3W68A

Crystal structure of mouse alpha-tocopherol transfer protein in complex with alpha-tocopherol and phosphatidylinositol-(4,5)-bisphosphate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
251
structure length
251
Chain Sequence
QPGLAELRRRVQEAGVPQTPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRAECPELSADLRPRSILGLLKAGYHGVLRSRDSTGSRVLIYRIAYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGWQVSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRIHLHGNNYKSSMLQHFPDILPREYGGKEFSMEDICQEWTNFIMKSEDYLSSISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-tocopherol transfer protein
publication title Impaired alpha-TTP-PIPs interaction underlies familial vitamin E deficiency
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 91
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
A PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.20 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 N-terminal domain of phosphatidylinositol transfer protein sec14p 3w68A01
1.20.5.1200 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Alpha-tocopherol transfer 3w68A02
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 3w68A03
1R5LA 4OMKA 4CJ6A 3B74A 4M8ZA 3B7NA 4OMJA 1OIZA 1O6UA 4J7QA 3W67A 4J7PA 3B7QA 2D4QA 3PG7A 2E2XA 4UYBA 1OLME 3P7ZA 3W68A 4CIZA 1OIPA 1OLMA 3HY5A 4TLGA 3PEGA 3B7ZA 3Q8GA 4FMMA 3HX3A 1AUAA
chains in the Genus database with same CATH superfamily
3PNYA 5AVYB 1NTZE 2OYIB 1FE6A 4PD4E 2QSIA 1ZOYC 2UXCM 2FFDA 3GLMA 3A3YB 4EOTA 1WHCA 1XTCC 1IN8A 1AVYA 4RKUF 2HYNA 1VQ7P 3CCEP 1VL2A 2CWBA 3GLIB 3HJ8A 2DZOB 3MGNA 1BGYE 4DV7M 4GHLA 4C7RA 1HNXM 2DHYA 2KNCA 1JY3P 2O5RA 2W6BA 1YE9A 1SFCC 5CHXA 5KAFE 4DV6M 1HGZA 5KTBA 1VQ8P 1QUSA 1T43A 4BRYB 4OMJA 3F92A 3M0DA 4FVMA 1W2EA 3SYKA 1NTME 1XTGB 2E2XA 2JZ1A 3G9RA 3GP1A 1LTMA 5AVUB 1IM2A 2M3BA 2C9CA 1L0NE 4LJ5A 4P17A 1USDA 3AEGC 4UB8H 1H89A 2O3JA 3FYDA 3LQQA 2LVOC 2KRUA 4LGYA 2R3SA 4ASVA 1E94E 4L6V6 3EWKA 4HLQA 2KZJA 2QJYC 2M5AB 1EZVD 4L73A 2HPCA 1ZMVA 3QWOC 1IC2A 1QGKB 3PP5A 2HR3A 1OQYA 2R4EA 3RK2D 4I81A 1T8ZA 4L16A 3OW2O 3CLQA 3LMMA 3LIEA 4QHSA 4RJTA 1FJGM 4JYBA 1J7KA 1FS0E 1J09A 1NTKG 1MZ9A 3L70E 2E75C 4QOSA 1W5SA 2B87A 4WY4C 5EP1A 3K8ZA 1D2NA 1PJQA 4PDIA 2Q3EA 3H1LG 4IBBA 1BCCE 4B3MM 2B3TA 1QAMA 1WMKA 2IBZD 2C9NY 1HT2E 3JR5A 1BE3G 2K47A 3N7NA 4H44C 3NMDA 2XGNA 3B7ZA 3L73J 1FZCC 3KHUA 1NU1J 3NBIA 5JI3E 2M5ZA 1QEXA 3RGUA 3CX5E 2WITA 3F89A 3SWFA 3BOSA 1ZW0A 3BCCD 2LXEA 2VDBB 1PP9J 2D2CC 3RGPA 3K5BA 4LCBA 1IN5A 1Q7YQ 3IG5A 3SMPA 1RQVA 4M9XA 5EFWB 2XNXA 1ZR4A 4KJMA 4MN4C 1FNNA 1JO5A 4EIJA 2QHOB 1OXZA 2CV2A 1JR3A 1JEKA 2QE7H 1DGHA 1IY1A 2R3CA 2WVRA 3VLFB 2KS1B 3OAKA 1HUCA 2SPZA 3B5ND 3T1YM 1Q02A 4DUYM 5TJHA 3L72J 3CC2P 3GQ4A 3AEBC 3DOAA 2ZYAA 4G4RA 2Y9YA 1G3IA 1S9KD 1VG5A 3TK1A 4DV4M 2BASA 2EO2A 5KJ7D 1SQXG 4KLNA 3CXHD 1PV3A 1F4IA 3ZH9B 4L4UA 3H4JA 1NHWC 1M57D 5APTA 1W2BO 1NY5A 5CCGD 3P8CD 1YYCA 4HJGH 3UZUA 3U6EA 3FTDA 1SQBD 2IYOA 5GTIE 2MJZA 3KOZE 3LW5J 4PV1C 3QH9A 1MJGM 3B7QA 1IN4A 1ZV1A 1J1EB 1KFMA 3DZDA 1SXJB 1G4AE 2YIUB 2DAMA 1L2PA 1DD4A 5ITRA 3OJAB 4KHPM 4FD2A 2AEFA 1AA0A 1LTAC 3V2RA 2XSZA 1QVGO 4DV2M 3PHLA 1X22A 5AVVB 2HODA 1GJSA 2J58A 2ZXXA 3HGIA 4Y99B 1W5TA 4ZKPA 3WHLA 2DAKA 2C9LY 4XK8F 1QDTA 3GPPA 5L8RJ 4IBKA 3QWLA 2F5PA 3SFZA 1NJIQ 3U6OA 1MX0A 1GL7A 3L73E 1NV9A 2GM4A 3TGUJ 3GLHB 1NU1E 2FBWC 1GK6A 3AOEA 2FYUG 4RESB 3I04M 1YBKA 1M1KQ 1EZVI 2FFJA 1IY0A 4FMMA 2H8PD 3A2AA 1IFIA 4I1LA 1BVSA 5ITXA 3BBZA 3RBXA 3H1JG 2AEMA 4PDGA 1S2EA 3HTKB 1RF1C 5KLIB 2L4FA 3CCRP 3MP7B 2ZTCA 5AW9B 1Z5CA 1KORA 2NPSD 4GMQA 1AQ5A 3UMMA 1IXRC 2CHGA 1EIJA 5K5GB 3HHWA 3L72E 2FS1A 2KHHA 1A02F 1YLAA 4N78D 3KDPB 3FUXA 1J5EM 1SQPJ 1KYIA 4ITQA 4DZOA 4IBIA 4MM3B 4UB6E 2FFDC 3H4MA 1TDZA 3V2PA 4PT5A 3KXDA 4L76A 1TTEA 4FWDA 2Y0QA 2WPSA 3FXDA 2K9JA 1FAVA 1VQ1A 1N7LA 2JO1A 1TF0B 2QA4P 4PD2A 1D0LA 3E21A 2RRUA 4KODA 2A06G 5CCHD 1YJ9P 3WHKA 1RE3A 2QJKC 5APVA 2OGUA 3B9PA 1YIJP 1VQ9P 3MMPA 1EXJA 3U6CA 3L75D 4HL4A 4LF7M 2F5NA 2DAGA 2A45I 1KYOI 3HWSA 2XFSA 1URQD 1RY3A 1S3SA 2XZUA 3M9HA 5M1BA 2N1TA 2XDJA 4QHTA 3HHZA 4AQYM 1M7LA 3VN0A 1KSFX 3HE4B 3TGUE 3L74G 3CXHI 3VMXA 3HD7D 5KPRA 3PTZA 2OO9A 4D6TE 1PJJA 3W0FA 2C98A 2UXBM 1OVRA 5BPVA 3GPYA 4W7ZA 3TF5A 1AJYA 1GO5A 4I2LC 3M6AA 1NWQA 3B71A 3KFUG 1LT9A 1XMQM 4B7FA 1SQQJ 2OYHC 3FE3A 1EFUB 4DR6M 3H1KJ 4TT3H 2BEQD 2YR0A 3FGAD 3BVHA 1R4GA 2M3EA 1VQOP 2WWWA 2WT7A 1MV8A 3C8VA 3IAOA 4II7A 1T6AA 1IBLM 4K35A 4WW0A 2ZFCA 3CGWA 4AKHA 3T1HM 3PXGA 1BE3D 2YNMD 4YY3M 1BGYG 5IT9S 4Z8XA 3J7BA 4S12A 1BDCA 2RGHA 4JI1M 2C0WA 2E75D 2WSCF 1FOSE 1KB9D 4B86A 1JB0J 2K1AA 1AQTA 3ITKA 2HG5D 3CF0A 2DWMA 2FY8A 4OGQC 3IF4A 3HU2A 1EC5A 3S9OA 1JM0A 2KNAA 2ZM6M 2QENA 1OWAA 1QLED 3T97B 1OX3A 3GRRA 2R32A 3VOPA 2RKOA 4FWHA 3BXWA 3RL0C 3H1HJ 1ZRTE 4EI2A 3FRIA 1HJPA 4IBGA 5AW8B 4NXMM 3O6QA 2QNJA 5B5EE 1N73B 2D2CD 1DD3A 4BWNA 2WSEH 3A45A 1RQUA 5CJ4A 1KILA 1KMIZ 1GZLA 2W6AA 3H1IE 1K3WA 4IOIH 5B66E 3SAVA 2FE8A 3B5NB 2IBZG 3L37A 3LVVA 3D71A 4DCKA 1XMOM 3MD0A 3FRHA 2JWSA 4XE5B 3AE1C 3I51A 2N9BA 2KZSA 1FZCA 3KS4A 3GLFE 3GHGB 1J1DC 2I7PA 1OW7A 4I7ZC 1SQQE 4YXDC 4X64M 1ZR2A 3FWLA 1GL2C 1JY2N 2WSEJ 3USSA 4IJEA 3SC3A 3LIDA 3VDPA 2DZLA 2FYNC 1EDJA 3AV0A 3EIEA 3M7GA 4CIZA 3U61B 2V6ZM 1TU3F 3CMEP 5H37D 3VMAA 4GC9A 2WSFH 4MGIE 3V2QA 4L75A 1NO1A 2JKVA 5EP2A 2QPAA 2H1RA 2HAKA 3C58A 3AEFC 2QJPB 1OJLA 1LTTC 2E5LM 2WPRA 1PGOA 2AXTH 3E1IA 4DUZM 3U1CA 2W90A 1ZV8A 1VQMP 3EFGA 1OIPA 2QP9X 1Y9BA 3AE6C 4C7NA 2E76D 4DV1M 3VTPC 1N7SA 5AW2B 5KO3A 3TNUB 3HX3A 1Q2NA 1Y8AA 2FH0A 2XU6A 5IREB 3VKGA 1VF5C 4H13C 1T2KC 2WZJA 3H1HE 1QQWA 2WSFJ 4F1IA 5AVXB 1E32A 3I4YA 5KPTA 3G3ZA 2ZAMA 3BASA 5BVZA 4OH8B 2BJVA 1S1CX 1IN7A 4HB1A 5KLVK 3M91A 4C46A 1WXQA 3UGJA 1VEGA 3L71D 1EE8A 2D7EA 2VIIA 2NPSB 2GNOA 2BWEA 1MFTA 2LXCB 1PM5A 1KB9I 4PJ0H 3AE5C 1S5LE 4GT1A 5GKNA 1L2BA 3WUUA 1L0LJ 2IX7C 2Q6QA 3GF3A 2Q3IA 4UYBA 4BB9A 2I1JA 1PJSA 5AW5B 2A06D 2I1KA 3IN6A 1NTZK 3MUDA 1G2CA 4BXLA 2ZBKB 1R5SA 2CV0A 1RE3C 5KLVE 1L1TA 1Y8GA 1OFIA 1GKIA 1LGHB 3U59A 2EKFA 1R7RA 2VQFM 4OU7A 3P7KA 5KAIH 1FBMA 2ZT9C 1SQVK 4XGIA 1LWUC 2N1TC 4IBJA 2ZXEB 2LWXA 5KLVD 1ZMUA 2KXEA 1NNJA 2CE7A 3ZQJA 4OVZA 1FU1A 1LJ2A 2KUBA 2P1JA 3AECC 8CATA 4AI6A 1JMBA 2L4EA 1NTMK 3UJNA 3A42A 1XB2B 2K88A 1URQB 3M9BA 1OIZA 3MIWA 3GF7A 3J2PB 1ZMWA 2JR8A 1L0NK 1SFCB 2A45H 1KYOH 4I6MC 1DEBA 1LT9C 1Q86Q 2M0BA 3HD7B 3L72G 4FCWA 3H32B 2JY5A 2KNVA 4IL6X 1T3TA 4YTPC 4AG6A 3BCCJ 1SQVE 1GD2E 2R65A 1NTZD 3CXHH 2K9DA 3KZIH 4I4LA 4PD4D 2QBYA 5BU8B 2E5YA 2KB7P 3LCUA 3L36A 4IBDA 2O1KA 2KI7B 1YTZT 1C1KA 1IXZA 4QOZC 1RHZB 2K9YA 1M1JC 1JTHA 2RKLA 3P7ZA 2QJYB 1BGYD 1YQ4C 3L75G 1WGNA 1IBMM 1E79H 3A0BH 5E79E 2W82A 3T38A 3U5ZB 1G1JA 1KFNA 1TH3A 2V1CA 2Z8YM 3PVSA 5FLXS 3PH0A 1E5WA 1L0LE 3K9OA 3QYBA 4LY6A 1NTMD 4N3YB 2Z5IA 2LVQD 3K1JA 3GO8A 2ZVNB 5BU5A 1HJBA 2E75B 4LZJA 1L0ND 3KOYE 3IG8A 4WY4B 3HJQA 1SQBJ 4B3SM 3JR4A 2YNYA 1N77A 2G3AA 1VQLP 2HKJA 3TGUG 2DAIA 1JR3E 2OYHA 4O9BA 3GPUA 3B74A 1PGQA 1GABA 3JC22 1WGLA 4D6TG 3N4XA 3CC4P 3C3DA 4H44B 1OVVA 1PPJE 4R4MA 3Q2YA 1G1IA 2OQQA 1LT1A 3HE5A 1KILC 1FJKA 4NL4H 2LTUA 2O01F 2P7JA 2Y20A 5L8RF 2JEEA 1P84E 1G8PA 1HQCA 1OFCX 2R4JA 2IFMA 2IZ0A 3L4FA 4LJ7A 4U3FE 3HHXA 3R8FA 4U7JA 2WMMA 1EDKA 3MZWB 5GTHH 3LQRA 4LJ9A 2D2CB 4Y28J 1HWTC 3L70D 2R46A 1MKMA 3J80S 1IXSB 2APLA 4AYCA 4W7YA 2BCCJ 1LTJB 1BCCD 5E6JA 1XXHB 2KZUA 2C96A 2YMKA 5KAIE 1GU4A 3IHPA 3THGA 3II6A 4ANRA 1H0TA 1FZGA 3JSVC 1LV7A 3G4SP 1OFHA 2RH0A 3Q8XA 1AFOA 1NSFA 1HNZM 1E9SA 1DEEG 2Q5UA 2FYZA 5FTMA 1G59A 1CI6B 3CX5D 3GLGE 4RKUJ 1HT1E 2WQYC 3M9QA 4NSOB 1T3UA 1GJTA 3A0HH 3AEEC 3RL0g 4H0LC 3U60A 3AKZA 4QNRA 2R45A 1WIVA 3LCVB 1IO4A 3GLFB 4PV1B 3EIHA 2KIKA 3HU3A 3AE3C 3V76A 3R9XB 3RBZA 1FOSF 3HUSB 2R18A 3KZIE 1DO2A 5ITXE 2A5YB 4JI7M 3SHFA 2OTJP 5DYIA 4G4NA 1QL1A 3QYEA 1TH4A 1U7MA 3GMAA 4CPGA 1N7SC 3ZC7B 2QRXA 4GC5A 2D4QA 1NU1K 1KD1Q 3GRUA 1VQNP 4OX9M 3CCMP 3VMYA 2H5XA 1TR8A 1SLQA 4EYYQ 3KOWE 3GQ3A 1RF0A 4PD4I 1JUNA 4L74A 3GRYA 3TWKA 3H1IG 2E76B 4UB8E 1V33A 1GL2A 1UFZA 3EQ2A 3E46A 1ZP0C 1LP1B 4GODA 5CJ0A 4ZNCA 1Z56A 2CUZA 3TYYA 2K37A 2IPPA 5EP4A 1NHLA 3L26A 1FZAA 1VF5D 4M9ZA 3GLGA 4H13D 2ZAOA 3ZCBB 1T2KD 2FKWB 4GITA 2KZIA 2W6JH 2K0BX 1AIPC 5C39A 3LVWA 3ILKA 1L4AA 1PFIA 2BCCE 4ZKUA 1RF1B 3Q8GA 3TE6A 3G71P 5KQ8A 2LXBA 3MUDC 5KJ7A 2CPBA 4R7GA 1YUBA 1NOHA 1TGUA 1M90Q 5AVRB 2VRSA 1PP9E 4OWFA 5ITYA 3W67A 1H88A 3FTCA 3RK3E 4ZPXA 1KB9H 5EJCA 3L73D 1SS1A 1YTZI 3UK6A 1NU1D 1NTKJ 3BRVB 4Y99C 1PL5A 4MB7A 4MGKE 5CBOA 1JCCA 3ZDMA 2DZNB 2H43A 3H1LJ 1AUAA 2FFDB 4GDOA 5AVTB 2IBZI 2XZFA 4TUWA 2IZ1A 4YXWH 2JUJA 3KXEC 2PP6A 1IFNA 2O1JA 3R4YA 2KW0A 2KLVA 2OARA 3L71G 4GKJM 4OVNF 4DR1M 4AG5A 1S72P 3BRTB 2KNCB 2C5RA 4DR3M 2MGWA 1MUUA 2YMYA 2ZT9D 2HFED 4F2LA 4YPCA 5FTKA 1OVUA 3L72D 5AVWB 1FZBA 4LF9M 2QJKB 3M0AA 2L91A 5DYGA 1QAOA 5AW6B 4J7PA 4FCVA 1LTSC 3A98B 1N32M 2DWZB 4G3OA 3D70A 5DNYA 1GK4A 4LLHA 1XNRM 4LGMA 2CHVA 4GRIA 3SASA 2HPCB 1I94M 1ZN5A 4AW4A 3K2LA 2CPSA 3CCSP 5KKZC 1LWUA 3B7NA 1FDOA 3PNVA 2WTYA 1SFCD 3FUTA 5KLVG 1SQXJ 2LR2A 3WU2H 1OLMA 2CP8A 3D8LA 4AZFA 1SQPK 2GQFA 1LTGC 1XWIA 2B87B 3NWLA 5EXXA 3TWLA 4LF6M 1OAOC 4EIWA 1PIXA 4L78A 1L2CA 4R3DA 1NKNA 4GIPA 1W5CE 1M56D 3ABVC 3TGUD 1CUKA 2M8RA 2YKPA 4LFCM 1NTKE 4D6TD 2KSJA 2XEPA 3H1LE 2LVNC 1NTZG 1XC8A 1KQFB 3Q3DA 5CCHA 3U6LA 3CWBJ 2OOBA 2KRKA 1KILE 5APQA 1H8AA 1VDFA 3RE8A 1SQPE 3GPXA 1M1JA 4GEWA 2QIWA 4A3VB 1O6UA 4DBGB 4KT0F 2OYIA 1SQVG 2E74C 3FKEA 2FYUJ 1FJPA 2H7HA 4WY4D 2UUCM 5TISH 1SG9A 3WMM0 3CCLP 4LG2A 4AQRD 3UIAA 1KILD 3GLIA 3RL0B 1K8AQ 2CHQA 1DGHB 1A02J 2DAEA 3H1JJ 1JY3N 3SARA 1N2DC 1VDDA 2DWNA 1NTMG 2L5GB 3CCVP 3SAUA 1L8QA 3RK2C 3F5HA 4H44D 4IFFA 1L0NG 2JP7A 1AVOA 3A5TA 5H2FH 1LTBC 4BRYA 1PRBA 1IFDA 3U1AA 1WJ7A 1SQQK 1N36M 4JBZA 4WVZA 2UUAM 2KDLA 5AVQB 2I8DA 1U57A 1X79B 5C18A 1N34M 1QVRA 3MHVA 1NVOA 1XHBA 1SQXE 1HH0A 4I7ZB 5A2QS 1ZRTD 2M5AA 5EXPA 1IFJA 3FWNA 2GUVA 3L70G 1WR1B 1ZXGA 2HODB 1SVFA 2FYNB 4RO0A 4XA4A 3HKPA 4MH0E 1RF0C 1BCCG 3AE9C 1RH5B 3H1ID 1C7YA 4GIFA 3VFDA 3H1KE 4IL6H 4U3FG 1N73C 1KFVA 1VPCA 2HLOA 2AXCA 4LJ4A 3CWBE 2WPQA 1JNMA 1KC8Q 2P67A 4PV1D 1SQQD 5FSWA 2WSCH 2YKOA 2KK7A 4G4OA 4HEOA 2F5QA 5E26A 3L74J 4PD4H 1JCDA 1R6BX 4JXJA 1L4AC 4WP2A 2FYUE 3D6ZA 3T6PA 3PLNA 3CPWO 1ZAEA 2JXNA 1X8YA 5APUA 1VF5B 4H13B 5KJ7C 2DNAA 3PG7A 3J81S 1KZUB 4MGYE 1SXJE 3H1JE 3KYQA 4JF7A 2BWBA 5KQDA 2MH8A 5DFLA 3FD9A 1DIPA 1UIIA 2EA0A 1EQ7A 5KAFH 5EP3A 2Q9IA 2UWJE 2QVAA 5AVSB 3H6PA 2WSCJ 4Z6YA 3SAWA 2QM8A 2ZYGA 2LNHC 2ITAA 1NH4A 4QMAA 1HR0M 1NGMB 2KS1A 2W27A 2KYVA 2LBCA 4LC1A 4NPFX 4W80A 2HHHM 2K9JB 1YSYA 1IJDB 4LF5M 2AHMA 2L7IA 1BGYJ 4XBOA 3H1HD 1Q90D 2CK3H 3U6QA 2QEXP 4JI5M 2QM7A 3AE7C 2CV1A 1S4XA 1GLNA 1EDLA 5AW1B 2DHRA 1USEA 4DV5M 3U6PA 1GL6A 2QZ4A 3L27A 2JNHA 5EXTA 1IFMA 2G8LA 1PGPA 1SXJA 2ZT9B 1VEJA 2N1TB 1FDIA 3RK3C 2QG4A 2R6FA 3AFHA 1HJ0A 4LRTA 1CSBA 1MN3A 2VF8A 3L73G 1JY2O 1NU1G 4K0KM 1SP4A 1NKZB 3FYCA 1S5LX 4P16A 3GG2A 1NAFA 4GOEA 4QNMA 2D7HA 1D0MA 4N6JA 3L74E 3FXEA 3KSJA 4D81A 5FTLA 4JV5M 2Z7JA 2KOGA 1PP9G 1LT9B 1HTLC 2YXRB 3GW6A 4PCZA 4JI8M 2R5BA 1ZQ9A 3GLHA 2PFXA 4CJ6A 2F5OA 1QX8A 1X37A 2JP3A 5APXA 5AW7B 4FWGA 4LF4M 2OTLP 1T6OA 2PRRA 2LHCA 4JQ0D 3E1RA 1NJFA 2DI0A 2WT7B 2YQZA 4LJAA 2JWDA 4WWIA 4DT0A 2GUSA 2QSFX 3HTKA 1TH2A 1L0LK 4FW9A 1OTRA 4JN6A 4LRSA 4DOJA 5APWA 4LFAM 4BBAA 3GQ5A 4IBEA 2W83C 3VKHA 5CCHC 3FUWA 3HRNA 2LVAA 2LH0A 1BDDA 1KQGB 5CBNA 1PGYA 2AXTE 4LZZA 3W0LB 1KTMA 4AKIA 2DVWB 1SQVD 2OYIC 1GU5A 1URQC 2C9OA 2YXQB 4LGDE 2R44A 4ASWA 3A46A 1DO0A 1Q39A 1R5LA 2OTKE 1NNUC 3HD7C 1IQPA 4NPEA 3FUVA 5GTIH 3SWYA 3DA1A 4GKKM 5AVZB 3CTWB 1GTWA 2ZANA 4R4LA 1YHQP 3AEDC 1IK7A 1EZVE 2J59M 3B8EB 2OPFA 1QANA 2Y9ZA 1R8EA 3KP0E 2BNKA 3O6QB 1Y47A 3LW5F 4DR5M 3SYLA 4M0DA 1FZEA 2E74D 4UN2B 4TLGA 1KILB 2QQ8A 5IWAM 3CC7P 2CRUA 2NZ2A 1L0LD 3CCJP 4Z1MH 2JWAA 1KQSO 5ITTA 4PJ0E 4OGQD 2YO2A 2XKMA 4IIWA 4DV3M 1P3QQ 4M9SA 3V5BA 2R62A 3M06A 4JI4M 5FTJA 3MHVC 4BLCA 3Q5PA 1FZCB 2V1UA 3HE4A 2F4VM 2IBZE 3I5CA 1NV8A 2XZRA 1VQ6P 3WUVA 3RL0D 4B08A 1JR3D 1RU3A 4B7GA 4CISA 2FXPA 2K6BA 2LKMA 2OYOA 1JMMA 1JY2P 2H88C 1QAQA 1PPJD 2DWLA 3D8BA 3QAUA 1HVVA 3IFMA 3NTNA 4YHHM 2FOIC 1OZHA 1P84D 3KDSE 3JCUH 3BCCE 3V4WA 4U3FD 4GKGA 1SQPG 2VF7A 1VQ4P 2ZVOB 1V34A 4H0LB 1YJWP 2L6OA 4WURA 5ITQA 1IK9A 4IBCA 1SQBK 3V2NA 2LVPC 2UU9M 1N86A 3MK6A 1E9RA 3K92A 1T3JA 2V4HA 4C7NB 3E7KA 1KYOE 4UB6H 1GL2D 1HF9A 1ORYB 1QUTA 1S3JA 1DGGA 2XSZD 3TL4X 1N7SB 3RGSA 3AE2C 1V92A 3J7AS 1LTJC 1S9KE 1OKSA 3TQSA 1QYRA 2PAJA 4MGHA 2WPVB 1NY6A 1Z59A 1QZEA 1G71A 3LW5H 3CXHE 1UIXA 1GDTA 4IFMA 3WUTA 3KOXE 1K3XA 5JI2E 3P8CE 2MJ5B 1KYOD 3DFZA 1SQBE 3SFEC 2Q1KA 3T97A 1L4AD 2J7OA 4D82A 2EKKA 2JZ0A 3HHYA 2MROB 3L2AA 4D80A 1MFZA 1MU5A 4JI0M 3A0BE 3VP9A 3SMSA 2PGDA 4REZA 2O01H 4OMKA 1N73A 1XNQM 1EXIA 2NQ8C 3OTOM 2XF3A 3TWMA 3AJIB 4JI2M 3L75J 2B88A 2UXDM 2KXPB 3HUSC 5EXSA 2ZAEB 1SQQG 2JA2A 1JQJC 3KP1E 1G2CB 3B5NA 2JY7A 2JDIH 2Z5HA 1K04A 4K3AA 3H1KG 4LJ8A 4RNAA 1OW6A 3HZJA 1AV1A 4FCTA 1J1EC 3CWBG 3CMAP 3GHGA 1SXJC 2DKLA 2YIUC 2O01J 2E42A 2BJWA 2E76C 3KSXA 2KEBA 5CCGA 3D6YA 1OAIA 2B89A 4OVZB 4R71A 4LF8M 3H25A 3HY5A 2BCCD 3HJSA 1QZMA 3E9SA 2CFOA 4Q7JA 4D6TJ 3L29A 5GTHE 3U61A 1QVFO 1NO4A 2RGOA 3FTFA 1QL2A 1N78A 1Q3CA 1IN6A 3U6DA 2QCUA 3VYIA 1PP9D 4L15A 1HNWM 3C1LA 5AW3B 3FX0A 3RK3D 3BATA 4N78E 1A5TA 1OLME 1BE3J 1RE4A 3JCUE 4DV0M 3AL0C 1IBKM 2V7QH 3K9PA 4TLFA 4JI3M 1JB0F 3H1HG 2QBYB 2N1TD 3CL3D 3V6IA 1K82A 2FXOA 1Z5BA 1P84I 3KS8A 3C9PA 4ZMDA 3KPEA 5KLIC 1JTHB 2WZ7A 3TNUA 1YJNP 4B7HA 2GA1A 2I7NA 3CD6P 3A0HE 5KKZB 2KA6B 2POHA 3L25A 5B5EH 3SATA 2O25A 1R2YA 3CX5I 2KSEA 1Z6TA 2V7QJ 3CI9A 3L75E 4AKGA 1NTKK 3IECA 2Z4SA 2ZJSE 5B66H 5EQTA 2ZTDA 2HWJA 2NPSA 1N8RQ 4RF1A 4X65M 4WBAA 1EDIA 2IDBA 1Q82Q 3NFQA 3MJ5A 5LMNM 3M0DC 1D7MA 3GLIE 2R0IA 2N35A 2KLUA 2OYHB 3O8ZA 2K3RA 3V4QA 3Q1MA 3FTEA 1L1ZA 3VK8A 2L7HA 1BSNA 5LMUM 5AW4B 4WB4A 3HE5B 2Y0DA 3CCQP 4J7QA 4AUWA 2CEAA 1GW4A 3H1IJ 2WSEF 3SHGB 1H6UA 3W68A 3A7OA 2P5TA 2E74B 4HYTB 1QDRA 1IFPA 2J7NA 3GRVA 3P32A 7CATA 3AOGA 4X66M 1IFYA 4HKZH 2OOAA 1H0TB 2Z4RA 3KVWA 1NAYA 1BE3E 1NTKD 2Y0TA 4IJFA 5FTNA 2RMZA 4OGQB 3SFDC 3TSIA 4DJGA 1NVMA 2KP8A 5F3WA 4I5SA 2N9YB 1URQA 4X62M 3FUUA 3H1LD 4JYCA 2XLJA 1KB9E 3G6EP 3RK2B 3EFFK 1SFCA 2JJLA 3CCUP 2XNDH 4GOFA 1NHGC 3R2PA 1M8OB 2W8ZA 3HD7A 3H32A 1SQXK 1SQPD 2Y0EA 2P2UA 5APYA 2D7GA 2Q7CA 1I4WA 3L35A 2HCBA 4G6ZA 1CW5A 2EUCA 3L28A 3U60B 4HH2A 2JY8A 2WSFF 3VP8A 1VDLA 3JAMS 4W5WA 1L0LG 1IZNB 3S1KA 4IFDK 2YKQA 4KO8A 1VQKP 1VQPP 1EZVG 2Y0CA 3CF6E 1S5LH 2KNZA 4NC6A 3U5ZA 1K05A 1ZLLA 3L71J 3U6MA 3VMZA 2FNAA 3HU1A 3E4RA 1XXHE 1J1DB 1GW3A 1K73Q 1HGVA 3B4SA 1KV4A 1JOCA 2LHGA 2JY6B 1GL2B 1KQLA 4GHAA 4NPDA 4M3LA 4LFBM 1DGFA 2MKVA 1VEKA 1NJGA 2YO3A 2FYUK 4WY4A 2RN0A 2XV5A 3AE4C 4H0LD 1PPJG 3SWKA 2Y21A 1WT6A 2O01N 1BSHA 5APSA 1SQXD 3OA7A 3GLGB 2F5SA 3AE8C 1GVNA 3VK7A 2J5UA 1Q3BA 2X8AA 1L4AB 2M60A 1PJIA 1N75A 1N7SD 2C0XA 3WU2E 5AW0B 3IR9A 2G3QA 3PEGA 2EJSA 3B5NC 1R2ZA 4NRVA 3I4VA 3PJSK 2L2DA 3SBJA 3H1KD 3BCCG 5KLVJ 3RFWA 2L09A 1DH3A 1IXSA 1CZQA 3CWBD 2XFTA 3GHGC 4NSRA 1LTJA 1XXHA 2E5TA 1IY2A 1OW8A 2DXIA 1FZFA 1G41A 3Q5RA 2ZYDA 5CCGC 2ERCA 4XFJA 1TDHA 3SSUA 3KQGA 2XH9A 2Z3XA 2FYUD 3PFIA 3AOEC 2A45G 3P8MC 4M0WA 1Q81Q 4KT0J 4CHTB 1JY3O 5BR8M 5CMZA 4NRWA 1CI6A 1NTZJ 3CF2A 1U7JA 4OW0A 4G4QA 4JPZB 2HL7A 2BEZF 5ITUA 1SXJD 3H1JD 1L2DA 2B9BA 1K9MQ 4JYAM 1FDMA 4B3RM 5E79H 5TISE 1FC2C 3S4RA 1D0KA 1VQ5P 3I56P 1Z5AA 1PZQA 2WSSH 3GLHE 2QJPC 1RE4C 1X9VA 3NBXX 2OQ4A 2UUBM 3L71E 2IYPA 4DR7M 1KN7A 1SQBG 4IBFA 5C1BA 3GLFA 1LNQA 1SQVJ 3C3EA 3TPZA 2MR9A 2AEJA 4LJ6A 3HUSA 1GMJA 2H89C 4RF0A 3RK3B 1WRGA 5H2FE 1DGBA 4A7PA 1HQYE 1PGJA 2DENA 2J5YA 1NTMJ 2G5GX 3Q5SA 1OMIA 1YI2P 3MTUE 1DV0A 1X0TA 2A06E 1L0NJ 1LWUB 1YITP 4DR4M 4NXNM 1LP1A 4M8ZA 2Z4EA 1DX7A 1NYHA 3B89A 2P58A 2FXMA 3J27B 2BCCG 2NPSC 1P84H 2C99A 1J2JB 4JI6M 2G8YA 2X4AA 5DJTB 4L8RC 3I55P 2R5DA 1UM8A 2E43A 1N33M 4EDFA 3NXSA 3C9IA 4NOOB 3KW6A 4Y28F 4CGYB 4I8OA 3PRJA 5KPZA 1RF1A 3CX5H 4B3TM 2YFQA 3VDUA 1ZMEC 5IZ7D 2Q2EB 1HBWA 4IL6E 1YQ3C 3L70J 2DW3A 3T15A 2X49A 4KHXA 2NRGA 1PJTA 5DJUB 3TDKA 3AEAC 3U6SA 2VQEM 3L74D 1BCCJ 2IFNA 4MGZE 3M0EA 1LTIC 4DR2M 4GH9A 1M1JB 2P10A 3I01M 4U3FJ
chains in the Genus database with same CATH topology
1R5LA 4OMKA 4CJ6A 3B74A 4M8ZA 3B7NA 4OMJA 1OIZA 1O6UA 4J7QA 3W67A 4J7PA 3B7QA 2D4QA 3PG7A 2E2XA 4UYBA 1OLME 3P7ZA 3W68A 4CIZA 1OIPA 1OLMA 3HY5A 4TLGA 3PEGA 3B7ZA 3Q8GA 4FMMA 3HX3A 1AUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5L A;  4OMK A;  4CJ6 A;  3B74 A;  4M8Z A;  3B7N A;  4OMJ A;  1OIZ A;  1O6U A;  4J7Q A;  3W67 A;  4J7P A;  3B7Q A;  2D4Q A;  3PG7 A;  2E2X A;  4UYB A;  1OLM E;  3P7Z A;  3W68 A;  4CIZ A;  1OIP A;  1OLM A;  3HY5 A;  4TLG A;  3PEG A;  3B7Z A;  3Q8G A;  4FMM A;  3HX3 A;  1AUA A; 
#chains in the Genus database with same CATH topology
 3PNY A;  5AVY B;  1NTZ E;  2OYI B;  1FE6 A;  4PD4 E;  2QSI A;  1ZOY C;  2UXC M;  2FFD A;  3GLM A;  3A3Y B;  4EOT A;  1WHC A;  1XTC C;  1IN8 A;  1AVY A;  4RKU F;  2HYN A;  1VQ7 P;  3CCE P;  1VL2 A;  2CWB A;  3GLI B;  3HJ8 A;  2DZO B;  3MGN A;  1BGY E;  4DV7 M;  4GHL A;  4C7R A;  1HNX M;  2DHY A;  2KNC A;  1JY3 P;  2O5R A;  2W6B A;  1YE9 A;  1SFC C;  5CHX A;  5KAF E;  4DV6 M;  1HGZ A;  5KTB A;  1VQ8 P;  1QUS A;  1T43 A;  4BRY B;  4OMJ A;  3F92 A;  3M0D A;  4FVM A;  1W2E A;  3SYK A;  1NTM E;  1XTG B;  2E2X A;  2JZ1 A;  3G9R A;  3GP1 A;  1LTM A;  5AVU B;  1IM2 A;  2M3B A;  2C9C A;  1L0N E;  4LJ5 A;  4P17 A;  1USD A;  3AEG C;  4UB8 H;  1H89 A;  2O3J A;  3FYD A;  3LQQ A;  2LVO C;  2KRU A;  4LGY A;  2R3S A;  4ASV A;  1E94 E;  4L6V 6;  3EWK A;  4HLQ A;  2KZJ A;  2QJY C;  2M5A B;  1EZV D;  4L73 A;  2HPC A;  1ZMV A;  3QWO C;  1IC2 A;  1QGK B;  3PP5 A;  2HR3 A;  1OQY A;  2R4E A;  3RK2 D;  4I81 A;  1T8Z A;  4L16 A;  3OW2 O;  3CLQ A;  3LMM A;  3LIE A;  4QHS A;  4RJT A;  1FJG M;  4JYB A;  1J7K A;  1FS0 E;  1J09 A;  1NTK G;  1MZ9 A;  3L70 E;  2E75 C;  4QOS A;  1W5S A;  2B87 A;  4WY4 C;  5EP1 A;  3K8Z A;  1D2N A;  1PJQ A;  4PDI A;  2Q3E A;  3H1L G;  4IBB A;  1BCC E;  4B3M M;  2B3T A;  1QAM A;  1WMK A;  2IBZ D;  2C9N Y;  1HT2 E;  3JR5 A;  1BE3 G;  2K47 A;  3N7N A;  4H44 C;  3NMD A;  2XGN A;  3B7Z A;  3L73 J;  1FZC C;  3KHU A;  1NU1 J;  3NBI A;  5JI3 E;  2M5Z A;  1QEX A;  3RGU A;  3CX5 E;  2WIT A;  3F89 A;  3SWF A;  3BOS A;  1ZW0 A;  3BCC D;  2LXE A;  2VDB B;  1PP9 J;  2D2C C;  3RGP A;  3K5B A;  4LCB A;  1IN5 A;  1Q7Y Q;  3IG5 A;  3SMP A;  1RQV A;  4M9X A;  5EFW B;  2XNX A;  1ZR4 A;  4KJM A;  4MN4 C;  1FNN A;  1JO5 A;  4EIJ A;  2QHO B;  1OXZ A;  2CV2 A;  1JR3 A;  1JEK A;  2QE7 H;  1DGH A;  1IY1 A;  2R3C A;  2WVR A;  3VLF B;  2KS1 B;  3OAK A;  1HUC A;  2SPZ A;  3B5N D;  3T1Y M;  1Q02 A;  4DUY M;  5TJH A;  3L72 J;  3CC2 P;  3GQ4 A;  3AEB C;  3DOA A;  2ZYA A;  4G4R A;  2Y9Y A;  1G3I A;  1S9K D;  1VG5 A;  3TK1 A;  4DV4 M;  2BAS A;  2EO2 A;  5KJ7 D;  1SQX G;  4KLN A;  3CXH D;  1PV3 A;  1F4I A;  3ZH9 B;  4L4U A;  3H4J A;  1NHW C;  1M57 D;  5APT A;  1W2B O;  1NY5 A;  5CCG D;  3P8C D;  1YYC A;  4HJG H;  3UZU A;  3U6E A;  3FTD A;  1SQB D;  2IYO A;  5GTI E;  2MJZ A;  3KOZ E;  3LW5 J;  4PV1 C;  3QH9 A;  1MJG M;  3B7Q A;  1IN4 A;  1ZV1 A;  1J1E B;  1KFM A;  3DZD A;  1SXJ B;  1G4A E;  2YIU B;  2DAM A;  1L2P A;  1DD4 A;  5ITR A;  3OJA B;  4KHP M;  4FD2 A;  2AEF A;  1AA0 A;  1LTA C;  3V2R A;  2XSZ A;  1QVG O;  4DV2 M;  3PHL A;  1X22 A;  5AVV B;  2HOD A;  1GJS A;  2J58 A;  2ZXX A;  3HGI A;  4Y99 B;  1W5T A;  4ZKP A;  3WHL A;  2DAK A;  2C9L Y;  4XK8 F;  1QDT A;  3GPP A;  5L8R J;  4IBK A;  3QWL A;  2F5P A;  3SFZ A;  1NJI Q;  3U6O A;  1MX0 A;  1GL7 A;  3L73 E;  1NV9 A;  2GM4 A;  3TGU J;  3GLH B;  1NU1 E;  2FBW C;  1GK6 A;  3AOE A;  2FYU G;  4RES B;  3I04 M;  1YBK A;  1M1K Q;  1EZV I;  2FFJ A;  1IY0 A;  4FMM A;  2H8P D;  3A2A A;  1IFI A;  4I1L A;  1BVS A;  5ITX A;  3BBZ A;  3RBX A;  3H1J G;  2AEM A;  4PDG A;  1S2E A;  3HTK B;  1RF1 C;  5KLI B;  2L4F A;  3CCR P;  3MP7 B;  2ZTC A;  5AW9 B;  1Z5C A;  1KOR A;  2NPS D;  4GMQ A;  1AQ5 A;  3UMM A;  1IXR C;  2CHG A;  1EIJ A;  5K5G B;  3HHW A;  3L72 E;  2FS1 A;  2KHH A;  1A02 F;  1YLA A;  4N78 D;  3KDP B;  3FUX A;  1J5E M;  1SQP J;  1KYI A;  4ITQ A;  4DZO A;  4IBI A;  4MM3 B;  4UB6 E;  2FFD C;  3H4M A;  1TDZ A;  3V2P A;  4PT5 A;  3KXD A;  4L76 A;  1TTE A;  4FWD A;  2Y0Q A;  2WPS A;  3FXD A;  2K9J A;  1FAV A;  1VQ1 A;  1N7L A;  2JO1 A;  1TF0 B;  2QA4 P;  4PD2 A;  1D0L A;  3E21 A;  2RRU A;  4KOD A;  2A06 G;  5CCH D;  1YJ9 P;  3WHK A;  1RE3 A;  2QJK C;  5APV A;  2OGU A;  3B9P A;  1YIJ P;  1VQ9 P;  3MMP A;  1EXJ A;  3U6C A;  3L75 D;  4HL4 A;  4LF7 M;  2F5N A;  2DAG A;  2A45 I;  1KYO I;  3HWS A;  2XFS A;  1URQ D;  1RY3 A;  1S3S A;  2XZU A;  3M9H A;  5M1B A;  2N1T A;  2XDJ A;  4QHT A;  3HHZ A;  4AQY M;  1M7L A;  3VN0 A;  1KSF X;  3HE4 B;  3TGU E;  3L74 G;  3CXH I;  3VMX A;  3HD7 D;  5KPR A;  3PTZ A;  2OO9 A;  4D6T E;  1PJJ A;  3W0F A;  2C98 A;  2UXB M;  1OVR A;  5BPV A;  3GPY A;  4W7Z A;  3TF5 A;  1AJY A;  1GO5 A;  4I2L C;  3M6A A;  1NWQ A;  3B71 A;  3KFU G;  1LT9 A;  1XMQ M;  4B7F A;  1SQQ J;  2OYH C;  3FE3 A;  1EFU B;  4DR6 M;  3H1K J;  4TT3 H;  2BEQ D;  2YR0 A;  3FGA D;  3BVH A;  1R4G A;  2M3E A;  1VQO P;  2WWW A;  2WT7 A;  1MV8 A;  3C8V A;  3IAO A;  4II7 A;  1T6A A;  1IBL M;  4K35 A;  4WW0 A;  2ZFC A;  3CGW A;  4AKH A;  3T1H M;  3PXG A;  1BE3 D;  2YNM D;  4YY3 M;  1BGY G;  5IT9 S;  4Z8X A;  3J7B A;  4S12 A;  1BDC A;  2RGH A;  4JI1 M;  2C0W A;  2E75 D;  2WSC F;  1FOS E;  1KB9 D;  4B86 A;  1JB0 J;  2K1A A;  1AQT A;  3ITK A;  2HG5 D;  3CF0 A;  2DWM A;  2FY8 A;  4OGQ C;  3IF4 A;  3HU2 A;  1EC5 A;  3S9O A;  1JM0 A;  2KNA A;  2ZM6 M;  2QEN A;  1OWA A;  1QLE D;  3T97 B;  1OX3 A;  3GRR A;  2R32 A;  3VOP A;  2RKO A;  4FWH A;  3BXW A;  3RL0 C;  3H1H J;  1ZRT E;  4EI2 A;  3FRI A;  1HJP A;  4IBG A;  5AW8 B;  4NXM M;  3O6Q A;  2QNJ A;  5B5E E;  1N73 B;  2D2C D;  1DD3 A;  4BWN A;  2WSE H;  3A45 A;  1RQU A;  5CJ4 A;  1KIL A;  1KMI Z;  1GZL A;  2W6A A;  3H1I E;  1K3W A;  4IOI H;  5B66 E;  3SAV A;  2FE8 A;  3B5N B;  2IBZ G;  3L37 A;  3LVV A;  3D71 A;  4DCK A;  1XMO M;  3MD0 A;  3FRH A;  2JWS A;  4XE5 B;  3AE1 C;  3I51 A;  2N9B A;  2KZS A;  1FZC A;  3KS4 A;  3GLF E;  3GHG B;  1J1D C;  2I7P A;  1OW7 A;  4I7Z C;  1SQQ E;  4YXD C;  4X64 M;  1ZR2 A;  3FWL A;  1GL2 C;  1JY2 N;  2WSE J;  3USS A;  4IJE A;  3SC3 A;  3LID A;  3VDP A;  2DZL A;  2FYN C;  1EDJ A;  3AV0 A;  3EIE A;  3M7G A;  4CIZ A;  3U61 B;  2V6Z M;  1TU3 F;  3CME P;  5H37 D;  3VMA A;  4GC9 A;  2WSF H;  4MGI E;  3V2Q A;  4L75 A;  1NO1 A;  2JKV A;  5EP2 A;  2QPA A;  2H1R A;  2HAK A;  3C58 A;  3AEF C;  2QJP B;  1OJL A;  1LTT C;  2E5L M;  2WPR A;  1PGO A;  2AXT H;  3E1I A;  4DUZ M;  3U1C A;  2W90 A;  1ZV8 A;  1VQM P;  3EFG A;  1OIP A;  2QP9 X;  1Y9B A;  3AE6 C;  4C7N A;  2E76 D;  4DV1 M;  3VTP C;  1N7S A;  5AW2 B;  5KO3 A;  3TNU B;  3HX3 A;  1Q2N A;  1Y8A A;  2FH0 A;  2XU6 A;  5IRE B;  3VKG A;  1VF5 C;  4H13 C;  1T2K C;  2WZJ A;  3H1H E;  1QQW A;  2WSF J;  4F1I A;  5AVX B;  1E32 A;  3I4Y A;  5KPT A;  3G3Z A;  2ZAM A;  3BAS A;  5BVZ A;  4OH8 B;  2BJV A;  1S1C X;  1IN7 A;  4HB1 A;  5KLV K;  3M91 A;  4C46 A;  1WXQ A;  3UGJ A;  1VEG A;  3L71 D;  1EE8 A;  2D7E A;  2VII A;  2NPS B;  2GNO A;  2BWE A;  1MFT A;  2LXC B;  1PM5 A;  1KB9 I;  4PJ0 H;  3AE5 C;  1S5L E;  4GT1 A;  5GKN A;  1L2B A;  3WUU A;  1L0L J;  2IX7 C;  2Q6Q A;  3GF3 A;  2Q3I A;  4UYB A;  4BB9 A;  2I1J A;  1PJS A;  5AW5 B;  2A06 D;  2I1K A;  3IN6 A;  1NTZ K;  3MUD A;  1G2C A;  4BXL A;  2ZBK B;  1R5S A;  2CV0 A;  1RE3 C;  5KLV E;  1L1T A;  1Y8G A;  1OFI A;  1GKI A;  1LGH B;  3U59 A;  2EKF A;  1R7R A;  2VQF M;  4OU7 A;  3P7K A;  5KAI H;  1FBM A;  2ZT9 C;  1SQV K;  4XGI A;  1LWU C;  2N1T C;  4IBJ A;  2ZXE B;  2LWX A;  5KLV D;  1ZMU A;  2KXE A;  1NNJ A;  2CE7 A;  3ZQJ A;  4OVZ A;  1FU1 A;  1LJ2 A;  2KUB A;  2P1J A;  3AEC C;  8CAT A;  4AI6 A;  1JMB A;  2L4E A;  1NTM K;  3UJN A;  3A42 A;  1XB2 B;  2K88 A;  1URQ B;  3M9B A;  1OIZ A;  3MIW A;  3GF7 A;  3J2P B;  1ZMW A;  2JR8 A;  1L0N K;  1SFC B;  2A45 H;  1KYO H;  4I6M C;  1DEB A;  1LT9 C;  1Q86 Q;  2M0B A;  3HD7 B;  3L72 G;  4FCW A;  3H32 B;  2JY5 A;  2KNV A;  4IL6 X;  1T3T A;  4YTP C;  4AG6 A;  3BCC J;  1SQV E;  1GD2 E;  2R65 A;  1NTZ D;  3CXH H;  2K9D A;  3KZI H;  4I4L A;  4PD4 D;  2QBY A;  5BU8 B;  2E5Y A;  2KB7 P;  3LCU A;  3L36 A;  4IBD A;  2O1K A;  2KI7 B;  1YTZ T;  1C1K A;  1IXZ A;  4QOZ C;  1RHZ B;  2K9Y A;  1M1J C;  1JTH A;  2RKL A;  3P7Z A;  2QJY B;  1BGY D;  1YQ4 C;  3L75 G;  1WGN A;  1IBM M;  1E79 H;  3A0B H;  5E79 E;  2W82 A;  3T38 A;  3U5Z B;  1G1J A;  1KFN A;  1TH3 A;  2V1C A;  2Z8Y M;  3PVS A;  5FLX S;  3PH0 A;  1E5W A;  1L0L E;  3K9O A;  3QYB A;  4LY6 A;  1NTM D;  4N3Y B;  2Z5I A;  2LVQ D;  3K1J A;  3GO8 A;  2ZVN B;  5BU5 A;  1HJB A;  2E75 B;  4LZJ A;  1L0N D;  3KOY E;  3IG8 A;  4WY4 B;  3HJQ A;  1SQB J;  4B3S M;  3JR4 A;  2YNY A;  1N77 A;  2G3A A;  1VQL P;  2HKJ A;  3TGU G;  2DAI A;  1JR3 E;  2OYH A;  4O9B A;  3GPU A;  3B74 A;  1PGQ A;  1GAB A;  3JC2 2;  1WGL A;  4D6T G;  3N4X A;  3CC4 P;  3C3D A;  4H44 B;  1OVV A;  1PPJ E;  4R4M A;  3Q2Y A;  1G1I A;  2OQQ A;  1LT1 A;  3HE5 A;  1KIL C;  1FJK A;  4NL4 H;  2LTU A;  2O01 F;  2P7J A;  2Y20 A;  5L8R F;  2JEE A;  1P84 E;  1G8P A;  1HQC A;  1OFC X;  2R4J A;  2IFM A;  2IZ0 A;  3L4F A;  4LJ7 A;  4U3F E;  3HHX A;  3R8F A;  4U7J A;  2WMM A;  1EDK A;  3MZW B;  5GTH H;  3LQR A;  4LJ9 A;  2D2C B;  4Y28 J;  1HWT C;  3L70 D;  2R46 A;  1MKM A;  3J80 S;  1IXS B;  2APL A;  4AYC A;  4W7Y A;  2BCC J;  1LTJ B;  1BCC D;  5E6J A;  1XXH B;  2KZU A;  2C96 A;  2YMK A;  5KAI E;  1GU4 A;  3IHP A;  3THG A;  3II6 A;  4ANR A;  1H0T A;  1FZG A;  3JSV C;  1LV7 A;  3G4S P;  1OFH A;  2RH0 A;  3Q8X A;  1AFO A;  1NSF A;  1HNZ M;  1E9S A;  1DEE G;  2Q5U A;  2FYZ A;  5FTM A;  1G59 A;  1CI6 B;  3CX5 D;  3GLG E;  4RKU J;  1HT1 E;  2WQY C;  3M9Q A;  4NSO B;  1T3U A;  1GJT A;  3A0H H;  3AEE C;  3RL0 g;  4H0L C;  3U60 A;  3AKZ A;  4QNR A;  2R45 A;  1WIV A;  3LCV B;  1IO4 A;  3GLF B;  4PV1 B;  3EIH A;  2KIK A;  3HU3 A;  3AE3 C;  3V76 A;  3R9X B;  3RBZ A;  1FOS F;  3HUS B;  2R18 A;  3KZI E;  1DO2 A;  5ITX E;  2A5Y B;  4JI7 M;  3SHF A;  2OTJ P;  5DYI A;  4G4N A;  1QL1 A;  3QYE A;  1TH4 A;  1U7M A;  3GMA A;  4CPG A;  1N7S C;  3ZC7 B;  2QRX A;  4GC5 A;  2D4Q A;  1NU1 K;  1KD1 Q;  3GRU A;  1VQN P;  4OX9 M;  3CCM P;  3VMY A;  2H5X A;  1TR8 A;  1SLQ A;  4EYY Q;  3KOW E;  3GQ3 A;  1RF0 A;  4PD4 I;  1JUN A;  4L74 A;  3GRY A;  3TWK A;  3H1I G;  2E76 B;  4UB8 E;  1V33 A;  1GL2 A;  1UFZ A;  3EQ2 A;  3E46 A;  1ZP0 C;  1LP1 B;  4GOD A;  5CJ0 A;  4ZNC A;  1Z56 A;  2CUZ A;  3TYY A;  2K37 A;  2IPP A;  5EP4 A;  1NHL A;  3L26 A;  1FZA A;  1VF5 D;  4M9Z A;  3GLG A;  4H13 D;  2ZAO A;  3ZCB B;  1T2K D;  2FKW B;  4GIT A;  2KZI A;  2W6J H;  2K0B X;  1AIP C;  5C39 A;  3LVW A;  3ILK A;  1L4A A;  1PFI A;  2BCC E;  4ZKU A;  1RF1 B;  3Q8G A;  3TE6 A;  3G71 P;  5KQ8 A;  2LXB A;  3MUD C;  5KJ7 A;  2CPB A;  4R7G A;  1YUB A;  1NOH A;  1TGU A;  1M90 Q;  5AVR B;  2VRS A;  1PP9 E;  4OWF A;  5ITY A;  3W67 A;  1H88 A;  3FTC A;  3RK3 E;  4ZPX A;  1KB9 H;  5EJC A;  3L73 D;  1SS1 A;  1YTZ I;  3UK6 A;  1NU1 D;  1NTK J;  3BRV B;  4Y99 C;  1PL5 A;  4MB7 A;  4MGK E;  5CBO A;  1JCC A;  3ZDM A;  2DZN B;  2H43 A;  3H1L J;  1AUA A;  2FFD B;  4GDO A;  5AVT B;  2IBZ I;  2XZF A;  4TUW A;  2IZ1 A;  4YXW H;  2JUJ A;  3KXE C;  2PP6 A;  1IFN A;  2O1J A;  3R4Y A;  2KW0 A;  2KLV A;  2OAR A;  3L71 G;  4GKJ M;  4OVN F;  4DR1 M;  4AG5 A;  1S72 P;  3BRT B;  2KNC B;  2C5R A;  4DR3 M;  2MGW A;  1MUU A;  2YMY A;  2ZT9 D;  2HFE D;  4F2L A;  4YPC A;  5FTK A;  1OVU A;  3L72 D;  5AVW B;  1FZB A;  4LF9 M;  2QJK B;  3M0A A;  2L91 A;  5DYG A;  1QAO A;  5AW6 B;  4J7P A;  4FCV A;  1LTS C;  3A98 B;  1N32 M;  2DWZ B;  4G3O A;  3D70 A;  5DNY A;  1GK4 A;  4LLH A;  1XNR M;  4LGM A;  2CHV A;  4GRI A;  3SAS A;  2HPC B;  1I94 M;  1ZN5 A;  4AW4 A;  3K2L A;  2CPS A;  3CCS P;  5KKZ C;  1LWU A;  3B7N A;  1FDO A;  3PNV A;  2WTY A;  1SFC D;  3FUT A;  5KLV G;  1SQX J;  2LR2 A;  3WU2 H;  1OLM A;  2CP8 A;  3D8L A;  4AZF A;  1SQP K;  2GQF A;  1LTG C;  1XWI A;  2B87 B;  3NWL A;  5EXX A;  3TWL A;  4LF6 M;  1OAO C;  4EIW A;  1PIX A;  4L78 A;  1L2C A;  4R3D A;  1NKN A;  4GIP A;  1W5C E;  1M56 D;  3ABV C;  3TGU D;  1CUK A;  2M8R A;  2YKP A;  4LFC M;  1NTK E;  4D6T D;  2KSJ A;  2XEP A;  3H1L E;  2LVN C;  1NTZ G;  1XC8 A;  1KQF B;  3Q3D A;  5CCH A;  3U6L A;  3CWB J;  2OOB A;  2KRK A;  1KIL E;  5APQ A;  1H8A A;  1VDF A;  3RE8 A;  1SQP E;  3GPX A;  1M1J A;  4GEW A;  2QIW A;  4A3V B;  1O6U A;  4DBG B;  4KT0 F;  2OYI A;  1SQV G;  2E74 C;  3FKE A;  2FYU J;  1FJP A;  2H7H A;  4WY4 D;  2UUC M;  5TIS H;  1SG9 A;  3WMM 0;  3CCL P;  4LG2 A;  4AQR D;  3UIA A;  1KIL D;  3GLI A;  3RL0 B;  1K8A Q;  2CHQ A;  1DGH B;  1A02 J;  2DAE A;  3H1J J;  1JY3 N;  3SAR A;  1N2D C;  1VDD A;  2DWN A;  1NTM G;  2L5G B;  3CCV P;  3SAU A;  1L8Q A;  3RK2 C;  3F5H A;  4H44 D;  4IFF A;  1L0N G;  2JP7 A;  1AVO A;  3A5T A;  5H2F H;  1LTB C;  4BRY A;  1PRB A;  1IFD A;  3U1A A;  1WJ7 A;  1SQQ K;  1N36 M;  4JBZ A;  4WVZ A;  2UUA M;  2KDL A;  5AVQ B;  2I8D A;  1U57 A;  1X79 B;  5C18 A;  1N34 M;  1QVR A;  3MHV A;  1NVO A;  1XHB A;  1SQX E;  1HH0 A;  4I7Z B;  5A2Q S;  1ZRT D;  2M5A A;  5EXP A;  1IFJ A;  3FWN A;  2GUV A;  3L70 G;  1WR1 B;  1ZXG A;  2HOD B;  1SVF A;  2FYN B;  4RO0 A;  4XA4 A;  3HKP A;  4MH0 E;  1RF0 C;  1BCC G;  3AE9 C;  1RH5 B;  3H1I D;  1C7Y A;  4GIF A;  3VFD A;  3H1K E;  4IL6 H;  4U3F G;  1N73 C;  1KFV A;  1VPC A;  2HLO A;  2AXC A;  4LJ4 A;  3CWB E;  2WPQ A;  1JNM A;  1KC8 Q;  2P67 A;  4PV1 D;  1SQQ D;  5FSW A;  2WSC H;  2YKO A;  2KK7 A;  4G4O A;  4HEO A;  2F5Q A;  5E26 A;  3L74 J;  4PD4 H;  1JCD A;  1R6B X;  4JXJ A;  1L4A C;  4WP2 A;  2FYU E;  3D6Z A;  3T6P A;  3PLN A;  3CPW O;  1ZAE A;  2JXN A;  1X8Y A;  5APU A;  1VF5 B;  4H13 B;  5KJ7 C;  2DNA A;  3PG7 A;  3J81 S;  1KZU B;  4MGY E;  1SXJ E;  3H1J E;  3KYQ A;  4JF7 A;  2BWB A;  5KQD A;  2MH8 A;  5DFL A;  3FD9 A;  1DIP A;  1UII A;  2EA0 A;  1EQ7 A;  5KAF H;  5EP3 A;  2Q9I A;  2UWJ E;  2QVA A;  5AVS B;  3H6P A;  2WSC J;  4Z6Y A;  3SAW A;  2QM8 A;  2ZYG A;  2LNH C;  2ITA A;  1NH4 A;  4QMA A;  1HR0 M;  1NGM B;  2KS1 A;  2W27 A;  2KYV A;  2LBC A;  4LC1 A;  4NPF X;  4W80 A;  2HHH M;  2K9J B;  1YSY A;  1IJD B;  4LF5 M;  2AHM A;  2L7I A;  1BGY J;  4XBO A;  3H1H D;  1Q90 D;  2CK3 H;  3U6Q A;  2QEX P;  4JI5 M;  2QM7 A;  3AE7 C;  2CV1 A;  1S4X A;  1GLN A;  1EDL A;  5AW1 B;  2DHR A;  1USE A;  4DV5 M;  3U6P A;  1GL6 A;  2QZ4 A;  3L27 A;  2JNH A;  5EXT A;  1IFM A;  2G8L A;  1PGP A;  1SXJ A;  2ZT9 B;  1VEJ A;  2N1T B;  1FDI A;  3RK3 C;  2QG4 A;  2R6F A;  3AFH A;  1HJ0 A;  4LRT A;  1CSB A;  1MN3 A;  2VF8 A;  3L73 G;  1JY2 O;  1NU1 G;  4K0K M;  1SP4 A;  1NKZ B;  3FYC A;  1S5L X;  4P16 A;  3GG2 A;  1NAF A;  4GOE A;  4QNM A;  2D7H A;  1D0M A;  4N6J A;  3L74 E;  3FXE A;  3KSJ A;  4D81 A;  5FTL A;  4JV5 M;  2Z7J A;  2KOG A;  1PP9 G;  1LT9 B;  1HTL C;  2YXR B;  3GW6 A;  4PCZ A;  4JI8 M;  2R5B A;  1ZQ9 A;  3GLH A;  2PFX A;  4CJ6 A;  2F5O A;  1QX8 A;  1X37 A;  2JP3 A;  5APX A;  5AW7 B;  4FWG A;  4LF4 M;  2OTL P;  1T6O A;  2PRR A;  2LHC A;  4JQ0 D;  3E1R A;  1NJF A;  2DI0 A;  2WT7 B;  2YQZ A;  4LJA A;  2JWD A;  4WWI A;  4DT0 A;  2GUS A;  2QSF X;  3HTK A;  1TH2 A;  1L0L K;  4FW9 A;  1OTR A;  4JN6 A;  4LRS A;  4DOJ A;  5APW A;  4LFA M;  4BBA A;  3GQ5 A;  4IBE A;  2W83 C;  3VKH A;  5CCH C;  3FUW A;  3HRN A;  2LVA A;  2LH0 A;  1BDD A;  1KQG B;  5CBN A;  1PGY A;  2AXT E;  4LZZ A;  3W0L B;  1KTM A;  4AKI A;  2DVW B;  1SQV D;  2OYI C;  1GU5 A;  1URQ C;  2C9O A;  2YXQ B;  4LGD E;  2R44 A;  4ASW A;  3A46 A;  1DO0 A;  1Q39 A;  1R5L A;  2OTK E;  1NNU C;  3HD7 C;  1IQP A;  4NPE A;  3FUV A;  5GTI H;  3SWY A;  3DA1 A;  4GKK M;  5AVZ B;  3CTW B;  1GTW A;  2ZAN A;  4R4L A;  1YHQ P;  3AED C;  1IK7 A;  1EZV E;  2J59 M;  3B8E B;  2OPF A;  1QAN A;  2Y9Z A;  1R8E A;  3KP0 E;  2BNK A;  3O6Q B;  1Y47 A;  3LW5 F;  4DR5 M;  3SYL A;  4M0D A;  1FZE A;  2E74 D;  4UN2 B;  4TLG A;  1KIL B;  2QQ8 A;  5IWA M;  3CC7 P;  2CRU A;  2NZ2 A;  1L0L D;  3CCJ P;  4Z1M H;  2JWA A;  1KQS O;  5ITT A;  4PJ0 E;  4OGQ D;  2YO2 A;  2XKM A;  4IIW A;  4DV3 M;  1P3Q Q;  4M9S A;  3V5B A;  2R62 A;  3M06 A;  4JI4 M;  5FTJ A;  3MHV C;  4BLC A;  3Q5P A;  1FZC B;  2V1U A;  3HE4 A;  2F4V M;  2IBZ E;  3I5C A;  1NV8 A;  2XZR A;  1VQ6 P;  3WUV A;  3RL0 D;  4B08 A;  1JR3 D;  1RU3 A;  4B7G A;  4CIS A;  2FXP A;  2K6B A;  2LKM A;  2OYO A;  1JMM A;  1JY2 P;  2H88 C;  1QAQ A;  1PPJ D;  2DWL A;  3D8B A;  3QAU A;  1HVV A;  3IFM A;  3NTN A;  4YHH M;  2FOI C;  1OZH A;  1P84 D;  3KDS E;  3JCU H;  3BCC E;  3V4W A;  4U3F D;  4GKG A;  1SQP G;  2VF7 A;  1VQ4 P;  2ZVO B;  1V34 A;  4H0L B;  1YJW P;  2L6O A;  4WUR A;  5ITQ A;  1IK9 A;  4IBC A;  1SQB K;  3V2N A;  2LVP C;  2UU9 M;  1N86 A;  3MK6 A;  1E9R A;  3K92 A;  1T3J A;  2V4H A;  4C7N B;  3E7K A;  1KYO E;  4UB6 H;  1GL2 D;  1HF9 A;  1ORY B;  1QUT A;  1S3J A;  1DGG A;  2XSZ D;  3TL4 X;  1N7S B;  3RGS A;  3AE2 C;  1V92 A;  3J7A S;  1LTJ C;  1S9K E;  1OKS A;  3TQS A;  1QYR A;  2PAJ A;  4MGH A;  2WPV B;  1NY6 A;  1Z59 A;  1QZE A;  1G71 A;  3LW5 H;  3CXH E;  1UIX A;  1GDT A;  4IFM A;  3WUT A;  3KOX E;  1K3X A;  5JI2 E;  3P8C E;  2MJ5 B;  1KYO D;  3DFZ A;  1SQB E;  3SFE C;  2Q1K A;  3T97 A;  1L4A D;  2J7O A;  4D82 A;  2EKK A;  2JZ0 A;  3HHY A;  2MRO B;  3L2A A;  4D80 A;  1MFZ A;  1MU5 A;  4JI0 M;  3A0B E;  3VP9 A;  3SMS A;  2PGD A;  4REZ A;  2O01 H;  4OMK A;  1N73 A;  1XNQ M;  1EXI A;  2NQ8 C;  3OTO M;  2XF3 A;  3TWM A;  3AJI B;  4JI2 M;  3L75 J;  2B88 A;  2UXD M;  2KXP B;  3HUS C;  5EXS A;  2ZAE B;  1SQQ G;  2JA2 A;  1JQJ C;  3KP1 E;  1G2C B;  3B5N A;  2JY7 A;  2JDI H;  2Z5H A;  1K04 A;  4K3A A;  3H1K G;  4LJ8 A;  4RNA A;  1OW6 A;  3HZJ A;  1AV1 A;  4FCT A;  1J1E C;  3CWB G;  3CMA P;  3GHG A;  1SXJ C;  2DKL A;  2YIU C;  2O01 J;  2E42 A;  2BJW A;  2E76 C;  3KSX A;  2KEB A;  5CCG A;  3D6Y A;  1OAI A;  2B89 A;  4OVZ B;  4R71 A;  4LF8 M;  3H25 A;  3HY5 A;  2BCC D;  3HJS A;  1QZM A;  3E9S A;  2CFO A;  4Q7J A;  4D6T J;  3L29 A;  5GTH E;  3U61 A;  1QVF O;  1NO4 A;  2RGO A;  3FTF A;  1QL2 A;  1N78 A;  1Q3C A;  1IN6 A;  3U6D A;  2QCU A;  3VYI A;  1PP9 D;  4L15 A;  1HNW M;  3C1L A;  5AW3 B;  3FX0 A;  3RK3 D;  3BAT A;  4N78 E;  1A5T A;  1OLM E;  1BE3 J;  1RE4 A;  3JCU E;  4DV0 M;  3AL0 C;  1IBK M;  2V7Q H;  3K9P A;  4TLF A;  4JI3 M;  1JB0 F;  3H1H G;  2QBY B;  2N1T D;  3CL3 D;  3V6I A;  1K82 A;  2FXO A;  1Z5B A;  1P84 I;  3KS8 A;  3C9P A;  4ZMD A;  3KPE A;  5KLI C;  1JTH B;  2WZ7 A;  3TNU A;  1YJN P;  4B7H A;  2GA1 A;  2I7N A;  3CD6 P;  3A0H E;  5KKZ B;  2KA6 B;  2POH A;  3L25 A;  5B5E H;  3SAT A;  2O25 A;  1R2Y A;  3CX5 I;  2KSE A;  1Z6T A;  2V7Q J;  3CI9 A;  3L75 E;  4AKG A;  1NTK K;  3IEC A;  2Z4S A;  2ZJS E;  5B66 H;  5EQT A;  2ZTD A;  2HWJ A;  2NPS A;  1N8R Q;  4RF1 A;  4X65 M;  4WBA A;  1EDI A;  2IDB A;  1Q82 Q;  3NFQ A;  3MJ5 A;  5LMN M;  3M0D C;  1D7M A;  3GLI E;  2R0I A;  2N35 A;  2KLU A;  2OYH B;  3O8Z A;  2K3R A;  3V4Q A;  3Q1M A;  3FTE A;  1L1Z A;  3VK8 A;  2L7H A;  1BSN A;  5LMU M;  5AW4 B;  4WB4 A;  3HE5 B;  2Y0D A;  3CCQ P;  4J7Q A;  4AUW A;  2CEA A;  1GW4 A;  3H1I J;  2WSE F;  3SHG B;  1H6U A;  3W68 A;  3A7O A;  2P5T A;  2E74 B;  4HYT B;  1QDR A;  1IFP A;  2J7N A;  3GRV A;  3P32 A;  7CAT A;  3AOG A;  4X66 M;  1IFY A;  4HKZ H;  2OOA A;  1H0T B;  2Z4R A;  3KVW A;  1NAY A;  1BE3 E;  1NTK D;  2Y0T A;  4IJF A;  5FTN A;  2RMZ A;  4OGQ B;  3SFD C;  3TSI A;  4DJG A;  1NVM A;  2KP8 A;  5F3W A;  4I5S A;  2N9Y B;  1URQ A;  4X62 M;  3FUU A;  3H1L D;  4JYC A;  2XLJ A;  1KB9 E;  3G6E P;  3RK2 B;  3EFF K;  1SFC A;  2JJL A;  3CCU P;  2XND H;  4GOF A;  1NHG C;  3R2P A;  1M8O B;  2W8Z A;  3HD7 A;  3H32 A;  1SQX K;  1SQP D;  2Y0E A;  2P2U A;  5APY A;  2D7G A;  2Q7C A;  1I4W A;  3L35 A;  2HCB A;  4G6Z A;  1CW5 A;  2EUC A;  3L28 A;  3U60 B;  4HH2 A;  2JY8 A;  2WSF F;  3VP8 A;  1VDL A;  3JAM S;  4W5W A;  1L0L G;  1IZN B;  3S1K A;  4IFD K;  2YKQ A;  4KO8 A;  1VQK P;  1VQP P;  1EZV G;  2Y0C A;  3CF6 E;  1S5L H;  2KNZ A;  4NC6 A;  3U5Z A;  1K05 A;  1ZLL A;  3L71 J;  3U6M A;  3VMZ A;  2FNA A;  3HU1 A;  3E4R A;  1XXH E;  1J1D B;  1GW3 A;  1K73 Q;  1HGV A;  3B4S A;  1KV4 A;  1JOC A;  2LHG A;  2JY6 B;  1GL2 B;  1KQL A;  4GHA A;  4NPD A;  4M3L A;  4LFB M;  1DGF A;  2MKV A;  1VEK A;  1NJG A;  2YO3 A;  2FYU K;  4WY4 A;  2RN0 A;  2XV5 A;  3AE4 C;  4H0L D;  1PPJ G;  3SWK A;  2Y21 A;  1WT6 A;  2O01 N;  1BSH A;  5APS A;  1SQX D;  3OA7 A;  3GLG B;  2F5S A;  3AE8 C;  1GVN A;  3VK7 A;  2J5U A;  1Q3B A;  2X8A A;  1L4A B;  2M60 A;  1PJI A;  1N75 A;  1N7S D;  2C0X A;  3WU2 E;  5AW0 B;  3IR9 A;  2G3Q A;  3PEG A;  2EJS A;  3B5N C;  1R2Z A;  4NRV A;  3I4V A;  3PJS K;  2L2D A;  3SBJ A;  3H1K D;  3BCC G;  5KLV J;  3RFW A;  2L09 A;  1DH3 A;  1IXS A;  1CZQ A;  3CWB D;  2XFT A;  3GHG C;  4NSR A;  1LTJ A;  1XXH A;  2E5T A;  1IY2 A;  1OW8 A;  2DXI A;  1FZF A;  1G41 A;  3Q5R A;  2ZYD A;  5CCG C;  2ERC A;  4XFJ A;  1TDH A;  3SSU A;  3KQG A;  2XH9 A;  2Z3X A;  2FYU D;  3PFI A;  3AOE C;  2A45 G;  3P8M C;  4M0W A;  1Q81 Q;  4KT0 J;  4CHT B;  1JY3 O;  5BR8 M;  5CMZ A;  4NRW A;  1CI6 A;  1NTZ J;  3CF2 A;  1U7J A;  4OW0 A;  4G4Q A;  4JPZ B;  2HL7 A;  2BEZ F;  5ITU A;  1SXJ D;  3H1J D;  1L2D A;  2B9B A;  1K9M Q;  4JYA M;  1FDM A;  4B3R M;  5E79 H;  5TIS E;  1FC2 C;  3S4R A;  1D0K A;  1VQ5 P;  3I56 P;  1Z5A A;  1PZQ A;  2WSS H;  3GLH E;  2QJP C;  1RE4 C;  1X9V A;  3NBX X;  2OQ4 A;  2UUB M;  3L71 E;  2IYP A;  4DR7 M;  1KN7 A;  1SQB G;  4IBF A;  5C1B A;  3GLF A;  1LNQ A;  1SQV J;  3C3E A;  3TPZ A;  2MR9 A;  2AEJ A;  4LJ6 A;  3HUS A;  1GMJ A;  2H89 C;  4RF0 A;  3RK3 B;  1WRG A;  5H2F E;  1DGB A;  4A7P A;  1HQY E;  1PGJ A;  2DEN A;  2J5Y A;  1NTM J;  2G5G X;  3Q5S A;  1OMI A;  1YI2 P;  3MTU E;  1DV0 A;  1X0T A;  2A06 E;  1L0N J;  1LWU B;  1YIT P;  4DR4 M;  4NXN M;  1LP1 A;  4M8Z A;  2Z4E A;  1DX7 A;  1NYH A;  3B89 A;  2P58 A;  2FXM A;  3J27 B;  2BCC G;  2NPS C;  1P84 H;  2C99 A;  1J2J B;  4JI6 M;  2G8Y A;  2X4A A;  5DJT B;  4L8R C;  3I55 P;  2R5D A;  1UM8 A;  2E43 A;  1N33 M;  4EDF A;  3NXS A;  3C9I A;  4NOO B;  3KW6 A;  4Y28 F;  4CGY B;  4I8O A;  3PRJ A;  5KPZ A;  1RF1 A;  3CX5 H;  4B3T M;  2YFQ A;  3VDU A;  1ZME C;  5IZ7 D;  2Q2E B;  1HBW A;  4IL6 E;  1YQ3 C;  3L70 J;  2DW3 A;  3T15 A;  2X49 A;  4KHX A;  2NRG A;  1PJT A;  5DJU B;  3TDK A;  3AEA C;  3U6S A;  2VQE M;  3L74 D;  1BCC J;  2IFN A;  4MGZ E;  3M0E A;  1LTI C;  4DR2 M;  4GH9 A;  1M1J B;  2P10 A;  3I01 M;  4U3F J; 
#chains in the Genus database with same CATH homology
 1R5L A;  4OMK A;  4CJ6 A;  3B74 A;  4M8Z A;  3B7N A;  4OMJ A;  1OIZ A;  1O6U A;  4J7Q A;  3W67 A;  4J7P A;  3B7Q A;  2D4Q A;  3PG7 A;  2E2X A;  4UYB A;  1OLM E;  3P7Z A;  3W68 A;  4CIZ A;  1OIP A;  1OLM A;  3HY5 A;  4TLG A;  3PEG A;  3B7Z A;  3Q8G A;  4FMM A;  3HX3 A;  1AUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...