2ZU6A 3DKPA 3UJNA 5F7ZA 3N07A 2OVFA 2ZU0C 1THGA 2CVFA 2IRWA 3QTTA 3WAGA 4MUEA 5ECYA 8MHTA 2G82A 4JUBA 5DT2A 4RZIA 4ZAYA 4JU8A 1T5BA 1P4SA 5BYJA 4E07A 5JZ9A 3NHFA 4RE6A 2DHDA 2I03A 4OBXA 5AUPB 4Q3KA 4GYJA 1WKCA 1PIWA 2QE7A 1QNLA 4D9IA 3BX1A 5K6AC 3UT0A 4IJ6A 4M7WA 1M66A 1JFLA 1PD1A 4PLVA 2R4TA 4PSAA 4JA2A 5AQEA 5CFNA 1NONA 4O4HB 1IBRA 4GP9A 1K8YB 1DDOA 2CVHA 1NUTA 2H1FA 2A6PA 3DCNA 2PXCA 3JWPA 1BGXT 4X5OA 4Z1MA 2FP3A 5DMHA 3S2IA 2HA4A 1BH6A 5I9MA 2IXBA 3GLRA 2GBGA 2GTPA 2PVPA 1HO3A 2G5TA 4JGIA 3P5SA 4BMCA 2XXAA 5HRAA 1RW4A 4OQYA 1WORA 1UKAA 1Y1PA 2LRHA 3D54D 3FNHA 3L5OA 4LJRA 2IV2X 5IVIA 4WUTA 5K3FA 2PSFA 3IHWA 2YOGA 4XIJA 5LZ4A 3HNPA 4WOJA 5DM70 1NAHA 4MMXB 1V8DA 2IL1A 2C9DA 2TMYA 3SLNA 2H4WA 3D8TA 2CNDA 3TSOA 5U9CA 1DJPA 2GHIA 4AMZA 4C4OA 5A5FA 1NOJA 2R6JA 2V0GA 2H57A 1I01A 4RGBA 1WW8A 3OE1A 2QRVA 3FJYA 1A04A 2AEEA 3ELYA 3P2MA 1W76A 3P4XA 1I0ZA 4OBBA 3T38A 3TAXA 5JNLA 3W5AA 3IUBA 3EX7C 4EARA 2OORA 5C1BA 1DRWA 2EU8A 3PRKE 4EL5A 1E9FA 1F60A 3K9FC 1FTYA 4NATA 2CUTA 3KEOA 1E2UA 2A9VA 3FROA 5TS3A 5BR1A 4A92A 3KYDB 3DQZA 1EINA 4HLNA 4Q4CA 4NCNA 2PM8A 2ID7A 5F2NA 5THQA 5FBZA 2QTVA 3WGOA 4GRIA 4YY3B 1GPLA 1QZTA 3AL0C 5G0TA 1A2QA 1JB1A 1CQZA 3VZDA 3FYUC 2GO7A 2O2CA 1WMSA 8ABPA 1UD6A 1Z39A 4MI1A 5JS2A 4L8LA 1AGXA 5BW4A 1XPOA 1YFKA 2I6SA 1KFEB 1NN3A 4QRDA 4X66B 1YOVA 1O96B 2J32A 3ADBA 3OKAA 4YPOA 2AZMA 2XIQA 1E6MA 1NXSA 3B8HA 3MCUA 1WZEA 1W0JA 5CLFA 3DXXA 3PWSA 5ILOA 1P3JA 3LKVA 4ALMA 1E3ZA 3FVQA 3CX8A 3I9V6 3MWGA 5EMHA 4BE9A 3I9KA 4YMVA 3HO1A 1P62B 1ZX1A 3ACCA 4BWYA 4HQLA 4FQ7A 5B7QA 3HPRA 3K9QO 1O6FA 1D3AA 1LB1B 3NYRA 4NNOA 2FSVA 1GTL1 2OZKA 2ZXIA 2HXSA 2D06A 3DT8A 5F5NA 4LBWA 3ORHA 4UOEA 2PSSA 3ICVA 4P7KA 5T67A 3ZG6A 3PJGA 2HHLA 2WTAA 4YRIA 4UTVA 1Y3IA 2CXRA 4KWTA 4QTTB 1EAMA 2Z8ZA 3USZA 2Q2VA 2XTNA 3V00A 1MVNA 1SRQA 2RIPA 1KH1A 3EEYA 5JDIA 1VBFA 3WIUA 3MQ4A 1EFRD 1NF9A 3F3KA 2D1QA 1U9IA 3LBHA 2Y6VA 1A8HA 2GKOA 5DWQA 2C03A 4ZVRA 4AJJA 4CTKA 1U4NA 2JLCA 1FP4A 1WUIS 1OKKD 4QJ4A 1K3UB 1H94A 1PTJA 4DLSA 3UT6A 3DCJA 5DX1A 1VYUA 5AXBA 1ZC3A 1M90D 1FYEA 2QZZA 1T8UA 2ZYTX 3ZWDA 4BO1A 3Q6QA 1UMCB 3GAZA 4XB1A 1QQTA 1P44A 4CL0A 4HXEB 4P86A 2I71A 4A5OA 4ALLA 1EWRA 3CRVA 4JBIA 3QUCA 4NEQA 3WLTA 3PUYA 4W7IA 4Y2JA 2WAYA 4M9SA 2RGRA 2IHZA 4M6WB 5JNVA 4CCYB 5DNCA 2Q5HA 3T8YA 2O7RA 3WQZA 2QU8A 4C3ZA 2X0KA 3C8DA 4ZN6A 4CM9D 3NYIA 5KNCH 4U7WA 2OLJA 3GRKA 5DHSA 4B3BA 3HACA 3LGXA 3UZUA 2CDRA 2Y0DA 2Z43A 2GTHA 3PI6A 3GUCA 2ZJ3A 3ZIAA 2E87A 2K7FA 1KXZA 2D7JA 2R8BA 4D99A 1PVOA 3W2IA 5E6UA 1ZNYA 1E1DA 3VPGA 3I28A 3OOEA 4N0EA 4U39A 3V7NA 4REQA 1S02A 3KE9A 3IP5A 3SIPA 1P4GA 4HDRA 2GF2A 4GM1A 1KYYA 2ZZEA 3HXPA 5J40A 3TDNA 2Q0SA 1FIUA 3JWIA 1NFQA 3R24A 4MCJA 5TQ0B 4FFRA 4C2AA 1OAOA 1P0IA 1R4NB 3DBHA 3KKKA 3TS1A 1X87A 3JQ6A 1VDMA 1NF8A 2QM0A 1I8DA 1ZD9A 4BGVA 1XSEA 3FYCA 4WNAB 7REQB 4PZAA 4EABA 5IG2A 1CUZA 4BJ1A 4Y30A 3H18A 3A9CA 3DWEX 4PGHA 1WUHS 3E2IA 5DV9A 4O2BF 4U00A 2F48A 5IXJA 5KWVA 2W2KB 4YT8A 5KEIA 5KTNA 2RHOA 1EK1A 3RV3A 3ETHA 4PLFA 1KR5A 4DMCA 3CO5A 1GL6A 1CK4A 3LYHA 5EP2A 3M3PA 1XYVA 2EF0A 4N6NA 3Q2KA 4ETMA 3U80A 2RDMA 4ZT4A 1Y9AA 4DVGA 1KEEA 1E8MA 3FKJA 4J9VA 1LX7A 4LPSA 2C0CA 1FDOA 4UUMA 4B4WA 1FP7A 5G0SA 3STUA 1UKCA 2FW6A 4EX6A 3AFMA 4QBTA 3UVEA 4AKGA 1E79A 4RWZA 4W5HA 4CG2A 3C16C 3UHJA 4E4TA 5B3LA 3IQHX 5ILQA 3RLIA 4IXDA 4GSKA 4KUHA 3RIMA 4CF4A 5KOHA 2CDAA 2HSDA 1KMNA 3NTUA 3OM8A 2QBYB 5NULA 4YS6A 4NJMA 2AKYA 5JS7A 1ZHOA 1FFAA 1Z0KA 3KR0A 2I34A 1Y42X 4TT3D 3AOEC 1R9NA 1E7YA 3O3OB 5FV7A 2VZLA 3NJ8A 5G1OA 1TO1E 2K5UA 5CJPA 5B7PA 2WOJA 1AD2A 4J0IA 1PSZA 1ZJ4A 2O3QA 2D2FA 2ZIEA 1Q14A 3DOJA 3OTHA 4PGMA 1GLNA 5ESXA 3RAJA 2WI8A 5IM4A 4N12A 4H6WA 4UFOA 1ACLA 1JEJA 1XG5A 3O8QB 1TTQB 4C1BA 3QX3A 4CZ2A 5BN3B 1NVVR 3R0XA 3ODPA 3U17A 4ZO6A 4ETWA 1F2DA 3GPCA 3LGSA 2DIEA 5EE9A 2VNSA 4P38A 5I7FA 4EKGA 2I7XA 2O2XA 2RGYA 2RH4A 1FFEA 1IHUA 2QN2A 3Q3AA 3MJCA 4KO8A 1QQ7A 2BEJA 5B57C 1LY1A 4TRNA 4IF6A 4TMVA 4D0RA 4Z4SA 2ZXUA 1S2OA 2D59A 2D5AA 3PXCX 1Y34E 1TEVA 1K2VN 2IUSA 3VC7A 3IYLW 1VJDA 2WY2D 4P4TA 4LMAA 5ICEA 1ULHA 2QZPA 4PQEA 2JH8A 3UN1A 2RBGA 3A35A 3X1JA 1TGVA 2QX6A 2VPPA 2XWQA 3M83A 1MEEA 1OI2A 4I46A 5BW6B 4OOVA 2I4NA 1WY7A 4LXIA 4E21A 3CMAB 5I9LA 5CVVA 4A6EA 4KR7A 3A4LA 1CKEA 4LY0A 4RV4A 3NH6A 4CMHA 1L8XA 4CDGA 1KI1A 1DJQA 4PZLA 5A62A 3IXQA 3SK0A 1EFPB 4K9RA 1N2IA 2JFXA 2VYVD 2X4GA 3OFSA 2WJGA 3OEWA 2EFCB 3OPXA 2ZETA 4LMBA 3OZWA 3GFPA 1XD2A 4H60A 3GRZA 4CODB 3BB4A 4INOA 4DA7A 4JC5A 4XOIA 5IXYA 1RTTA 4RDCA 1ZMRA 1BMFD 5F1OA 1QIHA 4AZ0A 3DE6X 2P67A 4BFYA 5CNJA 1HM5A 4AG5A 2GZ2A 3RC8A 2ZXFA 4UOQA 2P9HA 2YIJA 1G3QA 1WF3A 4ONEA 2YY5A 1XD9A 4PAOA 2LGJA 1ECLA 2WUVA 4ZA2A 1NQVA 4ZJZA 1XP5A 1VGRA 1R4MB 2JZOA 3KJFA 4V3CA 5AVKA 2BKUA 3VU0A 1G8JA 2WDPA 5DLQC 2Z6UA 1QWSA 2NUAA 3OA2A 4FYMA 4IMPA 3S5UA 4FDLA 3T94A 2ODTX 1VG9B 3BMNB 4EVIA 3CLTD 3I9NA 4QEZA 3A8JA 3ZCRA 3MWEA 5EIFA 2ZB7A 3KYCA 1XTVA 2FNAA 1E3WA 3AX6A 1UD3A 3HJTA 2Z2JA 1T2EA 2ZJ1A 1P9RA 2WNSA 3MS2A 3FCSB 4OH7A 1FFBA 4BX3A 4IDCA 4LWQA 4IDNA 4QEDA 3T1YB 2VH2A 3I5UA 1ZVJA 4M8IA 2OILA 1K5DA 2OXTA 3A31A 4BBAA 10MHA 3K4PA 1TVKB 2BDEA 3KXLA 2V6IA 4UDNA 2ERCA 2OZLA 4MOWA 5JYDA 1RRVA 4OHZA 3U7IA 3VR2D 3N70A 1ZZEA 4DDVA 1STOA 5BOVA 3I6BA 1U0OC 2FMIA 4FOLA 3I9V1 4IDBA 4X1IB 3W5CA 4RTPA 3CP2A 2RG1A 4MZXA 4EPTA 1BOOA 2GQ0A 2QVCA 4YAEA 3DM5A 1IUKA 3RSZA 5AW6A 3HR7A 2ZIAA 1C2TA 1X1EA 2X7XA 4QGGA 4C07A 5TARA 4CEJA 2BUAA 2P7IA 2V03A 3OOYA 2I8LA 2NYUA 2A5YB 3ZJVA 1REQB 1O0CA 1OY1A 4OQLA 3WNQA 5KX5F 4HDQB 3B9QA 1KJIA 1L7DA 2B7BA 1FS5A 3CCQB 3HZZA 3PTLA 4PCUA 3AYXB 1W34A 1UADA 3NKFA 2YNMD 2RH5A 3LX4A 3ENQA 5COBA 1W35A 4EMUA 4XB2A 3WYFA 2HSGA 1U94A 4W1SA 3GXOA 1QG2A 1SVUA 2GCGA 2V97A 2OEPA 2A14A 4U2KA 3Q2IA 3ZPXA 1RQXA 2YZ2A 1BE6A 1WBJB 5L6LB 3JATA 4QPPA 3PHHA 4QDOA 4E7PA 2QMUA 4A1FA 2PDAA 2GBCA 1FLVA 2OUKA 4JJZA 1QYWA 1LSJA 5TIIA 1Y6FA 1Z4NA 3I72A 3AM1A 4RCVA 4DS3A 5FI0B 2RJNA 5EHQA 4DPMA 4PFQA 3U5ZB 3VI4B 4MS1B 2X19A 4IHQA 3L4BC 1TQ6A 5FR1A 2NYVA 3OOSA 2IFTA 1ZYUA 2ZIWB 4RD1A 1KC8D 2GDZA 2ODBA 1NVEA 1NN1A 1R0RE 3RYFA 2QLFA 3QOFA 5DEOA 3GB9A 4I9GA 2RHWA 3UMGA 1P5HA 1QYIA 5JAZA 4IPTA 4ZOAA 4RTOA 3R5XA 3DPSA 2CNWD 3V48A 1EX1A 3BMQA 4MQUA 3QVSA 4QFDA 3H83A 1E77A 3GLTA 4NCHA 4E09A 4GR4A 4O8ZA 2H16A 4LFAB 1TCVA 1WZ2A 3ZI7A 3BGVA 4EHJA 3X1XA 1UK6A 4PRKA 1JN0A 3BL6A 2XKJE 4GPTA 5B58C 1SKMA 5E4JA 1HX7A 1MN6A 2Q9CA 4C0HA 3H0EA 3A3GA 3CCBA 2GT1A 4BNVA 3SBOA 1AZTA 1MGOA 4O3MA 5CCDA 3UGTA 4B4KA 2RHCA 1KMHB 2Q50A 2BGGA 1HDEA 3TEFA 1DWPA 1R2QA 4MR9B 1ZAKA 2AG5A 4TV8F 4BQPA 4RTNA 2XDYA 3AP3A 3Q5DA 4G4IA 1Q77A 4E12A 3DA8A 1DJLA 2V4MA 3ZDZB 4ZTZB 2QX7A 3A26A 4DDHA 3BKWA 2AZTA 3H1GA 4YUYA 4J4HA 1GU0A 2G4VA 3BYZA 1VHLA 5CYFA 1POXA 2H92A 1J23A 3I1YA 1W5AA 3O82A 1DG3A 4I1SA 4IJQA 5EQJB 1N1MA 4YMHA 2DXIA 2XZDA 4WA7A 1XDWA 2KE5A 1V5EA 1WDKA 2HW8A 4BKUA 2AFRA 2JIZD 3JR3A 3GRFA 1RXCA 2Z0MA 4FKZA 1X8KA 1TE2A 2XF8A 4QGFA 5CVJA 2IHKA 1ZD2P 1AZWA 1G8GA 4NYJQ 1UWKA 1G8MA 1QOPB 2J6CA 2PFGA 2PGIA 3E1GA 5FEMA 3AFGA 3TVDA 1RWMA 2NSJA 2XMBA 3JQ8B 3P9XA 2FW1A 4FUQA 3CWQA 4HH4A 1P0MA 1XZAA 2CWWA 3EWAA 3KG2A 3R6LA 4DMRA 5J23A 2IX9A 2XVYA 5AOCA 5ENZA 4ZDWA 3JPWA 4K40A 5FUYA 1SXJB 3QEOA 3FLAA 3PEEA 4TYNA 4G2TA 4H2DA 3L7KA 3MRSA 2Q4BA 2WKRA 1NC3A 3FFWA 2EW2A 3BFJA 1F38A 1L7MA 2B6NA 3ZHZA 3SE0A 4OQDA 2GVNA 4K9OA 5EE5B 2AFIB 2XTAA 4XGKA 2ZIXA 3PNQA 3SM3A 3CEJA 4B31A 3UMCA 2QSYA 3DZFA 4C0WA 2I91A 3HQ4O 4YJGA 5DM0A 3PT9A 1V7CA 2IWRA 2DR2A 2FR0A 1I1NA 1SK9A 2WC1A 4O2LA 2P2YA 3GGCA 1VE7A 1YHQB 5K2OA 1OIXA 1N2XA 3U3XA 3I37X 3PNOA 4IOLA 5DBIA 5JYBA 3N39C 3TEMA 1KAQA 5GZ3A 6LDHA 4DCNA 3ENZA 3R77A 1F2UA 5K4HA 2ZZNA 4G8BA 1E9VA 3WXMA 3ENWA 4UUQA 1Y1RA 4CEIB 4B73A 3H5OA 3GLFE 4EJSA 2PO5A 5HKLA 1YNOA 1JDUA 1RI2A 2RCYA 1A2BA 4ANFA 4V38A 2BI7A 3W6ZA 2ZTUA 4JUAA 1UK8A 3MK31 5KJ1A 1HEUA 2FOXA 5A7FA 4CNQA 5DLDA 5U1PA 4NFYA 4DC1A 3SF0A 5IDVA 1IXYA 5J2UA 4G81A 4HMQA 1T9KA 2H5IA 2PXAA 1DUIA 3ELUA 2BM1A 3AGPA 1P39A 4X63A 1YKGA 1JQEA 1JIXA 2ZANA 3K70B 1Z6XA 2X3FA 1ACJA 2FZGA 5FNVF 1OYOA 4FWIB 1A9XA 4RD6A 1YUMA 2J7KA 2IF0A 1NJ8A 4TLAA 4ZO7A 3D8HA 1O03A 2XRZA 4C0XA 3S2UA 5F5LA 1U0EA 1XRLA 2PFKA 2OG2A 5A9TA 1JEQB 1MV5A 3RO7A 2FA9A 2FZCA 4BAUA 3H2IA 5CD9A 1YB6A 1YR9A 4L1KA 1LK7A 3ADPA 3VV3A 1O4VA 4F2WA 1ZR4A 3KWMA 4B6PA 1ODKA 4L2IB 1TZ2A 2CUNA 4TPKA 2O8BB 4LECA 1W73A 1XQ1A 2WFLA 4AY5A 5J43A 4WBSA 3TQCA 1RNLA 4JBXA 3D3EA 3U7RA 4WZ6A 2BGIA 4ARVA 2ACWA 3P32A 1DINA 3HBAA 4L0MA 4XGIA 3RVNA 3ZCQA 5LOVA 2PRYA 2O5CA 1A1SA 2AQHA 4JLBA 3AWDA 2QJRA 1L3BA 1QH8A 3ZHYA 1T9HA 5BW5A 3PL1A 3ZJUA 3SFTA 5JG7A 8GPBA 1JFVA 3W5VA 3EQ7A 4AWAA 3GC6A 3ILHA 4ND8B 4S2EA 4A26A 2BFEB 4C21A 5GONA 2APJA 2WINI 3HNRA 4BUJA 1OLUA 1CRWG 1Z4PX 4TGLA 3S8EA 3EG5A 3KJEA 1HTWA 3O8LA 3DE1X 2VAPA 1SXPA 2IHUA 4ALJA 1M6WA 4W8GA 1N8TA 4HJXA 5ABPA 2GBFA 2MCFA 2PYDA 3HDQA 1QVWA 4RAOA 1DARA 4F91B 4AURA 3EGEA 4RV9A 4FM9A 5HFNA 2SNIE 2XTJA 1W4LA 1TFUA 1U7OA 1W49A 3A37A 4YV7A 4W7HA 1F8YA 2VP6A 4FYVA 3H2GA 4W5RA 1D1NA 1VKNA 3B3FA 1E8NA 3ETEA 1TJNA 5PGMA 1S1MA 5CM2Z 2IEYA 1XTPA 3D1JA 3FFTA 4Q4AB 3LOPA 1Z7YA 5KYKA 2V6GA 2TSYB 1M6HA 2B3TA 2VYND 4I8IA 4KITB 2FZWA 2QVLA 3P52A 4HTFA 2GWRA 4RXTA 1L7EA 2I1WA 3BWVA 4JFRA 2NT4A 4RESA 5KSYA 2GXAA 5TPZD 4OXQA 4RVDA 1VECA 3KLNA 3R0IA 4DILA 1UMBB 1KDPA 3FGZA 3L41A 1X1RA 1XDBA 3K1ZA 3R7WB 5K0CA 3RRBA 2X6YA 1A72A 3GOQA 1I2DA 2ZW9A 3D7NA 4HTAA 5ILGA 2CB0A 2FCRA 3L7CA 4R7TA 1ZUD1 1NURA 1EVYA 1RBZA 2C9OA 4YMIA 1NZFA 3IIJA 5JCJD 1NTRA 4JBNA 5KNDA 4LF6B 1C3OB 5M34A 1CD5A 2XA2A 1QVFB 1Z2AA 5AXCA 1WETA 2JJ2A 1JQAA 3KKPA 4EUFA 4I3FA 5CXUA 1Q0RA 2NU6B 3U7QA 5HM8A 1RWWA 3UQZA 4Z49A 3AG6A 3IPCA 5EHIA 3KV3O 4QGHA 4MUFA 3VSBA 1DAGA 2YWHA 3BGWA 3PGJA 4QELA 1DXOA 4YQYA 4BTLA 2IZ6A 2WK1A 3ORQA 5KDDA 3U5TA 2FF7A 4PXYA 3G68A 3LLMA 4NBVA 3WLJA 1NP7A 2JFUA 4XD7A 1ORIA 1YB1A 3MA0A 1OXTA 2EXXA 3W1WA 3ZW9A 2DC1A 1N77A 1IOWA 3JRNA 4JYAB 1Y37A 3WKCA 3LUGA 1VHOA 1P29A 2RAUA 2GLUA 3G2OA 4MW6A 2GAJA 1J8FA 2FP4B 3VPXA 1U5CA 4ZHQA 2H2FA 1L0BA 4ASUA 5I7AA 4XWKA 2A2ZA 4OLFA 4ZHSA 2H3HA 3G79A 1G3MA 5HIMA 5F7JA 3SKXA 3EPKA 3BMCA 1RLMA 1A97A 1NLUA 1GNQA 1T5OA 3OZUA 2CXSA 3OPYB 3R5TA 4P0TA 3U4AA 3HU1A 5A3QA 3EQ6A 2LZJA 3FOAA 4HB4A 2ZWMA 1J24A 3VU9A 5JWHA 4D4GA 3Q6MA 3VSEA 3FKQA 3SSNA 3CUYA 1FXWF 2DECA 4BMYA 3RBXA 2WW8A 4OU4A 4DYDA 5HXBA 3D1VA 4LDQA 3GUVA 3FWKA 3MGAA 1V8OA 3OQPA 1MAWA 2J87A 3ZHOA 5IN4A 1VMEA 1P4AA 1QBKC 1QYXA 1W5FA 3ZJ4A 2A7QA 1KERA 3UTDA 3ZQ4A 3URMA 1E2HA 1FNNA 3P4UA 4EZIA 4M9RA 1JSRA 1N75A 1KOLA 1XZGA 4PYQA 2X2EA 1X94A 1E69A 1XL0A 4IV8A 5KQMA 1KQGA 1SUEA 4Q3AA 3LT2A 1J2RA 4OPSA 3EDOA 4H3SA 1OYWA 3NGMA 4JP2A 4AKHA 1WSWA 3H9NA 3VU3A 1OU0A 1L5OA 2H1RA 3V1TC 2NZVG 2LIVA 1DXHA 2I6TA 1NASA 4Q6BA 1SB8A 1E5QA 5A88A 2I8AA 2Q29A 3KOUA 1AS3A 4AYWA 1U0RA 1XHEA 4CT0A 1QPZA 1W4ZA 3KB1A 1GJRA 5AVWA 4P81A 3TN7A 3FPBA 2FN7A 2OOKA 1DFGA 3WJ1A 1J8QA 4TKMA 5JQGB 4MV8A 2JARA 2X6QA 4DNPA 1U1GA 4IX1A 4ZDKA 1NQOA 4YAWA 4YRQA 3MJHA 4B71A 1W25A 2HZBA 3HWRA 1VP3A 1LTHR 2NVBA 4B7XA 3O5AA 4YJ2B 5JDCA 1X1BA 1EG7A 4NKRA 4UHBA 1FYXA 2HPZA 2PRSA 4YJ3F 4CV2A 2NO1A 3LDUA 3OWOA 3SEAA 3FW1A 2TMKA 1JIVA 1NNLA 3DYVA 3QKIA 2H2HA 2HRQA 1E3IA 4G67A 4Q4DA 4QDKA 5KKAA 2X8BA 3L07A 1AXEA 2EL7A 1UPTA 3NNSA 3GSIA 5C5CA 4JLVA 4GLLA 1KKUA 3JZDA 5LBTA 5JATA 3V8RA 5EJ5A 4ZCTA 1KOFA 1GPDG 1GNTA 2D9RA 1PJBA 1T9CA 1CSEE 2OP1A 5LQUA 4QECA 1Z37A 4H3HB 4HVTA 3N8DA 4OI2A 4AJKA 3PGXA 3OPVA 2NVUB 2DQZA 1Z29A 2Y8EA 4R2HA 2R1ZA 4DLRA 6GPBA 5HVNA 4MRPA 1E0DA 3ZBQA 1FNCA 1U4OA 2H7YA 3DKRA 1G66A 4ZALA 2PBZA 1NLMA 1GQYA 1VIYA 3OU2A 4I1VA 4Z9YA 1RDFA 1FEZA 5BW8A 1I9GA 1XZIA 1CEYA 1QOZA 2JJQA 2F1IA 2FY8A 5FWAA 4HG2A 4TOIA 5ALTA 5F7XA 2GYWA 3Q9NA 3HXKA 2E4AA 4HX5A 4TN1A 5AW5A 5KHLB 3G2NA 4BQEA 1FYVA 4FJ2A 2ZRMA 4LJ7A 4GZ3A 4DRXB 4PQRA 1JIIA 4JUCA 3KXDA 1HE4A 3KZXA 4P3XA 3C41J 3LYLA 4EY5A 2P1DA 3SYTA 2X5OA 2ZWIA 5EIOA 4DMUB 4KQ9A 3BTOA 3QUQA 2YWEA 1VPTA 2R8PA 2F2TA 1AA9A 3FKSA 2CXQA 5B2EA 3EZNA 2QD3A 3QKUA 1FYDA 5AKYA 1KI2A 1ZUNB 1Y8QB 2O2ZA 3FTCA 3RUPA 2H17A 1GKIA 1BO6A 4QICA 1R0BA 3RAPR 1CR2A 4J0KA 2H4XA 4C7OA 1I3MA 4IDHA 1OZFA 3KJNA 2G67A 2GESA 4PSVA 1MB3A 2AN9A 5IYZF 2CFSA 5ED4A 2EBWA 2BFCB 1YC5A 3K15A 4UASA 2YYAA 3ZN2A 1T6NA 2BEKA 2OMEA 2R2GA 2ZZKA 1PT9A 2FZLA 3HC7A 1GQFA 4JYZA 4DSAA 4UHEA 4GPAA 2J5XA 3QPBA 1DCKA 4JT2A 3AF1A 3PWTA 4M60A 4WA8A 3JRWA 1JNYA 1BCRA 2AG0A 1H2RS 1JHYA 5G4KB 3RC3A 2YJGA 3KAPA 2ZR9A 4Q3BA 1LLCA 4B6SA 5J2UB 4PPNA 5KBYA 5IC6A 3CURA 4RA9A 2PZBA 3WK4A 2L42A 5EVJA 4AVZA 1DC5A 2YWBA 1U04A 3Q9LA 2I2XB 4QAQA 2XUKA 2C7QA 2Q1TA 2ZUFA 4F56A 1U1CA 3CX4A 2J09A 3FY4A 3MCWA 2AXEA 3ZDEA 1QE3A 4F71A 4I0WB 3ZXUB 3L6EA 4YYEA 1G5HA 1PD0A 3RTEA 3AETA 1SQ0A 3GA0A 3RKSA 1XQXA 2IYUA 2QRHA 3THSA 5CVUA 3FCAA 3OU7A 2NU9B 4GI7A 3WGYA 1U02A 3AUFA 1LC3A 3JYNA 2BFBA 1MHTA 4E2XA 3I8XA 1B1AA 3VM6A 1WV1