3W68A

Crystal structure of mouse alpha-tocopherol transfer protein in complex with alpha-tocopherol and phosphatidylinositol-(4,5)-bisphosphate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
251
structure length
251
Chain Sequence
QPGLAELRRRVQEAGVPQTPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRAECPELSADLRPRSILGLLKAGYHGVLRSRDSTGSRVLIYRIAYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGWQVSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRIHLHGNNYKSSMLQHFPDILPREYGGKEFSMEDICQEWTNFIMKSEDYLSSISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impaired alpha-TTP-PIPs interaction underlies familial vitamin E deficiency
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Alpha-tocopherol transfer protein
total genus 91
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
A PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.20 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 N-terminal domain of phosphatidylinositol transfer protein sec14p 3w68A01
1.20.5.1200 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Alpha-tocopherol transfer 3w68A02
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 3w68A03
4FMMA 4M8ZA 4J7QA 4UYBA 1OIZA 4CIZA 2E2XA 1AUAA 3B74A 3B7ZA 3HX3A 4TLGA 4J7PA 4CJ6A 1OLME 3W67A 2D4QA 3W68A 1O6UA 4OMJA 3B7QA 3PG7A 3P7ZA 4OMKA 1OIPA 1R5LA 3B7NA 3Q8GA 3PEGA 1OLMA 3HY5A
chains in the Genus database with same CATH superfamily
2Q7CA 1M7LA 3SAWA 3E46A 2ZBKB 5KLIB 3HRNA 1D0LA 1AV1A 3H6PA 1L0LK 3H4MA 3LCUA 1BGYG 3M06A 3M9BA 2RMZA 1N73C 1MN3A 2FFDB 2G8LA 3E21A 2QHOB 4L73A 3FRHA 2C9LY 3PVSA 1RY3A 1EFUB 1L4AB 1GL2A 1SFCD 1Y8AA 2X8AA 3IG5A 1IO4A 4HH2A 4FW9A 3SWYA 4GRIA 1OWAA 1GZLA 4UYBA 2D7GA 1N7LA 2AXCA 1QEXA 5APUA 4KO8A 1NHWC 4AYCA 3TDKA 1T2KC 1SQBG 2IDBA 1GW3A 1RF1A 5AW4B 4JXJA 2PRRA 1T6AA 3ABVC 3CCLP 3M9QA 3MD0A 1DH3A 3VKHA 1VF5D 1G2CA 3MZWB 2KS1B 1IN6A 1IFDA 2AXTE 4Y99C 3KSXA 2XH9A 4B7GA 2KNCB 3KHUA 2QA4P 3AE8C 3CCQP 2YR0A 3R8FA 3BATA 3G4SP 2R5DA 2DZNB 1TF0B 2E76B 4WWIA 2YXRB 2OYIB 3MHVC 1IZNB 4DV5M 2N1TD 2F5PA 2IFNA 1S1CX 3TF5A 1LTAC 1PRBA 2C9OA 1NVOA 2FYUK 1XNRM 3RFWA 3HHZA 1N2DC 3GG2A 1OXZA 4XGIA 3KXEC 4L74A 3KOXE 3V2PA 2H8PD 1LNQA 1K8AQ 1YITP 4B3MM 1OVRA 1IFIA 1L0NE 1ZV1A 2L5GB 1L2BA 1SXJC 2WSFF 1KN7A 3FUXA 3KPEA 2LH0A 3AEBC 3AE7C 1BGYD 4I6MC 3Q8XA 4QOZC 4DV7M 1VQPP 3Q8GA 1RHZB 2DHRA 2P7JA 1L0NK 1OMIA 3RL0C 2GNOA 1Q2NA 4FCTA 1GW4A 4JI4M 2R3SA 4ITQA 4GOFA 1TTEA 1SXJE 1R5SA 2PP6A 2G3QA 2JP3A 1NVMA 1GL2D 1SFCA 1SQPD 5AVZB 3H1IJ 3B7QA 4X62M 3E1RA 1EC5A 1RE4C 3K92A 3QWLA 1BGYJ 1KQSO 2J7NA 1L0LJ 3CC4P 4AI6A 1FZEA 4F2LA 3B5NC 3WUTA 3AEAC 3U1AA 3FUVA 2OGUA 3C9PA 1QX8A 2MKVA 3VMZA 2DAGA 1NV8A 3H1HD 4JYCA 1PJTA 1W5SA 4LY6A 4HJGH 2IBZG 5ITXA 1FZCC 4DR1M 1PJIA 5E79E 1OW7A 1BCCD 1VF5B 5IT9S 3NFQA 3CTWB 1VQ6P 4OX9M 1N78A 3L75E 1L0LE 1PJQA 4NPDA 3GLFA 4MB7A 3BCCE 1RF1B 1ZMVA 3L72E 4WVZA 2DHYA 3GQ5A 1C1KA 1NU1G 2LVNC 2W6AA 3HX3A 5KPZA 1SQBJ 1T3TA 3H1KG 3V2QA 2QIWA 4JQ0D 2Y0CA 3H32A 5E6JA 3C58A 1SS1A 1FNNA 3FX0A 2KXPB 3A5TA 1NSFA 3H1HJ 1KB9I 5IZ7D 3PH0A 2CE7A 2L4EA 3V2RA 3FKEA 1IK9A 4BWNA 1W5TA 4CGYB 3HUSA 3J7BA 3L27A 2UUAM 2E74C 4PD4I 1J1DB 1L4AD 3IECA 3PP5A 1TR8A 4AW4A 1JB0J 1VQ8P 3IAOA 4M9SA 4NPFX 3BXWA 3H1JD 1K3WA 4LF5M 3GF3A 1JMMA 3N4XA 2FXPA 1QVFO 4L76A 2D7HA 1CI6B 1K9MQ 2YKOA 2Z7JA 2J58A 2YIUB 4FWDA 2L7IA 4MGZE 1HNXM 2Z4EA 3JR4A 2ERCA 1NJGA 3ZC7B 4IL6X 2JY7A 3HTKB 5KTBA 1K05A 2GQFA 3L35A 4U3FG 4YXDC 3LVVA 5DYIA 3RGUA 3U60B 1DGHB 3WUVA 5KAFH 2IYPA 2EO2A 4KHXA 1NY5A 2XKMA 3SAVA 1SQPG 4M0WA 2A45I 3JC22 4L78A 1S5LE 1PV3A 5APYA 5KAFE 2JZ0A 5ITYA 3LCVB 2RN0A 2P1JA 2WSFJ 4DR3M 1IXSA 1EDLA 3Q1MA 1QVGO 2QRXA 3HHXA 3AECC 1G2CB 1KQLA 2HG5D 1VQ1A 2FYZA 2A45H 2ZT9C 3R4YA 2C9CA 4L16A 1IJDB 4W80A 3FUWA 4GIPA 2QSFX 4LFCM 2HR3A 4G4QA 1L2CA 1G1IA 2V7QJ 2M5ZA 1FC2C 3CLQA 3I01M 4D81A 1NAFA 3AE9C 4EIWA 4L75A 2IYOA 1KQFB 4QHSA 1EZVE 2POHA 1D7MA 3Q3DA 1SFCC 2KB7P 2R5BA 4IIWA 3RK3D 1GL2C 5AW7B 1U57A 1RE4A 3A7OA 4AG5A 1ZV8A 4EDFA 1GD2E 4B08A 3SYKA 2AHMA 2JA2A 4G4RA 3L70D 1PJSA 5CBNA 1LV7A 1IY1A 1SQQD 1BSHA 1FE6A 2DZOB 4XFJA 2WVRA 3HWSA 3BRTB 3QH9A 4AKGA 1GJSA 2WSEJ 3HE5A 2BASA 3P8CE 2EKKA 3SARA 1RF1C 1GTWA 4G3OA 1NTMK 3VMYA 1QUSA 2BWBA 3LMMA 1XB2B 2R4EA 2Y0DA 1BE3G 1U7MA 2B87B 2C96A 2BEZF 3I51A 1LT9A 3AFHA 4WURA 1J1EC 1TH3A 4PJ0H 2XNDH 3L70J 2FFDC 4N3YB 3MP7B 4KODA 4NSRA 3VDPA 2C9NY 1KFNA 3GRYA 1SQQG 2P2UA 4HKZH 3AKZA 3SC3A 3T15A 3SWKA 3HUSB 2Z5IA 5F3WA 4Z6YA 1KYOE 4H13C 3K9PA 2K9YA 3GQ4A 1HR0M 4B3SM 2IBZI 1FAVA 2ZYGA 3L72D 4I1LA 4M9XA 1CW5A 3RBZA 1H88A 2KZIA 3U6PA 4LF7M 4U3FD 3VMXA 1VG5A 4L6V6 4FWGA 1BE3D 4YPCA 3C9IA 1HGVA 1SQVJ 5CCGC 2X49A 4OVNF 1Q3CA 2QE7H 4OGQB 2XFTA 1FDIA 5C39A 4LF9M 2WWWA 1PGJA 2O5RA 1LWUC 1QZEA 3GLFB 1LTBC 1DO0A 3Q2YA 2PFXA 1JY2P 1VL2A 3HJSA 1X8YA 2B87A 3T38A 3L26A 2C0WA 1YQ3C 5CCHA 1NOHA 2NPSA 1VEGA 3L75G 4LGDE 3TYYA 1E94E 3FYDA 4DV1M 1FZGA 1MX0A 4RNAA 1URQC 3IF4A 5AVVB 1OX3A 4GH9A 3W0LB 1L0NG 4IJFA 1YJ9P 3L28A 4ANRA 4LZJA 4LF4M 3ITKA 2D2CD 1WRGA 3CCRP 2BCCJ 1QL2A 2YKQA 3SHFA 1ZR4A 1T6OA 2QZ4A 2Q2EB 4WY4B 2WTYA 1VDFA 2LHCA 3U6OA 1NTZG 1PZQA 2E43A 3K8ZA 2PAJA 2QPAA 1MFZA 2K9JB 2E76C 2FYNC 2MGWA 1IY0A 1OVVA 4WP2A 3EFFK 1N36M 2K47A 4OH8B 1OKSA 2KXEA 1M1JA 1KZUB 2WSEH 1FDMA 1RE3A 1AVYA 2HFED 4N78E 4NSOB 1NJFA 5GTIH 2EA0A 1I94M 1Q82Q 2DNAA 1LT9B 5H37D 4WB4A 3GLHA 1IXSB 4M8ZA 3VFDA 2BCCD 1WMKA 2DZLA 1OW6A 5FTNA 3RK3B 1AIPC 3H32B 1UIIA 1X0TA 1CSBA 3AL0C 4H44D 2FE8A 3CF2A 4PD4E 1S72P 1EQ7A 5FTMA 4LGMA 1JQJC 4LZZA 3B4SA 1PP9D 4MM3B 2KOGA 4HLQA 4H13D 5BU8B 3CXHD 1USEA 5L8RJ 2M5AB 1U7JA 4W7YA 5KLVG 2QENA 1LP1B 1J2JB 3M9HA 3L4FA 4LLHA 4ZKPA 4GEWA 4JI3M 2WITA 4PD4H 1RQVA 1W2BO 3M0DC 2KHHA 5DJTB 2FFDA 4DJGA 3OJAB 3SFEC 5EQTA 1EE8A 2EKFA 1N7SC 5KLVJ 1Z5BA 2OOBA 1LGHB 2V1CA 2RKOA 1KILC 2Q3EA 5GTIE 2XDJA 4WBAA 1PJJA 1PP9G 2DWLA 3V6IA 5E79H 1KFMA 2FBWC 5KLIC 1ZR2A 2DWMA 4DR2M 1NNJA 1IN7A 3GLGA 2HPCA 1HJPA 2QEXP 2CEAA 2JWAA 2OYHA 3A98B 3D8LA 2C5RA 1QLED 5EP2A 2JKVA 3JAMS 1HH0A 1N33M 2B9BA 3RL0g 1VQLP 1K82A 5M1BA 1OIZA 3OW2O 1D0KA 3FTFA 2QBYB 1QAMA 4LG2A 4GKGA 1H0TB 2KZSA 3U6DA 3BBZA 2JP7A 2DXIA 1NTZD 2QJPC 2ZJSE 4DR4M 3VDUA 3E7KA 2QJYB 4PV1C 3T1HM 1D2NA 3SMPA 3U6MA 2P10A 1Q02A 2K1AA 2ZT9D 2J5UA 1ZOYC 3PTZA 3U5ZA 3RGPA 3I4VA 5C1BA 1V92A 4NRVA 1FJPA 2KS1A 5A2QS 1KILB 2JY5A 3LW5F 1J1EB 2R62A 1Z6TA 5EXTA 1GLNA 2M60A 2KLVA 2J59M 1XXHA 4JI2M 2BWEA 1JR3E 1NTZJ 1VPCA 1EZVD 4OVZB 4AKIA 1X9VA 2B89A 1N73A 1Y47A 1HJ0A 4I5SA 1TGUA 2RRUA 5AW8B 2F5NA 4IFDK 4CIZA 4MGYE 5ITRA 3EQ2A 2XU6A 2BNKA 1SQBE 3TGUD 3HGIA 2FKWB 2XEPA 3EWKA 1MZ9A 5KLVK 1YLAA 5KPRA 5KQ8A 1GL2B 4HEOA 3PHLA 4LJ7A 3U59A 2YMKA 2CHGA 2KZJA 2FH0A 3B7ZA 2HAKA 4RF1A 3E9SA 2K0BX 3L70E 4L8RC 2FXMA 2ZT9B 2AEFA 2M8RA 1VQKP 4QOSA 2FYNB 3M0DA 1SP4A 3EIEA 3GLGB 4EIJA 3UK6A 2OARA 4IBDA 1SQXD 1IN5A 3SAUA 1BDDA 1S9KD 1DGBA 3L74D 3NTNA 1GKIA 4NXNM 4AUWA 1YTZT 3A0BE 2KI7B 1IN8A 1G41A 1XMQM 2FXOA 2NPSB 3IFMA 1SQBD 1MV8A 4KT0J 3A3YB 1TU3F 2EJSA 3HU2A 2F5OA 1NU1D 2R4JA 4ASVA 2KA6B 4IL6E 2UXCM 1SQXJ 3EIHA 5B5EH 1LTSC 3WU2E 1NGMB 2KNZA 3CX5E 1R4GA 5CCHC 1OLME 3KDPB 3WHLA 1P84E 2WT7A 2FYUE 1R8EA 3HJ8A 4LF6M 3GLMA 2L6OA 3A2AA 3H1LG 2JXNA 2JZ1A 3KOWE 5AW2B 2Q9IA 2E74B 2FNAA 3M91A 2CV2A 3GHGA 5GTHH 3L29A 2KSJA 1VQ4P 2BJWA 2OPFA 5AW1B 1G4AE 4D80A 2N9BA 3BOSA 3SASA 2R44A 3S9OA 3Q5SA 1JY2N 3KVWA 2R32A 2DENA 1S2EA 2O01F 3A42A 5KPTA 4ZMDA 3IG8A 3KS8A 3C3EA 4KLNA 1N7SB 2WPRA 1NH4A 4GIFA 2UU9M 4N6JA 3FGAD 1OAOC 1IM2A 3CCMP 1QZMA 2GUVA 4K35A 2LHGA 3FTCA 2A06D 3HKPA 1Q3BA 5KJ7D 4QNRA 3V4QA 1SQVK 2EUCA 4N78D 4J7PA 2I1JA 3VP9A 1R6BX 1PPJE 3AEGC 1E5WA 1NO1A 2W27A 3CF6E 2X4AA 4KJMA 3MIWA 3FE3A 2LKMA 3KYQA 3AOGA 1PGYA 2BEQD 3AE4C 2Y0TA 5DNYA 3VN0A 1IXRC 2A5YB 1NTKK 3USSA 3HE4B 4B3TM 3P8MC 2AEJA 4IBFA 1OZHA 3AEEC 2WSEF 4EOTA 4BRYA 1T3JA 2KNCA 1K04A 2NRGA 3RBXA 2H89C 4WY4D 1R2ZA 5FTKA 1MJGM 2JWDA 4LJAA 3C1LA 2D2CB 2E75D 2AEMA 2JY8A 3ZQJA 3F5HA 5CMZA 5KAIE 4MGKE 1PIXA 2FY8A 3TGUE 3RL0B 3T97A 1GU4A 1T43A 2HHHM 2D7EA 5KLVE 1J5EM 1KB9H 3W0FA 3LIEA 3O6QA 2VF8A 1N34M 3L71G 2MH8A 1NHGC 2HL7A 4LRTA 2JDIH 4LFAM 1URQB 1VQ5P 4GT1A 5B66E 1NTKD 2XGNA 1RF0A 2L2DA 1LP1A 5DJUB 3RK2D 2KYVA 1N7SD 4NRWA 1FZAA 1KFVA 1L2DA 2E5YA 1G8PA 4OGQD 3IR9A 3RK2B 3GLFE 1X22A 3C3DA 2D4QA 3KP0E 1L0LG 4GDOA 2ZAMA 3L72G 2P58A 1URQD 2LVPC 4ZKUA 4WW0A 2C98A 5EXPA 4RJTA 5KKZB 2HKJA 4MN4C 3VYIA 1SXJA 1XWIA 2YNMD 3I5CA 3A46A 2NZ2A 4D82A 1TH4A 2OO9A 1OFHA 3H1HG 3AE5C 3FWNA 4JV5M 2Y9ZA 1FJKA 5EP1A 2AXTH 2M3EA 1K73Q 3KW6A 1GJTA 1WJ7A 1JR3D 2K9DA 5ITQA 1SQQJ 4Q7JA 2V6ZM 4Y99B 1OJLA 3HHWA 1S5LH 1TH2A 4BLCA 3GPXA 3GPYA 4K0KM 1OW8A 4I2LC 5AW3B 1ORYB 4REZA 2B88A 3GRVA 3V5BA 3H1KJ 1MFTA 4IOIH 4NC6A 2GUSA 2I1KA 4IBEA 3SFZA 1DIPA 1T8ZA 1P84H 2R46A 5CHXA 3KSJA 3EFGA 5AW0B 3A0HE 2OTJP 4IBIA 1YYCA 3S1KA 2C0XA 1DGHA 2LXEA 2IX7C 3TSIA 2ZFCA 3NWLA 3HD7C 3P7ZA 3HHYA 3VP8A 1KYOI 2KSEA 3NBIA 3WUUA 4FMMA 2QQ8A 2JUJA 4U3FE 1DV0A 4GC9A 1NTMJ 1KTMA 1BE3E 3L36A 5KJ7A 3A0BH 3GLHE 1CI6A 3FUUA 4IBGA 3MGNA 5K5GB 1AJYA 2SPZA 1JOCA 1YIJP 3L73J 4II7A 4BBAA 2XSZD 4DR5M 1CZQA 2VF7A 4HL4A 1R5LA 3B7NA 1IC2A 1RQUA 3CC2P 1HJBA 4UB8E 3G6EP 2LVOC 1TDHA 2E5LM 1YSYA 1NTME 5AVSB 1VEKA 2N1TA 4MGHA 1QDRA 1YQ4C 3CWBD 2UXBM 4IL6H 2UWJE 1XC8A 2FYUJ 2KW0A 1MUUA 5EXSA 4A7PA 3R9XB 1SVFA 5E26A 4PDIA 3UJNA 4YHHM 2Y0EA 3VTPC 2OYHB 2QVAA 3IN6A 5IWAM 3L73D 2GM4A 4NXMM 2QM8A 3H1LD 1FOSE 4JPZB 3GLGE 1BDCA 1Z5CA 5EP4A 2YXQB 2W90A 1Q7YQ 4JI5M 1Y8GA 3RK3C 2RKLA 1LTMA 1IBKM 4UB6E 1HTLC 2N35A 3L2AA 3QAUA 4DV6M 1MKMA 1EDKA 1PGOA 1LTJC 2I7PA 3D71A 4HYTB 3RK2C 2HWJA 1ZQ9A 1RH5B 5B66H 3I55P 2RH0A 1JUNA 4P17A 3II6A 3HE4A 1A02F 4J7QA 4L15A 2GA1A 1L1ZA 3RK3E 3I56P 2R45A 2JJLA 5C18A 1FDOA 3S4RA 1XXHB 4D6TD 2ITAA 3KP1E 1SQQE 4OMJA 3CCEP 3H1JJ 4JF7A 1NTZE 3E4RA 3NBXX 3L71J 2FYUG 3MUDA 3ILKA 4XK8F 1LWUB 2QJKC 1URQA 3H1LE 1BCCE 2E2XA 1NKNA 1OQYA 3TGUG 1PP9J 1SQVG 2XNXA 3D8BA 3DOAA 1HNZM 1JTHA 1AA0A 2VDBB 3L71E 3GLIE 4D6TJ 1VQMP 2J5YA 4PV1B 1XTCC 4X65M 1NWQA 2QJPB 3SMSA 1LT1A 1M56D 2RGHA 1IFMA 3AJIB 4H0LC 1JEKA 3C8VA 3CMEP 3QYEA 1KYOH 3FWLA 4OGQC 3K5BA 3HU1A 4C46A 4LF8M 2KEBA 1DD3A 3TL4X 2LR2A 2CHQA 4I4LA 1FZCB 4NL4H 4JYBA 3M0AA 1LTGC 3NMDA 2L09A 5KJ7C 1UIXA 3WHKA 4PJ0E 3QWOC 1H89A 1L0NJ 2V4HA 2A06E 2K6BA 1H8AA 3M0EA 2H88C 4GC5A 1Z56A 3PFIA 4BXLA 5TISE 1GMJA 3CGWA 4H44B 2ZYDA 3QYBA 2O01J 5GTHE 4GODA 2N1TC 2OTLP 1J09A 3TGUJ 1DGFA 1JY3O 1L8QA 1P3QQ 1OLMA 3U1CA 1FOSF 4JN6A 2Q3IA 1EXJA 1SFCB 4D6TG 1IN4A 2QBYA 3F92A 2R3CA 1PGPA 2DWNA 4G4OA 4ASWA 1JY3P 1UM8A 3P32A 1SQXE 2Y0QA 3V76A 3SHGB 4AQRD 4PD2A 3CC7P 1BGYE 2Q1KA 1ZW0A 1NTKE 3FD9A 4I7ZC 1IFNA 3PRJA 3KQGA 1CUKA 2ZVOB 3VK8A 3GP1A 1WGLA 3GLHB 4A3VB 3JSVC 3U6CA 3CL3D 4GMQA 2CWBA 1QDTA 3LQRA 4AZFA 4PT5A 1LTJA 1YJWP 1KV4A 1SQPJ 3KZIE 3H1ID 1KMIZ 3A0HH 4R4MA 2E76D 2NPSC 4B3RM 1G71A 2CV0A 1M1JB 1QAQA 3CX5I 5EFWB 4K3AA 4RKUJ 4OW0A 2Q6QA 3U6EA 2ZXEB 1SQQK 3U6SA 2O25A 2W83C 5APSA 4LJ8A 2M3BA 1BE3J 2OYIC 2IBZD 5CBOA 3CX5H 4IFMA 3SWFA 3H1HE 1BCCJ 3J80S 3MUDC 3PJSK 1N86A 4WY4C 3L73E 1PP9E 3B8EB 1HVVA 4Y28J 1M1JC 4L4UA 2DAEA 3DZDA 1TDZA 2E42A 5KO3A 3U61A 3GMAA 3UZUA 3L25A 2Z5HA 3J7AS 2G3AA 1XTGB 1SG9A 2O01H 2Y9YA 2L4FA 3L74G 4IBBA 2VIIA 2F5SA 5CJ4A 2YIUC 2R6FA 1N75A 3KFUG 1EXIA 3T97B 4KT0F 2W6BA 1FZFA 2YNYA 3TWMA 5IREB 1XMOM 2LTUA 3KDSE 2KP8A 1FZCA 1Q81Q 5BU5A 4OU7A 2M0BA 2QJYC 3GLIA 1JCDA 3HZJA 4W7ZA 3TWKA 4FCWA 4QNMA 4GITA 5H2FE 1SXJD 1G1JA 3GPUA 4TT3H 4R3DA 3KOZE 3CI9A 1GL6A 3GLIB 3JCUE 3LVWA 4B7HA 4C7NB 4NOOB 1NU1J 2H43A 2G5GX 1GVNA 1N73B 1DGGA 3PNVA 3WMM0 3AE2C 4H0LB 3Q5RA 2O1KA 1KD1Q 3T6PA 3G9RA 1JTHB 1KILA 3ZDMA 1FBMA 5H2FH 2OTKE 5APXA 1NY6A 1NYHA 1JO5A 4DBGB 1R7RA 4CJ6A 4CISA 1FJGM 3U5ZB 1L2PA 3HUSC 2VQEM 5JI2E 3CCUP 1HGZA 2APLA 1J7KA 2QG4A 3DA1A 2JR8A 2KDLA 1ZP0C 2WSCF 5CCHD 3FYCA 4FVMA 3IHPA 1XXHE 3RGSA 4PDGA 1KB9D 1F4IA 1JY3N 2ZM6M 1QANA 2Z8YM 3VLFB 3N7NA 1ZMWA 3U60A 2IZ1A 1NHLA 1Q90D 5AVWB 5ITXE 3D6YA 2ZTDA 2UXDM 3A45A 2XF3A 3HU3A 2CHVA 1EDJA 2R0IA 4LCBA 3HTKA 4DV3M 3FRIA 2YO3A 5KKZC 1QAOA 5BVZA 4C7RA 1ZN5A 2I8DA 1YUBA 5KAIH 1M1KQ 4EYYQ 5EP3A 4AQYM 1YI2P 3V2NA 1QVRA 5APWA 2JO1A 3KXDA 2V1UA 1USDA 5EJCA 3JCUH 4ZPXA 2ZAEB 2KK7A 3HD7D 3L70G 1NNUC 1NU1K 2BJVA 4DUYM 2R18A 3CCJP 3OA7A 2QNJA 2DAIA 1L1TA 2Y21A 2HODA 2QJKB 4CHTB 2IZ0A 4H0LD 2DVWB 1QL1A 3BASA 1LTJB 3GHGC 1L4AA 1IFYA 4B7FA 4UB8H 3ZCBB 2E75B 2MROB 1OIPA 1IBMM 1WHCA 2CPBA 1BSNA 4YY3M 4KHPM 4WY4A 1SXJB 1HBWA 2LXCB 3P8CD 5JI3E 2HYNA 4IBCA 3CXHE 1GABA 4FCVA 3KZIH 3FTEA 4EI2A 1OFIA 4LFBM 2YQZA 4DR7M 2O3JA 2YMYA 4D6TE 3B5NA 1NTZK 4RESB 4LJ6A 2CK3H 2WSCH 1SQVE 1ZRTE 4JI8M 2XFSA 2IFMA 5ITUA 5APQA 3PEGA 1Z5AA 2C99A 2FOIC 4M9ZA 1FU1A 1ZXGA 1WR1B 1HWTC 2E75C 1S9KE 2DW3A 2OQQA 3TNUA 4MGIE 3PLNA 1BVSA 4M3LA 4S12A 1X37A 2JY6B 4LJ4A 5AW5B 2YO2A 1LJ2A 5LMNM 3AE6C 4JBZA 4AKHA 3U6LA 1NTKJ 3BVHA 2F4VM 1SQVD 3HE5B 2KNVA 4GHAA 2K88A 1JY2O 4I7ZB 2DAKA 3B5ND 4DT0A 4JI0M 1VQOP 2IBZE 1W2EA 1DEEG 3MMPA 3Q5PA 3RE8A 2K3RA 3TWLA 3SATA 2O1JA 1QUTA 5AVUB 4JI7M 3H4JA 1SQPE 2WMMA 3H1JG 3O8ZA 1L0LD 1J1DC 3FUTA 3CX5D 2YFQA 1NTMD 3GHGB 2LVQD 1P84D 1XNQM 2XZRA 4IJEA 1N77A 4JI1M 1I4WA 3H1KE 4BRYB 5TJHA 3H1IE 4PV1D 4PD4D 4H44C 1HNWM 3SYLA 3FTDA 1PPJG 4LGYA 1IY2A 5FTJA 3CPWO 3ZH9B 2KIKA 3CXHH 3VMAA 1SLQA 1RF0C 1E79H 1KILD 1V34A 3H1KD 2FYUD 3TNUB 1T2KD 2B3TA 4DR6M 1DEBA 1SQXG 2LXBA 2XZUA 4DOJA 1N8RQ 4OMKA 1LWUA 2O01N 2H5XA 1S5LX 4B86A 1JB0F 2NPSD 1NTKG 3HY5A 5EXXA 2DI0A 3LIDA 2P67A 1VF5C 2XZFA 1S3JA 2VRSA 3H1LJ 1SQXK 2XSZA 1PL5A 3CF0A 1VQNP 1IFJA 1M8OB 1EZVI 4Z1MH 1NO4A 1R2YA 2OYIA 1O6UA 1SQBK 1YBKA 1XHBA 3TQSA 3M6AA 2OOAA 5KQDA 7CATA 1Q39A 1WXQA 1ZMUA 1G59A 1E9RA 3P7KA 5APTA 3L37A 3B9PA 2ZYAA 1W5CE 3KOYE 2WSSH 4IBJA 2YKPA 2IPPA 2JWSA 2W8ZA 1UFZA 2DAMA 1KILE 4OWFA 1GK6A 2WSCJ 2ZTCA 1N32M 1MU5A 2FFJA 4JYAM 2HLOA 2WPQA 2QM7A 3L71D 1RU3A 5BR8M 2G8YA 3HD7A 3MK6A 3U6QA 3GQ3A 1DX7A 2ZAOA 2WQYC 2D2CC 3L74E 3L75D 2CFOA 3AE3C 1V33A 2DWZB 2WPVB 2WZJA 1X79B 1OFCX 1VDLA 1S4XA 2M5AA 2A45G 2BCCE 8CATA 1NJIQ 2ZANA 1E32A 1LT9C 2K37A 2DKLA 1KORA 2KUBA 3CWBG 5AW6B 1WGNA 1QGKB 4DV2M 1PGQA 2CV1A 3MTUE 2Q5UA 2E5TA 1HT1E 1PPJD 4GKJM 5DYGA 1LTTC 4HB1A 4YXWH 3OAKA 5AVRB 3L75J 2I7NA 3CXHI 3NXSA 3O6QB 3GRRA 1YTZI 3GF7A 2JEEA 4TUWA 1JMBA 5AVYB 1N7SA 1VDDA 5AW9B 3PXGA 1DO2A 3WU2H 1JM0A 2R65A 4M0DA 5ITTA 4NPEA 1ZRTD 4UB6H 5CCGA 2Y20A 4I8OA 3AV0A 2PGDA 3AEDC 3VKGA 2ZVNB 4IFFA 3MHVA 1PM5A 1KYOD 3CCSP 1EDIA 1G3IA 5AVQB 1S3SA 4UN2B 1NKZB 3I04M 4LRSA 4X66M 4FD2A 3SSUA 1AQTA 2KLUA 1A02J 2N1TB 4LJ9A 4OVZA 3AOEA 1IK7A 3G71P 4DCKA 4RO0A 2L91A 4YTPC 3UIAA 2XLJA 2F5QA 3D6ZA 1AVOA 5CCGD 1LTIC 3HD7B 1QYRA 3M7GA 1NTMG 3J27B 1IFPA 1M57D 4U3FJ 1L4AC 2KRUA 3K1JA 3B74A 4CPGA 5GKNA 4GKKM 5B5EE 4P16A 3G3ZA 2P5TA 1A5TA 4X64M 1OVUA 1NAYA 1ZAEA 3T1YM 3SFDC 2RGOA 4W5WA 4DV4M 2LBCA 3PG7A 3B5NB 2KRKA 1L0ND 4R4LA 4H13B 2MJZA 1VQ7P 1WIVA 2JNHA 4Y28F 4PCZA 3UGJA 3OTOM 2HCBA 1RE3C 1K3XA 1NV9A 2MJ5B 1FS0E 2XV5A 4R71A 3H1IG 2FS1A 3GRUA 2VQFM 3GO8A 4G6ZA 1PFIA 5FSWA 2CPSA 4DV0M 3J2PB 1SQPK 4ZNCA 2ZXXA 4LC1A 3KS4A 5DFLA 2W6JH 2V7QH 3BCCG 4IBKA 1GU5A 2WT7B 1HQYE 2Z4SA 4QHTA 4DUZM 1AQ5A 2A06G 2HODB 1C7YA 3THGA 3L74J 4RKUF 1NU1E 3TPZA 2NQ8C 4XA4A 4R7GA 3FXEA 1Y9BA 1IQPA 1EIJA 4GHLA 1KQGB 1QQWA 2H1RA 2MR9A 5FLXS 1E9SA 2WSFH 1M90Q 3VK7A 2K9JA 5AVTB 3L72J 1IXZA 5TISH 1T3UA 3JR5A 4TLGA 4F1IA 4MH0E 2CRUA 3W67A 3U61B 1Q86Q 3W68A 1OAIA 1VEJA 1DD4A 3J81S 5LMUM 1BCCG 3GPPA 2CUZA 3LQQA 3B71A 1GL7A 1VQ9P 1YE9A 3FXDA 3CD6P 1ZLLA 3SBJA 3H25A 4XE5B 3K2LA 2QSIA 5BPVA 4TLFA 3DFZA 4QMAA 1GDTA 2WPSA 2L7HA 4C7NA 1WT6A 3B89A 1GK4A 1IBLM 2KZUA 2N9YB 2H7HA 3H1JE 4I81A 4XBOA 1JNMA 1HUCA 1D0MA 4GOEA 3V4WA 2OYHC 1KSFX 2OQ4A 1GO5A 3LW5J 2OYOA 3GW6A 3BCCJ 1FZBA 1KYIA 3D70A 1AUAA 4LJ5A 1JR3A 3UMMA 1OTRA 1KB9E 5AVXB 4U7JA 3MJ5A 2QP9X 1H0TA 5FTLA 2UUCM 3F89A 3LW5H 3CWBJ 2LNHC 3AE1C 3AEFC 3AOEC 1KC8Q 2QCUA 4BB9A 4JI6M 3CCVP 1YJNP 1HQCA 2E74D 3VOPA 2CP8A 5L8RF 3BRVB 2J7OA 5CJ0A 5KLVD 4DZOA 1HF9A 2Z4RA 2UUBM 1JCCA 1YHQP 4RF0A 3CMAP 3HJQA 3I4YA 3R2PA 2LWXA 4FWHA 1AFOA 2BCCG 2W82A 3BCCD 3L73G 1Z59A 2KNAA 2LVAA 4AG6A 2HPCB 1ZMEC 3RL0D 4G4NA 3CWBE 3TK1A 3K9OA 1H6UA 1P84I 4O9BA 1HT2E 5APVA 1EZVG 3TE6A 4Z8XA 2WZ7A 3PNYA 3E1IA 2Z3XA
chains in the Genus database with same CATH topology
4FMMA 4M8ZA 4J7QA 4UYBA 1OIZA 4CIZA 2E2XA 1AUAA 3B74A 3B7ZA 3HX3A 4TLGA 4J7PA 4CJ6A 1OLME 3W67A 2D4QA 3W68A 1O6UA 4OMJA 3B7QA 3PG7A 3P7ZA 4OMKA 1OIPA 1R5LA 3B7NA 3Q8GA 3PEGA 1OLMA 3HY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FMM A;  4M8Z A;  4J7Q A;  4UYB A;  1OIZ A;  4CIZ A;  2E2X A;  1AUA A;  3B74 A;  3B7Z A;  3HX3 A;  4TLG A;  4J7P A;  4CJ6 A;  1OLM E;  3W67 A;  2D4Q A;  3W68 A;  1O6U A;  4OMJ A;  3B7Q A;  3PG7 A;  3P7Z A;  4OMK A;  1OIP A;  1R5L A;  3B7N A;  3Q8G A;  3PEG A;  1OLM A;  3HY5 A; 
#chains in the Genus database with same CATH topology
 2Q7C A;  1M7L A;  3SAW A;  3E46 A;  2ZBK B;  5KLI B;  3HRN A;  1D0L A;  1AV1 A;  3H6P A;  1L0L K;  3H4M A;  3LCU A;  1BGY G;  3M06 A;  3M9B A;  2RMZ A;  1N73 C;  1MN3 A;  2FFD B;  2G8L A;  3E21 A;  2QHO B;  4L73 A;  3FRH A;  2C9L Y;  3PVS A;  1RY3 A;  1EFU B;  1L4A B;  1GL2 A;  1SFC D;  1Y8A A;  2X8A A;  3IG5 A;  1IO4 A;  4HH2 A;  4FW9 A;  3SWY A;  4GRI A;  1OWA A;  1GZL A;  4UYB A;  2D7G A;  1N7L A;  2AXC A;  1QEX A;  5APU A;  4KO8 A;  1NHW C;  4AYC A;  3TDK A;  1T2K C;  1SQB G;  2IDB A;  1GW3 A;  1RF1 A;  5AW4 B;  4JXJ A;  2PRR A;  1T6A A;  3ABV C;  3CCL P;  3M9Q A;  3MD0 A;  1DH3 A;  3VKH A;  1VF5 D;  1G2C A;  3MZW B;  2KS1 B;  1IN6 A;  1IFD A;  2AXT E;  4Y99 C;  3KSX A;  2XH9 A;  4B7G A;  2KNC B;  3KHU A;  2QA4 P;  3AE8 C;  3CCQ P;  2YR0 A;  3R8F A;  3BAT A;  3G4S P;  2R5D A;  2DZN B;  1TF0 B;  2E76 B;  4WWI A;  2YXR B;  2OYI B;  3MHV C;  1IZN B;  4DV5 M;  2N1T D;  2F5P A;  2IFN A;  1S1C X;  3TF5 A;  1LTA C;  1PRB A;  2C9O A;  1NVO A;  2FYU K;  1XNR M;  3RFW A;  3HHZ A;  1N2D C;  3GG2 A;  1OXZ A;  4XGI A;  3KXE C;  4L74 A;  3KOX E;  3V2P A;  2H8P D;  1LNQ A;  1K8A Q;  1YIT P;  4B3M M;  1OVR A;  1IFI A;  1L0N E;  1ZV1 A;  2L5G B;  1L2B A;  1SXJ C;  2WSF F;  1KN7 A;  3FUX A;  3KPE A;  2LH0 A;  3AEB C;  3AE7 C;  1BGY D;  4I6M C;  3Q8X A;  4QOZ C;  4DV7 M;  1VQP P;  3Q8G A;  1RHZ B;  2DHR A;  2P7J A;  1L0N K;  1OMI A;  3RL0 C;  2GNO A;  1Q2N A;  4FCT A;  1GW4 A;  4JI4 M;  2R3S A;  4ITQ A;  4GOF A;  1TTE A;  1SXJ E;  1R5S A;  2PP6 A;  2G3Q A;  2JP3 A;  1NVM A;  1GL2 D;  1SFC A;  1SQP D;  5AVZ B;  3H1I J;  3B7Q A;  4X62 M;  3E1R A;  1EC5 A;  1RE4 C;  3K92 A;  3QWL A;  1BGY J;  1KQS O;  2J7N A;  1L0L J;  3CC4 P;  4AI6 A;  1FZE A;  4F2L A;  3B5N C;  3WUT A;  3AEA C;  3U1A A;  3FUV A;  2OGU A;  3C9P A;  1QX8 A;  2MKV A;  3VMZ A;  2DAG A;  1NV8 A;  3H1H D;  4JYC A;  1PJT A;  1W5S A;  4LY6 A;  4HJG H;  2IBZ G;  5ITX A;  1FZC C;  4DR1 M;  1PJI A;  5E79 E;  1OW7 A;  1BCC D;  1VF5 B;  5IT9 S;  3NFQ A;  3CTW B;  1VQ6 P;  4OX9 M;  1N78 A;  3L75 E;  1L0L E;  1PJQ A;  4NPD A;  3GLF A;  4MB7 A;  3BCC E;  1RF1 B;  1ZMV A;  3L72 E;  4WVZ A;  2DHY A;  3GQ5 A;  1C1K A;  1NU1 G;  2LVN C;  2W6A A;  3HX3 A;  5KPZ A;  1SQB J;  1T3T A;  3H1K G;  3V2Q A;  2QIW A;  4JQ0 D;  2Y0C A;  3H32 A;  5E6J A;  3C58 A;  1SS1 A;  1FNN A;  3FX0 A;  2KXP B;  3A5T A;  1NSF A;  3H1H J;  1KB9 I;  5IZ7 D;  3PH0 A;  2CE7 A;  2L4E A;  3V2R A;  3FKE A;  1IK9 A;  4BWN A;  1W5T A;  4CGY B;  3HUS A;  3J7B A;  3L27 A;  2UUA M;  2E74 C;  4PD4 I;  1J1D B;  1L4A D;  3IEC A;  3PP5 A;  1TR8 A;  4AW4 A;  1JB0 J;  1VQ8 P;  3IAO A;  4M9S A;  4NPF X;  3BXW A;  3H1J D;  1K3W A;  4LF5 M;  3GF3 A;  1JMM A;  3N4X A;  2FXP A;  1QVF O;  4L76 A;  2D7H A;  1CI6 B;  1K9M Q;  2YKO A;  2Z7J A;  2J58 A;  2YIU B;  4FWD A;  2L7I A;  4MGZ E;  1HNX M;  2Z4E A;  3JR4 A;  2ERC A;  1NJG A;  3ZC7 B;  4IL6 X;  2JY7 A;  3HTK B;  5KTB A;  1K05 A;  2GQF A;  3L35 A;  4U3F G;  4YXD C;  3LVV A;  5DYI A;  3RGU A;  3U60 B;  1DGH B;  3WUV A;  5KAF H;  2IYP A;  2EO2 A;  4KHX A;  1NY5 A;  2XKM A;  3SAV A;  1SQP G;  4M0W A;  2A45 I;  3JC2 2;  4L78 A;  1S5L E;  1PV3 A;  5APY A;  5KAF E;  2JZ0 A;  5ITY A;  3LCV B;  2RN0 A;  2P1J A;  2WSF J;  4DR3 M;  1IXS A;  1EDL A;  3Q1M A;  1QVG O;  2QRX A;  3HHX A;  3AEC C;  1G2C B;  1KQL A;  2HG5 D;  1VQ1 A;  2FYZ A;  2A45 H;  2ZT9 C;  3R4Y A;  2C9C A;  4L16 A;  1IJD B;  4W80 A;  3FUW A;  4GIP A;  2QSF X;  4LFC M;  2HR3 A;  4G4Q A;  1L2C A;  1G1I A;  2V7Q J;  2M5Z A;  1FC2 C;  3CLQ A;  3I01 M;  4D81 A;  1NAF A;  3AE9 C;  4EIW A;  4L75 A;  2IYO A;  1KQF B;  4QHS A;  1EZV E;  2POH A;  1D7M A;  3Q3D A;  1SFC C;  2KB7 P;  2R5B A;  4IIW A;  3RK3 D;  1GL2 C;  5AW7 B;  1U57 A;  1RE4 A;  3A7O A;  4AG5 A;  1ZV8 A;  4EDF A;  1GD2 E;  4B08 A;  3SYK A;  2AHM A;  2JA2 A;  4G4R A;  3L70 D;  1PJS A;  5CBN A;  1LV7 A;  1IY1 A;  1SQQ D;  1BSH A;  1FE6 A;  2DZO B;  4XFJ A;  2WVR A;  3HWS A;  3BRT B;  3QH9 A;  4AKG A;  1GJS A;  2WSE J;  3HE5 A;  2BAS A;  3P8C E;  2EKK A;  3SAR A;  1RF1 C;  1GTW A;  4G3O A;  1NTM K;  3VMY A;  1QUS A;  2BWB A;  3LMM A;  1XB2 B;  2R4E A;  2Y0D A;  1BE3 G;  1U7M A;  2B87 B;  2C96 A;  2BEZ F;  3I51 A;  1LT9 A;  3AFH A;  4WUR A;  1J1E C;  1TH3 A;  4PJ0 H;  2XND H;  3L70 J;  2FFD C;  4N3Y B;  3MP7 B;  4KOD A;  4NSR A;  3VDP A;  2C9N Y;  1KFN A;  3GRY A;  1SQQ G;  2P2U A;  4HKZ H;  3AKZ A;  3SC3 A;  3T15 A;  3SWK A;  3HUS B;  2Z5I A;  5F3W A;  4Z6Y A;  1KYO E;  4H13 C;  3K9P A;  2K9Y A;  3GQ4 A;  1HR0 M;  4B3S M;  2IBZ I;  1FAV A;  2ZYG A;  3L72 D;  4I1L A;  4M9X A;  1CW5 A;  3RBZ A;  1H88 A;  2KZI A;  3U6P A;  4LF7 M;  4U3F D;  3VMX A;  1VG5 A;  4L6V 6;  4FWG A;  1BE3 D;  4YPC A;  3C9I A;  1HGV A;  1SQV J;  5CCG C;  2X49 A;  4OVN F;  1Q3C A;  2QE7 H;  4OGQ B;  2XFT A;  1FDI A;  5C39 A;  4LF9 M;  2WWW A;  1PGJ A;  2O5R A;  1LWU C;  1QZE A;  3GLF B;  1LTB C;  1DO0 A;  3Q2Y A;  2PFX A;  1JY2 P;  1VL2 A;  3HJS A;  1X8Y A;  2B87 A;  3T38 A;  3L26 A;  2C0W A;  1YQ3 C;  5CCH A;  1NOH A;  2NPS A;  1VEG A;  3L75 G;  4LGD E;  3TYY A;  1E94 E;  3FYD A;  4DV1 M;  1FZG A;  1MX0 A;  4RNA A;  1URQ C;  3IF4 A;  5AVV B;  1OX3 A;  4GH9 A;  3W0L B;  1L0N G;  4IJF A;  1YJ9 P;  3L28 A;  4ANR A;  4LZJ A;  4LF4 M;  3ITK A;  2D2C D;  1WRG A;  3CCR P;  2BCC J;  1QL2 A;  2YKQ A;  3SHF A;  1ZR4 A;  1T6O A;  2QZ4 A;  2Q2E B;  4WY4 B;  2WTY A;  1VDF A;  2LHC A;  3U6O A;  1NTZ G;  1PZQ A;  2E43 A;  3K8Z A;  2PAJ A;  2QPA A;  1MFZ A;  2K9J B;  2E76 C;  2FYN C;  2MGW A;  1IY0 A;  1OVV A;  4WP2 A;  3EFF K;  1N36 M;  2K47 A;  4OH8 B;  1OKS A;  2KXE A;  1M1J A;  1KZU B;  2WSE H;  1FDM A;  1RE3 A;  1AVY A;  2HFE D;  4N78 E;  4NSO B;  1NJF A;  5GTI H;  2EA0 A;  1I94 M;  1Q82 Q;  2DNA A;  1LT9 B;  5H37 D;  4WB4 A;  3GLH A;  1IXS B;  4M8Z A;  3VFD A;  2BCC D;  1WMK A;  2DZL A;  1OW6 A;  5FTN A;  3RK3 B;  1AIP C;  3H32 B;  1UII A;  1X0T A;  1CSB A;  3AL0 C;  4H44 D;  2FE8 A;  3CF2 A;  4PD4 E;  1S72 P;  1EQ7 A;  5FTM A;  4LGM A;  1JQJ C;  4LZZ A;  3B4S A;  1PP9 D;  4MM3 B;  2KOG A;  4HLQ A;  4H13 D;  5BU8 B;  3CXH D;  1USE A;  5L8R J;  2M5A B;  1U7J A;  4W7Y A;  5KLV G;  2QEN A;  1LP1 B;  1J2J B;  3M9H A;  3L4F A;  4LLH A;  4ZKP A;  4GEW A;  4JI3 M;  2WIT A;  4PD4 H;  1RQV A;  1W2B O;  3M0D C;  2KHH A;  5DJT B;  2FFD A;  4DJG A;  3OJA B;  3SFE C;  5EQT A;  1EE8 A;  2EKF A;  1N7S C;  5KLV J;  1Z5B A;  2OOB A;  1LGH B;  2V1C A;  2RKO A;  1KIL C;  2Q3E A;  5GTI E;  2XDJ A;  4WBA A;  1PJJ A;  1PP9 G;  2DWL A;  3V6I A;  5E79 H;  1KFM A;  2FBW C;  5KLI C;  1ZR2 A;  2DWM A;  4DR2 M;  1NNJ A;  1IN7 A;  3GLG A;  2HPC A;  1HJP A;  2QEX P;  2CEA A;  2JWA A;  2OYH A;  3A98 B;  3D8L A;  2C5R A;  1QLE D;  5EP2 A;  2JKV A;  3JAM S;  1HH0 A;  1N33 M;  2B9B A;  3RL0 g;  1VQL P;  1K82 A;  5M1B A;  1OIZ A;  3OW2 O;  1D0K A;  3FTF A;  2QBY B;  1QAM A;  4LG2 A;  4GKG A;  1H0T B;  2KZS A;  3U6D A;  3BBZ A;  2JP7 A;  2DXI A;  1NTZ D;  2QJP C;  2ZJS E;  4DR4 M;  3VDU A;  3E7K A;  2QJY B;  4PV1 C;  3T1H M;  1D2N A;  3SMP A;  3U6M A;  2P10 A;  1Q02 A;  2K1A A;  2ZT9 D;  2J5U A;  1ZOY C;  3PTZ A;  3U5Z A;  3RGP A;  3I4V A;  5C1B A;  1V92 A;  4NRV A;  1FJP A;  2KS1 A;  5A2Q S;  1KIL B;  2JY5 A;  3LW5 F;  1J1E B;  2R62 A;  1Z6T A;  5EXT A;  1GLN A;  2M60 A;  2KLV A;  2J59 M;  1XXH A;  4JI2 M;  2BWE A;  1JR3 E;  1NTZ J;  1VPC A;  1EZV D;  4OVZ B;  4AKI A;  1X9V A;  2B89 A;  1N73 A;  1Y47 A;  1HJ0 A;  4I5S A;  1TGU A;  2RRU A;  5AW8 B;  2F5N A;  4IFD K;  4CIZ A;  4MGY E;  5ITR A;  3EQ2 A;  2XU6 A;  2BNK A;  1SQB E;  3TGU D;  3HGI A;  2FKW B;  2XEP A;  3EWK A;  1MZ9 A;  5KLV K;  1YLA A;  5KPR A;  5KQ8 A;  1GL2 B;  4HEO A;  3PHL A;  4LJ7 A;  3U59 A;  2YMK A;  2CHG A;  2KZJ A;  2FH0 A;  3B7Z A;  2HAK A;  4RF1 A;  3E9S A;  2K0B X;  3L70 E;  4L8R C;  2FXM A;  2ZT9 B;  2AEF A;  2M8R A;  1VQK P;  4QOS A;  2FYN B;  3M0D A;  1SP4 A;  3EIE A;  3GLG B;  4EIJ A;  3UK6 A;  2OAR A;  4IBD A;  1SQX D;  1IN5 A;  3SAU A;  1BDD A;  1S9K D;  1DGB A;  3L74 D;  3NTN A;  1GKI A;  4NXN M;  4AUW A;  1YTZ T;  3A0B E;  2KI7 B;  1IN8 A;  1G41 A;  1XMQ M;  2FXO A;  2NPS B;  3IFM A;  1SQB D;  1MV8 A;  4KT0 J;  3A3Y B;  1TU3 F;  2EJS A;  3HU2 A;  2F5O A;  1NU1 D;  2R4J A;  4ASV A;  2KA6 B;  4IL6 E;  2UXC M;  1SQX J;  3EIH A;  5B5E H;  1LTS C;  3WU2 E;  1NGM B;  2KNZ A;  3CX5 E;  1R4G A;  5CCH C;  1OLM E;  3KDP B;  3WHL A;  1P84 E;  2WT7 A;  2FYU E;  1R8E A;  3HJ8 A;  4LF6 M;  3GLM A;  2L6O A;  3A2A A;  3H1L G;  2JXN A;  2JZ1 A;  3KOW E;  5AW2 B;  2Q9I A;  2E74 B;  2FNA A;  3M91 A;  2CV2 A;  3GHG A;  5GTH H;  3L29 A;  2KSJ A;  1VQ4 P;  2BJW A;  2OPF A;  5AW1 B;  1G4A E;  4D80 A;  2N9B A;  3BOS A;  3SAS A;  2R44 A;  3S9O A;  3Q5S A;  1JY2 N;  3KVW A;  2R32 A;  2DEN A;  1S2E A;  2O01 F;  3A42 A;  5KPT A;  4ZMD A;  3IG8 A;  3KS8 A;  3C3E A;  4KLN A;  1N7S B;  2WPR A;  1NH4 A;  4GIF A;  2UU9 M;  4N6J A;  3FGA D;  1OAO C;  1IM2 A;  3CCM P;  1QZM A;  2GUV A;  4K35 A;  2LHG A;  3FTC A;  2A06 D;  3HKP A;  1Q3B A;  5KJ7 D;  4QNR A;  3V4Q A;  1SQV K;  2EUC A;  4N78 D;  4J7P A;  2I1J A;  3VP9 A;  1R6B X;  1PPJ E;  3AEG C;  1E5W A;  1NO1 A;  2W27 A;  3CF6 E;  2X4A A;  4KJM A;  3MIW A;  3FE3 A;  2LKM A;  3KYQ A;  3AOG A;  1PGY A;  2BEQ D;  3AE4 C;  2Y0T A;  5DNY A;  3VN0 A;  1IXR C;  2A5Y B;  1NTK K;  3USS A;  3HE4 B;  4B3T M;  3P8M C;  2AEJ A;  4IBF A;  1OZH A;  3AEE C;  2WSE F;  4EOT A;  4BRY A;  1T3J A;  2KNC A;  1K04 A;  2NRG A;  3RBX A;  2H89 C;  4WY4 D;  1R2Z A;  5FTK A;  1MJG M;  2JWD A;  4LJA A;  3C1L A;  2D2C B;  2E75 D;  2AEM A;  2JY8 A;  3ZQJ A;  3F5H A;  5CMZ A;  5KAI E;  4MGK E;  1PIX A;  2FY8 A;  3TGU E;  3RL0 B;  3T97 A;  1GU4 A;  1T43 A;  2HHH M;  2D7E A;  5KLV E;  1J5E M;  1KB9 H;  3W0F A;  3LIE A;  3O6Q A;  2VF8 A;  1N34 M;  3L71 G;  2MH8 A;  1NHG C;  2HL7 A;  4LRT A;  2JDI H;  4LFA M;  1URQ B;  1VQ5 P;  4GT1 A;  5B66 E;  1NTK D;  2XGN A;  1RF0 A;  2L2D A;  1LP1 A;  5DJU B;  3RK2 D;  2KYV A;  1N7S D;  4NRW A;  1FZA A;  1KFV A;  1L2D A;  2E5Y A;  1G8P A;  4OGQ D;  3IR9 A;  3RK2 B;  3GLF E;  1X22 A;  3C3D A;  2D4Q A;  3KP0 E;  1L0L G;  4GDO A;  2ZAM A;  3L72 G;  2P58 A;  1URQ D;  2LVP C;  4ZKU A;  4WW0 A;  2C98 A;  5EXP A;  4RJT A;  5KKZ B;  2HKJ A;  4MN4 C;  3VYI A;  1SXJ A;  1XWI A;  2YNM D;  3I5C A;  3A46 A;  2NZ2 A;  4D82 A;  1TH4 A;  2OO9 A;  1OFH A;  3H1H G;  3AE5 C;  3FWN A;  4JV5 M;  2Y9Z A;  1FJK A;  5EP1 A;  2AXT H;  2M3E A;  1K73 Q;  3KW6 A;  1GJT A;  1WJ7 A;  1JR3 D;  2K9D A;  5ITQ A;  1SQQ J;  4Q7J A;  2V6Z M;  4Y99 B;  1OJL A;  3HHW A;  1S5L H;  1TH2 A;  4BLC A;  3GPX A;  3GPY A;  4K0K M;  1OW8 A;  4I2L C;  5AW3 B;  1ORY B;  4REZ A;  2B88 A;  3GRV A;  3V5B A;  3H1K J;  1MFT A;  4IOI H;  4NC6 A;  2GUS A;  2I1K A;  4IBE A;  3SFZ A;  1DIP A;  1T8Z A;  1P84 H;  2R46 A;  5CHX A;  3KSJ A;  3EFG A;  5AW0 B;  3A0H E;  2OTJ P;  4IBI A;  1YYC A;  3S1K A;  2C0X A;  1DGH A;  2LXE A;  2IX7 C;  3TSI A;  2ZFC A;  3NWL A;  3HD7 C;  3P7Z A;  3HHY A;  3VP8 A;  1KYO I;  2KSE A;  3NBI A;  3WUU A;  4FMM A;  2QQ8 A;  2JUJ A;  4U3F E;  1DV0 A;  4GC9 A;  1NTM J;  1KTM A;  1BE3 E;  3L36 A;  5KJ7 A;  3A0B H;  3GLH E;  1CI6 A;  3FUU A;  4IBG A;  3MGN A;  5K5G B;  1AJY A;  2SPZ A;  1JOC A;  1YIJ P;  3L73 J;  4II7 A;  4BBA A;  2XSZ D;  4DR5 M;  1CZQ A;  2VF7 A;  4HL4 A;  1R5L A;  3B7N A;  1IC2 A;  1RQU A;  3CC2 P;  1HJB A;  4UB8 E;  3G6E P;  2LVO C;  1TDH A;  2E5L M;  1YSY A;  1NTM E;  5AVS B;  1VEK A;  2N1T A;  4MGH A;  1QDR A;  1YQ4 C;  3CWB D;  2UXB M;  4IL6 H;  2UWJ E;  1XC8 A;  2FYU J;  2KW0 A;  1MUU A;  5EXS A;  4A7P A;  3R9X B;  1SVF A;  5E26 A;  4PDI A;  3UJN A;  4YHH M;  2Y0E A;  3VTP C;  2OYH B;  2QVA A;  3IN6 A;  5IWA M;  3L73 D;  2GM4 A;  4NXM M;  2QM8 A;  3H1L D;  1FOS E;  4JPZ B;  3GLG E;  1BDC A;  1Z5C A;  5EP4 A;  2YXQ B;  2W90 A;  1Q7Y Q;  4JI5 M;  1Y8G A;  3RK3 C;  2RKL A;  1LTM A;  1IBK M;  4UB6 E;  1HTL C;  2N35 A;  3L2A A;  3QAU A;  4DV6 M;  1MKM A;  1EDK A;  1PGO A;  1LTJ C;  2I7P A;  3D71 A;  4HYT B;  3RK2 C;  2HWJ A;  1ZQ9 A;  1RH5 B;  5B66 H;  3I55 P;  2RH0 A;  1JUN A;  4P17 A;  3II6 A;  3HE4 A;  1A02 F;  4J7Q A;  4L15 A;  2GA1 A;  1L1Z A;  3RK3 E;  3I56 P;  2R45 A;  2JJL A;  5C18 A;  1FDO A;  3S4R A;  1XXH B;  4D6T D;  2ITA A;  3KP1 E;  1SQQ E;  4OMJ A;  3CCE P;  3H1J J;  4JF7 A;  1NTZ E;  3E4R A;  3NBX X;  3L71 J;  2FYU G;  3MUD A;  3ILK A;  4XK8 F;  1LWU B;  2QJK C;  1URQ A;  3H1L E;  1BCC E;  2E2X A;  1NKN A;  1OQY A;  3TGU G;  1PP9 J;  1SQV G;  2XNX A;  3D8B A;  3DOA A;  1HNZ M;  1JTH A;  1AA0 A;  2VDB B;  3L71 E;  3GLI E;  4D6T J;  1VQM P;  2J5Y A;  4PV1 B;  1XTC C;  4X65 M;  1NWQ A;  2QJP B;  3SMS A;  1LT1 A;  1M56 D;  2RGH A;  1IFM A;  3AJI B;  4H0L C;  1JEK A;  3C8V A;  3CME P;  3QYE A;  1KYO H;  3FWL A;  4OGQ C;  3K5B A;  3HU1 A;  4C46 A;  4LF8 M;  2KEB A;  1DD3 A;  3TL4 X;  2LR2 A;  2CHQ A;  4I4L A;  1FZC B;  4NL4 H;  4JYB A;  3M0A A;  1LTG C;  3NMD A;  2L09 A;  5KJ7 C;  1UIX A;  3WHK A;  4PJ0 E;  3QWO C;  1H89 A;  1L0N J;  2V4H A;  2A06 E;  2K6B A;  1H8A A;  3M0E A;  2H88 C;  4GC5 A;  1Z56 A;  3PFI A;  4BXL A;  5TIS E;  1GMJ A;  3CGW A;  4H44 B;  2ZYD A;  3QYB A;  2O01 J;  5GTH E;  4GOD A;  2N1T C;  2OTL P;  1J09 A;  3TGU J;  1DGF A;  1JY3 O;  1L8Q A;  1P3Q Q;  1OLM A;  3U1C A;  1FOS F;  4JN6 A;  2Q3I A;  1EXJ A;  1SFC B;  4D6T G;  1IN4 A;  2QBY A;  3F92 A;  2R3C A;  1PGP A;  2DWN A;  4G4O A;  4ASW A;  1JY3 P;  1UM8 A;  3P32 A;  1SQX E;  2Y0Q A;  3V76 A;  3SHG B;  4AQR D;  4PD2 A;  3CC7 P;  1BGY E;  2Q1K A;  1ZW0 A;  1NTK E;  3FD9 A;  4I7Z C;  1IFN A;  3PRJ A;  3KQG A;  1CUK A;  2ZVO B;  3VK8 A;  3GP1 A;  1WGL A;  3GLH B;  4A3V B;  3JSV C;  3U6C A;  3CL3 D;  4GMQ A;  2CWB A;  1QDT A;  3LQR A;  4AZF A;  4PT5 A;  1LTJ A;  1YJW P;  1KV4 A;  1SQP J;  3KZI E;  3H1I D;  1KMI Z;  3A0H H;  4R4M A;  2E76 D;  2NPS C;  4B3R M;  1G71 A;  2CV0 A;  1M1J B;  1QAQ A;  3CX5 I;  5EFW B;  4K3A A;  4RKU J;  4OW0 A;  2Q6Q A;  3U6E A;  2ZXE B;  1SQQ K;  3U6S A;  2O25 A;  2W83 C;  5APS A;  4LJ8 A;  2M3B A;  1BE3 J;  2OYI C;  2IBZ D;  5CBO A;  3CX5 H;  4IFM A;  3SWF A;  3H1H E;  1BCC J;  3J80 S;  3MUD C;  3PJS K;  1N86 A;  4WY4 C;  3L73 E;  1PP9 E;  3B8E B;  1HVV A;  4Y28 J;  1M1J C;  4L4U A;  2DAE A;  3DZD A;  1TDZ A;  2E42 A;  5KO3 A;  3U61 A;  3GMA A;  3UZU A;  3L25 A;  2Z5H A;  3J7A S;  2G3A A;  1XTG B;  1SG9 A;  2O01 H;  2Y9Y A;  2L4F A;  3L74 G;  4IBB A;  2VII A;  2F5S A;  5CJ4 A;  2YIU C;  2R6F A;  1N75 A;  3KFU G;  1EXI A;  3T97 B;  4KT0 F;  2W6B A;  1FZF A;  2YNY A;  3TWM A;  5IRE B;  1XMO M;  2LTU A;  3KDS E;  2KP8 A;  1FZC A;  1Q81 Q;  5BU5 A;  4OU7 A;  2M0B A;  2QJY C;  3GLI A;  1JCD A;  3HZJ A;  4W7Z A;  3TWK A;  4FCW A;  4QNM A;  4GIT A;  5H2F E;  1SXJ D;  1G1J A;  3GPU A;  4TT3 H;  4R3D A;  3KOZ E;  3CI9 A;  1GL6 A;  3GLI B;  3JCU E;  3LVW A;  4B7H A;  4C7N B;  4NOO B;  1NU1 J;  2H43 A;  2G5G X;  1GVN A;  1N73 B;  1DGG A;  3PNV A;  3WMM 0;  3AE2 C;  4H0L B;  3Q5R A;  2O1K A;  1KD1 Q;  3T6P A;  3G9R A;  1JTH B;  1KIL A;  3ZDM A;  1FBM A;  5H2F H;  2OTK E;  5APX A;  1NY6 A;  1NYH A;  1JO5 A;  4DBG B;  1R7R A;  4CJ6 A;  4CIS A;  1FJG M;  3U5Z B;  1L2P A;  3HUS C;  2VQE M;  5JI2 E;  3CCU P;  1HGZ A;  2APL A;  1J7K A;  2QG4 A;  3DA1 A;  2JR8 A;  2KDL A;  1ZP0 C;  2WSC F;  5CCH D;  3FYC A;  4FVM A;  3IHP A;  1XXH E;  3RGS A;  4PDG A;  1KB9 D;  1F4I A;  1JY3 N;  2ZM6 M;  1QAN A;  2Z8Y M;  3VLF B;  3N7N A;  1ZMW A;  3U60 A;  2IZ1 A;  1NHL A;  1Q90 D;  5AVW B;  5ITX E;  3D6Y A;  2ZTD A;  2UXD M;  3A45 A;  2XF3 A;  3HU3 A;  2CHV A;  1EDJ A;  2R0I A;  4LCB A;  3HTK A;  4DV3 M;  3FRI A;  2YO3 A;  5KKZ C;  1QAO A;  5BVZ A;  4C7R A;  1ZN5 A;  2I8D A;  1YUB A;  5KAI H;  1M1K Q;  4EYY Q;  5EP3 A;  4AQY M;  1YI2 P;  3V2N A;  1QVR A;  5APW A;  2JO1 A;  3KXD A;  2V1U A;  1USD A;  5EJC A;  3JCU H;  4ZPX A;  2ZAE B;  2KK7 A;  3HD7 D;  3L70 G;  1NNU C;  1NU1 K;  2BJV A;  4DUY M;  2R18 A;  3CCJ P;  3OA7 A;  2QNJ A;  2DAI A;  1L1T A;  2Y21 A;  2HOD A;  2QJK B;  4CHT B;  2IZ0 A;  4H0L D;  2DVW B;  1QL1 A;  3BAS A;  1LTJ B;  3GHG C;  1L4A A;  1IFY A;  4B7F A;  4UB8 H;  3ZCB B;  2E75 B;  2MRO B;  1OIP A;  1IBM M;  1WHC A;  2CPB A;  1BSN A;  4YY3 M;  4KHP M;  4WY4 A;  1SXJ B;  1HBW A;  2LXC B;  3P8C D;  5JI3 E;  2HYN A;  4IBC A;  3CXH E;  1GAB A;  4FCV A;  3KZI H;  3FTE A;  4EI2 A;  1OFI A;  4LFB M;  2YQZ A;  4DR7 M;  2O3J A;  2YMY A;  4D6T E;  3B5N A;  1NTZ K;  4RES B;  4LJ6 A;  2CK3 H;  2WSC H;  1SQV E;  1ZRT E;  4JI8 M;  2XFS A;  2IFM A;  5ITU A;  5APQ A;  3PEG A;  1Z5A A;  2C99 A;  2FOI C;  4M9Z A;  1FU1 A;  1ZXG A;  1WR1 B;  1HWT C;  2E75 C;  1S9K E;  2DW3 A;  2OQQ A;  3TNU A;  4MGI E;  3PLN A;  1BVS A;  4M3L A;  4S12 A;  1X37 A;  2JY6 B;  4LJ4 A;  5AW5 B;  2YO2 A;  1LJ2 A;  5LMN M;  3AE6 C;  4JBZ A;  4AKH A;  3U6L A;  1NTK J;  3BVH A;  2F4V M;  1SQV D;  3HE5 B;  2KNV A;  4GHA A;  2K88 A;  1JY2 O;  4I7Z B;  2DAK A;  3B5N D;  4DT0 A;  4JI0 M;  1VQO P;  2IBZ E;  1W2E A;  1DEE G;  3MMP A;  3Q5P A;  3RE8 A;  2K3R A;  3TWL A;  3SAT A;  2O1J A;  1QUT A;  5AVU B;  4JI7 M;  3H4J A;  1SQP E;  2WMM A;  3H1J G;  3O8Z A;  1L0L D;  1J1D C;  3FUT A;  3CX5 D;  2YFQ A;  1NTM D;  3GHG B;  2LVQ D;  1P84 D;  1XNQ M;  2XZR A;  4IJE A;  1N77 A;  4JI1 M;  1I4W A;  3H1K E;  4BRY B;  5TJH A;  3H1I E;  4PV1 D;  4PD4 D;  4H44 C;  1HNW M;  3SYL A;  3FTD A;  1PPJ G;  4LGY A;  1IY2 A;  5FTJ A;  3CPW O;  3ZH9 B;  2KIK A;  3CXH H;  3VMA A;  1SLQ A;  1RF0 C;  1E79 H;  1KIL D;  1V34 A;  3H1K D;  2FYU D;  3TNU B;  1T2K D;  2B3T A;  4DR6 M;  1DEB A;  1SQX G;  2LXB A;  2XZU A;  4DOJ A;  1N8R Q;  4OMK A;  1LWU A;  2O01 N;  2H5X A;  1S5L X;  4B86 A;  1JB0 F;  2NPS D;  1NTK G;  3HY5 A;  5EXX A;  2DI0 A;  3LID A;  2P67 A;  1VF5 C;  2XZF A;  1S3J A;  2VRS A;  3H1L J;  1SQX K;  2XSZ A;  1PL5 A;  3CF0 A;  1VQN P;  1IFJ A;  1M8O B;  1EZV I;  4Z1M H;  1NO4 A;  1R2Y A;  2OYI A;  1O6U A;  1SQB K;  1YBK A;  1XHB A;  3TQS A;  3M6A A;  2OOA A;  5KQD A;  7CAT A;  1Q39 A;  1WXQ A;  1ZMU A;  1G59 A;  1E9R A;  3P7K A;  5APT A;  3L37 A;  3B9P A;  2ZYA A;  1W5C E;  3KOY E;  2WSS H;  4IBJ A;  2YKP A;  2IPP A;  2JWS A;  2W8Z A;  1UFZ A;  2DAM A;  1KIL E;  4OWF A;  1GK6 A;  2WSC J;  2ZTC A;  1N32 M;  1MU5 A;  2FFJ A;  4JYA M;  2HLO A;  2WPQ A;  2QM7 A;  3L71 D;  1RU3 A;  5BR8 M;  2G8Y A;  3HD7 A;  3MK6 A;  3U6Q A;  3GQ3 A;  1DX7 A;  2ZAO A;  2WQY C;  2D2C C;  3L74 E;  3L75 D;  2CFO A;  3AE3 C;  1V33 A;  2DWZ B;  2WPV B;  2WZJ A;  1X79 B;  1OFC X;  1VDL A;  1S4X A;  2M5A A;  2A45 G;  2BCC E;  8CAT A;  1NJI Q;  2ZAN A;  1E32 A;  1LT9 C;  2K37 A;  2DKL A;  1KOR A;  2KUB A;  3CWB G;  5AW6 B;  1WGN A;  1QGK B;  4DV2 M;  1PGQ A;  2CV1 A;  3MTU E;  2Q5U A;  2E5T A;  1HT1 E;  1PPJ D;  4GKJ M;  5DYG A;  1LTT C;  4HB1 A;  4YXW H;  3OAK A;  5AVR B;  3L75 J;  2I7N A;  3CXH I;  3NXS A;  3O6Q B;  3GRR A;  1YTZ I;  3GF7 A;  2JEE A;  4TUW A;  1JMB A;  5AVY B;  1N7S A;  1VDD A;  5AW9 B;  3PXG A;  1DO2 A;  3WU2 H;  1JM0 A;  2R65 A;  4M0D A;  5ITT A;  4NPE A;  1ZRT D;  4UB6 H;  5CCG A;  2Y20 A;  4I8O A;  3AV0 A;  2PGD A;  3AED C;  3VKG A;  2ZVN B;  4IFF A;  3MHV A;  1PM5 A;  1KYO D;  3CCS P;  1EDI A;  1G3I A;  5AVQ B;  1S3S A;  4UN2 B;  1NKZ B;  3I04 M;  4LRS A;  4X66 M;  4FD2 A;  3SSU A;  1AQT A;  2KLU A;  1A02 J;  2N1T B;  4LJ9 A;  4OVZ A;  3AOE A;  1IK7 A;  3G71 P;  4DCK A;  4RO0 A;  2L91 A;  4YTP C;  3UIA A;  2XLJ A;  2F5Q A;  3D6Z A;  1AVO A;  5CCG D;  1LTI C;  3HD7 B;  1QYR A;  3M7G A;  1NTM G;  3J27 B;  1IFP A;  1M57 D;  4U3F J;  1L4A C;  2KRU A;  3K1J A;  3B74 A;  4CPG A;  5GKN A;  4GKK M;  5B5E E;  4P16 A;  3G3Z A;  2P5T A;  1A5T A;  4X64 M;  1OVU A;  1NAY A;  1ZAE A;  3T1Y M;  3SFD C;  2RGO A;  4W5W A;  4DV4 M;  2LBC A;  3PG7 A;  3B5N B;  2KRK A;  1L0N D;  4R4L A;  4H13 B;  2MJZ A;  1VQ7 P;  1WIV A;  2JNH A;  4Y28 F;  4PCZ A;  3UGJ A;  3OTO M;  2HCB A;  1RE3 C;  1K3X A;  1NV9 A;  2MJ5 B;  1FS0 E;  2XV5 A;  4R71 A;  3H1I G;  2FS1 A;  3GRU A;  2VQF M;  3GO8 A;  4G6Z A;  1PFI A;  5FSW A;  2CPS A;  4DV0 M;  3J2P B;  1SQP K;  4ZNC A;  2ZXX A;  4LC1 A;  3KS4 A;  5DFL A;  2W6J H;  2V7Q H;  3BCC G;  4IBK A;  1GU5 A;  2WT7 B;  1HQY E;  2Z4S A;  4QHT A;  4DUZ M;  1AQ5 A;  2A06 G;  2HOD B;  1C7Y A;  3THG A;  3L74 J;  4RKU F;  1NU1 E;  3TPZ A;  2NQ8 C;  4XA4 A;  4R7G A;  3FXE A;  1Y9B A;  1IQP A;  1EIJ A;  4GHL A;  1KQG B;  1QQW A;  2H1R A;  2MR9 A;  5FLX S;  1E9S A;  2WSF H;  1M90 Q;  3VK7 A;  2K9J A;  5AVT B;  3L72 J;  1IXZ A;  5TIS H;  1T3U A;  3JR5 A;  4TLG A;  4F1I A;  4MH0 E;  2CRU A;  3W67 A;  3U61 B;  1Q86 Q;  3W68 A;  1OAI A;  1VEJ A;  1DD4 A;  3J81 S;  5LMU M;  1BCC G;  3GPP A;  2CUZ A;  3LQQ A;  3B71 A;  1GL7 A;  1VQ9 P;  1YE9 A;  3FXD A;  3CD6 P;  1ZLL A;  3SBJ A;  3H25 A;  4XE5 B;  3K2L A;  2QSI A;  5BPV A;  4TLF A;  3DFZ A;  4QMA A;  1GDT A;  2WPS A;  2L7H A;  4C7N A;  1WT6 A;  3B89 A;  1GK4 A;  1IBL M;  2KZU A;  2N9Y B;  2H7H A;  3H1J E;  4I81 A;  4XBO A;  1JNM A;  1HUC A;  1D0M A;  4GOE A;  3V4W A;  2OYH C;  1KSF X;  2OQ4 A;  1GO5 A;  3LW5 J;  2OYO A;  3GW6 A;  3BCC J;  1FZB A;  1KYI A;  3D70 A;  1AUA A;  4LJ5 A;  1JR3 A;  3UMM A;  1OTR A;  1KB9 E;  5AVX B;  4U7J A;  3MJ5 A;  2QP9 X;  1H0T A;  5FTL A;  2UUC M;  3F89 A;  3LW5 H;  3CWB J;  2LNH C;  3AE1 C;  3AEF C;  3AOE C;  1KC8 Q;  2QCU A;  4BB9 A;  4JI6 M;  3CCV P;  1YJN P;  1HQC A;  2E74 D;  3VOP A;  2CP8 A;  5L8R F;  3BRV B;  2J7O A;  5CJ0 A;  5KLV D;  4DZO A;  1HF9 A;  2Z4R A;  2UUB M;  1JCC A;  1YHQ P;  4RF0 A;  3CMA P;  3HJQ A;  3I4Y A;  3R2P A;  2LWX A;  4FWH A;  1AFO A;  2BCC G;  2W82 A;  3BCC D;  3L73 G;  1Z59 A;  2KNA A;  2LVA A;  4AG6 A;  2HPC B;  1ZME C;  3RL0 D;  4G4N A;  3CWB E;  3TK1 A;  3K9O A;  1H6U A;  1P84 I;  4O9B A;  1HT2 E;  5APV A;  1EZV G;  3TE6 A;  4Z8X A;  2WZ7 A;  3PNY A;  3E1I A;  2Z3X A; 
#chains in the Genus database with same CATH homology
 4FMM A;  4M8Z A;  4J7Q A;  4UYB A;  1OIZ A;  4CIZ A;  2E2X A;  1AUA A;  3B74 A;  3B7Z A;  3HX3 A;  4TLG A;  4J7P A;  4CJ6 A;  1OLM E;  3W67 A;  2D4Q A;  3W68 A;  1O6U A;  4OMJ A;  3B7Q A;  3PG7 A;  3P7Z A;  4OMK A;  1OIP A;  1R5L A;  3B7N A;  3Q8G A;  3PEG A;  1OLM A;  3HY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...