3W5JA

Crystal structure of gdp-bound nfeob from gallionella capsiferriformans
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
198
structure length
194
Chain Sequence
QFKRIALLGMPNTGKSTLFNRMTGGAARVGNWPGITVELLSGKILLGADMVEIIDLPGIYDLHGFSDDEQVVRHFLHDNVPDLALVILNATQIERQMSLLLQLKQLNMNIVVLLNMSDEAKQYGITIDSRKMSELLQIPVFQLSTGYQEALQAVTRALRYPTPGMAENVRTQLEQDEHIEAEMVRILKSAVQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an atypical FeoB G-domain reveals a putative domain-swapped dimer.
pubmed doi rcsb
source organism Gallionella capsiferriformans
molecule tags Metal transport
molecule keywords Ferrous iron transport protein B
total genus 63
structure length 194
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3w5jA00
4KFTA 1IY1A 3PG5A 3KL4A 3EZFA 5JRZA 1NVUQ 1II8A 2X2FA 3BFKA 4C0LA 4IDPA 3HPRA 3IHWA 1OHHA 1TTTA 4LJ6A 5FL3A 1T8TA 4US1R 4HAYA 3KDSE 4M0LA 3SN6A 3GD7A 3HU2A 1AA9A 4MRPA 1CS4C 2A5GA 4IKEA 4CEHA 4XD7D 1DAGA 4PO1A 2JCSA 3LVQE 1T0JB 4KI0A 1E79D 1M8PA 4NMMA 4WIAA 3ZGXA 5L3VA 2HYIC 2HF9A 1OHHD 1NKTA 2H92A 2JDIA 2VHUA 1OXTA 4PX9A 2TMKA 4B35A 2IX3A 1KO5A 4IOLA 4DLVA 1W44A 2ZRLA 1JJVA 2CCKA 4DEYA 2XSZD 4NBSA 2N42A 2ZI5A 2CNWA 3CF2A 3THXB 1XTKA 5C46F 1ZIOA 2RHDA 4AIIA 4A0FA 1ZIPA 4MGIR 3KKQA 1SZPA 4TYWA 3MJHA 5FBLB 2H18A 4M8NE 5EE1A 3IEVA 1GNPA 4UKDA 3IO3A 3TNFA 1PVOA 3K0AA 3LLMA 1AJEA 2B21A 1W36C 1EWRA 2ZEJA 1P9NA 1U8YA 4MGYR 3SZRA 1KY2A 1ZNYA 3R7WA 1NJGA 1KZGB 2J1LA 4M9QA 4D80A 1SULA 5CLLA 1NBMD 3ZS9A 2AKYA 1WXQA 2GCPA 2GWHA 4PC6A 1YHNA 3BB3A 1Z29A 1UDWA 5DE3A 1A1VA 1E9DA 4G5GA 1QHXA 3MGCA 2BWJA 5DGXA 1E1RD 5GJCA 2Z5FA 4WZ6A 4PSAA 4B48A 1R5OA 2PEZA 4ZCIA 3BK7A 1EX6A 1R0YA 3T12A 2YZ2A 4DIDA 4N0EA 4KODA 3QKRA 2PEYA 2G83A 1QG2A 4U5XA 2ZE6A 5GADl 3K0FA 1SKYB 4M1WA 1X1SA 1YR6A 3T5GA 3KKPA 1JNYA 1U9IA 3CF0A 1ZM2A 1E4VA 4RZXA 5JSZB 2NTYC 2HYDA 3KUCA 2I4IA 5CJ2A 4GMXA 5KNDA 4OHWA 1YR9A 2B8TA 2VP5A 1VYVA 2IT1A 2WHXA 4DEXA 4BECA 2AN9A 2ZPTX 3KUDA 4M1SA 1YE8A 3Q8XB 4BWYA 4AKHA 2VSXA 3EA5A 1G4UR 1GSIA 1VCMA 2REXB 2WJHA 3DVLA 4JVMA 4W5JA 5J4HA 4LJ7A 4IDQA 2PT5A 3B13B 5KHOC 1M7HA 4HATA 1Z6TA 2QENA 2PMKA 4OL0A 1LF0A 4DB2A 2WM9B 2WVJA 3VFDA 1SKYE 1AGPA 1XBTA 2BDTA 3MUFA 5CK5A 1XPRA 1IXSB 1EFRA 2RGAA 4L9WA 4V02A 4D0GA 4DJTA 1E3MA 1FUKA 3RC3A 1X3SA 1DAHA 3B9PA 3NEJA 2RB4A 1G3QA 5HZHA 2IYVA 4QRHA 3QVUA 4X8LA 2CDNA 2FE4A 2IW3A 4IHQA 4NE2A 1M7BA 2WZQA 1RFLA 2NZJA 2IL1A 2Q3HA 3OIUA 4QJ4A 4TYPA 1E94E 1L8QA 3LY5A 1G18A 3TBKA 2FFAA 3NBXX 5B57C 1E2NA 4C0HA 2CCGA 3ZVRA 1U90A 2I3BA 1AQYA 3H84A 1OKKA 1IAQA 5FPSA 3RWOA 3AKDA 4KLNA 4PC2A 1TQ6A 1NN1A 1FTNA 1QVRA 2P3SA 2ODNA 1ZNXA 2ZANA 3LV8A 1N5IA 4B74A 1UBFA 1VG9B 2J0VA 721PA 1N6PA 3GFOA 1JEEA 3V00A 1DEKA 2V55B 3S1AB 4ARZA 3F0TA 1KOFA 1EWQA 4HB4A 3O8DA 1H65A 1ZM9A 2GCOB 3BB4A 1GKUB 1N25A 4JLOA 4DB4A 1SVIA 2EWWA 4O25A 2MSDB 2IYXA 4WBSA 1Y3AA 2GZHA 4BFXA 1CKEA 1UBGA 2PX3A 1VG1A 2ZAOA 1C4OA 3AV0B 3CH4B 1Z0FA 3NXSA 1TQDA 4FN5A 4Q9LA 1DOAA 5UKDA 4A8JC 4DCVA 821PA 5JEDA 2JLYA 2DBYA 3HYTA 3LRPA 5DI9A 4BLQA 2CE2X 2HV8A 2NPIA 5J40A 3D31A 3V9PA 1IXRC 3EC2A 3LVRE 4Q1FA 3W6OA 3X1DA 4AD8A 2NG1A 3MJRA 4TQUS 4XD7A 2EFDB 2QPAA 3L82B 5AJYA 3EZ7A 4QHSA 2C78A 2RGGA 1HURA 5CIWA 2GAAA 2V4ZA 4H1UA 4A2PA 5EJEA 4WXRA 1QHGA 4H9GA 3BD9A 2B7CA 2OG2A 3TUIC 2CNWD 2IYUA 3BS4A 1KK2A 4LV5B 5FPTA 3L0OA 1Z8FA 1P3JA 3ZLJA 2FNAA 3OEHD 2Y8EA 3KXIA 1E9BA 4OBEA 2R8RA 3EZ2A 4YXWD 5EXSA 1W46A 2QTHA 3VU9B 4B3FX 3RSLA 3SBEA 1P2VA 3NKVA 5FH9A 1HT1E 4BLTA 2WIBA 4P31A 3FHTA 2IUTA 4LDJA 4NCNA 4LJ5A 2FSIA 4B6EA 3MAAC 1Y63A 4BRWA 1IY0A 1KI2A 4D4LA 4KAXA 1QHHB 1XTQA 4YMUA 2WWIA 2OUKA 4A1FA 2ZI7A 1IONA 1UAAA 2JJ8A 4YMVA 2H17A 2WWHA 5FOTA 3N2IA 1T91A 2R6AA 4LJ4A 1JALA 2ODWA 3PXGA 2RMKA 4A0HA 5KOYA 1WRBA 4QGAA 3KKOA 3F8TA 4MDEA 2GK7A 4C7OA 2QROA 2OCPA 4KITB 5TXGA 4FMCB 3KQKA 3U3MA 4D81A 1E2MA 3AVYA 2GBLA 1MRNA 1ZC4A 2IXEA 3KTAA 4ZDKA 4CEJA 1GL6A 3M6AA 2QRZA 2ZYVX 4HUQB 2YJTD 3QUSA 5BN3A 4MYTA 3LNCA 3UWOA 2OBLA 4KFUA 2OXCA 2ATXA 3VR6A 3EZ6A 1E69A 1ONBA 2A5DA 3N70A 2EWVA 1G8FA 4OQMA 5H8WA 4TTPA 1CEEA 3I5XA 2G9NA 4E22A 1N2CE 1Z6YA 4ASUD 1JR6A 2W00A 2LCFA 4RD0A 2DCUA 4ZDIA 4P32A 3RVBA 5GVSA 1R10A 3HYRA 2KWIA 3NEYA 2D7DA 3WNDA 4GOXA 1UDXA 1Z6GA 4PXAA 4CT5A 2OFOA 1EFRD 2Z4RA 1VDZA 3TK1A 1EFHA 4IEIA 1GL7A 3U44A 3GJ5A 4JT4A 1P2SA 2PZGA 1GILA 5DHFA 4KHZA 5JBQA 1VCNA 2CXXA 3R20A 2VEDA 4ZIRB 1XTIA 4MRSA 4NZYA 1QHYA 2XAUA 4FMDF 1W36B 2W83A 1XPOA 4UXIA 2IF0A 4XJXA 2ORIA 4KU4A 1GDDA 3QKUA 3GCGA 1A4RA 2QAGB 2YKGA 1YRAA 4AKIA 2FZLA 4QGFA 3WYGA 1GNQA 5CM8B 2V6JA 3K9GA 4PAMA 1OKKD 1ANKA 2PL3A 3JZAA 3NBYC 4XVQA 4DCSA 5F9HA 3GFTA 1G8HA 1Z5ZA 1KDOA 4E07A 1J7KA 1W7AA 1Z0JA 2NO6A 5KYKA 1L2TA 4P4TA 5KPDA 4LOAA 4ZO4A 4TZ6A 2YWHA 5FUYA 3AVUA 5EE5B 1GOTA 4D4JA 1FUUA 2PJZA 4CEIA 2DB3A 2CJWA 1GRNA 4MKHA 4TMKA 3WRXC 1UKZA 5DI3A 1S3SA 1C1YA 1G8YA 3O47A 3GLIE 1XXHA 3VMFA 4OI0A 3CWQA 1MO3A 4TMZA 1HV8A 5EUMA 1PJRA 1G41A 2B6HA 2WMOB 4UNSA 5EP2A 4DLXA 1DO2A 4OK3A 2XXAA 1RZ3A 5HE9A 1G3MA 4Q1BA 3RHFA 2XZOA 1NSFA 4ZV4A 3EPLA 4TL6A 1E32A 1VHTA 1KO8A 2P6NA 3LX5A 4B76A 4JKIA 1OF1A 2WWWA 2IS1A 1KI1A 4JLMA 4F93B 5DISB 3SEAA 2IBMA 3LD9A 5GVRA 3ZVLA 4BZXA 3PEUA 2ZRPA 4GZLA 1OB2A 1HE8B 2ZSEA 3AVVA 2O0KA 2R62A 1PV4A 4WW0A 2KBFA 2GKSA 3BIFA 3CZPA 3FKQA 5ELXA 4HAXA 4NP6A 3VR1A 3ADCA 1KGDA 2XNDA 4D4KA 3EPHA 1XRJA 1XCPA 2CK3D 4X8MA 5JS7A 4YXWA 5FBQB 4MUBA 1NVVQ 2IEZA 1W48A 1P60A 3L8ZA 2CHVA 1II9A 3NC0C 1EGAA 4B73A 2JLUA 1XXHB 4RFVA 1H8ED 3WXMA 5A4JA 5KO2A 4TN1A 2VTKA 4DDTA 2O8EA 2GESA 3CNOA 4G1UC 4QBFA 1NLFA 2FJUA 4DXAA 1WCV1 1TUEA 5DYGA 1WB9A 1K5DA 1JPJA 1K6MA 3QIAA 3W6PA 2RGBA 5IK2A 2DYKA 2VA8A 3QEOA 2FGKA 4ARZB 2HXYA 4M1YA 3AVWA 1LS1A 4Z54A 1LW7A 1MT0A 1E2HA 1AKEA 3SBDA 1J99A 1KMQA 5J4VA 4DLZA 5LB4A 3TR5A 1DBSA 2Q9BA 1BYIA 4XTRA 4L15A 2AWNA 2UZ3A 3W5JA 2QGNA 2OCBA 5FTLA 2RAPA 2YWFA 1WBBA 1G64A 1Q21A 1YVDA 2C03A 3GJ6A 4DT1B 3FGNA 1AS3A 4EFNA 5C2JB 1G6OA 3T35A 4RD4A 1N6LA 3B2EA 2JA1A 1N5KA 1UBEA 5AUQA 4A4DA 2HCBA 3BAFA 4FXPA 2PLFA 3ZQJA 4BRUA 3K09A 4KYIB 1FPMA 4PC7A 2WWGA 4TL9A 3G0HA 4WZAE 1FMLA 1GP2A 4C7OB 1OYYA 1IXZA 2IWHA 4LC0A 3KFVA 3B1VA 4M9SA 1WMSA 3VU9A 4CIDA 2YOHA 1DELA 1S3GA 1KSGA 4NCJA 3SE0A 5JCPA 1DAKA 3T1VA 3A4LA 1W2GA 2XZLA 2ZUDA 2ZRAA 2ZSAA 5EE9A 1TF2A 1E2QA 2GHIA 4LJ8A 2ZUCA 4KSCA 1LV7A 4MITA 3PITA 2J3EA 4AWXA 1Z0KA 3PCRB 3WP0A 5EZ5A 4DDVA 4M53A 1KDRA 5HZKA 2AK3A 3GLFE 3IGFA 3HU3A 2BCGY 5AK0A 1NVVR 3C14C 3VTKA 2QTFA 2BKEA 2J7KA 1T5IA 3A1WA 1E0JA 1US8B 1SVLA 1G7CA 1E0KA 4XSGA 1OV4A 4Q19A 3RRZA 1XD2A 2ZETA 4OKSA 3LW7A 3B82A 4RFSA 5F9FA 5G3YA 4KFRA 3FE2A 2FOLA 4G5RA 1NMYA 4F38A 2IYZA 4GRAA 1QHNA 4JLDA 4L9SA 3SOPA 1P9RA 1P2TA 4M9XA 4WXPA 1ZBDA 3U5ZB 1J8MF 1GL9B 1RYHA 1SKQA 1Z06A 3CUEF 4LPKA 1N6RA 1B0UA 2J0UB 2WSSD 3V4FA 1G5PA 3CH5A 1T0HB 1G16A 1NBME 5KSYA 3K0CA 2DFTA 3L2OB 1VCOA 3ZDQA 4E5UA 1W36D 1RC8A 2IS4A 3LWNA 3X1YA 3C8UA 1JPNA 4NDZA 3PEWA 2IYYA 3TIFA 4JL6A 2GJAA 4U7DA 2JLVA 2FG5A 5EQTA 2F9MA 4IDHA 2NMVA 1R0XA 3U7GA 4JIMA 3L43A 3CONA 3GEIA 3TMKA 2C8VA 3TQCA 3WP1B 4ZIRA 5JEEA 5JI3E 3IPXA 1N6HA 2O8BA 2IXFA 2WJVA 3X1ZA 2OHFA 1W0JD 2GXQA 6Q21A 1AGRA 2A5YB 1Z07A 4HAVA 1ZJ6A 3SHWA 1V43A 4Q01A 4NCHA 1KAOA 1TL7C 1OH7A 4ERNA 2Q3MA 1LF5A 1S1MA 2QA5A 1Z2AA 2UKDA 1KI6A 2QMHA 3QKSA 4O2LA 1Q20A 2QPTA 4QBHA 1RE0A 3SJCA 3DKVA 4GL2A 4DVGA 3WYAA 4CEIB 4GPTA 5FTMA 3AKYA 3GP8A 1MO5A 3EA0A 1TNDA 2VPPA 2W6IA 2ZJ2A 1JI0A 2R6DA 4XH9B 3AQ4A 2WPDD 3LXRA 3UANA 3D3QA 1COWD 2IXGA 3OAAA 3GMTA 2ERYA 3RS2A 2MMGA 4BEJA 3AF0A 4OI2A 2QGZA 1M2OB 5DLQC 1FQKA 4CF7A 4KYUA 5J4YA 3THYA 2R6CA 4DUGA 2VL7A 2O8BB 1E2JA 1UKYA 4JL5A 1JAHA 2BM0A 4K81B 2C96A 4PZZA 3FOZA 2C99A 2GJ8A 4ESVA 3Q5DA 4R98A 2L0XA 4QNMA 4Z1MD 2XJ9A 3CPEA 1O87A 1CR1A 1FW6A 1TQ2A 3CW2A 4QHTA 4CEHB 2VH5R 1TMKA 1NF3A 2ZJ8A 3RC8A 1N0WA 1T9HA 1KO1A 3L8YA 1KK0A 1OIVA 2JIZD 3QY0A 4KXFB 4Q1CA 1DAFA 1E98A 3CO5A 521PA 2GEVA 3AF3A 5DN6A 1YJ5A 1IJEA 1H8HD 3PV0A 2ZAMA 2CMKA 3EWSA 2QUZA 3RRYA 3THXA 3E70C 3N5CA 5KPJA 2JJ2A 3GEHA 5J4LA 3WMFA 1NY6A 4O3MA 1F2TA 4HYYA 1TF5A 5JWHA 1A2BA 2C04A 4TLAA 3LQQA 4D4MA 1NKSA 2E1RA 2DY1A 2XJ4A 2JATA 3UXMA 1AM4D 4PQRA 8OHMA 2QP9X 4LBZA 4IFEA 1ZM4A 1FP6A 2CL6X 1SVKA 1N5JA 3M1IA 5EUQB 1GIAA 2IYTA 2D4HA 3FKSD 1CJMA 4R7ZA 2JJ2D 2CE7A 1NP6A 2CVHA 3EC1A 5E4FA 4TT3A 4MGZR 3EG5A 4U02A 2KJQA 1SXJD 4LJAA 2CHQA 5LB2A 4HUTA 1G20E 4URYR 3IIMA 3A1UA 4RSGA 3QXSA 3DL0A 2CCJA 1FX0A 1LFDB 4NYMQ 3CM0A 3KJIA 1VIYA 3CRVA 1N0VC 1MKYA 2FEMA 3K0FB 4EPXA 4AKEA 3CPHA 3VKGA 1ZMXA 2HT6A 4LCBA 3PQCA 4IVQA 1UFQA 2WBLC 4YMWA 1KK1A 4PC3A 4TLBA 2ZJZA 2BM1A 3PENA 1U2RA 3KFXA 4OK6A 5FOSA 2AHOA 1R5NA 2EQBA 4HEJA 4XWKA 1XFAA 2GF0A 5G3ZA 3DZ8A 1E4YA 2D06A 2VIIA 2XNSA 4Q4AA 4B2PA 4QOSA 2OLJA 3QEJA 3PIRA 2K5UA 3MWLA 2YC2C 3MWJA 3U4QB 221PA 2VBCA 2O8CB 5AJXA 2J0SA 4WVFA 4C2UA 3QG1A 4P0TA 4R2HA 4Q9KA 5KSZA 3WYFA 2OBMA 3PEVA 3A1TA 1QHSA 2XITA 5TY0A 1SGWA 2NOAA 3HP1A 4MRNA 1NRJB 2QP3A 2QU8A 5D3MA 4DDUA 3ZIAD 2DWPA 4DCUA 2QT0A 5JMTA 2OCYC 1JJ7A 2R65A 2FWRA 1J2JA 1KNQA 1OFIA 1YZUA 3A4MA 3KJHA 1SVWA 4W5HA 2R6GA 2ZJ5A 3FPAA 4QBGB 4RCYA 3VAAA 5AWFC 1OXXK 2F43A 3OFND 3U7FB 3A1SA 5C1BA 5KDOA 5KNCA 2ZJBA 1GNRA 1RJ9B 3H4MA 2ATVA 1XD9A 1XTJA 4W5WA 3NBFA 4FCTA 3TGPA 2OO7A 4AURA 1VIAA 2BV3A 3CR8A 3TE6A 3Q7QA 4LRWA 1BYUA 4IRUB 4DKXA 3MG9A 4Q4JB 1KSHA 5IT5A 1BMFD 5DIFA 2B7BA 2PX0A 5AR1A 2J0UA 1VCIA 4TLEA 3T34A 1G4AE 2HEIA 3QF4B 1CJKC 2X1VA 4RZUA 4BZQA 4JYBA 1MRSA 3SC3A 5FPKA 3K0SA 1ZNZA 4UNRA 3K0EA 2YC4C 4M2LA 3R9WA 5LPNA 4HZIA 1CJTC 1CXZA 3CRW1 4KVAA 5SZHB 1MABB 3RYTC 4DHEA 5EE3A 4EFLA 2KSQA 2ZYWX 2P6RA 1II0A 2GILA 1CF4A 4C2TA 2QE7D 2GAOA 4ITRC 3I61A 1CP2A 1YZLA 2GTPA 3AF1A 3OIVA 4Z8YA 1SHZA 5EP1A 1U0JA 5EE0A 3BH7A 3JZMA 3KB2A 3UKDA 2GNOA 2NO7A 3IBGA 2FU5C 4HAZA 2Q21A 2NO1A 3BH0A 4PPGA 2P65A 2EFCB 3AF2A 3CF6R 2QNRA 1YR7A 1HY3A 3F5FA 4W9MC 1S9DA 2H57A 2JASA 2X19A 3W5IA 2C5LA 2G0TA 1R5BA 4R2IA 4U00A 4BFSA 4DSUA 4QJ3A 5BN4A 1G1MA 5JFGA 4OQNA 4MQBA 4Z8XA 1H8HA 3AP3A 3GLIB 5EZ6B 1KZ7B 1R7RA 3GLHB 2YHSA 2WMNB 4A2WA 5G53C 3FWYA 1SHKA 5F98A 5IHPA 4Z51A 1ZC3A 1E9CA 4Q18A 4XVRA 3U3KA 1DAEA 2HLDD 2FV8A 1BO6A 3WMGA 2O0HA 3GJ0A 2WKPA 4FI3C 4BFYA 4Q7KA 5C4MA 5K8TA 4A15A 2BMFA 3SQXA 3OEED 3RLFA 2C77A 4HLQB 3WBKA 2ZS8A 5E7MA 5IDVA 3W9YA 1XD8A 2QSZA 1Q44A 2C98A 2R44A 3OIYA 4JKYA 1S1CA 1SXJC 4PQYA 3AVXA 3ONWA 3THYB 1KMHB 1HE1C 1ZNWA 2P0EA 1TQ4A 3QF7A 4EPWA 3VR2A 2HDNB 4TL7A 3GLGB 2N46A 5CK4A 3OEEA 1ZM7A 2MSCB 4TMVA 4M1TA 3TW8B 4C9BA 4M22A 4OYHA 2SHKA 4MYUA 2O52A 5KNBA 5JRJA 2WOJA 5CB8A 2JGNA 3ZH9B 4LK2A 2YOGA 3SYLA 3GLIA 1SXJE 2QMEA 5G40A 4V0MA 2FSGA 5CM9C 3GLHA 3T5DA 4ABYA 4C4PA 2ZREA 2JEOA 2DWOA 2EU8A 5G41A 2VP6A 3CIOA 3A36A 4Q47A 3ASZA 2OT3B 4QM6A 2ZRHA 3GLGE 1TEVA 3E1SA 2VHCA 2PJRA 3ZS8A 1ZU5A 3I5YA 1M1YE 2V1XA 1U98A 2XB4A 2BBWA 4OI4A 2X2EA 2ZQ5A 4RY2A 3Q9LA 3VR3A 1US8A 1XP8A 3SJAA 2DFNA 3GEEA 1JEDA 3P26A 1DADA 4QGHA 3MSXA 2QRNA 1SXJB 3SI7A 5DYIA 4AYTA 4RJLA 2H8KA 2ZS7A 2V7QA 1CBUA 2CEAA 2ZRJA 4KJZA 5EXXA 2QEQA 2EYQA 2QQ0A 4JVSB 3AF4A 4URZR 3UMRA 3MCAA 4EUNA 2OAQ1 3DHWC 3A8TA 3HU1A 1LVGA 3O8BA 2LWIA 2WKQA 1OB5A 4HLUC 3VNUA 3HR8A 3TSOA 4F4CA 2GA8A 2IYQA 5CYPA 1TU4A 4HB3A 1DTSA 1F6BA 3NC1C 2BMJA 5EXTA 2C9CA 3BERA 2BBOA 3AH8A 5LDDC 1R8QA 3NH6A 5LBIA 4WA7A 4FD2A 5E7JA 5DH9A 2P67A 3B9QA 5HCIA 4ZDWA 4Q9IA 4JZKA 4A6XA 3CRQA 2QSYA 3RDPA 4GP6A 4HB2A 2JLQA 1KDPA 1N3BA 1S8FA 1Q22A 5D3QA 4DCTA 4LV6A 3GLHE 1P75A 2YOFA 1P9WA 1A82A 5FOWA 4LUCA 5FBVB 2FA9A 3SJBA 3W8NA 3DO6A 1U8AA 4FIDA 2ZXUA 1G19A 2WWYA 3ZD6A 2H1LA 2OESA 3B1WA 4MYHA 4Q4LA 1D9XA 3K1JA 4UJ5A 1L7VC 4XTCS 2F6RA 2QN6A 4X8OA 2F43B 1N0UA 3FTQA 3OE7D 2NO0A 3DKPA 1Z3IX 4I81A 3S1AA 4FW9A 1G8GA 5FI1B 2X77A 4OJQA 3RABA 2O8CA 3ND9A 4NKRA 3EWAA 5TDHA 3ECCA 2QPOA 2D2FA 3QBTA 5JS8A 3EPJA 1EFUA 3CRRA 4S2EA 2YWGA 1D9ZA 4RD1A 2CLSA 5F2EA 4X8HA 4AG5A 1XMVA 3LX8A 5DO9A 2ZITA 2QMUA 2J9RA 2ZI4A 5HPYB 2QTVB 2P2LA 4OQLA 3OHMA 2QG6A 1UEJA 4DLSA 1W0KA 3PJRA 1NN5A 2WAXA 4NTZA 4KFSA 4GOJA 4DSNA 1XCMA 1S0UA 4KBGA 3SS8A 1FP7A 4Q1AA 1XEXA 5DSZA 4NYJQ 2GJSA 3ZVNA 4R71A 2HLDA 1E2PA 2XZPA 4C0KA 1MOZA 4B75A 3IUYA 4DLRA 4LSGA 1OXVA 3Q85A 1Q1QA 3LXXA 4QJ5A 4TQ9A 5L3RA 1D2MA 3LFUA 3WHKA 1CR0A 2ZIAA 3R7WB 4PFSA 1P62B 2PMDA 4OHYA 3SNHA 1YRBA 2GVDC 2PBRA 1Z28A 1I4LD 3DM5A 2QBYB 2GZAA 1PLLA 3C5HA 4IEEA 3B78A 3RS4A 3N2EA 1AS2A 4Q48A 1YZNA 5GJWC 3THOA 4GFDA 4C0JA 1JQJC 2BJVA 2G1KA 1FTSA 4XIGS 2JLRA 4BLPA 3QOFA 2BEKA 1A2KC 1AIPA 2KI5A 4IW3B 3R9IA 2GJKA 4CT4B 3T06B 2W58A 3VHXA 1OH6A 3CBQA 3R8CA 4ZI2A 4KVGA 4RZ2A 2F1RA 4DDWA 1GKYA 2OFWA 1QDEA 4OQXA 3LW8A 3AVTA 1QG4A 3SFZA 2A2ZA 2PCJA 2BCJQ 2IS6A 3U60B 1E79A 2NZ8A 2V9PA 2V8OA 4P4SA 1IN5A 1LNZA 1NBMA 2WOOA 1W5TA 1FQJA 3D8BA 4NCIA 3RRNA 3RS7A 1W2HA 3NVAA 4XWOA 5FOUA 4AYWA 3KXLA 2CL0X 4JS0A 2UZIR 4JBXA 5KSOA 4H1VA 4EKDA 1ZD9A 2ORVA 3G82C 2HXSA 2Q3FA 4AI6A 1DAIA 1TU3A 2DWQA 2XTMA 1Z08A 5J47A 1XEWY 4HZUB 3ZD7A 3EW9A 5A5GA 4BFUA 3TVDA 3VR4A 3WHLA 1KJZA 2AXNA 4C0BA 2ZI3A 5EXPA 1NL3A 1G6HA 3K0CC 4PZYA 2ZRNA 3C4JA 1E2FA 3DOEA 5GJVC 4PSKA 4Y0AA 5FR1A 4C0QC 4BZPA 2OFXA 2Z4SA 1TADA 2IHYA 2G6BA 2GK6A 5HKKA 1GTVA 1UEIA 1P4SA 1E1RA 3IQXA 5K8LA 5DHAA 3F3YA 5DI3B 2IYWA 1FZQA 1KSJA 1OSNA 2FPKA 3OZXA 3M0EA 4JBWA 3KX2A 1AZTA 1P7CA 1Q0UA 4B6FA 5FI0B 3RSOA 5HKKD 1P2UA 2GJ9A 4G5QA 4NHOA 3B8HA 4RZ3A 3BRWD 2QM7A 1OH8A 4A8JA 1TAGA 1GM5A 1IN8A 3MLEA 3BB1A 3GJ4A 1PUIA 4NU0A 4YDHB 1E2DA 3NTUA 4B3BA 1E9AA 1Z63A 5JJKA 2BOVA 3MRSA 2V6IA 3FMOB 1X6VA 2DPXA 4BQSA 4FCWA 4QKQA 1CLUA 4IDNA 1Q1EA 1UM8A 5CIQA 2OM2A 5JECA 1E1QD 1TF7A 4CRWB 1G8PA 2W0MA 2ODEA 1ZM3A 2GXUA 1JECA 4FMDB 4TYNA 3K70C 4ZPXA 3P4YA 2RKOA 4WZBE 1KO7A 3TW4A 4A92A 1N5LA 3I92A 3P32A 2MMCA 2V3CC 1XU4A 1HT2E 1JXMA 1XX6A 4LJ9A 3TLXA 4CGZA 2Q9CA 1KDTA 3AVPA 3NDPA 3OESA 1OT3A 4XOIA 4EPVA 2WWXA 4IXMA 3R8FA 2GDJA 2VP2A 4B3DA 1E2EA 3A6PC 3QJYA 3RS0A 3KQHA 2JLZA 1U9IC 3X1WA 3REFA 3WMEA 2BKUA 4PTLA 4EJSB 4TYQA 3CZQA 3FFBA 3C5CA 4F92B 1E2LA 1N6KA 2FF7A 2F7SA 2RGNC 3RANA 4BUJA 5AJWA 4UXHA 3P4XA 2ZSFA 3E2IA 4DLUA 5FFMA 1MABA 4DSOA 3MWKA 1R4AA 3U2QA 3QXXA 4G5SA 1RW4A 1HTWA 1K5GA 3J81k 2YINC 2OCAA 2OAP1 1ZUIA 2GEUA 2OEPA 3IHLA 4DWJA 1P6XA 2EVWX 1XZQA 3W3AA 5TB5A 3SFVA 3T61A 4ACAA 2O8EB 1ESMA 4BFZA 4FINA 2MSEB 4GDFA 3K9LA 3OEHA 2LKDA 2ANBA 3X2SA 4B32A 2J59A 3ZZ0A 4C0SA 1VG8A 2Z0MA 4JVNA 4P3YA 3GJXC 2A5FA 2C95A 4CW7A 3GLFB 3LBNA 3ADDA 1OFTA 3HJNA 4EFMA 2ORWA 2WJYA 1G7RA 3K9HA 1ESNA 4C0AC 2J45A 3QSYA 3KZ1E 1IJFA 2XNDD 2CK3A 1BKDR 3X1XA 4HI0E 1P61B 5LD2B 4MRRA 2GF9A 2PLRA 4E03A 4QFMA 4DZZA 4NL4H 5LD2C 3NHAA 1SVOA 4QC2A 2QZ4A 4AY2A 2Q9AA 3G5UA 4NONA 1TX4B 4Y0VA 2UVQA 1H8EA 3VX3A 3Q3JB 2A5JA 4MA4A 4O2RA 3L0SA 3AUXA 4C3ZA 4D0NA 1YZKA 4M1KA 1XEXB 2AXPA 4PHFA 2V54A 4K8OA 4W7SA 1W5SA 5DNYB 1G291 1Z83A 1M34E 1NG1A 2QAJA 3KB1A 1XNJA 3FHOA 4Q7JB 4YMTA 3L0PA 1KYIA 1XZPA 3ZZUA 2ZROA 3KQUA 1LY1A 3UPUA 1JXOA 2ZR7A 1ZCAA 3T1QA 1YQTA 5C18A 3L0IB 3MD0A 1YR8A 1FFHA 1XTRA 2VP0A 2ZVPX 5FOVA 1ZU4A 2IEYA 3ZJYA 1NG9A 4V0KA 4HAUA 3WBJA 4I1OA 4RFSB 2XOKD 3CNNA 1IN7A 1IOZA 2ZJAA 1P72A 2F9LA 1G7SA 4IXNA 3I62A 4HAWA 4Q7LA 1NMXA 3Q7PA 2J87A 2D7CA 1TUIA 1KAGA 1RKBA 1WE2A 2YYZA 2QORA 5IF9A 2VQSA 4LZZA 4OQFA 2WTUA 3O8CA 3TH5A 4LHWA 4URWR 2QI9C 2BIFA 4D82A 1Q1BA 3QBVA 1QHHA 2IC5A 1U81A 2O8DA 2J5XA 2O8FB 2WICA 1OE0A 3JVVA 4JLPA 4KBFA 4QHYA 5FTNA 4B3CA 1CJUC 4V0NA 2XEXA 1O3YA 1KJYA 1U94A 3K0AB 2WIAA 1EK0A 4PPNA 4B44A 2R6FA 1R8SA 1ZRHA 4UNQA 4ON9A 1CULC 2I1QA 4IVRA 1EG7A 3AVOA 4WAUA 1W1WA 4JL8A 5TVKA 4POAA 4EPTA 4IFBA 4UNPA 1MO6A 3PUXA 2CLCX 2Q6TA 3BGWA 4HUQA 4AG6A 3KKNA 4MKGA 1NI3A 1F5NA 2RHMA 1IN4A 5ANRB 4BEBA 2ZM5A 3CRMA 4XWAA 1FNNA 2ZE8A 1BH2A 2A30A 2REOA 3CWZA 3K70B 2ZR0A 1KKLA 2XX3A 1ETUA 2BBTA 3QKTA 4YQFA 3I8SA 2J0QA 1HUQA 1R6BX 3H2YA 3KJGA 4HDQB 3T15A 1FNMA 1XTSA 2Z43A 1G9XA 5SZIA 1UJ2A 1XMJA 2O8FA 2O8DB 2C2HA 4OHZA 4LPSA 5JWOA 1RVDA 3QXCA 4LGMA 4B2LA 4BLSA 2G88A 3W34A 1E0AA 2D3WA 1MO4A 1M7GA 3VKHA 2JJ1D 2WJIA 4D2IA 3AGPA 4V0OA 3UMFA 1XXHE 3D6TB 1FOEB 1E0SA 3CR7A 3H1TA 1XCGB 4KCGA 4DCNA 2JLSA 3V4RA 4TQAA 3QF4A 4JBYA 5CDFA 2WAYA 4BLRA 3KKMA 5IRCD 3BFXA 4URVR 3FMFA 4PANA 1E9RA 3CB4A 2JJ1A 5KSPA 1VG0B 4DSTA 1WP9A 3U7HB 1DG3A 1W0JA 1JR3E 2J7PD 4MUAA 4QGGA 1IHUA 2HF8A 2NPFA 3SR0A 4ACBA 3VNVA 4AKGA 1XB2A 2CJWB 3IILA 1G17A 4DLWA 3O8RA 4YLGA 1JQLB 3NBZC 3P27A 4IOKA 1OPXA 2AFIE 2EFHB 2BMDA 4F91B 1E2KA 2PH1A 2VF7A 1CJVC 4KLZA 2J7PA 4LYAA 3THWA 5KDDA 3AP2A 1II8B 2VRWA 4EAQA 4HLCA 3DEFA 4YC7A 1ZYUA 4A82A 4B34A 2XXAB 4ESHA 2BBSA 3TUZC 1V5WA 4WOPA 3U61B 4LHVA 1CU1A 4EJSA 3EIEA 3U3JA 3B1XA 3B1ZA 5J5CA 5H70A 4Q02A 1NY5A 2VHQA 4NYIR 2QP4A 1T5LA 2PZEA 1E2GA 1KNXA 4FCVA 2ZE5A 2AL7A 2RCNA 5FUVA 1R2QA 2ZRCA 1SVSA 1DAMA 3P20A 2IUUA 1I4DD 1ZUHA 2GBLC 4B71A 4PSVA 1J8YF 1QVAA 3QENA 5FUXA 2PCLA 621PA 5GJBA 1SVMA 1E6CA 4RVCA 3FB4A 2XOKA 3MWYW 1OFUX 4GBMA 3U3RA 4PQFA 5L3QA 1U0HC 3PVSA 5BN5A 4ZCMA 4MH0R 5L8VA 1UPTA 1VHLA 1XJCA 3BE4A 4LWZA 2NGRA 3NG1A 1OIWA 2ZU6A 4P33A 3EZ9A 4P4SB 3WY9A 1VYTA 2P5TB 1KKMA 3VX4A 1HH4A 1KK3A 2ZUBA 4OK5A 3TSZA 2I1VB 3EARA 3K53A 4IOMA 4ASUA 2XB2A 2YWEA 3IPYA 1Z0AA 4TMWA 4LC1A 1NN3A 2IF2A 5B64A 2Q0HA 5EP4A 2F3RA 2FDCA 1U8ZA 2A3RA 2ZI6A 4OHXA 4IVPA 4V03A 3GFPA 3VHLB 4RKEA 3PR1A 4D25A 1KI4A 3ZZTA 3ZVMA 2CLDX 3EASA 1HQCA 1G3IA 2OV2A 4JJKA 4EDHA 4BGDA 1GWNA 4HZUA 4JVLA 1WBDA 1GG2A 3RWMB 2BMEA 3NHBA 1P73A 3P1JA 4B43A 3SQWA 5JWRA 1T3HA 4M21A 5JCZA 3MFYA 4EPRA 4BLOA 1KI9A 3B1YA 3B60A 2ZI9A 1LS6A 3KQLA 2D62A 1VPLA 2VHJA 1ZW6A 3IBYA 3C16C 4IDOA 5F3WB 2IUSA 2W6JA 4TL8A 3UG7A 2H7VA 1ZD1A 4LYJA 5TMPA 2ZSDA 4IJMA 2J41A 1ZVQA 2FN4A 1L4YA 2H16A 4US2R 2OLKA 1XDBA 3KJEA 1MR3F 1N6NA 1Q57A 4S35A 5BXQC 2HUPA 1E9SA 5FPHA 4URUR 3U3OA 2W6JD 2J46A 1HEIA 3A4NA 2P5SA 1XMIA 1Z22A 2ZSBA 1X1RA 4ZI3A 2ZYUX 4NCKA 3BFVA 1A7JA 4LBWA 4A6PA 4A2QA 3WNBA 1JB1A 3LLUA 4UQOA 3U4QA 2IS2A 3DDCA 3I8XA 5B58C 3RAPR 4LI0A 3PEYA 4Q4JA 4Q7MB 2GVZC 2HJGA 4P4UA 4QXAA 4UJ3A 4B47A 1EFTA 3AUYA 4Q00A 1D8TA 2QAGA 1E2IA 1GRQA 1X8JA 2F3TA 2AD5A 3SU8A 2G1JA 2X8AA 2GXSA 1XWIA 2W0SA 1RRCA 1N6OA 1Q3HA 2GETA 3ADBA 1ZAKA 2RH5A 3CX6A 1XJ0A 3DPUA 2WSSA 4MGKR 1OW3B 3JVUA 4JLJA 5KUTA 3QPUA 3DOFA 4EPYA 5FR2A 4C30A 1TEXA 4PAOA 1GVNB 1W4AA 4GI7A 3SDZA 4DC9A 4PPQA 3U7EB 3W8RA 1KTVA 4UXJA 4AYXA 4I4LA 2FMXA 4NYMR 3AP1A 4US0R 2ZTSA 2XGJA 3OIWA 2EFEB 3K70D 3QNUA 2F1IA 4XSHA 1G3RA 1TPZA 2REBA 3UK6A 5FTKA 2NQ2C 1AZSC 3REGA 4A36A 3I32A 2W6ID 1RYFA 2N1BA 3FMIA 5SZKB 1DARA 3U6BA 2OXRA 4V0LA 2GCNA 4BFTA 1IBRA 3Q72A 3IQWA 3GPLA 4Q9JA 1WQ1R 4BASA 2FFQA 1XMSA 1F2UB 2GZDA 4DLYA 2YNMA 4KV9A 5IK2D 5CB6A 1CIPA 1W47A 3OF5A 4HLUA 1Z6AA 1F48A 4DUGD 2AD1A 2O0JA 4M1OA 2FFHA 2CHGA 5B2ZA 4E09A 4RD2A 2ZU0C 2QAGC 5E3HA 2FSHA 1BMFA 1DO0A 2IYLD 3GJ3A 5FBWB 1F2TB 1BS1A 1MH1A 4Z1MA 5JHGB 1T3SA 4QM7A 2BHRA 4TSFA 4KSBA 121PA 1OXUA 2AX4A 1OYWA 1COWA 2ONJA 4PR0A 4TMXA 1CR4A 1S2MA 3BXZA 1F3OA 3BH6A 1N6IA 3AVQA 3TSWA 3THWB 5FPYA 1QF9A 2F55A 2CL7X 4CYMA 4JLNA 4I1VA 2FEOA 3K9NA 5AJVB 1UKEA 4QG7A 4HDOB 3E5HA 3IKJA 2QL6A 3LA6A 4TSFD 1U99A 2QY9A 5BYKA 1E99A 1G21E 5DN6D 1DVRA 1JBKA 4JSYA 4PAQA 4XVUA 1KI6B 3QKSB 1CTQA 1OIXA 5JHHB 1YKSA 4ILEA 4QL3A 3NH9A 3BC1A 1DPFA 1GITA 1P5ZB 4LBVA 1F2UA 2JLXA 4LHZA 4TLDA 3GQBA 4JLAA 4B2IA 4ZKDA 5SZJA 4D26A 1ZD8A 5KU1A 1G7TA 2JAQA 1VYUA 1E9FA 4JYCA 2FPLA 2D74A 1EX7A 1U0LA 3R9XA 3W6NA 2QT1A 5L3QB 4BFVA 2F1HA 1D6JA 3I72A 2ZRBA 4GSYA 1LB1B 1ZP6A 1DE0A 2AR7A 3QXHA 2OBNA 4HSEA 4Q4AB 3A58B 1W4BA 3NIBA 5K8UA 1FMJA 3UIEA 5FL7D 1YZQA 4CEJB 5P21A 2H5EA 1UBCA 3BOSA 1J70A 5J4KA 2IYRA 1WF3A 3IIJA 2IK8A 1J90A 1PUJA 1KI3A 2CBZA 3QI2A 5AJZA 2A78A 3A37A 3AB3A 4OI1A 4LX0A 1X86B 1CRQA 2ONKA 2W2XA 2YV5A 3ICEA 2WKRA 5A0FA 1Q12A 3SHFA 5FL7A 1GAJA 5JJIA 1RIFA 2VF8A 3FKSA 3FDIA 5CYOA 1Z2CA 5H1YA 4M4SA 1XEFA 1XF9A 3AKCA 3DMDA 2A9KA 2ZRGA 3EAQA 1IQPA 1VKJA 3I4LA 4ZCLA 5B30A 5M04A 2FX3A 1ODFA 2ASEA 4ZDJA 4DBLC 2ECKA 3U44B 2ZVQX 2R2AA 5KTYA 5FBRB 4URXR 5JLJA 2HJVA 4EQ6A 4JMPA 2GRJA 4II7A 2OE2A 3EX7C 4F4IA 4PO9A 4QBIA 5BWMA 4NYIQ 2O5VA 1OLOA 1T8UA 2QBYA 5CLQA 1YZTA 4GOKA 3I73A 2OILA 4D6PA 2FSFA 4TLCA 4TTRA 1IM2A 1ZUNB 1ZINA 4QNRA 4HB0A 1UKVY 3HDTA 3C15C 2W2VA 3B6EA 1T6NA 5JZVA 2QMOA 1AK2A 2ZRMA 1GFIA 1DG1G 3C7KA 3HPQA 1YZGA 3RRMA 4GZMA 1R0ZA 4NH0A 2JLWA 3TUJC 2IWRA 3K09C 4Q03A 1W4RA 1S9HA 4BPBA 3PUWA 3WNCA 1X8LA 2V7QD 2YVUA 2XTZA 4G3XA 2EYUA 2ZE7A 4LV8B 2ANCA 4RD6A 2AFHE 3CKLA 3LBHA 5AUPB 2R9VA 4PHHA 3UWKA 3NDBB 3AM1A 3CPJB 2FPMA 4KO8A 1RRGA 1KJWA 2ZRKA 1NN0A 2P6UA 3FHCB 4BFWA 3NWJA 4G01B 2BC9A 3TQFA 2FFBA 3QPWA 4MKIA 1D2NA 2WSMA 2WPDA 4JLVA 2AWOA 2RGCA 2QQEA 3FYHA 4JSTA 1HYQA 1MV5A 3OAAD 3VQTA 4GP7A 1EXMA 3C41J 3QXJA 3IDQA 1W49A 4N0DA 1I4TD 1S4QA 3EXAA 4N1AA 4LHYA 4YDSA 1I2MA 1NVXQ 5E7IA 2IA5A 1CRPA 4PHTA 2DHRA 3HWSA 3I3SR 2BVNA 5JJLA 3AEZA 5HCNA 3T1TA 3RS3A 3ZYCA 4EIWA 3LDAA 1YU9A 3ND8A 3TKLA 4BE7B 1CR2A 2VHTA 2ZJOA 1QZXA 2RGXA 4GT1A 5C4GB 4ZKEA 2WWFA 1OXSC 2VYFA 2A7QA 4F7WA 1XEWX 4L5BA 5K8IA 3OE7A 2AK2A 2ZRDA 3AKEA 3LBIA 4Q66C 1D2EA 3GJ7A 2VLIA 5E95A 1NMZA 1OH5A 1XPUA 4OJKA 2FGJA 4JLBA 1ELOA 1KO4A 2EFGA 2VSFA 1RPZA 4HDCA 1AS0A 1T4GA 2VP9A 3B85A 2B8WA 4Q1DA 2JIZA 1Z47A 1DS6A 2ZRFA 3CNLA 2WJGA 4L8GA 2QE7A 2FZ4A 4LY6A 4AC9A 5TARA 1M6NA 2NIPA 1GUAA 1QHIA 2Z6VA 1NSTA 2ZR9A 3EIQA 1AKYA 4RCZA 1HA3A 4FMBB 3HR7A 4I1SA 4AK9A 4PO8A 4PZLA 1G5TA 1NLYA 4TMTA 3WRYC 2NO9A 2VP4A 2IHBA 3FVQA 4D0LB 3K8YA 3ICQB 2IYSA 5FOXA 4DT1A 5HE8A 4DIEA 4TT3D 3H86A 4A9AA 4B3XA 1NIJA 4G5OA 2PZFA 3D7MA 4LHXA 2BJWA 3KXKA 4LYHA 3TAUA 1SXJA 1JAIA 4M9ZA 3GJ8A 1RRPA 3W90A 3CX8A 4MYCA 3SYNA 3ASYA 3VR5A 4G0NA 5JSZA 2KBEA 1A5TA 2HCJB 3SYKA 5JI2E 2ZS9A 4K46A 2E87A 1IY2A 2JDID 4FWIB 1VMAA 1ZCBA 3M4YA 1E96A 1EESA 4Q5IA 1F60A 3IEUA 3KTAB 4Q1EA 2VSOA 4F4JA 1G5RA 4Q4HA 2XSZA 3T1OA 3ADKA 4A8JB 3DZDA 1EFCA 2W2TA 3QQ5A 3PFIA 2AKAB 1UF9A 5BYJA 3QKRB 5AUNB 3FFAA 2F1JA 1IN6A 1S96A 4LJYA 1SQ5A 2ZRIA 3Q5EA 1FL9A 1GKIA 1GZSA 1LTQA 4GNKA 3ZQ6A 1QBKC 2ERXA 4Q9HA 4TYYA 1KIMA 3TR0A 4PPFA 5FTJA 4EJSC 5KDLA 1XJQA 1WA5A 2DFKB 3H0KA 1X8KA 5FUWA 5HTKA 1KI7A 3BJIC 1JR3D 4JJZA 4V0ME 4RD3A 1OJLA 1PLJA 2G0NA 3RNLA 2G77B 3KQNA 4NYJR 3VKWA 5CDFE 1G3UA 2RGNA 1XD2B 1R0WA 4B3GA 1KMHA 4MDFA 1GRRA 3ZIAA 1NJFA 3PUVA 2HT1A 2GEDA 4R9UC 3GLGA 1JR3A 3A1VA 4YONB 4EQ6B 1NLZA 3LH5A 2BEJA 1OFHA 2C9YA 2KE5A 1HQYE 3IIKA 4YMSA 1Z0DA 2WJJA 3PUZA 5TV2A 3DMNA 3OFNA 4TWZA 2OSBA 1L4UA 1Q1ZA 1Z0IA 3CLVA 3B7GA 3QPVA 4GMDA 1KY3A 4LYFA 3U6KA 2RGDA 3LQRA 1Q3TA 2LKCA 3EIHA 1D5CA 4Q4HB 1KI8A 1FX0B 3IO5A 2QM8A 1KSFX 4IOJA 3LAWA 1VTKA 2GCOA 4RKFA 5AUOB 4TTQA 4MKFA 5L3SA 5H68A 5CITA 2WV9A 2GXAA 4NPHA 4DRZA 3UG6A 1AQUA 2CVFA 3PUYA 4MRVA 3CX7A 2G3YA 3SJZA 2DR3A 3AGQA 5HR5A 2D2EA 1RRFA 2RGEA 3W3ZB 4A0RA 3QVVA 3BORA 4N3NA 2ODBA 1E9EA 2ZJYA 421PA 4CZ2A 4I1UA 4DLTA 4OHVA 4A0GA 2DFLA 3LO5A 4PHGA 3BWDD 1C9KA 1PZNA 4J0QA 3TRFA 2ZYTX 1WDTA 3BBPA 3UMSA 4UNNA 1NNEA 4CDGA 1RJ9A 1T3LA 2Z83A 1VECA 5BQ5A 4TZ0A 1W4CA 3QG5A 3QE0A 4L16A 3GLFA 1E1QA 4Q21A 2V1UA 3I1FA 4O0MA 4CVNA 2VO1A 2EW1A 1NVWQ 3FMPB 3TVTA 3EPKA 5D3MB 1KHTA 1B23P 1K8RA 4L4UA 5CJPA 1I2DA 4FMCF 3MMPA 2C9OA 2FH5B 1Z6XA 4HLDA 1AN0A 2PT7A 1BIFA 3DM9B 2XTNA 1PLKA 1NIPA 4JT2A 1M74A 5L3SB 4FWTA 1UADA 2OZEA 4PC1A 5BW8A 1QRAA 2KB0A 5EP3A 3TJZA 4LBYA 3ETLA 2B92A 1BOFA 4I99A 4M1MA 3RS5A 3TAHA 3UATA 4JLKA 4B33A 2E9SA 1W0KD 3B5JA
chains in the Genus database with same CATH superfamily
1IY1A 5E2IA 5IJAA 4XM0A 4FR2A 2IU4A 4U2DA 3H42B 1X74A 2YTZA 3EZFA 2B5WA 5CVCA 2FW7A 3LSTA 3MMNA 3BFKA 3IQDB 3AB7A 3JVEA 3TCKA 2NTVA 3HPRA 3QOYA 1OHHA 4RH0A 4JH0A 4AW9A 4RXMA 3ID6C 3ANTA 3B7WA 3QU9A 3KDSE 4HAYA 5DCUA 3JSAA 2CNBA 3A1EA 3SN6A 3ZGNA 2NT3A 3V4LA 2HBQA 3N53A 4W7HA 4HV4A 3IE2A 4Y2XA 1Z6PA 4YJHB 2C61A 2RBGA 1DAGA 2P2YA 3KSUA 3NORA 3V6LA 1QK4A 3LVQE 3O4RA 3N8GA 1E79D 1M8PA 3I6BA 2OFPA 4KI0A 4WIAA 1ZZGA 5L3VA 4QELA 4RDIA 3EH2A 1SXIA 5D86A 1JYSA 2ZRLA 1JJVA 5DXJA 1C8VB 5LXTF 2B1QA 2E4ZA 1U3DA 3ZY2A 2J9GA 2XSZD 3H4VA 3VSCA 1FP4B 1TGYA 4HEA1 2JLCA 2W98A 4RO0A 1ZIDA 3H1AA 1GDHA 1ISJA 2CZQA 1RRMA 3T95A 3B52X 4I9HA 5C46F 2HRQA 5ED4A 1R15A 3HZOA 4JQSA 5LWHA 1SZPA 2OWEA 3MJHA 4XI9A 5FBLB 1QU3A 3E9MA 3PT9A 4QARA 4XUGB 1XL1A 1SRQA 3IO3A 2C20A 4LRSB 2Q4EA 3MB5A 1CNEA 4KQEA 1H4TA 3HBNA 1P9NA 2Z1NA 2KPOA 1U8YA 3R2JA 3R5FA 4GG1A 3NHUA 2R79A 3PT5A 3R7WA 2XUAA 1MVLA 4O2AF 2QJTA 4D80A 5JROA 1QR2A 5CLLA 1NBMD 1U1DA 2AKYA 1QUEA 1WXQA 2QUHA 3CG0A 5G2OA 3ZU3A 4CR6A 5EWJA 1UDWA 5L9AA 1N7HA 4R4JA 3AZOA 4AN1A 1T5BA 4F3TA 1TO2E 1E1RD 1LDGA 5BMVB 1EQAA 3BMOB 4WZ6A 4B48A 1N2JA 5ILQA 3OCCA 3M3PA 2VUHB 5TQJA 1W36B 2G72A 2VYVA 4BWGA 4EH1A 1R0YA 3T12A 3AUSA 4MQEA 1EQUA 16PKA 2G83A 1QDUA 4EW6A 2ZE6A 4MA5A 3RR2A 1GG5A 1I30A 1JRLA 4GPAA 4QUIA 3EYWA 1N57A 3LZCA 4O8CA 1HKUA 3NUZA 3VZQA 3WC4A 1PFVA 3W2FA 5JLAA 3SC6A 3HVRA 1U9IA 1E4VA 4RZXA 1I7PA 2I4IA 3FSJX 4MHTA 5CJ2A 1EP1B 1VA5A 1OGYA 2QTGA 3B2QA 1C3LA 2IODA 4WQMA 2LTAA 1B14A 4X93A 2YWDA 1XRNA 1CB0A 2XOEA 3KUDA 4PAGA 4BECA 1C3OA 4B7AA 3WYDA 3PQDA 4AKHA 5FLEX 1KJNA 4M0EA 1D1QA 1NHWA 2YNMC 1VCMA 4ML3A 1B4DA 3DVLA 4MAFA 4W5JA 3ZI7A 4DCMA 5J4HA 3HO1A 4LJ7A 2PT5A 3B13B 2BW0A 4RS4A 2VBGA 1NDQA 3EVDA 4PINA 1Z6TA 2QUAA 4QATA 1UPBA 1LF0A 3ITKA 4YRJA 1T5HX 2CD9A 2V5AA 3A1NA 3P52A 5AXDA 4CN9A 4EK9A 2C88A 5JTUA 1XBTA 1RM3A 4QEDA 1U2GA 3F67A 4V02A 1B76A 4D0GA 2E3JA 1FUKA 3GWZA 4DJTA 5B6IA 3HNPA 2P8SA 1JFVA 3B9PA 3MW8A 4LZWA 2JGFA 2HXGA 3M1LA 2G09A 3OVMA 2G82A 5F73A 4EMTA 3H97A 1E59A 2GEFA 4E14A 3HA2A 1NRIA 4H18A 4IHQA 1IEXA 3V2GA 3ISVA 1R4MA 2NZJA 2OO3A 2IL1A 2Q3HA 3BIOA 4QJ4A 3TZQA 4EI2A 2OCKA 3PX7A 1FNBA 2FFAA 4W8HA 4AJOA 1U90A 1VJGA 2I3BA 2ZAIA 4J0GA 1U2DA 1T9AA 4JWKA 5D5HA 1E5LA 3PHBE 2ZIVB 3E2MA 2D1QA 3LMKA 3RU3A 3TINA 1NN1A 3FPGA 4QDZA 1FTNA 3OTHA 2ODNA 3DLAA 2VC2B 3NPAA 4LOIA 4B74A 4F1WA 2WRZA 4YALA 3GRCA 4MP6A 1RQXA 5CW1A 3UFXA 4H77A 1JEEA 3OF3A 1GT91 3D6NB 3KPUA 1G8AA 2PZAA 1KOFA 4ARZA 5AVRA 5CNMA 1PFWA 4Z0HO 1JSRA 4UU8A 1ZM9A 1AB5A 1GKUB 1APBA 5LL6P 2YMQA 1XZAA 2CY0A 2HL6A 3DOHA 3G85A 5E2AA 5F3DA 3WLMA 4ES6A 5IAEA 3JRXA 1C3XA 3GCXA 3GUCA 3Q2IA 2PX3A 4KWEA 3CH4B 3V3KA 1LBEA 3NXSA 1TQDA 1EWQA 4Q9LA 1DOAA 4KNYA 1EFLA 4BO7A 3D4LA 1QXSA 2CB9A 4HH4A 2JLYA 3BJMA 5ALWA 1T1GA 4I1RA 3IQEA 1IXRC 1SUPA 2K7ZA 4AD8A 5AKZA 3I9V6 3SVTA 3MJRA 4XD7A 1ULTA 1K68A 3DKRA 1C9JA 3B38A 2BZSA 3KT0A 3L82B 5ER9A 4DV1B 2J8ZA 4QHSA 2D6FA 4G37A 4IYJA 3KUXA 5EJMA 1SOVA 1Z36A 3K3PA 4IZIA 5G0SA 4A2PA 3PF8A 1W5FA 1BW9A 2P4HX 2PRIA 4RMNA 2X6QA 4TUYA 1RWBA 1X1TA 3B3AA 2C1EA 2D0OB 1AY0A 2VHEA 4H9GA 4J6FA 1Q0SA 2B7CA 3TUIC 4LV5B 1GAWA 5H59A 1Z15A 4O4JF 2XT6A 3TCNA 2IYEA 3JQ8A 1P0FA 3KQMA 1E9BA 4OBEA 2HNAA 1N1DA 3ZHSA 2FK8A 2IXBA 3AR6A 3JASA 4HCJA 1C81A 2WJ3A 3L8CA 3I1JA 2DLDA 2O05A 3M8KA 3NKVA 4XQGA 5CCXA 1HT1E 4BLTA 4UDYX 1XZBA 2WIBA 3V7UA 4ZANA 4KACA 3K1YA 2IUTA 3FHTA 1Y9EA 2AF4C 2AGVA 1WWKA 3B89A 3EIOA 3P0FA 4HNQA 2FN9A 2FSIA 3T3HA 2XDAA 1VFPA 1SKAA 4DCOA 3MAAC 4BRWA 1I6LA 4LN1A 1IY0A 1KI2A 1WKCA 2WTEA 4D4LA 1QHHB 4ZMSA 4IZOA 4GZ6A 1OZHA 4EZIA 3T3NA 3AL3A 1E8MA 3LF2A 4YMUA 4MYRA 2QR5A 3IP9A 1QRSA 3I04M 3CLSD 4UM5A 4ME6A 5LOVB 3HY3A 2DP4E 3L7KA 1LCIA 3KQQA 3R7AA 3VR4D 5FOTA 1E92A 1ZIXA 5J3JA 1BHQ1 4G5XA 2ZAYA 1ORIA 1NOJA 1T91A 3N2IA 2R6AA 4ZZ1A 4Y2QA 1J2YA 1AO3A 3X2FA 5KOYA 2RMKA 4MV6A 4MDEA 1WRBA 1T6XA 1TYBE 2PO7A 3T1HB 2Z9DA 4RNCA 3MTEA 3UEOA 3P45A 4DV0B 2LRHA 1OLXA 1FFAA 4RIFA 4D81A 1W29A 1XV5A 5EHIA 5I7OA 1PFUA 4PFKA 1PYOA 2RG7A 2F4VB 3LNTA 4ZAVA 1GL6A 3M6AA 1HF3A 1GYPA 4HUQB 4AVYA 4PYRA 3FPJA 3DD5A 1FDRA 4PLFA 3H4IA 1NXVA 2QLMA 2GERA 3LPDA 2OXCA 2J33A 3S0JA 3FLMA 1Z35A 1ONBA 3FIUA 4IMPA 3FNEA 3SDSA 2YRXA 3IUNA 3I5XA 2FMHA 3SZUA 4YRFA 3VTZA 1Z6YA 2BI4A 2TMGA 4Q1VA 4RD0A 4C7JA 5IZCC 2ZBPA 3ILHA 3QHAA 2HK8A 4KDEA 4P32A 3TJMA 5LN1A 3HYRA 2KWIA 3NLLA 3TLGB 4IRXA 1Q77A 3R3YA 3KQTA 1IM8A 4GOXA 4O1HA 5IAOA 1EIZA 3GVHA 2OFOA 1EFRD 1EJBA 1S8NA 1A5AB 2Q1SA 5A6VA 1GL7A 3E8MA 5JBQA 1LK5A 1SCJA 1JHQA 2PAAA 3I2FA 3D6VA 1DCTA 3F96A 3R3SA 1YZ3A 3RTDA 4ZIRB 3V8NA 3ENKA 4EUSA 3RJ5A 4KUGA 1HNXB 4QYXA 4ZYZA 4LVCA 3R5XA 4RLFA 1P39A 1LKZA 1GDDA 5HDBB 3QKUA 2Q3DA 4WXEA 1K75A 5KINB 1A4RA 4ZI5A 1Q15A 2Q7OE 1NQAO 5HF8A 1ZONA 3WYGA 3N59A 4ZQFA 4CLOA 3CR3C 1N0IA 2AG8A 4DTIA 4PGFA 4DNXA 4ENQA 1XQ1A 1Z5ZA 3BJEA 3LGAA 1CD5A 4RDHA 2V6BA 4MP3A 3A04A 2ZULA 5F7JA 4F45A 2HF7A 1UM9A 1L5RA 4RYLA 5ELLA 2J67A 4MQEB 4NFLA 3GA5A 2Y0PA 3CV3A 4P4TA 4LOAA 2ZWVA 4EELA 2X5JO 5IKXA 1W73A 2EOAA 3D4PA 2N0SA 2G08A 4RMJA 2AC7A 3W7AA 2QUIA 2J08A 2WF6A 3L7AA 1NQ5A 3CJTA 1UKZA 1CNFA 3KQPA 1FU8A 2R2GA 3L5KA 1C1YA 2YMLA 5KYYA 4RHCA 3CUSA 3O47A 3RM3A 1GV1A 3FYCA 2V4MA 3CKKA 1SY7A 1BCRA 1HV8A 3P2MA 1QDLB 4LDZA 1PJRA 1G41A 1AZLA 3FUWA 1AGYA 4JFRA 4UNSA 5ALQA 4B3TB 3EVTA 3PX2A 5K4HA 4PF1A 4K6FA 4DLXA 2WT8A 3G9ZA 2M1ZA 5ICCA 3R4CA 4BCDA 3H9CA 4P7JA 2AYYA 4PG7A 1AK1A 1E7MA 2J3LA 1L7PA 3IKLA 2WT9A 3SM3A 4Q1BA 1CETA 3JYHA 4YCLA 1NSFA 3EPLA 4TL6A 4XFDA 2I3DA 3IKVA 3LX5A 4JKIA 4C6TB 2JKYA 2RHLA 3WLNA 3HEMA 3LD9A 5GVRA 5IW8A 4BZXA 1X7HA 3RHSA 1CC1S 1Z17A 1LLFA 3KR9A 3PEUA 3CO0S 3V1TC 2OKCA 1P74A 1R12A 2I7TA 2ZSEA 3CLRD 4QPDA 2O0KA 2H4XA 2R62A 5COQA 5CT9A 5AVQA 2IYAA 1ITZA 1AMOA 1PV4A 5BOSA 6ABPA 4WOJA 3O8QB 4JR0A 3HP4A 5ELXA 4UTZA 4HAXA 4NP6A 4BGEA 4M36A 1T2NA 1PWEA 2G5PA 1G9TA 2Q1UA 1GTJ1 2GCIA 2XNDA 2V6FA 1XCPA 2CK3D 3AJRA 3O74A 3VPDA 4LZPA 1VSVA 1XL0A 2ZSHA 3TXAA 1O4VA 4J03A 1EDOA 5FBQB 3J7AC 3EBPA 3NATA 1BA3A 1NVVQ 4MUBA 1PL8A 5JSHA 1JJFA 3K73O 4KI7A 4LOKA 4DL9A 2ZBFA 4DWWA 2HM7A 2WSIA 4HPWA 2WA2A 4ZOBA 4N48A 3ND6A 1JDPA 1JG2A 3EEQA 3BICA 2JLUA 2QHXA 4BQRA 1G59A 1GTRA 3SAJA 1RXYA 4TN1A 4IQ0A 4DDTA 5KO2A 2O8EA 4FE3A 1UFKA 1XLUA 2IRWA 3CNOA 4FMPA 1KWKA 3HC7A 4XVCA 3D3JA 3BEOA 1TUEA 4XSVA 2LDXA 4DTCA 1K5DA 3QIAA 1K6MA 3PCXA 3W6PA 3VI3B 3BKWA 5IK2A 5JCOC 4DIOA 4WEOA 3X1KA 1U8CB 1R88A 4ARZB 2GUGA 1JHRA 2LIPA 3SF8A 4DIKA 1CV2A 1K7YA 4PV7A 2BMVA 1MT0A 1Q7GA 4EX7A 2PGOA 2EEZA 3SBDA 1J99A 1FFEA 3GRYA 2A59A 3IERA 4LYGA 5LB4A 1KPHA 2Q9BA 1BYIA 2D5AA 4HC4A 3TEMA 4L15A 4UHCA 4YT8A 1JWAB 1P91A 2AWNA 3NM5A 2UZ3A 2WIGA 3I2KA 4GWKA 4JUCA 4BO8A 2HB6A 2QGNA 3PC4A 3FPCA 1FFWA 2OVFA 3ZWMA 1PDVA 3HV0A 1NAHA 2HLHA 3BTSA 2OC9A 3AJ9A 3CN9A 2YWFA 3C7DB 2HDWA 3OCXA 3OPNA 3CURA 3HJGA 3TBHA 1Q21A 3R9KA 2YY6A 4BVFA 1GR0A 3L49A 4WKCA 1USGA 3GJ6A 3K0KA 4NQRA 1AS3A 4N5DA 4P3OA 3T35A 4WKGA 1RLOA 4QU9A 4YYEA 2WQ6A 3RFCA 1N6LA 1NUSA 1GSOA 3B2EA 4AY5A 3VO2A 1N5KA 2IOFA 1JUDA 4F21A 4BE4A 2XH8A 5AUQA 2N1MA 2HCBA 5DGTA 3TQHA 1IAVA 1XDUA 2QRJA 4A4DA 2PLFA 1P8AA 3AUTA 3ELYA 4A0SA 3CRNA 3K09A 1UDAA 4KMRA 1FPMA 4W9NA 1U0RA 2DTDA 3EY9A 1HDZA 2IHUA 4ISCA 3ZE9A 2IU3A 1DOHA 4QVGA 1NXWA 1FMLA 4CT0A 1AQJA 3AJ8A 5ALYA 5ITZA 4N5IX 2HOQA 4O4LB 4EEXA 3SKXA 3U48A 4MXDA 3VI4B 3S28A 4Q3BA 1NVDA 3DMTA 1DELA 1S3GA 4GM1A 4NV1A 4R3NA 5JCPA 3D6AA 3E9ZA 2E18A 4B81A 2IVZA 1QBGA 3WO0A 1OY1A 2CXNA 4TS4A 3TCXB 3RVOA 4FFRA 2X9NA 3ZYZA 3GUYA 5CHYA 1PS9A 1E2QA 1G8JA 1TMGE 3I76A 4LJ8A 2HFJA 5IAAA 1ZN8A 4D9JA 3LXUX 1AN9A 1BMQA 4GOMD 3KVNA 1Z0KA 4K8RB 4F60A 1VPTA 1D4ZA 1UZLA 3IHTA 5EZ5A 4DDVA 5KOHB 2WB2A 2BFOA 4M53A 2MYNA 1NU8A 1P44A 1SIOA 2FDRA 3EZNA 4NBKA 3EOBI 2QD1A 2X4GA 5DM60 1VKRA 2BKEA 2FZKA 1QVWA 1NM5C 2BGTA 5K2MA 1U1GA 1E0KA 1JFFA 4XSGA 3EXEA 3OPXA 1QLHA 4RF5A 4BO9A 3BREA 4I5EA 1MZVA 3WB1A 5D7NA 1YS6A 3V42A 3E7WA 5F9FA 3OLQA 3U7QA 2X14A 4G5RA 4LZAA 1ZFNA 4EYQA 2I87A 4GRAA 1QHNA 1P9RA 5AK3A 1P2TA 1NVEA 4UASA 4EI8A 4AY6A 1PD1A 1ZBDA 2QX9A 5B3JA 1HLGA 3U5ZB 1RYHA 1BGXT 4EABA 1Z06A 4LPKA 1DRJA 4MR7B 1SUBA 2J0UB 2MSKA 2WSSD 4FB5A 2WVAA 4AJNA 1T0HB 3C8ZA 1RCUA 1NDUA 1YJCA 4YRCA 3DPIA 5IBRA 4GHWA 4BJ6A 3L2OB 1T2CA 1VCOA 4YRAA 1W36D 5HJ2A 5CT8A 5KYWB 4MW4A 1NW3A 4NDZA 4YJFB 1FLAA 3FDZA 4CN8A 4BP9A 3A9CA 2ZIXA 3H99A 4EW3A 4U7DA 2W9XA 1FJ2A 1VSUA 2ZYDA 4FFVA 2QE6A 3NBUA 2XGSA 4G97A 4YBZA 1G63A 3HWX1 2F9MA 2ZB2A 3U7GA 2JI8A 3GAAA 3Q3VA 3EUFA 3TMKA 3WP1B 4MHSA 3SKYA 2DY0A 4PGAA 1N6HA 2I3AA 1J1UA 4D8YA 3F4KA 1YQDA 2WJVA 4P4GA 4EEZA 2H2FA 2QG4A 3V9AA 3KEFA 3R6TA 3LA8A 2QX7A 5GZ3A 1AGRA 2B82A 2FWAA 2PKYX 1Z07A 1TKRA 2DPLA 2Q8NA 3BGSA 3PDHA 3R76A 1ZJ6A 2QL9A 3A32A 4NCHA 2J3JA 3ENQA 3I2IA 1FFXA 5I7WA 1LV8A 3GHHA 1YI0A 2Q3MA 4Q3NA 5A5VA 4EKYA 1XDZA 3OZUA 2I2XB 1J7JA 2JGMA 2IEGA 3ER9A 4YO7A 3R3XA 1C30A 1Q7EA 2UKDA 5K5EA 2GPJA 2ABWA 4F6RB 2QPTA 1OPRA 3UAZA 3I0MA 3CFYA 3WGIA 2EW2A 2JFYA 1TIPA 4U7HA 3GUZA 3UV6A 4GL2A 2F2TA 3UXEA 3WYAA 4N41A 4GPTA 1CQJA 1MPTA 4NCAA 4DYDA 2VJQA 2WK1A 1GQYA 1ZGHA 2QW0X 3UJHA 3JYQA 2W6IA 2ZJ2A 1JI0A 2X6RA 1WXGA 4R8RA 3SIXA 4AXBA 3LXRA 4QXRA 3D3QA 1HLFA 2VDWB 2GRUA 4RPKA 3WOHA 3OAAA 4X64B 3KETA 1VIVA 3HCRA 2H06A 4I2NA 4YV0A 3RS2A 3NETA 3B3JA 5DRTA 3MK31 1YU6A 2YW2A 3UQYS 1R6TA 2QGZA 2C7VA 4MQLA 4G23A 4NK5A 3H2KA 4WX2B 2Z95A 4NQZA 1XVLA 2P91A 1TCVA 4M55A 5LNK6 1XNHA 2RGUA 2ZLBA 2HCFA 3NWBA 5J4YA 1KFKB 4DUGA 1S5PA 4OAOA 2JZCA 4LISA 2PPVA 5A1TA 1DDIA 1X39A 1K89A 5TJ9A 1GNSA 4TV9F 2P9TA 2XF8A 2FSSA 3RFTA 1M5UA 3FOZA 1LNSA 2A0WA 2PZJA 5THQA 4ESVA 4YN3A 4QOFA 2Q4RA 5B53A 4R98A 3HXKA 3MTJA 4QNMA 4KW7A 5C8VA 4HWTA 4MR9A 3K32A 2ZWMA 1CR1A 1CEQA 1P2FA 3GIWA 4MV7A 2ZZMA 2QVXX 4J07A 1OAAA 5DNEA 2B35A 5FTWA 1M76A 3L6CA 3JQQA 4RZSA 4CTJA 1Q7RA 2MYUA 2ZJ8A 3OIGA 2GZ2A 4HWKA 1KO1A 2QQGA 3UJAA 4JI3B 5K20A 3NYQA 3QY0A 2VHVA 1XKQA 4ZEWA 2R1UA 4FDUA 4HRYA 2VYCA 4BQPA 1PHPA 1E98A 5K3AA 5IULC 5DN6A 1YJ5A 1IJEA 2EKQA 1KEUA 1VBNA 1F0KA 4HFNA 1M83A 3A6HA 1I5RA 2CMKA 1TMOA 1Z4NA 1ZEJA 2IPNA 3O3CA 3RRYA 2I5PO 4IS2A 3E70C 1WJGA 1SPBS 1KAQA 3TTXA 3CMMA 5HMLA 5IDQA 3WMFA 3G2NA 3A3NA 1NY6A 3H5LA 2X3YA 5J4LA 2P9YA 2H7YA 1TF5A 5JWHA 4A10A 2Q2QA 4W9RA 2C04A 3LQQA 2VBIA 3UXMA 3L1IA 1AM4D 1HYGA 1I2CA 4LBZA 2QV0A 2EBWA 1ZM4A 1FP6A 1RPTA 1XG5A 2CL6X 3DVAB 1N5JA 3JQ9A 4ZOCA 3IEIA 5IU6A 1NBOA 3MJEA 2IYTA 3KR1A 2D4HA 3FKSD 1ND5A 4PR3A 5ES3A 3DCYA 2POQX 4CM4B 3VH3A 4TT3A 1GGHA 3BKXA 3FR8A 4MGZR 1TZCA 1OV6A 1VKOA 3E0XA 3JQ6A 3P19A 3V8EA 3JCZA 1ABBA 2JH3A 2OHIA 3QUAA 4P82A 1SXJD 1RYEA 1QVZA 4UEQA 5I9NA 2R1VA 3WKDA 1D2HA 3ACBA 4JN6B 4UM8B 1VJRA 3IJ5A 4URYR 2D4AA 4X94A 1O03A 3RK0A 4PRYA 1XZJA 1SELA 4O1IA 1RJDA 3T4XA 3H16A 1FX0A 2IY8A 4NYMQ 4XDZA 1PI3A 2CBGA 3HI4A 2Y1GA 3KKZA 4QSHA 4N82A 5A71A 4ZMBA 1KZHA 4Z4CA 1N0VC 3IBCA 2UXDB 2FEMA 4KYTA 1UBTS 4XIJA 1K6XA 1LLUA 2BEWB 5IP5A 2YWRA 4DY6A 1AV6A 5F2KA 5KREA 5IJ0B 1XVUA 2HA2A 2H1SA 3A9UA 2HT6A 2Q4TA 5F35A 4CTMA 3R5TA 2QVGA 4Z49A 3O7MA 1XDGA 2IUFA 4NESA 5KSZA 3T4EA 5EJGA 2B6NA 2CMFA 2ZJZA 4GQAA 4OX9Y 2JGKA 1U7OA 2G4LA 2UUCB 3PLNA 5DNUA 1LRKA 1R5NA 2QZ9A 4P36A 4LXGA 2BM8A 2F62A 2YIDA 3KKLA 2GF0A 4JEIA 3DZ8A 3ZU2A 2VIIA 4U2KA 3LUAA 3A1CA 2OLJA 3QEJA 2IH4A 1R0SA 4FONA 4F97A 3EVZA 2BGKA 3MC1A 1W93A 3EVEA 1N2XA 4HUJA 2C4VA 1QANA 1E1LA 3G1WA 2WJWA 4NE7A 4R2HA 1U31A 1F2DA 4O8ZA 3S2GA 5JVDF 5BW5A 1A8QA 5TY0A 1KAHA 3M33A 3HP1A 1U28C 4QWWA 4MR7A 3L1KA 1XZDA 4H27A 1P7PA 5D3MA 4P3PA 3EEOA 1JZQA 3NHSA 5JMTA 2HBRA 1JJ7A 1ZL0A 3I42A 1YZUA 3BCRA 1SHJA 3KJHA 5FNVA 1T3TA 1KMNA 3DMYA 2J3QA 2OQ2A 2PRJA 1E3LA 2XMDA 2R6GA 4ZAWA 3AFMA 3EXEB 3MA0A 1GGJA 1K66A 4MRAA 5C1BA 4ZAYA 2O3RA 4MUIA 4W5WA 1CQIB 5DULA 4FN4A 3CR8A 1TK3A 1V96A 1XIVA 3QEBZ 1XN1A 2ERCA 1BYUA 1NLUA 1S2OA 2IV7A 1QJCA 2FZWA 2HIGA 4B46A 2QPLA 4QJBA 5IT5A 5J1TB 1V25A 2FW8A 2B3DA 3WFJA 3M5WA 1U5CA 1FY2A 5AR1A 4CI9A 2J0UA 3TW0A 4F3KA 4TLEA 2OA0A 2AQKA 2PPLA 2REQA 4KIJA 1MHPA 2J3MA 2XMBA 1CQPA 1IHPA 5KC9A 1WCIB 1CYEA 5BOSB 3KXPA 2L19A 2GD0A 4O5OA 5BSUA 3IUEA 1NC3A 3S40A 5LPNA 5ECDA 4PYJA 1XZEA 3KAQA 3RQIA 4LE1A 1CJTC 5SZHB 3CRW1 4AJKA 1MABB 3EEFA 5DLDA 2H4JA 2FXIA 2I6QA 4EFLA 4UW9A 2GILA 1KFBB 2PMFA 3DA8A 2GZ1A 4FK8A 4NCXA 5EJ4A 5JJCA 5IVHA 2QE7D 4ITRC 1O57A 1UKCA 4BOYA 3I61A 4G5HA 3TSAA 3OIVA 3DR5A 4Z8YA 4EY6A 2GZ3A 4LVUA 3PPYA 3UKDA 2UYCA 1K3TA 1IZYA 1KYXA 4HAZA 5FV4A 2H00A 1EG2A 2EFCB 4RMHA 4BS9A 1U7PA 4FX2A 1LWNA 3C1OA 3F5FA 5EMMA 4W9MC 2C5LA 1R5BA 2LIVA 2QTRA 3MTAA 4R2IA 2H2HA 3P8ZA 4BO3A 2VSYA 2NW6A 4ED9A 5JFGA 2AUTA 4N5NA 4Z8XA 2RHWA 3R7DA 3KLBA 2A92A 4QX6A 4NPAA 3LY9A 2F3PA 4EHJA 4EI7A 4BTVA 5E1MA 2W6MA 5G53C 2FUKA 3FWYA 3NDRA 4MWDA 1X42A 5F98A 2UVDA 4RV9A 1E9CA 1Y8AA 1UAYA 4RETA 4XVRA 1WCWA 2Z3WA 4G0PA 4MW5A 1M2KA 2PT6A 2Q45A 3B6JA 4TLLB 2CSXA 1E5TA 2HLDD 2FV8A 1S2GA 1TXGA 1UJ6A 2WTMA 4BUCA 5C4MA 4Q7KA 5K8TA 5KHLB 3HYNA 2BMFA 2AN5A 1QK5A 3N8DA 1EFAA 2D5LA 2AF3C 1UMKA 2LD4A 3MINA 4HLQB 2VQEB 1UJMA 2Z08A 2ZYSA 4DABA 5HJ5A 3IV7A 4BDSA 1O95C 3MFQA 4F56A 3QVWA 1DP4A 1Q44A 3WV5A 4LQDA 2AJBA 1CVLA 1XELA 1GXSA 1S1CA 2INGX 1K8YB 1O9HA 1V2HE 2X9QA 4PS1A 3B12A 3ONWA 4YDRA 1ZNWA 3HEAA 1JU9A 2NYAA 3QF7A 4EPWA 4E3WA 3DDUA 3PQ2A 5JXIA 4PTYA 1EXVA 1QKJA 1J23A 2NZUG 3IAEA 4JKOA 1P2DA 1GQFA 3ZW9A 2VZLA 1NONA 2E49A 3OEEA 1U6JA 3DTNA 5DNCA 3TW8B 3A31A 4GUAA 1UBJS 3JALB 1NX6A 3LYUA 1W9HA 4JQOA 1YC2A 2O52A 1C4KA 4KNVA 3CNQS 3ADOA 1T8RA 3IODA 4F5EA 5CB8A 2VRNA 1K5PA 1SB9A 5AVXA 1KYYA 3C7AA 5FAXA 4UM9B 3L41A 2A67A 5FFFA 1V26A 3PQ8A 4BB0A 4DJDC 1ZJYA 2BAGA 1BDBA 3BQ9A 3GLHA 1NI4A 3SSMA 4GI1A 4F3NA 2PANA 2VJMA 2ZREA 3KXDA 3B5EA 4ITUA 2G0AA 3GPBA 4CKZA 4R2LA 2OV3A 4RHEA 2Z09A 2FCAA 4JJ8A 1G9SA 1U65A 4MCIA 2M6RA 3ASZA 4QPCA 3GQBB 5AJHA 4YPFA 1TEVA 4JELA 2Q5QA 3IDSA 3ONVA 3TDNA 3TE7A 1QRUA 2V1XA 1WUTA 1U98A 3QFCA 3QELB 5E38A 1DQYA 2GYYA 2ZQ5A 4NOJA 4DZTA 1DKUA 2PV0A 4DA6A 2Y05A 4GLFA 1V11A 1A4IA 4E5YA 1JEDA 2Q99A 5ENVA 1Z3CA 2QMQA 3GD5A 2A8YA 3U9SA 3R75A 3OBBA 1XQ6A 4RJLA 3UH0A 1CZHA 1NW4A 3ZKWA 2V7QA 2D1TA 5K1ZA 1G5FA 1YJAA 3CZRA 3AY6A 4Y1EA 4CM4A 3S2IA 4Y6PA 1HTTA 3L0BA 3L84A 4DA8A 4RVNA 3VNUA 3HU1A 2GDZA 5I8PA 3DMTC 1WF6A 1Z0UA 1QYRA 3TSOA 3ZDBA 4IIXA 1QFYA 4JT9A 4J0KA 3PTZA 2XADA 1TU4A 2QIOA 3G2QA 1DTSA 1F6BA 5JCXA 1Y9DA 3B8EA 1JTFA 4ID9A 4V2UA 3AH8A 2CV2A 3IPAA 3NH6A 1K86A 2JIDA 3WSTA 4AO7A 5E7JA 4HJXA 2P67A 2VHXA 5DH9A 3OZGA 4BU1A 1QS0B 3JV7A 1NJ6A 3Q15C 3W9SA 3CUWA 1PT9A 3CRQA 3OE4A 3ZKAA 3L0CA 1M9NA 1NW9B 1FFSA 2JLQA 3CVYA 2HQ1A 5AM1A 1CQWA 1N3BA 1S8FA 1Q22A 1SVNA 2C5HA 4OOFA 4DCTA 1EZ1A 1SB8A 1ZITA 4U2CA 4NPCA 5FOWA 5DPMA 1T1RA 1XTTA 3GFFA 2PU7A 3SJBA 3QFRA 1DJQA 1D4AA 3E7FA 5AI8A 2J85A 3M9XA 1EM8B 5CVEA 4Q4LA 2OESA 3ZD6A 4DREA 3K1JA 4MVJI 1T29A 1H6DA 4JNCA 4X8OA 3JQGA 4EENA 2RK3A 1A9YA 4BV8A 1RI2A 2EX1A 3S68A 1ESZA 2AJCA 5HOEA 3PRHA 4CKYA 5HWSA 2BGJA 1G8GA 5FI1B 2X77A 1Z4KA 3GGJA 3RABA 4YJ3F 1L5FA 4A8PA 1ZGGA 1AJEA 4NKRA 4CKEB 1VHQA 3ECCA 1L0BA 4R9SA 4E5VA 2IH5A 2ZK7A 3B3QA 3QBTA 1HPLA 2E48A 5DX8A 4O4HB 3T5BA 1M10A 4X24A 4B31A 2YWGA 3EMVA 2CLSA 5F2EA 4QUAA 1X7YA 4AG5A 1V1RA 3UK7A 3QX3A 2X7HA 3C4QA 3JASB 3LX8A 3V8VA 4EYSA 2QVBA 2IHNA 3ELDA 1IYZA 3JSXA 1CRLA 3DHNA 2C2BA 4BMYA 2QG6A 2RGWA 3L7IA 4DLSA 3X43A 2WAXA 2QXUA 3DGFC 3OEWA 2H9IA 1EM6A 2R8OA 3AU9A 4GOJA 1XCMA 1U2ZA 4HGRA 3P94A 3G49A 4UFNA 1CFJA 1HNNA 4Q1AA 4UPVA 2I4LA 4WCFA 1A2QA 1AF7A 3D8TA 1W19A 3A1DA 4B75A 4TUYF 5JD5A 4DLRA 1EJ0A 3LXXA 2PYDA 2P9JA 5LQMA 4F6CA 5BV0A 1LPNA 4Y1RB 1LBHA 4OGGA 4C0WA 1V48A 3FOCA 3OCUA 3R7WB 2FQYA 4OAQA 4IKPA 3RUAA 1JSCA 3OFVA 3I9OA 3VJRA 1GAXA 5ALGA 3NTRA 5CGQB 2PBRA 4HNUA 2W93A 2BH2A 1Z28A 1JHDA 1QQ5A 4P4LA 2WVGA 3DHEA 4IEEA 4EMBA 2BHNA 4PZDA 3BTVA 5BSWA 3T5PA 3EFOB 5A02A 2DQZA 5MFPA 4GFDA 2BJVA 3GU3A 2OHOA 1TW2A 1Y4SA 4RY8A 4EB0A 5C51B 4QASA 3AINA 3WBFA 5TLSA 4H08A 1N5RA 4IW3B 5TEVA 2XYGA 1MNQA 3HDVA 2D0PB 2I7CA 3NB0A 3UV3A 1UXHA 1LSJA 1E7WA 2F1RA 4I2VA 4DDWA 2X6TA 1PEYA 4YCSA 4Q9DA 2HREA 1QDEA 3CVOA 3KQYA 3LCCA 5M3BA 3ZE1B 1KEPA 1ZWLA 4C03A 4W4TA 3LG2A 2Y76A 1GFSA 4D9CA 2H1VA 1ADYA 2PCJA 1C4WA 2WY2D 1RAEA 1E79A 2HSDA 1O94C 2PA3A 2CDCA 1IN5A 3IBFA 4X7MA 4CLXA 1C0EA 1LNZA 3L02A 1G2IA 4HQRA 5EAIA 3OQIB 4D8XA 1FQJA 3S2SA 5EJ7A 1SEVA 2UZ1A 3ML1A 1X1EA 2X40A 3HEBA 3N2YA 4YI5A 3BHJA 5AI0A 2H7CA 1Y3BE 3EMBA 3KXLA 1AXEA 4IQGA 5MF6A 1LFAA 3U4MA 5D1HA 3K16A 1MC8A 1NHGA 4WASA 2BTQB 5FADA 1V7PC 4H1VA 1ZD9A 2F67A 3DTTA 4IPTA 2WJPA 9LDBA 5HGXA 4AI6A 3AW8A 2P4QA 5JZBA 5C1IA 1DAIA 2DWQA 2XTMA 1NVMB 2BFMA 2H1WA 2V03A 4M7PA 1RXUA 4IGAA 4ETWA 4OYRA 4C5BA 1YQQA 1JKXA 2W2NA 3TD9A 1Z5UA 3AEYA 1F12A 4C0BA 5KQLA 3H3FA 3K2BA 3TOSA 4G1EB 1FEZA 3OTWA 4DIUA 3HBJA 3K0CC 4PZYA 5BSVA 3WDMA 2DHDA 2ZRNA 4DLLA 1Z5PA 3L6BA 5DIZA 1U4NA 3C4VA 4PBSA 4PSKA 3NHJA 2P9QA 3ZHQA 5JUWA 5KTPA 2GPSA 2FP4B 1QAMA 2R7AA 2OFXA 4FGJA 4EP1A 5HIAA 5GIOE 4Z99A 2G6BA 3WO1A 1ZD2P 3WGZA 3NHRA 4P0QB 2ZP1A 1SUDA 5IMBA 1E1RA 3WKEA 1I5OA 4IIJA 1O77A 1VGVA 3AB8A 1JQ5A 1W581 3F3YA 3GJTA 2AZ4A 4RNDB 5HP4A 1P33A 2WPNA 4RXTA 4BJ5A 1KSJA 4KIFA 1Q14A 2YZGA 3E5MA 3KX2A 2HX1A 2X8JA 3OQJA 3QWBA 1NATA 2X2PA 4QVKA 4XYMA 5FI0B 1LLCA 4O4IB 4G1MB 4HQLA 3RSOA 3PNPA 4CMEA 5HKKD 1JG6A 3UGQA 4IF4A 4R9VA 1EUCB 3BRCA 2XBLA 3PE3A 2GTHA 3JQEA 3DCJA 3GARA 1NI4B 4MUXA 3P4UA 3V8QA 1OH8A 1Z4OA 4MPDA 2YASA 2FXVA 3MLEA 2JFFA 4GX0A 4M9RA 1FLNA 3FNGA 4F71A 2HMSA 3PGA1 4YDHB 3FROA 1E2DA 3NBMA 3WHPA 1WS6A 1E9AA 3D8UA 3G2PA 3TQIA 3HYCA 1Z63A 2BOVA 3QW2A 1PFQA 1I3CA 2VH1A 2V6IA 4AQYB 1LLQA 5F78A 1V16B 5AICA 2X0FA 3AU8A 1YVUA 3VR0A 4KJXA 2PV7A 3RJ9A 5MN4A 2W8BA 2CLHB 4FCWA 3NR2A 4QKQA 1YOBA 1CLUA 4MEBA 4IDNA 3DULA 5NULA 5B55A 5IZCA 2PWBA 2FRXA 3PNOA 4B82A 1TF7A 5HF6A 4HPJB 1ZM3A 3RW9A 1DIBA 3YASA 1ZGJA 5H4GA 1MQ9A 4DYVA 1ZJ4A 5LZ8A 3W4JA 1G20B 4A27A 1GR1A 5KTNA 2RKOA 2X0NA 3PC6A 4WZBE 5MHTA 4C4YA 1VL6A 1J21A 4H1WA 3Q7EA 3KD3A 4CLEA 3VZBA 2HK9A 3CZ9A 2WF7A 2MMCA 3P32A 4XA8A 4F8YA 5EJ5A 1YBMA 3A05A 3PDIA 5DBFA 1O95A 4GXRA 5C1DA 1JXMA