3W68A

Crystal structure of mouse alpha-tocopherol transfer protein in complex with alpha-tocopherol and phosphatidylinositol-(4,5)-bisphosphate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
251
structure length
251
Chain Sequence
QPGLAELRRRVQEAGVPQTPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRAECPELSADLRPRSILGLLKAGYHGVLRSRDSTGSRVLIYRIAYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGWQVSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRIHLHGNNYKSSMLQHFPDILPREYGGKEFSMEDICQEWTNFIMKSEDYLSSISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impaired alpha-TTP-PIPs interaction underlies familial vitamin E deficiency
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Alpha-tocopherol transfer protein
total genus 91
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
A PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.20 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 N-terminal domain of phosphatidylinositol transfer protein sec14p 3w68A01
1.20.5.1200 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Alpha-tocopherol transfer 3w68A02
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 3w68A03
4M8ZA 4OMKA 4TLGA 3W68A 2D4QA 4J7PA 3HX3A 1O6UA 3PG7A 3B7QA 4CJ6A 3W67A 3B7ZA 3HY5A 3B7NA 4FMMA 4CIZA 2E2XA 4UYBA 1R5LA 1OIPA 1OLMA 1OIZA 3B74A 1AUAA 4OMJA 3Q8GA 1OLME 3P7ZA 3PEGA 4J7QA
chains in the Genus database with same CATH superfamily
3IG8A 5C39A 4RNAA 4OU7A 4LGDE 3TGUD 3HHWA 2G8LA 2Y21A 1YI2P 1L0NE 4D81A 1NAFA 1Q39A 1JY2N 4I1LA 3MZWB 3FXEA 1R5SA 2QENA 3NFQA 5KLVK 2Q2EB 1GK6A 1IXSB 4UN2B 2C0WA 2D2CB 5CHXA 4WY4C 1OFCX 2WSEF 2WPRA 3SARA 1J1DC 4IBIA 1IFPA 3K8ZA 4IFMA 4H13B 2C0XA 4H44C 1L0LG 1SQQJ 1ZV1A 4PD2A 1PPJE 2R3CA 4N3YB 4IFFA 1LV7A 3KSJA 1DD3A 3M9BA 1HF9A 1Q82Q 1D2NA 4JXJA 3E21A 2VRSA 2WSCF 2KA6B 4GRIA 3VMZA 4KHXA 3Q8GA 1RF0C 5CCHA 3H32A 4OVNF 1KSFX 4MH0E 4LZJA 3SSUA 1MFTA 3W67A 3TPZA 1IXSA 5KJ7D 1QAOA 2O01N 1DV0A 4L76A 4UB6H 3I51A 3HE4B 3FUWA 4CIZA 4OX9M 7CATA 2B89A 3L74D 1SQXJ 2YMKA 3EIEA 1P84E 3WHLA 1S4XA 3KPEA 4RKUJ 3RBXA 3TNUB 2UUAM 1GLNA 1Q02A 1PIXA 4QHTA 3I01M 3E1IA 1YLAA 4XFJA 2V4HA 1ZOYC 3H1LJ 4IBJA 3SAUA 1RHZB 2FFDA 1OZHA 1D7MA 2DVWB 1QUSA 2GUSA 1QDRA 2OYOA 3K2LA 2O01H 3V2PA 2HWJA 1KD1Q 4H13D 4MN4C 1SQBJ 1WXQA 2DWLA 3K92A 2AEMA 3GF7A 3L72E 2KW0A 4LCBA 4WY4A 2L5GB 3H4JA 3V4WA 4O9BA 3ZQJA 1AVYA 1SQQE 1BE3J 3PRJA 1NJGA 3CX5D 3AOEA 3GW6A 1OXZA 2DKLA 4OGQB 4R7GA 4EYYQ 3L35A 3M9HA 1GL6A 1R8EA 2IZ1A 2G3AA 3RL0g 2J7NA 1J5EM 5ITRA 2ZJSE 1TR8A 4DT0A 3HE4A 3KS8A 2L09A 3TWLA 3IG5A 3L74J 3HHXA 2R62A 4LRTA 4QNMA 4IL6E 2WSCH 1L2BA 3GLHE 2BCCG 1MV8A 1J1DB 4R71A 1JTHA 2Y9ZA 3GPUA 1RF0A 4GKGA 3P32A 2F5PA 1ZR4A 2ZANA 2E5TA 3B5NA 2CFOA 2C9CA 4AG6A 1CI6B 1IFMA 5JI3E 1XNRM 3GP1A 2E2XA 1GO5A 5KPTA 1ZXGA 1BE3E 3LW5H 3L71E 5FTKA 2QZ4A 2M3BA 1D0MA 2IZ0A 2W27A 1NWQA 3P7ZA 4MM3B 2Z5HA 2N9YB 4L4UA 1FZFA 1EQ7A 1HJ0A 1SQPE 4HEOA 1KYOE 1LJ2A 3A7OA 1T8ZA 4DV1M 2O1KA 2HL7A 2ZVNB 1LNQA 1FDIA 3A46A 3CXHD 4JPZB 3C9PA 4AKGA 1J2JB 1WR1B 1S3JA 4B86A 5EQTA 3RL0D 3K1JA 4JYAM 2FH0A 4CGYB 1S5LX 2QJPC 1QAMA 2KHHA 2UXBM 2L6OA 2XNXA 3GRRA 3Q5RA 2KZSA 4IBDA 2FYNC 2F5OA 3V5BA 3T15A 1H8AA 4NPEA 3HZJA 3PLNA 1OMIA 2JUJA 4Y99C 2DAMA 2E74C 1YITP 2HCBA 1JMBA 1YJNP 3CC7P 5TISH 3JC22 3FUVA 4JYBA 1QANA 2VIIA 1E79H 1SQVJ 3CWBD 1NO1A 1NU1G 1LT1A 5KJ7A 2EO2A 1IY2A 2DW3A 2QRXA 4RJTA 1DD4A 1WT6A 1SQQG 1L4AA 1ZAEA 1L4AD 3RE8A 1U7MA 1QAQA 2G3QA 4G4QA 3NBIA 2LXCB 4D6TJ 3BCCE 3B5NC 3VKGA 2XFSA 1G71A 1R2YA 2ERCA 1OIPA 3L37A 1BVSA 3GRVA 1XHBA 2R18A 3SWKA 3AE8C 1E9SA 2UWJE 4PDIA 3H1IE 2QE7H 2NPSC 1F4IA 1URQB 3U6QA 1PZQA 3VP8A 4BLCA 1JR3E 5C18A 1OWAA 3HU2A 3EWKA 1EZVI 1YJWP 4GIFA 3L26A 3L72G 2Y0CA 4AI6A 2DHRA 4FWGA 1PPJD 1IC2A 3GLHA 2R5BA 1VQPP 4EOTA 1KB9D 2R44A 3GQ4A 4D80A 1EZVD 2ZYGA 3DA1A 1G59A 3O6QA 1N7LA 4DV3M 2N1TC 1Q2NA 1LTTC 2F5QA 2M3EA 3DOAA 2UUCM 1PGYA 4OVZB 3GO8A 3U1CA 2Y0QA 1NTZG 1JNMA 5EP1A 2DZNB 1L4AB 5AVUB 3J2PB 3AKZA 1BGYJ 1LWUB 2QSIA 4HKZH 1VQNP 1PPJG 2LHGA 1KILA 3GLFE 1L0NK 1OW7A 3A0BH 1GL2B 3H1KE 1L2DA 2DAEA 1SS1A 5AW1B 3SMSA 1C7YA 1VEJA 2AEFA 2FYUG 4KT0J 4B7GA 1IFDA 4B7HA 1IN5A 2UXDM 1SFCC 3QYEA 3WHKA 2RKOA 4I2LC 3TK1A 2QNJA 4X65M 3WUVA 3L75D 1KB9E 1VQOP 1M8OB 2QA4P 3CCLP 2HHHM 1NNUC 2XZUA 2WSFJ 1QQWA 1VDFA 1SQQD 3J80S 2A45I 2K9YA 1EXJA 3C3DA 1KYOD 2YQZA 2Y0TA 4OVZA 4GHAA 3MUDC 1S3SA 2BNKA 1KZUB 3WU2E 1M1JB 1AFOA 5DYIA 5AVWB 1U7JA 3KVWA 1IQPA 5GKNA 4J7PA 1NTMG 4GKJM 1VEGA 3I04M 3L75G 2BWBA 2F5NA 3IN6A 3GLFA 4D6TE 3OA7A 3SATA 4X66M 1KILE 1DGHA 2HPCA 2WSEH 2QM7A 3RFWA 3KOZE 5DJUB 1M90Q 1DEEG 4XE5B 2F5SA 3L70E 3V76A 3G6EP 2IBZD 3CCEP 3HD7B 4Q7JA 2SPZA 1YYCA 4IJFA 2I8DA 4AYCA 3C1LA 2JY5A 3E4RA 2K9DA 1QGKB 4HYTB 4XA4A 1JY3P 3H1HD 1X37A 1H0TB 2K1AA 3ITKA 3HHYA 1K73Q 1SFCB 2YMYA 3H1HE 1Z5CA 1PFIA 5LMUM 1QVRA 2FKWB 3CCUP 1JEKA 1NTMD 1BCCG 1H88A 1G2CA 1X79B 1LT9A 2PP6A 1QVFO 2WPQA 1NTZD 4NRVA 2QPAA 1S5LE 2JEEA 3HKPA 2O25A 1IN4A 2LWXA 2LH0A 3SHFA 1NTMJ 2DWMA 4WURA 1GW4A 5CJ4A 4NSOB 1VQMP 3MMPA 4DV6M 3T6PA 2PGDA 1SQVK 2CRUA 2D7EA 4TUWA 2KLVA 3A2AA 2A06D 3A0BE 1FOSE 3J7AS 2YR0A 3PP5A 4U7JA 4ANRA 1Q90D 2KK7A 3PFIA 3L72D 4I7ZB 4ZKPA 2YO3A 1IBMM 2Z8YM 3HX3A 3H1JD 1N73C 4ASVA 4Y28J 4OGQD 3I5CA 3H1JG 4GT1A 5B5EH 3JR5A 2Z4EA 1E32A 2BEZF 2KZJA 1PRBA 3FWLA 1C1KA 3V6IA 2IYPA 3KZIH 2CHVA 2OQQA 1ZLLA 3CI9A 3L74E 4J7QA 4QOSA 3I4YA 3FTEA 5EP3A 2M5AA 2FE8A 3WUTA 1GDTA 1G2CB 2MJZA 4L15A 3AE1C 3F5HA 1KB9H 1Z56A 4REZA 3A3YB 1OFIA 2APLA 4PDGA 3KXDA 1HJBA 3VDUA 2WWWA 1J1EB 4ZMDA 3UK6A 1OIZA 2ZFCA 4C7RA 3AEAC 4IIWA 5IZ7D 2ZAMA 1Q81Q 2YKPA 3KS4A 2HYNA 3GPPA 1SXJA 4R4LA 4Z8XA 3ZH9B 1V92A 2G5GX 3SFDC 1SQBD 4JI2M 3DFZA 2KI7B 3LQRA 3KDSE 3OAKA 4GOEA 1R4GA 3SASA 1PV3A 2K9JA 1K05A 3H1HG 4WY4D 3GLGA 2E75D 3G4SP 3E9SA 5DJTB 2LTUA 4HH2A 3HTKA 2W8ZA 3L28A 1NTKG 2QIWA 3HJ8A 1L0LJ 1YE9A 3JAMS 1SQXE 4M0WA 4B08A 5ITXA 1AV1A 1SVFA 4FD2A 3IR9A 2OYIA 3K9PA 1NJFA 3VMXA 1LTIC 2BEQD 1VQ5P 1JY3O 3CWBE 4I6MC 1SFCD 3MTUE 2OYIB 2J58A 3A0HH 1W2BO 2JNHA 2KB7P 1DO0A 5BU5A 1CZQA 1SQVE 2GUVA 1QLED 1SQBK 4OMKA 4Y28F 3WMM0 1L8QA 4IBEA 2F4VM 3F92A 4TLFA 3KSXA 1KILC 3U6EA 2NQ8C 2XZFA 2W6BA 1L1ZA 1VQ1A 3AEGC 1PGJA 3KHUA 3B8EB 1HT2E 1NTKK 2WITA 2WSSH 2P58A 1N36M 1KFVA 4NRWA 1VF5C 2K3RA 4I81A 1KQLA 1SXJC 4MGHA 3HU1A 2WSEJ 3VN0A 3H25A 3J7BA 3KOWE 4GKKM 2PAJA 1S1CX 3HD7D 3II6A 3VK7A 1RE4C 1Y8AA 1BE3G 2HPCB 3I55P 2QJKC 2H1RA 3DZDA 3PXGA 2KS1B 3SYKA 2MR9A 1ZMUA 5EJCA 1YTZI 2MGWA 2NPSA 1XXHA 2ZXXA 5B5EE 1QL1A 3GRUA 4LJ4A 1A5TA 3KQGA 1EDIA 3IFMA 5KLVG 2ZAEB 2YNMD 3SAWA 4DR1M 5AVSB 3ZCBB 4MGYE 2OTLP 2FFDC 5AVQB 2YXQB 4WBAA 2CV1A 5JI2E 5AW7B 1DEBA 1EZVG 1KQGB 3OJAB 3A42A 3KDPB 2JZ0A 3L74G 2RGOA 2HLOA 2JR8A 2BCCJ 3N7NA 3LW5F 4AZFA 2Q9IA 1N73A 2Y20A 2Z7JA 2IDBA 2QHOB 4BBAA 1GKIA 1GL2A 3AFHA 4G4NA 1N75A 3PHLA 3GLIA 1IXRC 2N1TA 1Y8GA 3HD7A 3L70G 3MJ5A 2BJVA 4DUZM 2HG5D 2KSEA 3E46A 4EIWA 1AIPC 1LTBC 1Z5BA 3V4QA 2ZYAA 3FXDA 2HKJA 2G8YA 2IBZI 3U6OA 1K9MQ 1N34M 3UMMA 3KP1E 4U3FG 1FZCA 4JV5M 1GL7A 3D70A 1T3TA 1XMOM 4LF4M 1RE3A 1HTLC 3Q5PA 1XXHB 4LFCM 3S4RA 4IL6H 1LT9B 3CX5E 1NY5A 4LJ7A 1PJQA 3M0EA 3D8BA 2WPSA 5E6JA 3I56P 3U6LA 2J59M 5BPVA 4M8ZA 4RKUF 3RGPA 1FJKA 1NTKJ 3BATA 1Y47A 3L71G 1LTSC 4NL4H 1P84I 1ZN5A 3GHGA 3FUUA 2OOAA 4DR5M 4GC9A 1NV9A 1S9KE 3ILKA 3HRNA 3B5ND 3VK8A 2B87B 1SQVG 4JI0M 1N78A 5APXA 1OQYA 2EKKA 2L4FA 4JQ0D 5AW8B 4W7YA 4MGZE 1URQD 1N7SC 5DYGA 2DAGA 5GTHH 4LG2A 4I4LA 2WZ7A 1M1JA 4Z1MH 3SFEC 2R4EA 4KT0F 3NXSA 1FJGM 2KP8A 4QMAA 4GC5A 2JWAA 5APVA 4KLNA 1FNNA 1L0LK 3BCCD 4A3VB 2Y0EA 3SFZA 1ORYB 3M6AA 3LW5J 5TJHA 4DR6M 1JMMA 4FVMA 3CCSP 4U3FE 1WGLA 1BDDA 1N8RQ 4G3OA 3LMMA 3FYDA 1NTMK 2E76B 5TISE 3PG7A 5AW5B 1N7SD 3D6YA 1N73B 3EFGA 1MN3A 4YTPC 3W0FA 1RE3C 3K9OA 1YIJP 2FOIC 3CX5I 1K8AQ 1OLMA 2JWSA 2IFNA 4GITA 5C1BA 2YXRB 1NJIQ 5AW9B 4P17A 2O1JA 1VQ8P 3U6CA 2E75B 2C5RA 1LTJC 5APUA 3G3ZA 1QDTA 3RGUA 2O01J 1AA0A 4WY4B 1FU1A 4DV0M 4DV2M 1HNXM 1URQA 3AEDC 2WZJA 3GPYA 2L7HA 3L73D 3CF2A 5APYA 1GK4A 2RGHA 1KQFB 4MGKE 2UUBM 1IFIA 3J81S 2KYVA 2QJYC 4XK8F 2QEXP 4W5WA 4JI8M 1NHLA 2KS1A 2R5DA 1OW8A 1I94M 1PJIA 5KLVE 1FS0E 2M5AB 2WPVB 3U61B 4CPGA 1V34A 2W6AA 5DFLA 3Q5SA 3S1KA 3AJIB 1L0LE 2YKOA 1FZEA 4KJMA 1D0KA 1UM8A 1EC5A 2R4JA 1R6BX 3SBJA 3C3EA 3PJSK 2LKMA 2N1TD 3VTPC 3C8VA 2EKFA 2D7HA 2XV5A 3Q2YA 3OTOM 1XNQM 1KYIA 3CX5H 2K37A 1IJDB 2KZIA 1VG5A 5KAFH 1IM2A 4OWFA 1L2CA 2KIKA 5H2FE 2POHA 1D0LA 1M56D 3JCUH 3CMAP 1JOCA 1G1IA 2DAIA 1SQPJ 2YIUC 4PCZA 1SQXK 1NU1J 4B7FA 3WUUA 3Q3DA 4DV4M 4M3LA 4ZKUA 2FFDB 4KODA 1RF1A 1HGZA 1SG9A 1OVRA 1T2KD 1ZW0A 2P7JA 2KOGA 3L71J 1YSYA 4BRYA 1KILD 1M1KQ 4N78D 2NZ2A 1GVNA 2KSJA 1J7KA 4LF8M 5CBNA 2XKMA 2DWNA 2BWEA 1N7SA 2FYUK 1ZQ9A 3GLGB 4DV7M 1XMQM 1N32M 4ASWA 4LY6A 2JY7A 4I5SA 2FYZA 1PJSA 3AV0A 3E1RA 2JXNA 2VQFM 3O8ZA 3CMEP 1KTMA 4TT3H 1HWTC 3CCVP 1HR0M 4JI4M 3WU2H 4GOFA 1TDHA 1T43A 1I4WA 1NGMB 3FRIA 2K9JB 5FTJA 3A5TA 1PGPA 5FTNA 2CWBA 3B74A 2RMZA 3U1AA 2JZ1A 1NTZJ 4LF9M 1GZLA 3HUSA 3U61A 1BGYG 4K0KM 1PP9E 2NRGA 2AHMA 1CUKA 5ITQA 1NU1K 2XEPA 2KNZA 3MHVA 2NPSB 1LP1B 2XGNA 4KO8A 3FYCA 2FYUJ 2ZYDA 5AVYB 1X9VA 1QUTA 4H44B 1QZEA 3H6PA 1LT9C 2YO2A 5E26A 1TH3A 3CCMP 1IXZA 5AW0B 3L70D 3W68A 2C98A 3VYIA 4WB4A 2Y9YA 1FZBA 3H1IG 5KTBA 2KXPB 1SQBG 1ZR2A 2DXIA 5KAFE 3HTKB 5KKZB 1IN6A 3B71A 5EP4A 1T6AA 1Q7YQ 4DR7M 1RY3A 3JCUE 3KXEC 4YXWH 2UXCM 3HHZA 2R45A 3CTWB 2KNCA 1R7RA 5AVXB 2BJWA 4LFAM 1O6UA 3FX0A 2LVPC 3NTNA 3IF4A 4YY3M 3L75J 4DOJA 4NXMM 3QWOC 3AE2C 1R5LA 2UU9M 5KJ7C 2WT7B 4GH9A 2OTJP 4I8OA 4AG5A 1PGQA 3L75E 4IFDK 5B66E 3J27B 3HJSA 2CHQA 2I1KA 3RK2D 1GABA 1EXIA 1JY2O 5FSWA 3A98B 5IWAM 2W6JH 3H1HJ 1PP9J 4C46A 4B3MM 1FC2C 3BOSA 1R2ZA 2DZOB 2YFQA 3RGSA 1QEXA 3NBXX 2EUCA 1SXJE 1AUAA 1NAYA 5BVZA 2E42A 1TU3F 1VDDA 1WHCA 4MB7A 3U60B 5H37D 1JY3N 4FCTA 1NH4A 4MGIE 5CJ0A 1TH4A 1VQ6P 2LR2A 4FWDA 3GMAA 2XFTA 2ZTCA 1WGNA 1SXJB 1KQSO 1OTRA 4WP2A 4CJ6A 4I7ZC 1DH3A 3TWMA 1DGHB 5LMNM 1N33M 5E79E 5EXXA 3P8CE 3R8FA 3C58A 2GA1A 3QWLA 1VL2A 4C7NB 1G41A 2OO9A 2KLUA 4LZZA 2FYUE 4K35A 3CWBJ 3O6QB 1X8YA 2FXOA 1LGHB 2E74D 4M0DA 3CXHH 3PNVA 2FXPA 3T97B 2EA0A 3TQSA 5KLIB 1K82A 4G4RA 3VMYA 4Z6YA 1MX0A 2XU6A 3L73J 5IT9S 2Q1KA 1RF1B 1EZVE 3NWLA 1XB2B 3M9QA 1IK7A 4FCWA 4UYBA 1NTKD 3HUSC 1G3IA 1E5WA 1MU5A 1HNZM 4NSRA 2QBYB 1ZMEC 5FTLA 2D7GA 2IPPA 3VFDA 1RU3A 3JSVC 3H1JJ 2WSFH 3AE7C 1X0TA 1AVOA 3H1LD 1UIXA 2MJ5B 2Z5IA 3LIEA 3M06A 3QAUA 1UIIA 2OYHA 4GODA 1QYRA 4H0LB 4HJGH 2A45H 3HE5A 2R6FA 1FBMA 1IY0A 3KOYE 4DR3M 3I4VA 4IL6X 5AW2B 2DZLA 3BCCJ 1BGYE 1IN7A 5IREB 3AE4C 3AE5C 5AVRB 4IBBA 3GQ5A 1IBLM 5EXSA 1TH2A 2OOBA 3CCJP 1NHGC 3ABVC 4M9ZA 1YJ9P 2RRUA 2B88A 5AVTB 2FFJA 2R3SA 3U6MA 4AQRD 1X22A 2LNHC 1NO4A 4U3FD 1L2PA 2QP9X 3PVSA 4BB9A 3TSIA 4JI1M 2ZBKB 1KYOH 3BXWA 2QQ8A 3KOXE 2LBCA 2OYIC 1RQVA 3B7QA 3GLIE 5B66H 1FDMA 2LVNC 4IBCA 4HL4A 2CPBA 2CP8A 3D8LA 4D6TG 2Q6QA 1JY2P 3BVHA 2N9BA 4WW0A 4YPCA 1Q3BA 1ZMVA 1FZGA 1IO4A 4LJAA 4DZOA 4W80A 1FOSF 1E94E 1IK9A 3T38A 2W83C 1IFNA 5ITYA 1T2KC 3A45A 1PGOA 3GLGE 1FZCB 2ZXEB 2E43A 5A2QS 1NTME 4LLHA 2D2CD 1T3JA 4RESB 3CXHE 3UIAA 3L36A 3NMDA 1YQ3C 5CCHD 1TGUA 2HR3A 3MHVC 3M0DA 2E74B 5GTIH 3VKHA 3BASA 2GM4A 3U6PA 3HJQA 5E79H 1EDJA 1OVUA 1VQLP 3B89A 4L78A 3U60A 5AW6B 2DAKA 2JKVA 1W2EA 1JB0J 1KORA 1WRGA 1N86A 3V2RA 2JY8A 4OGQC 1BE3D 4PJ0H 3VLFB 3RBZA 2KNAA 1SQPK 2OPFA 2A45G 3KW6A 1EDKA 4B3TM 2KDLA 2RN0A 1BCCE 8CATA 2HODA 5KAIH 2E5LM 2K0BX 2V7QJ 1JO5A 1KFMA 1KMIZ 5AVVB 4QOZC 2A06G 3Q1MA 2P67A 3AEFC 3VOPA 2H89C 2Z4RA 2V1CA 3GF3A 3AE9C 4IBKA 2KRKA 1YTZT 1HJPA 4DCKA 4F2LA 1SQXG 1EE8A 3CWBG 4N6JA 3IAOA 3CC2P 3EQ2A 2CUZA 3GLMA 2KNCB 1SQXD 1NVOA 2ZTDA 2LVQD 3B5NB 3UGJA 1SXJD 4LJ9A 4L6V6 3H1LG 2FS1A 1DIPA 1SLQA 4DUYM 1FDOA 4NPFX 5ITXE 2OGUA 4NPDA 3VMAA 3G71P 1JR3D 2LXEA 3SYLA 2WSFF 3FTCA 1JR3A 3L70J 2WSCJ 1XWIA 2ZAOA 1NYHA 1SQQK 5APSA 1VQ7P 1JUNA 3M0AA 1HQYE 2QVAA 2CPSA 2FYUD 1ZV8A 3GLIB 2IFMA 2YIUB 3KZIE 2V1UA 2C99A 2QJPB 4P16A 4W7ZA 1TDZA 2HODB 2Q3EA 5KQ8A 3SMPA 3V2NA 5APQA 1NU1E 4L8RC 2BCCE 1JCDA 2WVRA 2J7OA 1VQKP 1W5TA 1TTEA 3FD9A 2JY6B 4L75A 2JP3A 2A5YB 4FWHA 3SHGB 2XDJA 2YKQA 3H1KD 4LGMA 4JI3M 3AE6C 4U3FJ 4UB6E 1PL5A 4TLGA 3ZC7B 4BWNA 4LRSA 1YHQP 2JA2A 2B9BA 3B7ZA 2I1JA 5KLIC 3T97A 1ZRTD 1BDCA 1LWUC 1HT1E 4JBZA 2C9LY 3HE5B 1VQ9P 2E75C 2WMMA 2XSZA 1XTCC 1WMKA 4LC1A 1EIJA 2B3TA 2R0IA 1U57A 1OAIA 1A02F 2PRRA 1S72P 3P8CD 2DHYA 3EIHA 2LHCA 4PJ0E 5CMZA 1L0ND 3RK2B 2WQYC 2AXCA 5M1BA 1PM5A 4FW9A 1HQCA 2JP7A 2X49A 2B87A 4WVZA 3GPXA 2MKVA 1LTJB 2W82A 3FRHA 1IFYA 1L0NG 1GD2E 2XF3A 2FNAA 4OW0A 3L2AA 3TE6A 1K04A 2BASA 1RE4A 3U5ZB 4WWIA 2C96A 2K47A 3AEEC 2R65A 5KAIE 3USSA 5L8RF 4DBGB 3E7KA 1KV4A 3TF5A 3LQQA 1OW6A 3GLHB 3HY5A 2KEBA 2VF8A 2I7PA 3LIDA 4ZNCA 2OTKE 5BR8M 1S5LH 4ZPXA 2QG4A 2HAKA 2CEAA 5H2FH 2K6BA 5CBOA 1CI6A 3H1KG 5APWA 1LTGC 2A06E 1URQC 2M60A 3JR4A 1BCCD 3QH9A 1RF1C 2D4QA 1MUUA 4RF0A 1LTAC 3HU3A 3VP9A 4GEWA 3UJNA 1DGBA 5FLXS 1USEA 3TGUJ 1L0NJ 4EDFA 1GU4A 1E9RA 5ITUA 4X64M 1XTGB 2QCUA 3D6ZA 1WJ7A 5EP2A 2IBZG 2I7NA 3MIWA 4L74A 5BU8B 1KYOI 1KN7A 3SWFA 1OAOC 1VF5D 3LCUA 2Z3XA 5KPZA 3AL0C 3CCRP 4JF7A 1QVGO 3SC3A 4M9XA 1K3XA 2AXTH 2CK3H 3U6SA 2V7QH 1A02J 3MGNA 2WT7A 1VQ4P 4DR2M 4N78E 1Y9BA 5K5GB 3H1KJ 2V6ZM 3H1LE 4IOIH 3L25A 3V2QA 5EXPA 4IJEA 3TWKA 5KQDA 5AVZB 1S9KD 3RL0C 4GIPA 1GJTA 3PEGA 1FE6A 3M0DC 2R46A 5FTMA 2IYOA 1W5CE 1WIVA 2KUBA 4D82A 3ZDMA 3GRYA 1MFZA 3GQ3A 3IHPA 1IZNB 2L91A 3TNUA 3U5ZA 3TGUG 2H8PD 1M7LA 2W90A 3H1JE 2YNYA 3T1YM 2EJSA 2L4EA 4PV1B 3CPWO 1OJLA 3EFFK 4K3AA 1Z5AA 4OMJA 1MZ9A 3KFUG 2O5RA 2VF7A 1H6UA 4LF6M 5L8RJ 3TDKA 3U59A 2ZT9C 1FJPA 3FGAD 3HGIA 5APTA 1LWUA 1NOHA 3GG2A 1Z6TA 4IBFA 2FXMA 1J09A 1G1JA 3RK2C 1OX3A 1SP4A 1L1TA 2IBZE 2QJYB 1G8PA 1SQBE 1XC8A 1M1JC 4JI5M 3LVWA 4BRYB 4CHTB 1VF5B 2JDIH 1Q3CA 3K5BA 2C9NY 2FY8A 5CCHC 4EI2A 3AECC 3B9PA 3CD6P 1VEKA 3BRVB 3PTZA 4PD4H 3B7NA 2HFED 1IY1A 3A0HE 1LTJA 2XZRA 4JYCA 4NXNM 3S9OA 1GL2C 5CCGC 2MROB 3CGWA 1KC8Q 2XSZD 1ZP0C 2BCCD 1NY6A 1NTKE 1IN8A 3HD7C 2KXEA 2VDBB 4XGIA 4R4MA 5KLVJ 3SAVA 1DGGA 1QL2A 1ZRTE 1JQJC 3H1ID 2KRUA 4D6TD 4PD4D 4B3SM 3T1HM 2E76C 1KILB 2D2CC 5GTHE 4LGYA 4ITQA 2H5XA 3PNYA 2WTYA 3L72J 5EXTA 2X4AA 2ZT9B 2Z4SA 3AEBC 4GMQA 1GL2D 3C9IA 3PH0A 3FE3A 2OARA 1FAVA 4PV1C 1H89A 1DGFA 3L73G 1PJJA 2PFXA 3L29A 4LF5M 2JO1A 5DNYA 2R32A 4HLQA 4G4OA 3TGUE 1LTMA 1TF0B 4KHPM 3H1IJ 4FCVA 3N4XA 2H7HA 4AQYM 4FMMA 1BCCJ 5AW4B 1CSBA 2AXTE 5F3WA 2IX7C 4LJ8A 1SFCA 3Q8XA 1NU1D 2CE7A 4LFBM 1VDLA 2LXBA 1N2DC 3BRTB 2QBYA 2QM8A 1JTHB 3THGA 1GW3A 3LVVA 3HWSA 4QHSA 1V33A 2C9OA 2MH8A 4JI6M 3HUSB 1PP9D 4DR4M 4H0LD 3KP0E 2N35A 2Q5UA 1LP1A 2L2DA 1GJSA 5KO3A 4LF7M 3D71A 3GHGB 4AW4A 3RK3B 4AUWA 2KZUA 2P2UA 3GLFB 1RH5B 4B3RM 4AKIA 3GHGC 1J1EC 4AKHA 1RQUA 2QJKB 1JB0F 1M57D 4RF1A 1IFJA 3P8MC 4EIJA 4X62M 3UZUA 1KFNA 3CF0A 4M9SA 4L16A 2M0BA 4UB8E 3MK6A 1Z59A 3CF6E 3FUXA 4G6ZA 1DX7A 2OYHC 1IBKM 3RK3C 3R9XB 1EFUB 1BSHA 4R3DA 2CV2A 1QZMA 2OYHB 3M7GA 3M91A 3AE3C 1HUCA 4PD4E 1NTZE 1VPCA 2XLJA 3VDPA 4JN6A 5AW3B 1HBWA 5KPRA 3CXHI 1DO2A 4H0LC 1PP9G 1T6OA 3G9RA 1AJYA 1N7SB 4LJ6A 1Q86Q 3B4SA 3L71D 1S2EA 1AQTA 1W5SA 5KKZC 2XH9A 2AEJA 4YHHM 4L73A 2FYNB 2ZM6M 4HB1A 4GHLA 1KB9I 2N1TB 2Y0DA 4DV5M 4F1IA 1CW5A 4QNRA 2DENA 2LVAA 1SQPD 3H32B 4NC6A 1T3UA 2H43A 1OVVA 3CC4P 3TYYA 2XNDH 1OFHA 5CCGA 2O3JA 2RKLA 4PV1D 1NVMA 2ITAA 3KYQA 3H4MA 2P10A 1P84D 3CCQP 2KNVA 4S12A 3L27A 2M5ZA 1USDA 3MD0A 1N77A 1GMJA 1NTZK 1NKNA 1OLME 4H13C 2ZT9D 2J5YA 2P5TA 1HH0A 1JM0A 2OQ4A 2K88A 3MUDA 2O01F 3OW2O 2J5UA 3SWYA 4C7NA 2JJLA 3FTFA 3AOGA 3FUTA 1P84H 3AOEC 2E76D 1YQ4C 1HVVA 1FZCC 5ITTA 1HNWM 2M8RA 3R2PA 2H88C 4XBOA 4JI7M 1GTWA 1NKZB 4RO0A 4II7A 4IBGA 3CLQA 4GDOA 1BSNA 3FKEA 5EFWB 4PD4I 5GTIE 2DI0A 1NSFA 2DNAA 4LJ5A 4Y99B 1ZMWA 1HGVA 1MKMA 1NNJA 1FZAA 1NHWC 2LVOC 3U6DA 3FTDA 4YXDC 2JWDA 2ZVOB 3QYBA 5CCGD 5KLVD 2RH0A 3L73E 1QX8A 3BCCG 1PJTA 2CV0A 3P7KA 2GQFA 3RK3D 2CHGA 1L4AC 1P3QQ 2DWZB 1XXHE 4PT5A 2FBWC 2L7IA 2P1JA 2Q3IA 3R4YA 2NPSD 3MP7B 1OKSA 3LCVB 3RK3E 4DJGA 1NV8A 1AQ5A 2GNOA 4H44D 4BXLA 1JCCA 4CISA 3FWNA 2E5YA 3L4FA 2QSFX 1L0LD 3BBZA 3CL3D 3TL4X 3F89A 1UFZA 1MJGM 4NOOB 4UB8H 1YUBA 3IECA 3RL0B 1YBKA 1SQVD 4A7PA 1G4AE 1BGYD 1K3WA 1SQPG 1GU5A 1H0TA 2X8AA 4OH8B 1EDLA 2Q7CA 2VQEM 3W0LB
chains in the Genus database with same CATH topology
4M8ZA 4OMKA 4TLGA 3W68A 2D4QA 4J7PA 3HX3A 1O6UA 3PG7A 3B7QA 4CJ6A 3W67A 3B7ZA 3HY5A 3B7NA 4FMMA 4CIZA 2E2XA 4UYBA 1R5LA 1OIPA 1OLMA 1OIZA 3B74A 1AUAA 4OMJA 3Q8GA 1OLME 3P7ZA 3PEGA 4J7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M8Z A;  4OMK A;  4TLG A;  3W68 A;  2D4Q A;  4J7P A;  3HX3 A;  1O6U A;  3PG7 A;  3B7Q A;  4CJ6 A;  3W67 A;  3B7Z A;  3HY5 A;  3B7N A;  4FMM A;  4CIZ A;  2E2X A;  4UYB A;  1R5L A;  1OIP A;  1OLM A;  1OIZ A;  3B74 A;  1AUA A;  4OMJ A;  3Q8G A;  1OLM E;  3P7Z A;  3PEG A;  4J7Q A; 
#chains in the Genus database with same CATH topology
 3IG8 A;  5C39 A;  4RNA A;  4OU7 A;  4LGD E;  3TGU D;  3HHW A;  2G8L A;  2Y21 A;  1YI2 P;  1L0N E;  4D81 A;  1NAF A;  1Q39 A;  1JY2 N;  4I1L A;  3MZW B;  3FXE A;  1R5S A;  2QEN A;  3NFQ A;  5KLV K;  2Q2E B;  1GK6 A;  1IXS B;  4UN2 B;  2C0W A;  2D2C B;  5CHX A;  4WY4 C;  1OFC X;  2WSE F;  2WPR A;  3SAR A;  1J1D C;  4IBI A;  1IFP A;  3K8Z A;  4IFM A;  4H13 B;  2C0X A;  4H44 C;  1L0L G;  1SQQ J;  1ZV1 A;  4PD2 A;  1PPJ E;  2R3C A;  4N3Y B;  4IFF A;  1LV7 A;  3KSJ A;  1DD3 A;  3M9B A;  1HF9 A;  1Q82 Q;  1D2N A;  4JXJ A;  3E21 A;  2VRS A;  2WSC F;  2KA6 B;  4GRI A;  3VMZ A;  4KHX A;  3Q8G A;  1RF0 C;  5CCH A;  3H32 A;  4OVN F;  1KSF X;  4MH0 E;  4LZJ A;  3SSU A;  1MFT A;  3W67 A;  3TPZ A;  1IXS A;  5KJ7 D;  1QAO A;  2O01 N;  1DV0 A;  4L76 A;  4UB6 H;  3I51 A;  3HE4 B;  3FUW A;  4CIZ A;  4OX9 M;  7CAT A;  2B89 A;  3L74 D;  1SQX J;  2YMK A;  3EIE A;  1P84 E;  3WHL A;  1S4X A;  3KPE A;  4RKU J;  3RBX A;  3TNU B;  2UUA M;  1GLN A;  1Q02 A;  1PIX A;  4QHT A;  3I01 M;  3E1I A;  1YLA A;  4XFJ A;  2V4H A;  1ZOY C;  3H1L J;  4IBJ A;  3SAU A;  1RHZ B;  2FFD A;  1OZH A;  1D7M A;  2DVW B;  1QUS A;  2GUS A;  1QDR A;  2OYO A;  3K2L A;  2O01 H;  3V2P A;  2HWJ A;  1KD1 Q;  4H13 D;  4MN4 C;  1SQB J;  1WXQ A;  2DWL A;  3K92 A;  2AEM A;  3GF7 A;  3L72 E;  2KW0 A;  4LCB A;  4WY4 A;  2L5G B;  3H4J A;  3V4W A;  4O9B A;  3ZQJ A;  1AVY A;  1SQQ E;  1BE3 J;  3PRJ A;  1NJG A;  3CX5 D;  3AOE A;  3GW6 A;  1OXZ A;  2DKL A;  4OGQ B;  4R7G A;  4EYY Q;  3L35 A;  3M9H A;  1GL6 A;  1R8E A;  2IZ1 A;  2G3A A;  3RL0 g;  2J7N A;  1J5E M;  5ITR A;  2ZJS E;  1TR8 A;  4DT0 A;  3HE4 A;  3KS8 A;  2L09 A;  3TWL A;  3IG5 A;  3L74 J;  3HHX A;  2R62 A;  4LRT A;  4QNM A;  4IL6 E;  2WSC H;  1L2B A;  3GLH E;  2BCC G;  1MV8 A;  1J1D B;  4R71 A;  1JTH A;  2Y9Z A;  3GPU A;  1RF0 A;  4GKG A;  3P32 A;  2F5P A;  1ZR4 A;  2ZAN A;  2E5T A;  3B5N A;  2CFO A;  2C9C A;  4AG6 A;  1CI6 B;  1IFM A;  5JI3 E;  1XNR M;  3GP1 A;  2E2X A;  1GO5 A;  5KPT A;  1ZXG A;  1BE3 E;  3LW5 H;  3L71 E;  5FTK A;  2QZ4 A;  2M3B A;  1D0M A;  2IZ0 A;  2W27 A;  1NWQ A;  3P7Z A;  4MM3 B;  2Z5H A;  2N9Y B;  4L4U A;  1FZF A;  1EQ7 A;  1HJ0 A;  1SQP E;  4HEO A;  1KYO E;  1LJ2 A;  3A7O A;  1T8Z A;  4DV1 M;  2O1K A;  2HL7 A;  2ZVN B;  1LNQ A;  1FDI A;  3A46 A;  3CXH D;  4JPZ B;  3C9P A;  4AKG A;  1J2J B;  1WR1 B;  1S3J A;  4B86 A;  5EQT A;  3RL0 D;  3K1J A;  4JYA M;  2FH0 A;  4CGY B;  1S5L X;  2QJP C;  1QAM A;  2KHH A;  2UXB M;  2L6O A;  2XNX A;  3GRR A;  3Q5R A;  2KZS A;  4IBD A;  2FYN C;  2F5O A;  3V5B A;  3T15 A;  1H8A A;  4NPE A;  3HZJ A;  3PLN A;  1OMI A;  2JUJ A;  4Y99 C;  2DAM A;  2E74 C;  1YIT P;  2HCB A;  1JMB A;  1YJN P;  3CC7 P;  5TIS H;  3JC2 2;  3FUV A;  4JYB A;  1QAN A;  2VII A;  1E79 H;  1SQV J;  3CWB D;  1NO1 A;  1NU1 G;  1LT1 A;  5KJ7 A;  2EO2 A;  1IY2 A;  2DW3 A;  2QRX A;  4RJT A;  1DD4 A;  1WT6 A;  1SQQ G;  1L4A A;  1ZAE A;  1L4A D;  3RE8 A;  1U7M A;  1QAQ A;  2G3Q A;  4G4Q A;  3NBI A;  2LXC B;  4D6T J;  3BCC E;  3B5N C;  3VKG A;  2XFS A;  1G71 A;  1R2Y A;  2ERC A;  1OIP A;  3L37 A;  1BVS A;  3GRV A;  1XHB A;  2R18 A;  3SWK A;  3AE8 C;  1E9S A;  2UWJ E;  4PDI A;  3H1I E;  2QE7 H;  2NPS C;  1F4I A;  1URQ B;  3U6Q A;  1PZQ A;  3VP8 A;  4BLC A;  1JR3 E;  5C18 A;  1OWA A;  3HU2 A;  3EWK A;  1EZV I;  1YJW P;  4GIF A;  3L26 A;  3L72 G;  2Y0C A;  4AI6 A;  2DHR A;  4FWG A;  1PPJ D;  1IC2 A;  3GLH A;  2R5B A;  1VQP P;  4EOT A;  1KB9 D;  2R44 A;  3GQ4 A;  4D80 A;  1EZV D;  2ZYG A;  3DA1 A;  1G59 A;  3O6Q A;  1N7L A;  4DV3 M;  2N1T C;  1Q2N A;  1LTT C;  2F5Q A;  2M3E A;  3DOA A;  2UUC M;  1PGY A;  4OVZ B;  3GO8 A;  3U1C A;  2Y0Q A;  1NTZ G;  1JNM A;  5EP1 A;  2DZN B;  1L4A B;  5AVU B;  3J2P B;  3AKZ A;  1BGY J;  1LWU B;  2QSI A;  4HKZ H;  1VQN P;  1PPJ G;  2LHG A;  1KIL A;  3GLF E;  1L0N K;  1OW7 A;  3A0B H;  1GL2 B;  3H1K E;  1L2D A;  2DAE A;  1SS1 A;  5AW1 B;  3SMS A;  1C7Y A;  1VEJ A;  2AEF A;  2FYU G;  4KT0 J;  4B7G A;  1IFD A;  4B7H A;  1IN5 A;  2UXD M;  1SFC C;  3QYE A;  3WHK A;  2RKO A;  4I2L C;  3TK1 A;  2QNJ A;  4X65 M;  3WUV A;  3L75 D;  1KB9 E;  1VQO P;  1M8O B;  2QA4 P;  3CCL P;  2HHH M;  1NNU C;  2XZU A;  2WSF J;  1QQW A;  1VDF A;  1SQQ D;  3J80 S;  2A45 I;  2K9Y A;  1EXJ A;  3C3D A;  1KYO D;  2YQZ A;  2Y0T A;  4OVZ A;  4GHA A;  3MUD C;  1S3S A;  2BNK A;  1KZU B;  3WU2 E;  1M1J B;  1AFO A;  5DYI A;  5AVW B;  1U7J A;  3KVW A;  1IQP A;  5GKN A;  4J7P A;  1NTM G;  4GKJ M;  1VEG A;  3I04 M;  3L75 G;  2BWB A;  2F5N A;  3IN6 A;  3GLF A;  4D6T E;  3OA7 A;  3SAT A;  4X66 M;  1KIL E;  1DGH A;  2HPC A;  2WSE H;  2QM7 A;  3RFW A;  3KOZ E;  5DJU B;  1M90 Q;  1DEE G;  4XE5 B;  2F5S A;  3L70 E;  3V76 A;  3G6E P;  2IBZ D;  3CCE P;  3HD7 B;  4Q7J A;  2SPZ A;  1YYC A;  4IJF A;  2I8D A;  4AYC A;  3C1L A;  2JY5 A;  3E4R A;  2K9D A;  1QGK B;  4HYT B;  4XA4 A;  1JY3 P;  3H1H D;  1X37 A;  1H0T B;  2K1A A;  3ITK A;  3HHY A;  1K73 Q;  1SFC B;  2YMY A;  3H1H E;  1Z5C A;  1PFI A;  5LMU M;  1QVR A;  2FKW B;  3CCU P;  1JEK A;  1NTM D;  1BCC G;  1H88 A;  1G2C A;  1X79 B;  1LT9 A;  2PP6 A;  1QVF O;  2WPQ A;  1NTZ D;  4NRV A;  2QPA A;  1S5L E;  2JEE A;  3HKP A;  2O25 A;  1IN4 A;  2LWX A;  2LH0 A;  3SHF A;  1NTM J;  2DWM A;  4WUR A;  1GW4 A;  5CJ4 A;  4NSO B;  1VQM P;  3MMP A;  4DV6 M;  3T6P A;  2PGD A;  1SQV K;  2CRU A;  2D7E A;  4TUW A;  2KLV A;  3A2A A;  2A06 D;  3A0B E;  1FOS E;  3J7A S;  2YR0 A;  3PP5 A;  4U7J A;  4ANR A;  1Q90 D;  2KK7 A;  3PFI A;  3L72 D;  4I7Z B;  4ZKP A;  2YO3 A;  1IBM M;  2Z8Y M;  3HX3 A;  3H1J D;  1N73 C;  4ASV A;  4Y28 J;  4OGQ D;  3I5C A;  3H1J G;  4GT1 A;  5B5E H;  3JR5 A;  2Z4E A;  1E32 A;  2BEZ F;  2KZJ A;  1PRB A;  3FWL A;  1C1K A;  3V6I A;  2IYP A;  3KZI H;  2CHV A;  2OQQ A;  1ZLL A;  3CI9 A;  3L74 E;  4J7Q A;  4QOS A;  3I4Y A;  3FTE A;  5EP3 A;  2M5A A;  2FE8 A;  3WUT A;  1GDT A;  1G2C B;  2MJZ A;  4L15 A;  3AE1 C;  3F5H A;  1KB9 H;  1Z56 A;  4REZ A;  3A3Y B;  1OFI A;  2APL A;  4PDG A;  3KXD A;  1HJB A;  3VDU A;  2WWW A;  1J1E B;  4ZMD A;  3UK6 A;  1OIZ A;  2ZFC A;  4C7R A;  3AEA C;  4IIW A;  5IZ7 D;  2ZAM A;  1Q81 Q;  2YKP A;  3KS4 A;  2HYN A;  3GPP A;  1SXJ A;  4R4L A;  4Z8X A;  3ZH9 B;  1V92 A;  2G5G X;  3SFD C;  1SQB D;  4JI2 M;  3DFZ A;  2KI7 B;  3LQR A;  3KDS E;  3OAK A;  4GOE A;  1R4G A;  3SAS A;  1PV3 A;  2K9J A;  1K05 A;  3H1H G;  4WY4 D;  3GLG A;  2E75 D;  3G4S P;  3E9S A;  5DJT B;  2LTU A;  4HH2 A;  3HTK A;  2W8Z A;  3L28 A;  1NTK G;  2QIW A;  3HJ8 A;  1L0L J;  1YE9 A;  3JAM S;  1SQX E;  4M0W A;  4B08 A;  5ITX A;  1AV1 A;  1SVF A;  4FD2 A;  3IR9 A;  2OYI A;  3K9P A;  1NJF A;  3VMX A;  1LTI C;  2BEQ D;  1VQ5 P;  1JY3 O;  3CWB E;  4I6M C;  1SFC D;  3MTU E;  2OYI B;  2J58 A;  3A0H H;  1W2B O;  2JNH A;  2KB7 P;  1DO0 A;  5BU5 A;  1CZQ A;  1SQV E;  2GUV A;  1QLE D;  1SQB K;  4OMK A;  4Y28 F;  3WMM 0;  1L8Q A;  4IBE A;  2F4V M;  3F92 A;  4TLF A;  3KSX A;  1KIL C;  3U6E A;  2NQ8 C;  2XZF A;  2W6B A;  1L1Z A;  1VQ1 A;  3AEG C;  1PGJ A;  3KHU A;  3B8E B;  1HT2 E;  1NTK K;  2WIT A;  2WSS H;  2P58 A;  1N36 M;  1KFV A;  4NRW A;  1VF5 C;  2K3R A;  4I81 A;  1KQL A;  1SXJ C;  4MGH A;  3HU1 A;  2WSE J;  3VN0 A;  3H25 A;  3J7B A;  3KOW E;  4GKK M;  2PAJ A;  1S1C X;  3HD7 D;  3II6 A;  3VK7 A;  1RE4 C;  1Y8A A;  1BE3 G;  2HPC B;  3I55 P;  2QJK C;  2H1R A;  3DZD A;  3PXG A;  2KS1 B;  3SYK A;  2MR9 A;  1ZMU A;  5EJC A;  1YTZ I;  2MGW A;  2NPS A;  1XXH A;  2ZXX A;  5B5E E;  1QL1 A;  3GRU A;  4LJ4 A;  1A5T A;  3KQG A;  1EDI A;  3IFM A;  5KLV G;  2ZAE B;  2YNM D;  3SAW A;  4DR1 M;  5AVS B;  3ZCB B;  4MGY E;  2OTL P;  2FFD C;  5AVQ B;  2YXQ B;  4WBA A;  2CV1 A;  5JI2 E;  5AW7 B;  1DEB A;  1EZV G;  1KQG B;  3OJA B;  3A42 A;  3KDP B;  2JZ0 A;  3L74 G;  2RGO A;  2HLO A;  2JR8 A;  2BCC J;  3N7N A;  3LW5 F;  4AZF A;  2Q9I A;  1N73 A;  2Y20 A;  2Z7J A;  2IDB A;  2QHO B;  4BBA A;  1GKI A;  1GL2 A;  3AFH A;  4G4N A;  1N75 A;  3PHL A;  3GLI A;  1IXR C;  2N1T A;  1Y8G A;  3HD7 A;  3L70 G;  3MJ5 A;  2BJV A;  4DUZ M;  2HG5 D;  2KSE A;  3E46 A;  4EIW A;  1AIP C;  1LTB C;  1Z5B A;  3V4Q A;  2ZYA A;  3FXD A;  2HKJ A;  2G8Y A;  2IBZ I;  3U6O A;  1K9M Q;  1N34 M;  3UMM A;  3KP1 E;  4U3F G;  1FZC A;  4JV5 M;  1GL7 A;  3D70 A;  1T3T A;  1XMO M;  4LF4 M;  1RE3 A;  1HTL C;  3Q5P A;  1XXH B;  4LFC M;  3S4R A;  4IL6 H;  1LT9 B;  3CX5 E;  1NY5 A;  4LJ7 A;  1PJQ A;  3M0E A;  3D8B A;  2WPS A;  5E6J A;  3I56 P;  3U6L A;  2J59 M;  5BPV A;  4M8Z A;  4RKU F;  3RGP A;  1FJK A;  1NTK J;  3BAT A;  1Y47 A;  3L71 G;  1LTS C;  4NL4 H;  1P84 I;  1ZN5 A;  3GHG A;  3FUU A;  2OOA A;  4DR5 M;  4GC9 A;  1NV9 A;  1S9K E;  3ILK A;  3HRN A;  3B5N D;  3VK8 A;  2B87 B;  1SQV G;  4JI0 M;  1N78 A;  5APX A;  1OQY A;  2EKK A;  2L4F A;  4JQ0 D;  5AW8 B;  4W7Y A;  4MGZ E;  1URQ D;  1N7S C;  5DYG A;  2DAG A;  5GTH H;  4LG2 A;  4I4L A;  2WZ7 A;  1M1J A;  4Z1M H;  3SFE C;  2R4E A;  4KT0 F;  3NXS A;  1FJG M;  2KP8 A;  4QMA A;  4GC5 A;  2JWA A;  5APV A;  4KLN A;  1FNN A;  1L0L K;  3BCC D;  4A3V B;  2Y0E A;  3SFZ A;  1ORY B;  3M6A A;  3LW5 J;  5TJH A;  4DR6 M;  1JMM A;  4FVM A;  3CCS P;  4U3F E;  1WGL A;  1BDD A;  1N8R Q;  4G3O A;  3LMM A;  3FYD A;  1NTM K;  2E76 B;  5TIS E;  3PG7 A;  5AW5 B;  1N7S D;  3D6Y A;  1N73 B;  3EFG A;  1MN3 A;  4YTP C;  3W0F A;  1RE3 C;  3K9O A;  1YIJ P;  2FOI C;  3CX5 I;  1K8A Q;  1OLM A;  2JWS A;  2IFN A;  4GIT A;  5C1B A;  2YXR B;  1NJI Q;  5AW9 B;  4P17 A;  2O1J A;  1VQ8 P;  3U6C A;  2E75 B;  2C5R A;  1LTJ C;  5APU A;  3G3Z A;  1QDT A;  3RGU A;  2O01 J;  1AA0 A;  4WY4 B;  1FU1 A;  4DV0 M;  4DV2 M;  1HNX M;  1URQ A;  3AED C;  2WZJ A;  3GPY A;  2L7H A;  3L73 D;  3CF2 A;  5APY A;  1GK4 A;  2RGH A;  1KQF B;  4MGK E;  2UUB M;  1IFI A;  3J81 S;  2KYV A;  2QJY C;  4XK8 F;  2QEX P;  4W5W A;  4JI8 M;  1NHL A;  2KS1 A;  2R5D A;  1OW8 A;  1I94 M;  1PJI A;  5KLV E;  1FS0 E;  2M5A B;  2WPV B;  3U61 B;  4CPG A;  1V34 A;  2W6A A;  5DFL A;  3Q5S A;  3S1K A;  3AJI B;  1L0L E;  2YKO A;  1FZE A;  4KJM A;  1D0K A;  1UM8 A;  1EC5 A;  2R4J A;  1R6B X;  3SBJ A;  3C3E A;  3PJS K;  2LKM A;  2N1T D;  3VTP C;  3C8V A;  2EKF A;  2D7H A;  2XV5 A;  3Q2Y A;  3OTO M;  1XNQ M;  1KYI A;  3CX5 H;  2K37 A;  1IJD B;  2KZI A;  1VG5 A;  5KAF H;  1IM2 A;  4OWF A;  1L2C A;  2KIK A;  5H2F E;  2POH A;  1D0L A;  1M56 D;  3JCU H;  3CMA P;  1JOC A;  1G1I A;  2DAI A;  1SQP J;  2YIU C;  4PCZ A;  1SQX K;  1NU1 J;  4B7F A;  3WUU A;  3Q3D A;  4DV4 M;  4M3L A;  4ZKU A;  2FFD B;  4KOD A;  1RF1 A;  1HGZ A;  1SG9 A;  1OVR A;  1T2K D;  1ZW0 A;  2P7J A;  2KOG A;  3L71 J;  1YSY A;  4BRY A;  1KIL D;  1M1K Q;  4N78 D;  2NZ2 A;  1GVN A;  2KSJ A;  1J7K A;  4LF8 M;  5CBN A;  2XKM A;  2DWN A;  2BWE A;  1N7S A;  2FYU K;  1ZQ9 A;  3GLG B;  4DV7 M;  1XMQ M;  1N32 M;  4ASW A;  4LY6 A;  2JY7 A;  4I5S A;  2FYZ A;  1PJS A;  3AV0 A;  3E1R A;  2JXN A;  2VQF M;  3O8Z A;  3CME P;  1KTM A;  4TT3 H;  1HWT C;  3CCV P;  1HR0 M;  4JI4 M;  3WU2 H;  4GOF A;  1TDH A;  1T43 A;  1I4W A;  1NGM B;  3FRI A;  2K9J B;  5FTJ A;  3A5T A;  1PGP A;  5FTN A;  2CWB A;  3B74 A;  2RMZ A;  3U1A A;  2JZ1 A;  1NTZ J;  4LF9 M;  1GZL A;  3HUS A;  3U61 A;  1BGY G;  4K0K M;  1PP9 E;  2NRG A;  2AHM A;  1CUK A;  5ITQ A;  1NU1 K;  2XEP A;  2KNZ A;  3MHV A;  2NPS B;  1LP1 B;  2XGN A;  4KO8 A;  3FYC A;  2FYU J;  2ZYD A;  5AVY B;  1X9V A;  1QUT A;  4H44 B;  1QZE A;  3H6P A;  1LT9 C;  2YO2 A;  5E26 A;  1TH3 A;  3CCM P;  1IXZ A;  5AW0 B;  3L70 D;  3W68 A;  2C98 A;  3VYI A;  4WB4 A;  2Y9Y A;  1FZB A;  3H1I G;  5KTB A;  2KXP B;  1SQB G;  1ZR2 A;  2DXI A;  5KAF E;  3HTK B;  5KKZ B;  1IN6 A;  3B71 A;  5EP4 A;  1T6A A;  1Q7Y Q;  4DR7 M;  1RY3 A;  3JCU E;  3KXE C;  4YXW H;  2UXC M;  3HHZ A;  2R45 A;  3CTW B;  2KNC A;  1R7R A;  5AVX B;  2BJW A;  4LFA M;  1O6U A;  3FX0 A;  2LVP C;  3NTN A;  3IF4 A;  4YY3 M;  3L75 J;  4DOJ A;  4NXM M;  3QWO C;  3AE2 C;  1R5L A;  2UU9 M;  5KJ7 C;  2WT7 B;  4GH9 A;  2OTJ P;  4I8O A;  4AG5 A;  1PGQ A;  3L75 E;  4IFD K;  5B66 E;  3J27 B;  3HJS A;  2CHQ A;  2I1K A;  3RK2 D;  1GAB A;  1EXI A;  1JY2 O;  5FSW A;  3A98 B;  5IWA M;  2W6J H;  3H1H J;  1PP9 J;  4C46 A;  4B3M M;  1FC2 C;  3BOS A;  1R2Z A;  2DZO B;  2YFQ A;  3RGS A;  1QEX A;  3NBX X;  2EUC A;  1SXJ E;  1AUA A;  1NAY A;  5BVZ A;  2E42 A;  1TU3 F;  1VDD A;  1WHC A;  4MB7 A;  3U60 B;  5H37 D;  1JY3 N;  4FCT A;  1NH4 A;  4MGI E;  5CJ0 A;  1TH4 A;  1VQ6 P;  2LR2 A;  4FWD A;  3GMA A;  2XFT A;  2ZTC A;  1WGN A;  1SXJ B;  1KQS O;  1OTR A;  4WP2 A;  4CJ6 A;  4I7Z C;  1DH3 A;  3TWM A;  1DGH B;  5LMN M;  1N33 M;  5E79 E;  5EXX A;  3P8C E;  3R8F A;  3C58 A;  2GA1 A;  3QWL A;  1VL2 A;  4C7N B;  1G41 A;  2OO9 A;  2KLU A;  4LZZ A;  2FYU E;  4K35 A;  3CWB J;  3O6Q B;  1X8Y A;  2FXO A;  1LGH B;  2E74 D;  4M0D A;  3CXH H;  3PNV A;  2FXP A;  3T97 B;  2EA0 A;  3TQS A;  5KLI B;  1K82 A;  4G4R A;  3VMY A;  4Z6Y A;  1MX0 A;  2XU6 A;  3L73 J;  5IT9 S;  2Q1K A;  1RF1 B;  1EZV E;  3NWL A;  1XB2 B;  3M9Q A;  1IK7 A;  4FCW A;  4UYB A;  1NTK D;  3HUS C;  1G3I A;  1E5W A;  1MU5 A;  1HNZ M;  4NSR A;  2QBY B;  1ZME C;  5FTL A;  2D7G A;  2IPP A;  3VFD A;  1RU3 A;  3JSV C;  3H1J J;  2WSF H;  3AE7 C;  1X0T A;  1AVO A;  3H1L D;  1UIX A;  2MJ5 B;  2Z5I A;  3LIE A;  3M06 A;  3QAU A;  1UII A;  2OYH A;  4GOD A;  1QYR A;  4H0L B;  4HJG H;  2A45 H;  3HE5 A;  2R6F A;  1FBM A;  1IY0 A;  3KOY E;  4DR3 M;  3I4V A;  4IL6 X;  5AW2 B;  2DZL A;  3BCC J;  1BGY E;  1IN7 A;  5IRE B;  3AE4 C;  3AE5 C;  5AVR B;  4IBB A;  3GQ5 A;  1IBL M;  5EXS A;  1TH2 A;  2OOB A;  3CCJ P;  1NHG C;  3ABV C;  4M9Z A;  1YJ9 P;  2RRU A;  2B88 A;  5AVT B;  2FFJ A;  2R3S A;  3U6M A;  4AQR D;  1X22 A;  2LNH C;  1NO4 A;  4U3F D;  1L2P A;  2QP9 X;  3PVS A;  4BB9 A;  3TSI A;  4JI1 M;  2ZBK B;  1KYO H;  3BXW A;  2QQ8 A;  3KOX E;  2LBC A;  2OYI C;  1RQV A;  3B7Q A;  3GLI E;  5B66 H;  1FDM A;  2LVN C;  4IBC A;  4HL4 A;  2CPB A;  2CP8 A;  3D8L A;  4D6T G;  2Q6Q A;  1JY2 P;  3BVH A;  2N9B A;  4WW0 A;  4YPC A;  1Q3B A;  1ZMV A;  1FZG A;  1IO4 A;  4LJA A;  4DZO A;  4W80 A;  1FOS F;  1E94 E;  1IK9 A;  3T38 A;  2W83 C;  1IFN A;  5ITY A;  1T2K C;  3A45 A;  1PGO A;  3GLG E;  1FZC B;  2ZXE B;  2E43 A;  5A2Q S;  1NTM E;  4LLH A;  2D2C D;  1T3J A;  4RES B;  3CXH E;  3UIA A;  3L36 A;  3NMD A;  1YQ3 C;  5CCH D;  1TGU A;  2HR3 A;  3MHV C;  3M0D A;  2E74 B;  5GTI H;  3VKH A;  3BAS A;  2GM4 A;  3U6P A;  3HJQ A;  5E79 H;  1EDJ A;  1OVU A;  1VQL P;  3B89 A;  4L78 A;  3U60 A;  5AW6 B;  2DAK A;  2JKV A;  1W2E A;  1JB0 J;  1KOR A;  1WRG A;  1N86 A;  3V2R A;  2JY8 A;  4OGQ C;  1BE3 D;  4PJ0 H;  3VLF B;  3RBZ A;  2KNA A;  1SQP K;  2OPF A;  2A45 G;  3KW6 A;  1EDK A;  4B3T M;  2KDL A;  2RN0 A;  1BCC E;  8CAT A;  2HOD A;  5KAI H;  2E5L M;  2K0B X;  2V7Q J;  1JO5 A;  1KFM A;  1KMI Z;  5AVV B;  4QOZ C;  2A06 G;  3Q1M A;  2P67 A;  3AEF C;  3VOP A;  2H89 C;  2Z4R A;  2V1C A;  3GF3 A;  3AE9 C;  4IBK A;  2KRK A;  1YTZ T;  1HJP A;  4DCK A;  4F2L A;  1SQX G;  1EE8 A;  3CWB G;  4N6J A;  3IAO A;  3CC2 P;  3EQ2 A;  2CUZ A;  3GLM A;  2KNC B;  1SQX D;  1NVO A;  2ZTD A;  2LVQ D;  3B5N B;  3UGJ A;  1SXJ D;  4LJ9 A;  4L6V 6;  3H1L G;  2FS1 A;  1DIP A;  1SLQ A;  4DUY M;  1FDO A;  4NPF X;  5ITX E;  2OGU A;  4NPD A;  3VMA A;  3G71 P;  1JR3 D;  2LXE A;  3SYL A;  2WSF F;  3FTC A;  1JR3 A;  3L70 J;  2WSC J;  1XWI A;  2ZAO A;  1NYH A;  1SQQ K;  5APS A;  1VQ7 P;  1JUN A;  3M0A A;  1HQY E;  2QVA A;  2CPS A;  2FYU D;  1ZV8 A;  3GLI B;  2IFM A;  2YIU B;  3KZI E;  2V1U A;  2C99 A;  2QJP B;  4P16 A;  4W7Z A;  1TDZ A;  2HOD B;  2Q3E A;  5KQ8 A;  3SMP A;  3V2N A;  5APQ A;  1NU1 E;  4L8R C;  2BCC E;  1JCD A;  2WVR A;  2J7O A;  1VQK P;  1W5T A;  1TTE A;  3FD9 A;  2JY6 B;  4L75 A;  2JP3 A;  2A5Y B;  4FWH A;  3SHG B;  2XDJ A;  2YKQ A;  3H1K D;  4LGM A;  4JI3 M;  3AE6 C;  4U3F J;  4UB6 E;  1PL5 A;  4TLG A;  3ZC7 B;  4BWN A;  4LRS A;  1YHQ P;  2JA2 A;  2B9B A;  3B7Z A;  2I1J A;  5KLI C;  3T97 A;  1ZRT D;  1BDC A;  1LWU C;  1HT1 E;  4JBZ A;  2C9L Y;  3HE5 B;  1VQ9 P;  2E75 C;  2WMM A;  2XSZ A;  1XTC C;  1WMK A;  4LC1 A;  1EIJ A;  2B3T A;  2R0I A;  1U57 A;  1OAI A;  1A02 F;  2PRR A;  1S72 P;  3P8C D;  2DHY A;  3EIH A;  2LHC A;  4PJ0 E;  5CMZ A;  1L0N D;  3RK2 B;  2WQY C;  2AXC A;  5M1B A;  1PM5 A;  4FW9 A;  1HQC A;  2JP7 A;  2X49 A;  2B87 A;  4WVZ A;  3GPX A;  2MKV A;  1LTJ B;  2W82 A;  3FRH A;  1IFY A;  1L0N G;  1GD2 E;  2XF3 A;  2FNA A;  4OW0 A;  3L2A A;  3TE6 A;  1K04 A;  2BAS A;  1RE4 A;  3U5Z B;  4WWI A;  2C96 A;  2K47 A;  3AEE C;  2R65 A;  5KAI E;  3USS A;  5L8R F;  4DBG B;  3E7K A;  1KV4 A;  3TF5 A;  3LQQ A;  1OW6 A;  3GLH B;  3HY5 A;  2KEB A;  2VF8 A;  2I7P A;  3LID A;  4ZNC A;  2OTK E;  5BR8 M;  1S5L H;  4ZPX A;  2QG4 A;  2HAK A;  2CEA A;  5H2F H;  2K6B A;  5CBO A;  1CI6 A;  3H1K G;  5APW A;  1LTG C;  2A06 E;  1URQ C;  2M60 A;  3JR4 A;  1BCC D;  3QH9 A;  1RF1 C;  2D4Q A;  1MUU A;  4RF0 A;  1LTA C;  3HU3 A;  3VP9 A;  4GEW A;  3UJN A;  1DGB A;  5FLX S;  1USE A;  3TGU J;  1L0N J;  4EDF A;  1GU4 A;  1E9R A;  5ITU A;  4X64 M;  1XTG B;  2QCU A;  3D6Z A;  1WJ7 A;  5EP2 A;  2IBZ G;  2I7N A;  3MIW A;  4L74 A;  5BU8 B;  1KYO I;  1KN7 A;  3SWF A;  1OAO C;  1VF5 D;  3LCU A;  2Z3X A;  5KPZ A;  3AL0 C;  3CCR P;  4JF7 A;  1QVG O;  3SC3 A;  4M9X A;  1K3X A;  2AXT H;  2CK3 H;  3U6S A;  2V7Q H;  1A02 J;  3MGN A;  2WT7 A;  1VQ4 P;  4DR2 M;  4N78 E;  1Y9B A;  5K5G B;  3H1K J;  2V6Z M;  3H1L E;  4IOI H;  3L25 A;  3V2Q A;  5EXP A;  4IJE A;  3TWK A;  5KQD A;  5AVZ B;  1S9K D;  3RL0 C;  4GIP A;  1GJT A;  3PEG A;  1FE6 A;  3M0D C;  2R46 A;  5FTM A;  2IYO A;  1W5C E;  1WIV A;  2KUB A;  4D82 A;  3ZDM A;  3GRY A;  1MFZ A;  3GQ3 A;  3IHP A;  1IZN B;  2L91 A;  3TNU A;  3U5Z A;  3TGU G;  2H8P D;  1M7L A;  2W90 A;  3H1J E;  2YNY A;  3T1Y M;  2EJS A;  2L4E A;  4PV1 B;  3CPW O;  1OJL A;  3EFF K;  4K3A A;  1Z5A A;  4OMJ A;  1MZ9 A;  3KFU G;  2O5R A;  2VF7 A;  1H6U A;  4LF6 M;  5L8R J;  3TDK A;  3U59 A;  2ZT9 C;  1FJP A;  3FGA D;  3HGI A;  5APT A;  1LWU A;  1NOH A;  3GG2 A;  1Z6T A;  4IBF A;  2FXM A;  1J09 A;  1G1J A;  3RK2 C;  1OX3 A;  1SP4 A;  1L1T A;  2IBZ E;  2QJY B;  1G8P A;  1SQB E;  1XC8 A;  1M1J C;  4JI5 M;  3LVW A;  4BRY B;  4CHT B;  1VF5 B;  2JDI H;  1Q3C A;  3K5B A;  2C9N Y;  2FY8 A;  5CCH C;  4EI2 A;  3AEC C;  3B9P A;  3CD6 P;  1VEK A;  3BRV B;  3PTZ A;  4PD4 H;  3B7N A;  2HFE D;  1IY1 A;  3A0H E;  1LTJ A;  2XZR A;  4JYC A;  4NXN M;  3S9O A;  1GL2 C;  5CCG C;  2MRO B;  3CGW A;  1KC8 Q;  2XSZ D;  1ZP0 C;  2BCC D;  1NY6 A;  1NTK E;  1IN8 A;  3HD7 C;  2KXE A;  2VDB B;  4XGI A;  4R4M A;  5KLV J;  3SAV A;  1DGG A;  1QL2 A;  1ZRT E;  1JQJ C;  3H1I D;  2KRU A;  4D6T D;  4PD4 D;  4B3S M;  3T1H M;  2E76 C;  1KIL B;  2D2C C;  5GTH E;  4LGY A;  4ITQ A;  2H5X A;  3PNY A;  2WTY A;  3L72 J;  5EXT A;  2X4A A;  2ZT9 B;  2Z4S A;  3AEB C;  4GMQ A;  1GL2 D;  3C9I A;  3PH0 A;  3FE3 A;  2OAR A;  1FAV A;  4PV1 C;  1H89 A;  1DGF A;  3L73 G;  1PJJ A;  2PFX A;  3L29 A;  4LF5 M;  2JO1 A;  5DNY A;  2R32 A;  4HLQ A;  4G4O A;  3TGU E;  1LTM A;  1TF0 B;  4KHP M;  3H1I J;  4FCV A;  3N4X A;  2H7H A;  4AQY M;  4FMM A;  1BCC J;  5AW4 B;  1CSB A;  2AXT E;  5F3W A;  2IX7 C;  4LJ8 A;  1SFC A;  3Q8X A;  1NU1 D;  2CE7 A;  4LFB M;  1VDL A;  2LXB A;  1N2D C;  3BRT B;  2QBY A;  2QM8 A;  1JTH B;  3THG A;  1GW3 A;  3LVV A;  3HWS A;  4QHS A;  1V33 A;  2C9O A;  2MH8 A;  4JI6 M;  3HUS B;  1PP9 D;  4DR4 M;  4H0L D;  3KP0 E;  2N35 A;  2Q5U A;  1LP1 A;  2L2D A;  1GJS A;  5KO3 A;  4LF7 M;  3D71 A;  3GHG B;  4AW4 A;  3RK3 B;  4AUW A;  2KZU A;  2P2U A;  3GLF B;  1RH5 B;  4B3R M;  4AKI A;  3GHG C;  1J1E C;  4AKH A;  1RQU A;  2QJK B;  1JB0 F;  1M57 D;  4RF1 A;  1IFJ A;  3P8M C;  4EIJ A;  4X62 M;  3UZU A;  1KFN A;  3CF0 A;  4M9S A;  4L16 A;  2M0B A;  4UB8 E;  3MK6 A;  1Z59 A;  3CF6 E;  3FUX A;  4G6Z A;  1DX7 A;  2OYH C;  1IBK M;  3RK3 C;  3R9X B;  1EFU B;  1BSH A;  4R3D A;  2CV2 A;  1QZM A;  2OYH B;  3M7G A;  3M91 A;  3AE3 C;  1HUC A;  4PD4 E;  1NTZ E;  1VPC A;  2XLJ A;  3VDP A;  4JN6 A;  5AW3 B;  1HBW A;  5KPR A;  3CXH I;  1DO2 A;  4H0L C;  1PP9 G;  1T6O A;  3G9R A;  1AJY A;  1N7S B;  4LJ6 A;  1Q86 Q;  3B4S A;  3L71 D;  1S2E A;  1AQT A;  1W5S A;  5KKZ C;  2XH9 A;  2AEJ A;  4YHH M;  4L73 A;  2FYN B;  2ZM6 M;  4HB1 A;  4GHL A;  1KB9 I;  2N1T B;  2Y0D A;  4DV5 M;  4F1I A;  1CW5 A;  4QNR A;  2DEN A;  2LVA A;  1SQP D;  3H32 B;  4NC6 A;  1T3U A;  2H43 A;  1OVV A;  3CC4 P;  3TYY A;  2XND H;  1OFH A;  5CCG A;  2O3J A;  2RKL A;  4PV1 D;  1NVM A;  2ITA A;  3KYQ A;  3H4M A;  2P10 A;  1P84 D;  3CCQ P;  2KNV A;  4S12 A;  3L27 A;  2M5Z A;  1USD A;  3MD0 A;  1N77 A;  1GMJ A;  1NTZ K;  1NKN A;  1OLM E;  4H13 C;  2ZT9 D;  2J5Y A;  2P5T A;  1HH0 A;  1JM0 A;  2OQ4 A;  2K88 A;  3MUD A;  2O01 F;  3OW2 O;  2J5U A;  3SWY A;  4C7N A;  2JJL A;  3FTF A;  3AOG A;  3FUT A;  1P84 H;  3AOE C;  2E76 D;  1YQ4 C;  1HVV A;  1FZC C;  5ITT A;  1HNW M;  2M8R A;  3R2P A;  2H88 C;  4XBO A;  4JI7 M;  1GTW A;  1NKZ B;  4RO0 A;  4II7 A;  4IBG A;  3CLQ A;  4GDO A;  1BSN A;  3FKE A;  5EFW B;  4PD4 I;  5GTI E;  2DI0 A;  1NSF A;  2DNA A;  4LJ5 A;  4Y99 B;  1ZMW A;  1HGV A;  1MKM A;  1NNJ A;  1FZA A;  1NHW C;  2LVO C;  3U6D A;  3FTD A;  4YXD C;  2JWD A;  2ZVO B;  3QYB A;  5CCG D;  5KLV D;  2RH0 A;  3L73 E;  1QX8 A;  3BCC G;  1PJT A;  2CV0 A;  3P7K A;  2GQF A;  3RK3 D;  2CHG A;  1L4A C;  1P3Q Q;  2DWZ B;  1XXH E;  4PT5 A;  2FBW C;  2L7I A;  2P1J A;  2Q3I A;  3R4Y A;  2NPS D;  3MP7 B;  1OKS A;  3LCV B;  3RK3 E;  4DJG A;  1NV8 A;  1AQ5 A;  2GNO A;  4H44 D;  4BXL A;  1JCC A;  4CIS A;  3FWN A;  2E5Y A;  3L4F A;  2QSF X;  1L0L D;  3BBZ A;  3CL3 D;  3TL4 X;  3F89 A;  1UFZ A;  1MJG M;  4NOO B;  4UB8 H;  1YUB A;  3IEC A;  3RL0 B;  1YBK A;  1SQV D;  4A7P A;  1G4A E;  1BGY D;  1K3W A;  1SQP G;  1GU5 A;  1H0T A;  2X8A A;  4OH8 B;  1EDL A;  2Q7C A;  2VQE M;  3W0L B; 
#chains in the Genus database with same CATH homology
 4M8Z A;  4OMK A;  4TLG A;  3W68 A;  2D4Q A;  4J7P A;  3HX3 A;  1O6U A;  3PG7 A;  3B7Q A;  4CJ6 A;  3W67 A;  3B7Z A;  3HY5 A;  3B7N A;  4FMM A;  4CIZ A;  2E2X A;  4UYB A;  1R5L A;  1OIP A;  1OLM A;  1OIZ A;  3B74 A;  1AUA A;  4OMJ A;  3Q8G A;  1OLM E;  3P7Z A;  3PEG A;  4J7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...