3W68A

Crystal structure of mouse alpha-tocopherol transfer protein in complex with alpha-tocopherol and phosphatidylinositol-(4,5)-bisphosphate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
251
structure length
251
Chain Sequence
b'QPGLAELRRRVQEAGVPQTPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRAECPELSADLRPRSILGLLKAGYHGVLRSRDSTGSRVLIYRIAYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGWQVSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKDRIHLHGNNYKSSMLQHFPDILPREYGGKEFSMEDICQEWTNFIMKSEDYLSSISE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-tocopherol transfer protein
publication title Impaired alpha-TTP-PIPs interaction underlies familial vitamin E deficiency
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 91
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
A PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.20 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 N-terminal domain of phosphatidylinositol transfer protein sec14p 3w68A01
1.20.5.1200 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Alpha-tocopherol transfer 3w68A02
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 3w68A03
1R5LA 3Q8GA 3B74A 3PG7A 4FMMA 2E2XA 1AUAA 4CJ6A 3B7QA 1OIZA 3B7NA 3B7ZA 3W67A 4TLGA 4CIZA 4J7PA 4J7QA 1OIPA 3W68A 3HY5A 4OMJA 1O6UA 3P7ZA 2D4QA 3PEGA 3HX3A 4UYBA 1OLME 4OMKA 4M8ZA 1OLMA
chains in the Genus database with same CATH superfamily
3H1LD 1TDZA 3HHZA 4D6TD 1DH3A 1HBWA 2EKKA 1NGMB 4GDOA 5CCHA 4L8RC 1K05A 3CCMP 1DD3A 3L29A 4J7QA 2XFSA 1IFNA 3H1IJ 4AI6A 2XLJA 3HUSA 5AW1B 4RNAA 1VQOP 1RY3A 2N35A 3SC3A 1AVYA 3O6QB 1GL2C 3MMPA 4IIWA 1JQJC 3U6OA 4FMMA 1JNMA 4L78A 1N78A 1S4XA 5IZ7D 3IECA 1BSHA 3E21A 3U61B 4J7PA 2UUBM 2QQ8A 1RQUA 5FTJA 3OW2O 1VQPP 4LCBA 4W5WA 1IY0A 1L0NK 1PP9G 1NU1G 1KTMA 3T15A 1NJGA 1YJ9P 5APQA 4G4RA 3CWBG 2WSFF 1JR3D 3MJ5A 2Z4SA 1P84E 4UB6E 3TGUJ 4PD2A 5APUA 4NRWA 2DXIA 1NOHA 3KZIE 4IFMA 3Q5RA 2ZYGA 1LJ2A 4OGQB 1UM8A 4IBDA 1NTZG 3CX5E 1Q82Q 2I7PA 2BCCJ 2IYOA 2K9JA 1CUKA 4IFFA 1J7KA 1RH5B 3RK3E 3GHGC 4WB4A 1GL2A 5AW3B 2HYNA 1HNZM 3ZCBB 3M0DC 1IN8A 3LIEA 5APXA 4IL6H 4IBEA 3KOXE 2YR0A 1SQXG 3AEGC 1JR3A 3VTPC 3B5ND 4JPZB 4O9BA 1SXJB 2XSZA 1NO1A 1CI6A 3I55P 3VKHA 1LP1A 1W5SA 1PGOA 1OAIA 4PD4H 2FE8A 2IBZE 3IR9A 3I4VA 4HEOA 3L36A 1OFCX 2WITA 3C58A 3G3ZA 1L0LG 2A5YB 2FYNB 1G2CB 1L1ZA 1URQB 4OX9M 2R0IA 3A3YB 2P2UA 4JI6M 4DR5M 2H7HA 2OPFA 3RGPA 3UGJA 2JO1A 5APSA 2Y0CA 1VG5A 2BCCD 1QDRA 4OGQC 1GK4A 4M0WA 2NQ8C 2O01N 3GHGA 3M0DA 2X49A 3O6QA 4H0LB 3FUUA 3KOYE 2BJWA 3UZUA 1SQBG 2QBYA 1TU3F 4GC9A 5C1BA 1JY3N 1SXJC 3T6PA 3U61A 1EDKA 1VF5B 1RE3C 4QMAA 4GT1A 3A46A 3EQ2A 2KHHA 4GIFA 3RK2D 4KODA 4F1IA 4LF5M 2FY8A 4WP2A 4AKGA 4K3AA 4IJFA 2IZ0A 3HGIA 3HWSA 1U7JA 4FWGA 3C8VA 1KC8Q 3KW6A 1KORA 1YQ4C 2FYNC 3A5TA 3L70E 1URQC 2PRRA 5M1BA 2A06E 2QM8A 1KFMA 1SFCD 1K73Q 4PJ0H 1MZ9A 3DOAA 3BCCE 2K47A 1T3UA 3FWNA 4G4OA 1L0NG 3TDKA 3C3EA 5EFWB 4B08A 2LBCA 1HJ0A 1RHZB 4H0LC 3GLGB 2GUSA 1N7SB 3P8MC 3RGSA 2QJKC 2R18A 4GODA 3WU2E 3SYKA 1H0TB 1SXJA 8CATA 3FTEA 3SMSA 1SQPD 1RE3A 3GLIE 3HTKB 1R2YA 2G8YA 3H1LG 1VF5C 4D6TG 1DEBA 3ITKA 3G4SP 4EYYQ 3AE5C 4DUZM 3K2LA 3VLFB 4JI3M 3Q2YA 3L2AA 3H1HE 1URQA 1HUCA 4QOZC 4NC6A 5EXXA 1XNRM 1VQ9P 1LTAC 2Z5HA 4PD4I 3DA1A 1VF5D 1XXHE 3SHFA 1USDA 1ZRTD 2QNJA 2VIIA 2X4AA 1X79B 3QYEA 1Y47A 4R4LA 2UU9M 3AV0A 1N7SC 2YKPA 3GPYA 3NBXX 3MK6A 1W5CE 5BU5A 2WSEH 1L2CA 2CRUA 3EWKA 3ZDMA 3CCUP 1JTHB 2KNAA 4JI8M 3VFDA 3ZQJA 3SBJA 2ZVNB 3RBXA 1VQMP 2OTJP 2VQFM 5GTHH 4BBAA 1WRGA 1VQ6P 4L74A 1HTLC 3V76A 5AVTB 4XK8F 3CWBE 3P7ZA 1QQWA 2KK7A 1L2PA 4MGIE 3B89A 1N7LA 3KXDA 2E76B 1YLAA 4L15A 3H1JJ 1JMBA 4B3TM 1RF1B 1NTZE 1OIZA 1C7YA 2KSJA 1FZGA 4KJMA 4B7HA 1NAYA 1FS0E 1S5LH 2A45H 4Y28F 1T6OA 3GLGA 1YSYA 2OTLP 1N7SA 2YKQA 3KOZE 1ZR2A 5KLVD 3TYYA 3KOWE 1KFNA 4NXMM 1H0TA 1NTKJ 1D7MA 2OGUA 1SQXE 2YMKA 4FW9A 2EA0A 3NXSA 3HTKA 1XTCC 2P10A 2I7NA 5ITXA 3G9RA 3HZJA 1NY5A 3B7NA 2X8AA 1ZV8A 2IYPA 2E75B 1FNNA 1Q3CA 3L74D 2LVOC 4DOJA 1UIIA 2ZTDA 3TWLA 4DR1M 2KXPB 2JJLA 3T38A 4JI0M 2K9YA 1L0LE 4CIZA 3CMEP 2BCCG 1OWAA 4TLFA 1JB0J 3CMAP 2P58A 2JXNA 2UWJE 3LW5F 3U1CA 4OU7A 4IL6E 1ZMWA 1NVOA 1V34A 3AE2C 4OH8B 2E76C 1IFJA 1ZN5A 3T1HM 1PJTA 5AW0B 1RF1C 3PP5A 2WZ7A 4BWNA 1M1JB 4GKKM 1H89A 1JOCA 2QRXA 2LXEA 1SP4A 3TSIA 2EUCA 4Z6YA 4DR7M 2RKLA 4PD4E 3W67A 3KP1E 1PJJA 1NHGC 4L4UA 1ZAEA 2ZT9D 3E46A 5GTIH 1WIVA 3E7KA 3SASA 2Y0QA 1JTHA 2LVAA 5AVZB 1JY3O 3I04M 2ITAA 4GOEA 2Q7CA 2DZOB 1K3WA 1Z56A 3QH9A 4IBBA 5AW7B 3D6YA 3J7AS 4YTPC 2JY5A 1PFIA 3M9QA 4JI4M 2W6JH 1VQ5P 4U7JA 4PDGA 2HR3A 3BVHA 3O8ZA 1PL5A 1PIXA 1QVRA 1OIPA 1ZV1A 2FBWC 3A0BH 2WSCJ 4I2LC 3QWOC 1RF1A 4IBJA 1NTMD 1M7LA 5KJ7D 2KNZA 4R3DA 5CBOA 1PP9J 1NU1J 3K8ZA 3K5BA 4AUWA 1L0NE 1R7RA 1KV4A 1M1JC 1SQPG 4MB7A 3QWLA 3GO8A 4QHSA 1BCCJ 2KYVA 1YITP 1J09A 1D2NA 2DW3A 2HODB 5KTBA 4WWIA 1JY3P 5L8RJ 1FJKA 2A45I 3RL0B 3VMZA 1Q81Q 1FAVA 1NJIQ 2H5XA 2L4FA 1P3QQ 3L72D 1ZMUA 4U3FD 2LWXA 4D6TE 4LGMA 5AVYB 2FFDB 1H6UA 1SQXJ 1DO2A 2V6ZM 2FFJA 4LJAA 2C9LY 1NTKK 1YI2P 1IJDB 3R2PA 5CJ4A 4X65M 2MH8A 4C7RA 3TQSA 1YIJP 2O01F 3V2NA 3L35A 1FDIA 1JMMA 2MJZA 5AW8B 3HX3A 1K04A 5CJ0A 1YTZT 4WY4D 3GPPA 3F92A 1M1JA 1KQLA 1GABA 1TH2A 1HWTC 3SFZA 5FLXS 5BU8B 3CD6P 3KQGA 1BCCD 1LTTC 4M3LA 1UIXA 3BATA 1FJGM 4DV2M 4LGDE 1EC5A 1WGNA 3H1KD 1YJWP 4Z8XA 2FKWB 1FZAA 2W27A 3CF0A 1OKSA 4QNMA 5JI3E 3RL0C 3EIHA 2R5DA 3GRUA 3K9OA 3NFQA 3T97A 2KA6B 1AJYA 1Q90D 1KD1Q 2C9OA 3IG5A 5ITRA 2FFDC 1SQBJ 3CF6E 4LRSA 1QVFO 4B7GA 3CCQP 3H1IE 1DGGA 2Z8YM 3PNYA 4AQYM 3L75D 1HVVA 3LQRA 2KNVA 5KLVG 4HH2A 4HYTB 3HU1A 2OQ4A 4LJ6A 1IFIA 2H1RA 1NAFA 3I01M 1T3JA 2KDLA 4BRYB 1RQVA 1YBKA 4X64M 1OXZA 5GKNA 1KILD 2HODA 3L74G 4MGYE 5GTHE 3CCVP 3GLHE 1EFUB 1GZLA 3HE5B 3A2AA 1IZNB 2K88A 2R62A 3B7ZA 3D6ZA 2R65A 1NU1K 1PGYA 1M1KQ 1MJGM 3A0HH 2KZIA 1OTRA 1IBLM 4GHLA 2FFDA 1WXQA 2HPCB 1NO4A 2OOBA 3TGUE 1PJQA 2O1JA 3GRYA 3OJAB 1NY6A 2QG4A 2WPQA 3AE6C 1IN7A 1S5LE 2K37A 2M0BA 1NNJA 3H1LJ 2ZYDA 2BCCE 5AVXB 2VF8A 1R5SA 4D6TJ 1BE3D 1GJSA 2ZVOB 1EIJA 1VDDA 1SQXK 2WMMA 4CGYB 4IFDK 3P8CD 3VMAA 1BGYD 3C3DA 4KT0F 2B89A 2FXPA 5APVA 1E94E 1DEEG 2Y0TA 2ERCA 5AW5B 3THGA 4RF1A 2E5LM 2XZFA 3GQ3A 1F4IA 2QE7H 5CCHD 1L2DA 3LCUA 1TGUA 1Z5BA 1SQVD 1HT1E 2XZUA 3LMMA 3GG2A 1Z6TA 3Q1MA 3CCLP 2GA1A 1I94M 1DV0A 2CPSA 4QNRA 2Y0DA 2JA2A 1Q02A 4RF0A 1WJ7A 1OW7A 2Z4RA 5DJUB 2LNHC 1YJNP 4M0DA 2E2XA 1OZHA 5CCGC 2J58A 3J2PB 2MROB 2IFMA 2ZXEB 2KS1B 4GH9A 2KNCB 5GTIE 2HG5D 1AQ5A 1SQBK 3U5ZB 1J2JB 2WSCH 3L26A 3D8BA 2UUAM 4XA4A 2LVNC 2GQFA 2APLA 3L72G 5H2FH 1MFTA 3QYBA 2WSEJ 3HE5A 1KSFX 1MN3A 4U3FG 3M9BA 3H32B 1IFMA 3UJNA 2P1JA 1QL2A 1L2BA 2XEPA 1S1CX 3OTOM 1QL1A 3KXEC 3A0BE 2HPCA 1OMIA 1TH3A 3MZWB 4I1LA 3WMM0 2DENA 2OOAA 2YIUB 1GL2D 1PJIA 2JWSA 4DZOA 3FUWA 4QHTA 1ZR4A 1QUSA 1ZRTE 1KQFB 2JY7A 1Y9BA 3EFFK 2W8ZA 1TF0B 1X37A 1A5TA 1S3SA 1EZVD 2UXDM 2DVWB 2XSZD 1BCCG 2OYHB 4C7NB 2L7HA 2P5TA 1GKIA 2LHCA 3H1KG 2JY8A 4II7A 2FXMA 3HHYA 2D7HA 3PVSA 4EI2A 1XB2B 4AZFA 1GJTA 2CP8A 2R5BA 3MGNA 4OVZA 1LTSC 3L71D 5BPVA 1NKZB 5FTMA 4CISA 1A02F 1HQYE 1GL7A 1IN5A 2KW0A 2KOGA 4PCZA 4YHHM 1L1TA 3LW5J 1NVMA 3CCJP 4MGZE 5DFLA 1G1JA 3L75G 2E5YA 1FZEA 2YIUC 1VDFA 4L75A 3E4RA 4W80A 2J5YA 4AKHA 2JKVA 3PH0A 1OQYA 1L8QA 3GLMA 2CV2A 4FVMA 2M3EA 3WHKA 2KNCA 1M57D 2JZ0A 2OYOA 1GU4A 1CZQA 2E74B 4A7PA 3TNUB 3FUVA 3L73J 3B9PA 4RJTA 4KLNA 3QAUA 3SWKA 2OO9A 3K9PA 3VMXA 2Q3EA 3SMPA 4JI1M 1NYHA 3H32A 3L74E 4GKJM 1JY2O 3AOGA 2WVRA 5AW2B 4EOTA 1EDJA 4PV1B 2C9NY 3SARA 2Y9ZA 1SQPJ 4OGQD 3CCSP 1PGJA 3MUDC 3L28A 1TDHA 3HKPA 3AEFC 5K5GB 3IFMA 5KQ8A 1YYCA 4GMQA 4FCWA 1BE3G 3HD7B 3F89A 2BNKA 1WT6A 2R4EA 3AE3C 1VEKA 5AW4B 4R71A 3H1JE 5E79H 2R45A 4JYCA 1X8YA 3UK6A 1BGYG 4B3MM 3GLFE 4RESB 1SXJD 3SYLA 1SQQD 4C7NA 2M3BA 3CPWO 2E74C 4L6V6 5E26A 5DYIA 2L4EA 3L73D 1OVRA 1NTKE 3GQ4A 1GW3A 3FWLA 1PM5A 3A0HE 2IPPA 3M9HA 4ZMDA 4D80A 3U6CA 1SQVG 1GL6A 1JY2P 2Q9IA 1E32A 3HHXA 3FRHA 4M9SA 5KPTA 1KMIZ 1PPJG 3VK7A 1I4WA 1URQD 2B87B 3PRJA 3ZC7B 1S9KD 2KI7B 3MUDA 4N78D 4PV1C 3RK3B 2PAJA 1HF9A 1HGVA 2KB7P 4TUWA 2R3CA 3PJSK 1KYIA 3HD7C 4H0LD 3K1JA 2R44A 2OYIB 2DAIA 3VK8A 1G2CA 1LWUB 3FYCA 3AEAC 2Q6QA 3TNUA 2HCBA 3VDPA 1N32M 1IC2A 3PLNA 4H13B 4WW0A 3FRIA 1WHCA 1WR1B 2R3SA 4BXLA 1ZMEC 3FTCA 2LVQD 1USEA 5AVVB 4DV4M 1LTIC 2B9BA 5AVQB 3AEDC 5KLVJ 1EQ7A 3L72E 4U3FE 1EXIA 2V1CA 1E9RA 2N1TB 2CHVA 2ZFCA 4DCKA 3RK3C 4NSRA 1LTMA 2QHOB 3HD7A 3L74J 3CC2P 1P84D 3BOSA 3CTWB 1EZVG 5APTA 3SSUA 1XNQM 1N7SD 4B86A 1FZFA 2OYIC 2FYUJ 2O1KA 3CX5D 1DGBA 1PP9E 5BR8M 1NU1E 1SQPK 2K6BA 1BDCA 1LWUC 2F5QA 3RK3D 4Q7JA 1LTJB 1QGKB 4NPDA 1GDTA 1BCCE 3TWMA 1VEGA 2IFNA 4ZKUA 4GIPA 3JSVC 3PG7A 2CWBA 3FX0A 5AVWB 3U6EA 2NPSB 2OARA 1FZCB 1EXJA 3L71G 3RE8A 4JXJA 2LVPC 2B87A 2L5GB 2XZRA 5EP2A 2XF3A 2RH0A 4N6JA 3V2PA 4LF6M 2N9BA 3MHVC 2YXQB 3V5BA 2KRKA 1FE6A 4JF7A 1Q86Q 2R4JA 1HGZA 1HJBA 2JR8A 1JCDA 1VEJA 1NHLA 4DV5M 2KLVA 4OW0A 3VKGA 1PJSA 5FTNA 1AV1A 4LGYA 1IQPA 2HAKA 4KHPM 1Q39A 4LJ4A 5LMNM 2OYIA 1IN6A 5E6JA 1QLED 5JI2E 3L75E 2Z3XA 3LW5H 1JO5A 2ZAOA 2FYUD 3G6EP 3PHLA 3GLIB 1LWUA 3RL0g 3GRRA 5AW6B 2CHQA 4LF7M 2O25A 4MN4C 2F5OA 2M8RA 2Q1KA 2ZJSE 2YO2A 3WUVA 1LTJC 1T2KC 4HLQA 5TJHA 4KHXA 2LH0A 1YQ3C 2YO3A 1KILE 2JY6B 2DAKA 2RGHA 1NTMJ 3H25A 3BRTB 2JP7A 3U6MA 5CHXA 1T3TA 1QZMA 5LMUM 3U6PA 1PGQA 3BASA 1N36M 1XXHB 1GTWA 3C9IA 1EZVI 5KAFH 1G1IA 1SQBE 1PRBA 3N7NA 1ZQ9A 3VYIA 2E76D 4XBOA 1OLME 1IXSB 2GNOA 4MM3B 3L72J 2PFXA 4NSOB 2E75C 1GK6A 4U3FJ 3KSXA 3I56P 2A06D 2KZSA 5KLVK 4GKGA 4LZZA 1OFIA 3VOPA 1IK7A 2JWAA 3L73G 2O5RA 4N3YB 2Q3IA 2ZBKB 1LTJA 1WGLA 4G4QA 4EDFA 2Z5IA 2BEZF 1ZP0C 3OA7A 1AFOA 3HU2A 2E75D 2V7QJ 3KS8A 3UIAA 4ASWA 2WTYA 2FYUK 4AYCA 3U1AA 1FC2C 4REZA 1NNUC 4GITA 1LNQA 2WWWA 3JAMS 3GQ5A 1XC8A 2P7JA 3U6LA 3A45A 2KXEA 3AJIB 1PPJE 2AEFA 3H1KJ 5E79E 3AKZA 4FCTA 4ZNCA 3CC4P 3FYDA 4YPCA 2QEXP 1FJPA 3H1LE 1EE8A 2WSFJ 3M0EA 2KRUA 4PJ0E 2QZ4A 1YHQP 3FXEA 3GLIA 1X0TA 3ILKA 1P84H 2D7GA 3WUTA 4LFAM 3Q5PA 1YE9A 4G3OA 2POHA 4Y99B 2HL7A 2D7EA 2W83C 1G8PA 2FNAA 3L75J 1HH0A 2K3RA 1PZQA 2UXCM 2C0WA 3Q8XA 3JC22 4OMKA 4AKIA 1XXHA 4P16A 1Y8GA 1MFZA 3AE4C 2D2CB 3S1KA 2LXBA 3ZH9B 3B71A 4D82A 3PNVA 1JUNA 2I1JA 5DYGA 5ITQA 4LY6A 1QEXA 1NTMK 2IDBA 1IXSA 2BWBA 4L73A 5B5EH 1G3IA 2OQQA 3PEGA 1QUTA 1N73B 3NBIA 5APYA 1LV7A 3HU3A 2YNYA 4JI7M 1JR3E 3L4FA 2ZAEB 2L2DA 4NRVA 1N86A 3RL0D 1MKMA 3R4YA 4Y99C 4GEWA 3FTDA 5EQTA 3SHGB 3SAWA 1BE3J 3U59A 1FDOA 1GU5A 2J59M 2C0XA 1JCCA 2E5TA 4H44B 1BGYJ 2C98A 5EXSA 1M56D 1R5LA 1DGHB 2XGNA 3L71E 2F4VM 3MTUE 1R4GA 1GO5A 2D2CC 3Q5SA 1KB9D 1CSBA 3GPXA 1YUBA 1NSFA 3CCRP 2FYUG 3LQQA 2LTUA 1SQVJ 3U6SA 2AXTH 2RMZA 1QAMA 3VP9A 1N73C 3GF7A 3U60B 1VL2A 3HE4B 3PTZA 1KZUB 3L25A 1V92A 4LFBM 4X62M 1NHWC 4I5SA 1FBMA 1PV3A 4WBAA 4JI2M 1IY1A 2GM4A 3D71A 4PD4D 2XKMA 1P84I 1XWIA 2QENA 4S12A 1NKNA 3M06A 3VP8A 4H44C 1U57A 1L4AB 3CX5I 4DV0M 3SFDC 1BDDA 4I81A 4JQ0D 4LFCM 3FKEA 4AQRD 1BSNA 1MX0A 3I4YA 1AUAA 5ITUA 2GUVA 3M0AA 1FOSE 1D0KA 2A06G 2F5SA 3CXHD 3E9SA 4UN2B 5AVSB 2FS1A 2WT7B 3RGUA 5DJTB 4K35A 3VMYA 1IK9A 1SXJE 3T1YM 3FGAD 2RKOA 3H4JA 3HJSA 4D81A 3L73E 1FZBA 1NTMG 3SFEC 4L76A 1HR0M 2B3TA 3S9OA 2PGDA 5KAFE 5H37D 1HQCA 1W2BO 2V7QH 4BRYA 1E79H 1DGHA 4GHAA 1L4AC 3TWKA 3J27B 4ASVA 3M7GA 1OAOC 1SQPE 2W90A 1FDMA 3JCUH 2XU6A 1E9SA 4UB8H 3V6IA 5CCGD 4AW4A 1T6AA 4RO0A 5KQDA 2ZYAA 2CUZA 3B5NB 4EIWA 3M91A 2H89C 3MIWA 5AVRB 4WURA 3L71J 5CBNA 1IXZA 3FTFA 5B66H 4IBKA 1AQTA 1PGPA 1L4AD 3Q3DA 4XE5B 3U60A 2RGOA 3GLHB 4OMJA 3GHGB 1O6UA 1Y8AA 1GVNA 2WSCF 3HE4A 2WSFH 2DAGA 1AA0A 1V33A 3GP1A 4B3RM 3SWYA 3Q8GA 1K9MQ 5CCGA 1QANA 2LXCB 1OVVA 1SQVK 2QBYB 3RFWA 4Y28J 3AL0C 3KP0E 5F3WA 2Y21A 2AXCA 4M9XA 1JM0A 4DT0A 3MP7B 2FXOA 4DR6M 2DHYA 1L4AA 2Z4EA 5L8RF 4LC1A 3VDUA 2YFQA 1OW8A 2IX7C 2R6FA 5KPZA 4WVZA 2HFED 5ITYA 3VN0A 2L09A 4LF8M 2Y20A 3DFZA 3K92A 3J80S 2AHMA 3TL4X 5AVUB 2CHGA 3GLGE 3B5NC 3AE8C 1Z5CA 1KB9H 4JV5M 2WT7A 2F5PA 3H1ID 4G6ZA 2ZANA 4ZKPA 4DV1M 3AEBC 2H88C 4FCVA 4PDIA 5IT9S 3RK2B 2XNXA 4RKUF 2ZM6M 5ITXE 1LTGC 3EFGA 2RRUA 2QCUA 3GRVA 3NTNA 3KDSE 2KS1A 2KLUA 1ZXGA 3P32A 1S72P 1SQQJ 4FD2A 5EJCA 3U5ZA 1N33M 2OYHC 2Q2EB 1SFCB 3MD0A 5KLVE 5TISH 2WSSH 2QSIA 1RU3A 5CMZA 3J7BA 2FH0A 1NWQA 5B5EE 3GF3A 2G3QA 2C5RA 2MGWA 4R7GA 4DR4M 1KQGB 1EDIA 2AEMA 4IL6X 4UYBA 4P17A 3SATA 3M6AA 3TGUD 1BVSA 3B5NA 2UXBM 1J1EB 1QVGO 4CJ6A 2FYUE 1NV9A 2MKVA 1KYOD 2XV5A 2M5AB 4QOSA 1OFHA 3I5CA 3GLHA 3AE9C 3CXHH 1EDLA 2CFOA 3FD9A 2EKFA 2CEAA 1N2DC 3P7KA 3RK2C 2EO2A 3L27A 2QJKB 5IWAM 2KIKA 2JEEA 5KKZB 2L7IA 1G41A 3W0LB 4IJEA 4AG5A 3U6DA 2OYHA 4I6MC 1N77A 2MR9A 5IREB 2VDBB 2QJPB 3FE3A 1SG9A 2JP3A 3RBZA 1SFCC 4HJGH 1Q7YQ 4R4MA 4DBGB 1E5WA 2AXTE 4LJ5A 2Y0EA 2EJSA 2Z7JA 5EXTA 1IBMM 1KN7A 2E74D 2F5NA 1J1EC 2DZNB 2QJYB 3SAVA 5FTLA 1R2ZA 1GMJA 1ZW0A 3GPUA 2JWDA 3KHUA 2K9DA 2O01J 4MGKE 1M90Q 5EXPA 1T8ZA 5KPRA 1DGFA 2OTKE 3TE6A 1KFVA 4BLCA 1KB9I 1WMKA 7CATA 2J7OA 2BWEA 3AECC 5KKZC 1NTME 4FWDA 1U7MA 4PV1D 4M8ZA 1SFCA 3C1LA 2VF7A 2QJPC 1VQKP 1OX3A 3L37A 3HD7D 4EIJA 2G8LA 1XTGB 3IAOA 3DZDA 4OVNF 4G4NA 5EP1A 3TK1A 3II6A 2W6BA 3KPEA 1SQQK 1YTZI 2E42A 2VQEM 2DAEA 4HL4A 1R8EA 1HNXM 1ORYB 2E43A 2M5AA 2BJVA 2LKMA 5EP3A 3NMDA 2C96A 2QJYC 3PFIA 4IBFA 1K8AQ 1X22A 2H8PD 1H8AA 5APWA 2CV0A 2KSEA 3UMMA 2Q5UA 3W0FA 2M60A 2MJ5B 2JZ1A 3PXGA 1LGHB 3CXHI 3JCUE 1LT9B 5H2FE 1HNWM 1DX7A 1SS1A 4UB8E 2O3JA 2WSEF 3H6PA 3AE7C 1MU5A 4DJGA 3FUTA 4H13C 5EP4A 3OAKA 4I8OA 3WHLA 3ABVC 3H1KE 5B66E 3GLFB 3E1IA 1OVUA 2M5ZA 4IOIH 1S3JA 3G71P 2YKOA 3H1IG 3HY5A 1KQSO 3FUXA 1VPCA 3TF5A 2IBZD 2N1TC 1Z59A 3GW6A 2ZT9B 4LJ8A 1QX8A 4H13D 2L6OA 2NRGA 4YXDC 3CI9A 2J7NA 2RN0A 3L70J 4DV6M 1AVOA 1KYOH 3AOEC 3IF4A 1VQ7P 1IM2A 2HKJA 2CV1A 2R46A 3HJ8A 2K1AA 1IXRC 2N1TD 3BCCJ 3USSA 1SVFA 2KEBA 1QDTA 3IHPA 4KT0J 1IO4A 1LT9C 3BRVB 3TPZA 1C1KA 4DR3M 2YXRB 1XMOM 1GLNA 2SPZA 2WPSA 3B74A 3FXDA 3TGUG 2H43A 1KB9E 1DO0A 1S5LX 3B7QA 3IN6A 2NPSC 2WPRA 3AFHA 1FZCC 3IG8A 2A45G 4AG6A 2C99A 2DWMA 3V4QA 3MHVA 1CW5A 4F2LA 2N1TA 2XDJA 1T2KD 1IFYA 4JBZA 2QA4P 1FOSF 2C9CA 1Z5AA 4B7FA 2B88A 2ZT9C 3LCVB 3H1JD 4W7ZA 5KAIH 1N34M 2FYZA 1TTEA 3H1HJ 2NPSD 4NL4H 3AOEA 3L70D 1T43A 5TISE 2KZJA 1SQQG 2XNDH 1BE3E 1ZOYC 1AIPC 1UFZA 1NTKD 3BCCD 1DIPA 3H4MA 1Q2NA 4OWFA 1DD4A 1LT9A 3P8CE 1J5EM 4TT3H 1BGYE 4MGHA 4LG2A 4LJ7A 1G4AE 2L91A 4CPGA 2I8DA 1IBKM 2NZ2A 1NJFA 4NXNM 3HRNA 2WZJA 3T97B 4LF9M 2NPSA 3GLFA 1FZCA 2DZLA 5KJ7C 2DKLA 4IBCA 4WY4B 3LVWA 4JN6A 3CL3D 1W2EA 3CXHE 2LHGA 3CCEP 2DHRA 1SQVE 1QYRA 2DAMA 2FOIC 3KFUG 1QAQA 3R9XB 4NPEA 5FTKA 2WQYC 3H1HD 1LT1A 2JDIH 1IFDA 3CWBJ 4JI5M 1GW4A 1VQ1A 3S4RA 1Q3BA 2QVAA 5BVZA 4UB6H 2O01H 2V1UA 4JYAM 3V4WA 3KZIH 3LVVA 4A3VB 1NTZJ 3SAUA 3B4SA 3C9PA 4L16A 5FSWA 1KYOI 3CX5H 1QAOA 5KJ7A 2HWJA 1G59A 2YQZA 4W7YA 1K82A 2QM7A 4WY4C 4I7ZB 2KP8A 4LJ9A 1A02J 4LLHA 1TH4A 3AE1C 4ITQA 5C18A 3KS4A 1KILB 2XH9A 3JR4A 1MV8A 4XGIA 1N75A 1IFPA 2HLOA 1D0LA 4RKUJ 3I51A 3SWFA 3D8LA 4Z1MH 1PP9D 1VQLP 3E1RA 4MH0E 1NU1D 1L0LJ 1G71A 3EIEA 2YNMD 1OW6A 3CWBD 4DUYM 4C46A 2BEQD 1RE4C 1H88A 2KUBA 1X9VA 1EZVE 4HB1A 1LTBC 1NH4A 1GD2E 1S2EA 1NTZD 1VQ8P 2VRSA 4YXWH 2CPBA 3A7OA 2CE7A 4TLGA 3CGWA 4FWHA 3A98B 3KVWA 2K0BX 2CK3H 1HT2E 3AEEC 2G5GX 5DNYA 3R8FA 4WY4A 1K3XA 3BXWA 4CHTB 1SQXD 1R6BX 2IBZG 1ZLLA 4NPFX 4I7ZC 1RF0C 2P67A 3V2RA 2DWLA 4YY3M 1KILC 4ZPXA 4DV7M 3U6QA 1VQNP 1N8RQ 1VDLA 5C39A 4GRIA 4X66M 2J5UA 4IBGA 2ZTCA 1L0LD 4LF4M 3KDPB 2D4QA 1JEKA 1RE4A 2KZUA 1XMQM 2G3AA 2D2CD 3HUSB 2R32A 1IN4A 4DR2M 1VQ4P 5KLIB 2DWZB 4B3SM 2ZAMA 1JY2N 1J1DB 1OJLA 2QIWA 1L0NJ 3D70A 4KO8A 1FU1A 4BB9A 5A2QS 4I4LA 3J81S 2XFTA 2WPVB 2JNHA 3NWLA 1SLQA 2Y9YA 2DI0A 5ITTA 4K0KM 1SQBD 2JUJA 1RF0A 3B8EB 3LIDA 3WU2H 1NTZK 4HKZH 3H1JG 2HHHM 1KILA 4GOFA 2IZ1A 1KYOE 3CLQA 3L70G 4GC5A 5AW9B 2AEJA 4ANRA 2ZXXA 1IY2A 3KYQA 2QPAA 5CCHC 1NV8A 3HJQA 2UUCM 3V2QA 2W82A 1NTKG 1N73A 3BCCG 2BASA 4H44D 4XFJA 2DNAA 3BBZA 1JB0F 1W5TA 3N4XA 1HJPA 3CF2A 2DWNA 2K9JB 1ZMVA 5KO3A 2I1KA 4LRTA 1SQQE 2PP6A 1XHBA 2W6AA 3HUSC 1OLMA 2QP9X 2V4HA 4NOOB 1GL2B 4LZJA 1TR8A 3WUUA 2IBZI 4IBIA 5KLIC 2QSFX 3CC7P 1J1DC 4DV3M 1L0ND 3HHWA 1L0LK 4M9ZA 2YMYA 4OVZB 4JYBA 3F5HA 1PPJD 1CI6B 3W68A 4PT5A 2N9YB 1M8OB 3JR5A 1D0MA 3A42A 1LP1B 3GMAA 5KAIE 3KSJA 1QZEA 2LR2A 1S9KE 4N78E 1MUUA 3H1HG
chains in the Genus database with same CATH topology
1R5LA 3Q8GA 3B74A 3PG7A 4FMMA 2E2XA 1AUAA 4CJ6A 3B7QA 1OIZA 3B7NA 3B7ZA 3W67A 4TLGA 4CIZA 4J7PA 4J7QA 1OIPA 3W68A 3HY5A 4OMJA 1O6UA 3P7ZA 2D4QA 3PEGA 3HX3A 4UYBA 1OLME 4OMKA 4M8ZA 1OLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5L A;  3Q8G A;  3B74 A;  3PG7 A;  4FMM A;  2E2X A;  1AUA A;  4CJ6 A;  3B7Q A;  1OIZ A;  3B7N A;  3B7Z A;  3W67 A;  4TLG A;  4CIZ A;  4J7P A;  4J7Q A;  1OIP A;  3W68 A;  3HY5 A;  4OMJ A;  1O6U A;  3P7Z A;  2D4Q A;  3PEG A;  3HX3 A;  4UYB A;  1OLM E;  4OMK A;  4M8Z A;  1OLM A; 
#chains in the Genus database with same CATH topology
 3H1L D;  1TDZ A;  3HHZ A;  4D6T D;  1DH3 A;  1HBW A;  2EKK A;  1NGM B;  4GDO A;  5CCH A;  4L8R C;  1K05 A;  3CCM P;  1DD3 A;  3L29 A;  4J7Q A;  2XFS A;  1IFN A;  3H1I J;  4AI6 A;  2XLJ A;  3HUS A;  5AW1 B;  4RNA A;  1VQO P;  1RY3 A;  2N35 A;  3SC3 A;  1AVY A;  3O6Q B;  1GL2 C;  3MMP A;  4IIW A;  1JQJ C;  3U6O A;  4FMM A;  1JNM A;  4L78 A;  1N78 A;  1S4X A;  5IZ7 D;  3IEC A;  1BSH A;  3E21 A;  3U61 B;  4J7P A;  2UUB M;  2QQ8 A;  1RQU A;  5FTJ A;  3OW2 O;  1VQP P;  4LCB A;  4W5W A;  1IY0 A;  1L0N K;  1PP9 G;  1NU1 G;  1KTM A;  3T15 A;  1NJG A;  1YJ9 P;  5APQ A;  4G4R A;  3CWB G;  2WSF F;  1JR3 D;  3MJ5 A;  2Z4S A;  1P84 E;  4UB6 E;  3TGU J;  4PD2 A;  5APU A;  4NRW A;  2DXI A;  1NOH A;  3KZI E;  4IFM A;  3Q5R A;  2ZYG A;  1LJ2 A;  4OGQ B;  1UM8 A;  4IBD A;  1NTZ G;  3CX5 E;  1Q82 Q;  2I7P A;  2BCC J;  2IYO A;  2K9J A;  1CUK A;  4IFF A;  1J7K A;  1RH5 B;  3RK3 E;  3GHG C;  4WB4 A;  1GL2 A;  5AW3 B;  2HYN A;  1HNZ M;  3ZCB B;  3M0D C;  1IN8 A;  3LIE A;  5APX A;  4IL6 H;  4IBE A;  3KOX E;  2YR0 A;  1SQX G;  3AEG C;  1JR3 A;  3VTP C;  3B5N D;  4JPZ B;  4O9B A;  1SXJ B;  2XSZ A;  1NO1 A;  1CI6 A;  3I55 P;  3VKH A;  1LP1 A;  1W5S A;  1PGO A;  1OAI A;  4PD4 H;  2FE8 A;  2IBZ E;  3IR9 A;  3I4V A;  4HEO A;  3L36 A;  1OFC X;  2WIT A;  3C58 A;  3G3Z A;  1L0L G;  2A5Y B;  2FYN B;  1G2C B;  1L1Z A;  1URQ B;  4OX9 M;  2R0I A;  3A3Y B;  2P2U A;  4JI6 M;  4DR5 M;  2H7H A;  2OPF A;  3RGP A;  3UGJ A;  2JO1 A;  5APS A;  2Y0C A;  1VG5 A;  2BCC D;  1QDR A;  4OGQ C;  1GK4 A;  4M0W A;  2NQ8 C;  2O01 N;  3GHG A;  3M0D A;  2X49 A;  3O6Q A;  4H0L B;  3FUU A;  3KOY E;  2BJW A;  3UZU A;  1SQB G;  2QBY A;  1TU3 F;  4GC9 A;  5C1B A;  1JY3 N;  1SXJ C;  3T6P A;  3U61 A;  1EDK A;  1VF5 B;  1RE3 C;  4QMA A;  4GT1 A;  3A46 A;  3EQ2 A;  2KHH A;  4GIF A;  3RK2 D;  4KOD A;  4F1I A;  4LF5 M;  2FY8 A;  4WP2 A;  4AKG A;  4K3A A;  4IJF A;  2IZ0 A;  3HGI A;  3HWS A;  1U7J A;  4FWG A;  3C8V A;  1KC8 Q;  3KW6 A;  1KOR A;  1YQ4 C;  2FYN C;  3A5T A;  3L70 E;  1URQ C;  2PRR A;  5M1B A;  2A06 E;  2QM8 A;  1KFM A;  1SFC D;  1K73 Q;  4PJ0 H;  1MZ9 A;  3DOA A;  3BCC E;  2K47 A;  1T3U A;  3FWN A;  4G4O A;  1L0N G;  3TDK A;  3C3E A;  5EFW B;  4B08 A;  2LBC A;  1HJ0 A;  1RHZ B;  4H0L C;  3GLG B;  2GUS A;  1N7S B;  3P8M C;  3RGS A;  2QJK C;  2R18 A;  4GOD A;  3WU2 E;  3SYK A;  1H0T B;  1SXJ A;  8CAT A;  3FTE A;  3SMS A;  1SQP D;  1RE3 A;  3GLI E;  3HTK B;  1R2Y A;  2G8Y A;  3H1L G;  1VF5 C;  4D6T G;  1DEB A;  3ITK A;  3G4S P;  4EYY Q;  3AE5 C;  4DUZ M;  3K2L A;  3VLF B;  4JI3 M;  3Q2Y A;  3L2A A;  3H1H E;  1URQ A;  1HUC A;  4QOZ C;  4NC6 A;  5EXX A;  1XNR M;  1VQ9 P;  1LTA C;  2Z5H A;  4PD4 I;  3DA1 A;  1VF5 D;  1XXH E;  3SHF A;  1USD A;  1ZRT D;  2QNJ A;  2VII A;  2X4A A;  1X79 B;  3QYE A;  1Y47 A;  4R4L A;  2UU9 M;  3AV0 A;  1N7S C;  2YKP A;  3GPY A;  3NBX X;  3MK6 A;  1W5C E;  5BU5 A;  2WSE H;  1L2C A;  2CRU A;  3EWK A;  3ZDM A;  3CCU P;  1JTH B;  2KNA A;  4JI8 M;  3VFD A;  3ZQJ A;  3SBJ A;  2ZVN B;  3RBX A;  1VQM P;  2OTJ P;  2VQF M;  5GTH H;  4BBA A;  1WRG A;  1VQ6 P;  4L74 A;  1HTL C;  3V76 A;  5AVT B;  4XK8 F;  3CWB E;  3P7Z A;  1QQW A;  2KK7 A;  1L2P A;  4MGI E;  3B89 A;  1N7L A;  3KXD A;  2E76 B;  1YLA A;  4L15 A;  3H1J J;  1JMB A;  4B3T M;  1RF1 B;  1NTZ E;  1OIZ A;  1C7Y A;  2KSJ A;  1FZG A;  4KJM A;  4B7H A;  1NAY A;  1FS0 E;  1S5L H;  2A45 H;  4Y28 F;  1T6O A;  3GLG A;  1YSY A;  2OTL P;  1N7S A;  2YKQ A;  3KOZ E;  1ZR2 A;  5KLV D;  3TYY A;  3KOW E;  1KFN A;  4NXM M;  1H0T A;  1NTK J;  1D7M A;  2OGU A;  1SQX E;  2YMK A;  4FW9 A;  2EA0 A;  3NXS A;  3HTK A;  1XTC C;  2P10 A;  2I7N A;  5ITX A;  3G9R A;  3HZJ A;  1NY5 A;  3B7N A;  2X8A A;  1ZV8 A;  2IYP A;  2E75 B;  1FNN A;  1Q3C A;  3L74 D;  2LVO C;  4DOJ A;  1UII A;  2ZTD A;  3TWL A;  4DR1 M;  2KXP B;  2JJL A;  3T38 A;  4JI0 M;  2K9Y A;  1L0L E;  4CIZ A;  3CME P;  2BCC G;  1OWA A;  4TLF A;  1JB0 J;  3CMA P;  2P58 A;  2JXN A;  2UWJ E;  3LW5 F;  3U1C A;  4OU7 A;  4IL6 E;  1ZMW A;  1NVO A;  1V34 A;  3AE2 C;  4OH8 B;  2E76 C;  1IFJ A;  1ZN5 A;  3T1H M;  1PJT A;  5AW0 B;  1RF1 C;  3PP5 A;  2WZ7 A;  4BWN A;  1M1J B;  4GKK M;  1H89 A;  1JOC A;  2QRX A;  2LXE A;  1SP4 A;  3TSI A;  2EUC A;  4Z6Y A;  4DR7 M;  2RKL A;  4PD4 E;  3W67 A;  3KP1 E;  1PJJ A;  1NHG C;  4L4U A;  1ZAE A;  2ZT9 D;  3E46 A;  5GTI H;  1WIV A;  3E7K A;  3SAS A;  2Y0Q A;  1JTH A;  2LVA A;  5AVZ B;  1JY3 O;  3I04 M;  2ITA A;  4GOE A;  2Q7C A;  2DZO B;  1K3W A;  1Z56 A;  3QH9 A;  4IBB A;  5AW7 B;  3D6Y A;  3J7A S;  4YTP C;  2JY5 A;  1PFI A;  3M9Q A;  4JI4 M;  2W6J H;  1VQ5 P;  4U7J A;  4PDG A;  2HR3 A;  3BVH A;  3O8Z A;  1PL5 A;  1PIX A;  1QVR A;  1OIP A;  1ZV1 A;  2FBW C;  3A0B H;  2WSC J;  4I2L C;  3QWO C;  1RF1 A;  4IBJ A;  1NTM D;  1M7L A;  5KJ7 D;  2KNZ A;  4R3D A;  5CBO A;  1PP9 J;  1NU1 J;  3K8Z A;  3K5B A;  4AUW A;  1L0N E;  1R7R A;  1KV4 A;  1M1J C;  1SQP G;  4MB7 A;  3QWL A;  3GO8 A;  4QHS A;  1BCC J;  2KYV A;  1YIT P;  1J09 A;  1D2N A;  2DW3 A;  2HOD B;  5KTB A;  4WWI A;  1JY3 P;  5L8R J;  1FJK A;  2A45 I;  3RL0 B;  3VMZ A;  1Q81 Q;  1FAV A;  1NJI Q;  2H5X A;  2L4F A;  1P3Q Q;  3L72 D;  1ZMU A;  4U3F D;  2LWX A;  4D6T E;  4LGM A;  5AVY B;  2FFD B;  1H6U A;  1SQX J;  1DO2 A;  2V6Z M;  2FFJ A;  4LJA A;  2C9L Y;  1NTK K;  1YI2 P;  1IJD B;  3R2P A;  5CJ4 A;  4X65 M;  2MH8 A;  4C7R A;  3TQS A;  1YIJ P;  2O01 F;  3V2N A;  3L35 A;  1FDI A;  1JMM A;  2MJZ A;  5AW8 B;  3HX3 A;  1K04 A;  5CJ0 A;  1YTZ T;  4WY4 D;  3GPP A;  3F92 A;  1M1J A;  1KQL A;  1GAB A;  1TH2 A;  1HWT C;  3SFZ A;  5FLX S;  5BU8 B;  3CD6 P;  3KQG A;  1BCC D;  1LTT C;  4M3L A;  1UIX A;  3BAT A;  1FJG M;  4DV2 M;  4LGD E;  1EC5 A;  1WGN A;  3H1K D;  1YJW P;  4Z8X A;  2FKW B;  1FZA A;  2W27 A;  3CF0 A;  1OKS A;  4QNM A;  5JI3 E;  3RL0 C;  3EIH A;  2R5D A;  3GRU A;  3K9O A;  3NFQ A;  3T97 A;  2KA6 B;  1AJY A;  1Q90 D;  1KD1 Q;  2C9O A;  3IG5 A;  5ITR A;  2FFD C;  1SQB J;  3CF6 E;  4LRS A;  1QVF O;  4B7G A;  3CCQ P;  3H1I E;  1DGG A;  2Z8Y M;  3PNY A;  4AQY M;  3L75 D;  1HVV A;  3LQR A;  2KNV A;  5KLV G;  4HH2 A;  4HYT B;  3HU1 A;  2OQ4 A;  4LJ6 A;  1IFI A;  2H1R A;  1NAF A;  3I01 M;  1T3J A;  2KDL A;  4BRY B;  1RQV A;  1YBK A;  4X64 M;  1OXZ A;  5GKN A;  1KIL D;  2HOD A;  3L74 G;  4MGY E;  5GTH E;  3CCV P;  3GLH E;  1EFU B;  1GZL A;  3HE5 B;  3A2A A;  1IZN B;  2K88 A;  2R62 A;  3B7Z A;  3D6Z A;  2R65 A;  1NU1 K;  1PGY A;  1M1K Q;  1MJG M;  3A0H H;  2KZI A;  1OTR A;  1IBL M;  4GHL A;  2FFD A;  1WXQ A;  2HPC B;  1NO4 A;  2OOB A;  3TGU E;  1PJQ A;  2O1J A;  3GRY A;  3OJA B;  1NY6 A;  2QG4 A;  2WPQ A;  3AE6 C;  1IN7 A;  1S5L E;  2K37 A;  2M0B A;  1NNJ A;  3H1L J;  2ZYD A;  2BCC E;  5AVX B;  2VF8 A;  1R5S A;  4D6T J;  1BE3 D;  1GJS A;  2ZVO B;  1EIJ A;  1VDD A;  1SQX K;  2WMM A;  4CGY B;  4IFD K;  3P8C D;  3VMA A;  1BGY D;  3C3D A;  4KT0 F;  2B89 A;  2FXP A;  5APV A;  1E94 E;  1DEE G;  2Y0T A;  2ERC A;  5AW5 B;  3THG A;  4RF1 A;  2E5L M;  2XZF A;  3GQ3 A;  1F4I A;  2QE7 H;  5CCH D;  1L2D A;  3LCU A;  1TGU A;  1Z5B A;  1SQV D;  1HT1 E;  2XZU A;  3LMM A;  3GG2 A;  1Z6T A;  3Q1M A;  3CCL P;  2GA1 A;  1I94 M;  1DV0 A;  2CPS A;  4QNR A;  2Y0D A;  2JA2 A;  1Q02 A;  4RF0 A;  1WJ7 A;  1OW7 A;  2Z4R A;  5DJU B;  2LNH C;  1YJN P;  4M0D A;  2E2X A;  1OZH A;  5CCG C;  2J58 A;  3J2P B;  2MRO B;  2IFM A;  2ZXE B;  2KS1 B;  4GH9 A;  2KNC B;  5GTI E;  2HG5 D;  1AQ5 A;  1SQB K;  3U5Z B;  1J2J B;  2WSC H;  3L26 A;  3D8B A;  2UUA M;  4XA4 A;  2LVN C;  2GQF A;  2APL A;  3L72 G;  5H2F H;  1MFT A;  3QYB A;  2WSE J;  3HE5 A;  1KSF X;  1MN3 A;  4U3F G;  3M9B A;  3H32 B;  1IFM A;  3UJN A;  2P1J A;  1QL2 A;  1L2B A;  2XEP A;  1S1C X;  3OTO M;  1QL1 A;  3KXE C;  3A0B E;  2HPC A;  1OMI A;  1TH3 A;  3MZW B;  4I1L A;  3WMM 0;  2DEN A;  2OOA A;  2YIU B;  1GL2 D;  1PJI A;  2JWS A;  4DZO A;  3FUW A;  4QHT A;  1ZR4 A;  1QUS A;  1ZRT E;  1KQF B;  2JY7 A;  1Y9B A;  3EFF K;  2W8Z A;  1TF0 B;  1X37 A;  1A5T A;  1S3S A;  1EZV D;  2UXD M;  2DVW B;  2XSZ D;  1BCC G;  2OYH B;  4C7N B;  2L7H A;  2P5T A;  1GKI A;  2LHC A;  3H1K G;  2JY8 A;  4II7 A;  2FXM A;  3HHY A;  2D7H A;  3PVS A;  4EI2 A;  1XB2 B;  4AZF A;  1GJT A;  2CP8 A;  2R5B A;  3MGN A;  4OVZ A;  1LTS C;  3L71 D;  5BPV A;  1NKZ B;  5FTM A;  4CIS A;  1A02 F;  1HQY E;  1GL7 A;  1IN5 A;  2KW0 A;  2KOG A;  4PCZ A;  4YHH M;  1L1T A;  3LW5 J;  1NVM A;  3CCJ P;  4MGZ E;  5DFL A;  1G1J A;  3L75 G;  2E5Y A;  1FZE A;  2YIU C;  1VDF A;  4L75 A;  3E4R A;  4W80 A;  2J5Y A;  4AKH A;  2JKV A;  3PH0 A;  1OQY A;  1L8Q A;  3GLM A;  2CV2 A;  4FVM A;  2M3E A;  3WHK A;  2KNC A;  1M57 D;  2JZ0 A;  2OYO A;  1GU4 A;  1CZQ A;  2E74 B;  4A7P A;  3TNU B;  3FUV A;  3L73 J;  3B9P A;  4RJT A;  4KLN A;  3QAU A;  3SWK A;  2OO9 A;  3K9P A;  3VMX A;  2Q3E A;  3SMP A;  4JI1 M;  1NYH A;  3H32 A;  3L74 E;  4GKJ M;  1JY2 O;  3AOG A;  2WVR A;  5AW2 B;  4EOT A;  1EDJ A;  4PV1 B;  2C9N Y;  3SAR A;  2Y9Z A;  1SQP J;  4OGQ D;  3CCS P;  1PGJ A;  3MUD C;  3L28 A;  1TDH A;  3HKP A;  3AEF C;  5K5G B;  3IFM A;  5KQ8 A;  1YYC A;  4GMQ A;  4FCW A;  1BE3 G;  3HD7 B;  3F89 A;  2BNK A;  1WT6 A;  2R4E A;  3AE3 C;  1VEK A;  5AW4 B;  4R71 A;  3H1J E;  5E79 H;  2R45 A;  4JYC A;  1X8Y A;  3UK6 A;  1BGY G;  4B3M M;  3GLF E;  4RES B;  1SXJ D;  3SYL A;  1SQQ D;  4C7N A;  2M3B A;  3CPW O;  2E74 C;  4L6V 6;  5E26 A;  5DYI A;  2L4E A;  3L73 D;  1OVR A;  1NTK E;  3GQ4 A;  1GW3 A;  3FWL A;  1PM5 A;  3A0H E;  2IPP A;  3M9H A;  4ZMD A;  4D80 A;  3U6C A;  1SQV G;  1GL6 A;  1JY2 P;  2Q9I A;  1E32 A;  3HHX A;  3FRH A;  4M9S A;  5KPT A;  1KMI Z;  1PPJ G;  3VK7 A;  1I4W A;  1URQ D;  2B87 B;  3PRJ A;  3ZC7 B;  1S9K D;  2KI7 B;  3MUD A;  4N78 D;  4PV1 C;  3RK3 B;  2PAJ A;  1HF9 A;  1HGV A;  2KB7 P;  4TUW A;  2R3C A;  3PJS K;  1KYI A;  3HD7 C;  4H0L D;  3K1J A;  2R44 A;  2OYI B;  2DAI A;  3VK8 A;  1G2C A;  1LWU B;  3FYC A;  3AEA C;  2Q6Q A;  3TNU A;  2HCB A;  3VDP A;  1N32 M;  1IC2 A;  3PLN A;  4H13 B;  4WW0 A;  3FRI A;  1WHC A;  1WR1 B;  2R3S A;  4BXL A;  1ZME C;  3FTC A;  2LVQ D;  1USE A;  5AVV B;  4DV4 M;  1LTI C;  2B9B A;  5AVQ B;  3AED C;  5KLV J;  1EQ7 A;  3L72 E;  4U3F E;  1EXI A;  2V1C A;  1E9R A;  2N1T B;  2CHV A;  2ZFC A;  4DCK A;  3RK3 C;  4NSR A;  1LTM A;  2QHO B;  3HD7 A;  3L74 J;  3CC2 P;  1P84 D;  3BOS A;  3CTW B;  1EZV G;  5APT A;  3SSU A;  1XNQ M;  1N7S D;  4B86 A;  1FZF A;  2OYI C;  2FYU J;  2O1K A;  3CX5 D;  1DGB A;  1PP9 E;  5BR8 M;  1NU1 E;  1SQP K;  2K6B A;  1BDC A;  1LWU C;  2F5Q A;  3RK3 D;  4Q7J A;  1LTJ B;  1QGK B;  4NPD A;  1GDT A;  1BCC E;  3TWM A;  1VEG A;  2IFN A;  4ZKU A;  4GIP A;  3JSV C;  3PG7 A;  2CWB A;  3FX0 A;  5AVW B;  3U6E A;  2NPS B;  2OAR A;  1FZC B;  1EXJ A;  3L71 G;  3RE8 A;  4JXJ A;  2LVP C;  2B87 A;  2L5G B;  2XZR A;  5EP2 A;  2XF3 A;  2RH0 A;  4N6J A;  3V2P A;  4LF6 M;  2N9B A;  3MHV C;  2YXQ B;  3V5B A;  2KRK A;  1FE6 A;  4JF7 A;  1Q86 Q;  2R4J A;  1HGZ A;  1HJB A;  2JR8 A;  1JCD A;  1VEJ A;  1NHL A;  4DV5 M;  2KLV A;  4OW0 A;  3VKG A;  1PJS A;  5FTN A;  1AV1 A;  4LGY A;  1IQP A;  2HAK A;  4KHP M;  1Q39 A;  4LJ4 A;  5LMN M;  2OYI A;  1IN6 A;  5E6J A;  1QLE D;  5JI2 E;  3L75 E;  2Z3X A;  3LW5 H;  1JO5 A;  2ZAO A;  2FYU D;  3G6E P;  3PHL A;  3GLI B;  1LWU A;  3RL0 g;  3GRR A;  5AW6 B;  2CHQ A;  4LF7 M;  2O25 A;  4MN4 C;  2F5O A;  2M8R A;  2Q1K A;  2ZJS E;  2YO2 A;  3WUV A;  1LTJ C;  1T2K C;  4HLQ A;  5TJH A;  4KHX A;  2LH0 A;  1YQ3 C;  2YO3 A;  1KIL E;  2JY6 B;  2DAK A;  2RGH A;  1NTM J;  3H25 A;  3BRT B;  2JP7 A;  3U6M A;  5CHX A;  1T3T A;  1QZM A;  5LMU M;  3U6P A;  1PGQ A;  3BAS A;  1N36 M;  1XXH B;  1GTW A;  3C9I A;  1EZV I;  5KAF H;  1G1I A;  1SQB E;  1PRB A;  3N7N A;  1ZQ9 A;  3VYI A;  2E76 D;  4XBO A;  1OLM E;  1IXS B;  2GNO A;  4MM3 B;  3L72 J;  2PFX A;  4NSO B;  2E75 C;  1GK6 A;  4U3F J;  3KSX A;  3I56 P;  2A06 D;  2KZS A;  5KLV K;  4GKG A;  4LZZ A;  1OFI A;  3VOP A;  1IK7 A;  2JWA A;  3L73 G;  2O5R A;  4N3Y B;  2Q3I A;  2ZBK B;  1LTJ A;  1WGL A;  4G4Q A;  4EDF A;  2Z5I A;  2BEZ F;  1ZP0 C;  3OA7 A;  1AFO A;  3HU2 A;  2E75 D;  2V7Q J;  3KS8 A;  3UIA A;  4ASW A;  2WTY A;  2FYU K;  4AYC A;  3U1A A;  1FC2 C;  4REZ A;  1NNU C;  4GIT A;  1LNQ A;  2WWW A;  3JAM S;  3GQ5 A;  1XC8 A;  2P7J A;  3U6L A;  3A45 A;  2KXE A;  3AJI B;  1PPJ E;  2AEF A;  3H1K J;  5E79 E;  3AKZ A;  4FCT A;  4ZNC A;  3CC4 P;  3FYD A;  4YPC A;  2QEX P;  1FJP A;  3H1L E;  1EE8 A;  2WSF J;  3M0E A;  2KRU A;  4PJ0 E;  2QZ4 A;  1YHQ P;  3FXE A;  3GLI A;  1X0T A;  3ILK A;  1P84 H;  2D7G A;  3WUT A;  4LFA M;  3Q5P A;  1YE9 A;  4G3O A;  2POH A;  4Y99 B;  2HL7 A;  2D7E A;  2W83 C;  1G8P A;  2FNA A;  3L75 J;  1HH0 A;  2K3R A;  1PZQ A;  2UXC M;  2C0W A;  3Q8X A;  3JC2 2;  4OMK A;  4AKI A;  1XXH A;  4P16 A;  1Y8G A;  1MFZ A;  3AE4 C;  2D2C B;  3S1K A;  2LXB A;  3ZH9 B;  3B71 A;  4D82 A;  3PNV A;  1JUN A;  2I1J A;  5DYG A;  5ITQ A;  4LY6 A;  1QEX A;  1NTM K;  2IDB A;  1IXS A;  2BWB A;  4L73 A;  5B5E H;  1G3I A;  2OQQ A;  3PEG A;  1QUT A;  1N73 B;  3NBI A;  5APY A;  1LV7 A;  3HU3 A;  2YNY A;  4JI7 M;  1JR3 E;  3L4F A;  2ZAE B;  2L2D A;  4NRV A;  1N86 A;  3RL0 D;  1MKM A;  3R4Y A;  4Y99 C;  4GEW A;  3FTD A;  5EQT A;  3SHG B;  3SAW A;  1BE3 J;  3U59 A;  1FDO A;  1GU5 A;  2J59 M;  2C0X A;  1JCC A;  2E5T A;  4H44 B;  1BGY J;  2C98 A;  5EXS A;  1M56 D;  1R5L A;  1DGH B;  2XGN A;  3L71 E;  2F4V M;  3MTU E;  1R4G A;  1GO5 A;  2D2C C;  3Q5S A;  1KB9 D;  1CSB A;  3GPX A;  1YUB A;  1NSF A;  3CCR P;  2FYU G;  3LQQ A;  2LTU A;  1SQV J;  3U6S A;  2AXT H;  2RMZ A;  1QAM A;  3VP9 A;  1N73 C;  3GF7 A;  3U60 B;  1VL2 A;  3HE4 B;  3PTZ A;  1KZU B;  3L25 A;  1V92 A;  4LFB M;  4X62 M;  1NHW C;  4I5S A;  1FBM A;  1PV3 A;  4WBA A;  4JI2 M;  1IY1 A;  2GM4 A;  3D71 A;  4PD4 D;  2XKM A;  1P84 I;  1XWI A;  2QEN A;  4S12 A;  1NKN A;  3M06 A;  3VP8 A;  4H44 C;  1U57 A;  1L4A B;  3CX5 I;  4DV0 M;  3SFD C;  1BDD A;  4I81 A;  4JQ0 D;  4LFC M;  3FKE A;  4AQR D;  1BSN A;  1MX0 A;  3I4Y A;  1AUA A;  5ITU A;  2GUV A;  3M0A A;  1FOS E;  1D0K A;  2A06 G;  2F5S A;  3CXH D;  3E9S A;  4UN2 B;  5AVS B;  2FS1 A;  2WT7 B;  3RGU A;  5DJT B;  4K35 A;  3VMY A;  1IK9 A;  1SXJ E;  3T1Y M;  3FGA D;  2RKO A;  3H4J A;  3HJS A;  4D81 A;  3L73 E;  1FZB A;  1NTM G;  3SFE C;  4L76 A;  1HR0 M;  2B3T A;  3S9O A;  2PGD A;  5KAF E;  5H37 D;  1HQC A;  1W2B O;  2V7Q H;  4BRY A;  1E79 H;  1DGH A;  4GHA A;  1L4A C;  3TWK A;  3J27 B;  4ASV A;  3M7G A;  1OAO C;  1SQP E;  2W90 A;  1FDM A;  3JCU H;  2XU6 A;  1E9S A;  4UB8 H;  3V6I A;  5CCG D;  4AW4 A;  1T6A A;  4RO0 A;  5KQD A;  2ZYA A;  2CUZ A;  3B5N B;  4EIW A;  3M91 A;  2H89 C;  3MIW A;  5AVR B;  4WUR A;  3L71 J;  5CBN A;  1IXZ A;  3FTF A;  5B66 H;  4IBK A;  1AQT A;  1PGP A;  1L4A D;  3Q3D A;  4XE5 B;  3U60 A;  2RGO A;  3GLH B;  4OMJ A;  3GHG B;  1O6U A;  1Y8A A;  1GVN A;  2WSC F;  3HE4 A;  2WSF H;  2DAG A;  1AA0 A;  1V33 A;  3GP1 A;  4B3R M;  3SWY A;  3Q8G A;  1K9M Q;  5CCG A;  1QAN A;  2LXC B;  1OVV A;  1SQV K;  2QBY B;  3RFW A;  4Y28 J;  3AL0 C;  3KP0 E;  5F3W A;  2Y21 A;  2AXC A;  4M9X A;  1JM0 A;  4DT0 A;  3MP7 B;  2FXO A;  4DR6 M;  2DHY A;  1L4A A;  2Z4E A;  5L8R F;  4LC1 A;  3VDU A;  2YFQ A;  1OW8 A;  2IX7 C;  2R6F A;  5KPZ A;  4WVZ A;  2HFE D;  5ITY A;  3VN0 A;  2L09 A;  4LF8 M;  2Y20 A;  3DFZ A;  3K92 A;  3J80 S;  2AHM A;  3TL4 X;  5AVU B;  2CHG A;  3GLG E;  3B5N C;  3AE8 C;  1Z5C A;  1KB9 H;  4JV5 M;  2WT7 A;  2F5P A;  3H1I D;  4G6Z A;  2ZAN A;  4ZKP A;  4DV1 M;  3AEB C;  2H88 C;  4FCV A;  4PDI A;  5IT9 S;  3RK2 B;  2XNX A;  4RKU F;  2ZM6 M;  5ITX E;  1LTG C;  3EFG A;  2RRU A;  2QCU A;  3GRV A;  3NTN A;  3KDS E;  2KS1 A;  2KLU A;  1ZXG A;  3P32 A;  1S72 P;  1SQQ J;  4FD2 A;  5EJC A;  3U5Z A;  1N33 M;  2OYH C;  2Q2E B;  1SFC B;  3MD0 A;  5KLV E;  5TIS H;  2WSS H;  2QSI A;  1RU3 A;  5CMZ A;  3J7B A;  2FH0 A;  1NWQ A;  5B5E E;  3GF3 A;  2G3Q A;  2C5R A;  2MGW A;  4R7G A;  4DR4 M;  1KQG B;  1EDI A;  2AEM A;  4IL6 X;  4UYB A;  4P17 A;  3SAT A;  3M6A A;  3TGU D;  1BVS A;  3B5N A;  2UXB M;  1J1E B;  1QVG O;  4CJ6 A;  2FYU E;  1NV9 A;  2MKV A;  1KYO D;  2XV5 A;  2M5A B;  4QOS A;  1OFH A;  3I5C A;  3GLH A;  3AE9 C;  3CXH H;  1EDL A;  2CFO A;  3FD9 A;  2EKF A;  2CEA A;  1N2D C;  3P7K A;  3RK2 C;  2EO2 A;  3L27 A;  2QJK B;  5IWA M;  2KIK A;  2JEE A;  5KKZ B;  2L7I A;  1G41 A;  3W0L B;  4IJE A;  4AG5 A;  3U6D A;  2OYH A;  4I6M C;  1N77 A;  2MR9 A;  5IRE B;  2VDB B;  2QJP B;  3FE3 A;  1SG9 A;  2JP3 A;  3RBZ A;  1SFC C;  4HJG H;  1Q7Y Q;  4R4M A;  4DBG B;  1E5W A;  2AXT E;  4LJ5 A;  2Y0E A;  2EJS A;  2Z7J A;  5EXT A;  1IBM M;  1KN7 A;  2E74 D;  2F5N A;  1J1E C;  2DZN B;  2QJY B;  3SAV A;  5FTL A;  1R2Z A;  1GMJ A;  1ZW0 A;  3GPU A;  2JWD A;  3KHU A;  2K9D A;  2O01 J;  4MGK E;  1M90 Q;  5EXP A;  1T8Z A;  5KPR A;  1DGF A;  2OTK E;  3TE6 A;  1KFV A;  4BLC A;  1KB9 I;  1WMK A;  7CAT A;  2J7O A;  2BWE A;  3AEC C;  5KKZ C;  1NTM E;  4FWD A;  1U7M A;  4PV1 D;  4M8Z A;  1SFC A;  3C1L A;  2VF7 A;  2QJP C;  1VQK P;  1OX3 A;  3L37 A;  3HD7 D;  4EIJ A;  2G8L A;  1XTG B;  3IAO A;  3DZD A;  4OVN F;  4G4N A;  5EP1 A;  3TK1 A;  3II6 A;  2W6B A;  3KPE A;  1SQQ K;  1YTZ I;  2E42 A;  2VQE M;  2DAE A;  4HL4 A;  1R8E A;  1HNX M;  1ORY B;  2E43 A;  2M5A A;  2BJV A;  2LKM A;  5EP3 A;  3NMD A;  2C96 A;  2QJY C;  3PFI A;  4IBF A;  1K8A Q;  1X22 A;  2H8P D;  1H8A A;  5APW A;  2CV0 A;  2KSE A;  3UMM A;  2Q5U A;  3W0F A;  2M60 A;  2MJ5 B;  2JZ1 A;  3PXG A;  1LGH B;  3CXH I;  3JCU E;  1LT9 B;  5H2F E;  1HNW M;  1DX7 A;  1SS1 A;  4UB8 E;  2O3J A;  2WSE F;  3H6P A;  3AE7 C;  1MU5 A;  4DJG A;  3FUT A;  4H13 C;  5EP4 A;  3OAK A;  4I8O A;  3WHL A;  3ABV C;  3H1K E;  5B66 E;  3GLF B;  3E1I A;  1OVU A;  2M5Z A;  4IOI H;  1S3J A;  3G71 P;  2YKO A;  3H1I G;  3HY5 A;  1KQS O;  3FUX A;  1VPC A;  3TF5 A;  2IBZ D;  2N1T C;  1Z59 A;  3GW6 A;  2ZT9 B;  4LJ8 A;  1QX8 A;  4H13 D;  2L6O A;  2NRG A;  4YXD C;  3CI9 A;  2J7N A;  2RN0 A;  3L70 J;  4DV6 M;  1AVO A;  1KYO H;  3AOE C;  3IF4 A;  1VQ7 P;  1IM2 A;  2HKJ A;  2CV1 A;  2R46 A;  3HJ8 A;  2K1A A;  1IXR C;  2N1T D;  3BCC J;  3USS A;  1SVF A;  2KEB A;  1QDT A;  3IHP A;  4KT0 J;  1IO4 A;  1LT9 C;  3BRV B;  3TPZ A;  1C1K A;  4DR3 M;  2YXR B;  1XMO M;  1GLN A;  2SPZ A;  2WPS A;  3B74 A;  3FXD A;  3TGU G;  2H43 A;  1KB9 E;  1DO0 A;  1S5L X;  3B7Q A;  3IN6 A;  2NPS C;  2WPR A;  3AFH A;  1FZC C;  3IG8 A;  2A45 G;  4AG6 A;  2C99 A;  2DWM A;  3V4Q A;  3MHV A;  1CW5 A;  4F2L A;  2N1T A;  2XDJ A;  1T2K D;  1IFY A;  4JBZ A;  2QA4 P;  1FOS F;  2C9C A;  1Z5A A;  4B7F A;  2B88 A;  2ZT9 C;  3LCV B;  3H1J D;  4W7Z A;  5KAI H;  1N34 M;  2FYZ A;  1TTE A;  3H1H J;  2NPS D;  4NL4 H;  3AOE A;  3L70 D;  1T43 A;  5TIS E;  2KZJ A;  1SQQ G;  2XND H;  1BE3 E;  1ZOY C;  1AIP C;  1UFZ A;  1NTK D;  3BCC D;  1DIP A;  3H4M A;  1Q2N A;  4OWF A;  1DD4 A;  1LT9 A;  3P8C E;  1J5E M;  4TT3 H;  1BGY E;  4MGH A;  4LG2 A;  4LJ7 A;  1G4A E;  2L91 A;  4CPG A;  2I8D A;  1IBK M;  2NZ2 A;  1NJF A;  4NXN M;  3HRN A;  2WZJ A;  3T97 B;  4LF9 M;  2NPS A;  3GLF A;  1FZC A;  2DZL A;  5KJ7 C;  2DKL A;  4IBC A;  4WY4 B;  3LVW A;  4JN6 A;  3CL3 D;  1W2E A;  3CXH E;  2LHG A;  3CCE P;  2DHR A;  1SQV E;  1QYR A;  2DAM A;  2FOI C;  3KFU G;  1QAQ A;  3R9X B;  4NPE A;  5FTK A;  2WQY C;  3H1H D;  1LT1 A;  2JDI H;  1IFD A;  3CWB J;  4JI5 M;  1GW4 A;  1VQ1 A;  3S4R A;  1Q3B A;  2QVA A;  5BVZ A;  4UB6 H;  2O01 H;  2V1U A;  4JYA M;  3V4W A;  3KZI H;  3LVV A;  4A3V B;  1NTZ J;  3SAU A;  3B4S A;  3C9P A;  4L16 A;  5FSW A;  1KYO I;  3CX5 H;  1QAO A;  5KJ7 A;  2HWJ A;  1G59 A;  2YQZ A;  4W7Y A;  1K82 A;  2QM7 A;  4WY4 C;  4I7Z B;  2KP8 A;  4LJ9 A;  1A02 J;  4LLH A;  1TH4 A;  3AE1 C;  4ITQ A;  5C18 A;  3KS4 A;  1KIL B;  2XH9 A;  3JR4 A;  1MV8 A;  4XGI A;  1N75 A;  1IFP A;  2HLO A;  1D0L A;  4RKU J;  3I51 A;  3SWF A;  3D8L A;  4Z1M H;  1PP9 D;  1VQL P;  3E1R A;  4MH0 E;  1NU1 D;  1L0L J;  1G71 A;  3EIE A;  2YNM D;  1OW6 A;  3CWB D;  4DUY M;  4C46 A;  2BEQ D;  1RE4 C;  1H88 A;  2KUB A;  1X9V A;  1EZV E;  4HB1 A;  1LTB C;  1NH4 A;  1GD2 E;  1S2E A;  1NTZ D;  1VQ8 P;  2VRS A;  4YXW H;  2CPB A;  3A7O A;  2CE7 A;  4TLG A;  3CGW A;  4FWH A;  3A98 B;  3KVW A;  2K0B X;  2CK3 H;  1HT2 E;  3AEE C;  2G5G X;  5DNY A;  3R8F A;  4WY4 A;  1K3X A;  3BXW A;  4CHT B;  1SQX D;  1R6B X;  2IBZ G;  1ZLL A;  4NPF X;  4I7Z C;  1RF0 C;  2P67 A;  3V2R A;  2DWL A;  4YY3 M;  1KIL C;  4ZPX A;  4DV7 M;  3U6Q A;  1VQN P;  1N8R Q;  1VDL A;  5C39 A;  4GRI A;  4X66 M;  2J5U A;  4IBG A;  2ZTC A;  1L0L D;  4LF4 M;  3KDP B;  2D4Q A;  1JEK A;  1RE4 A;  2KZU A;  1XMQ M;  2G3A A;  2D2C D;  3HUS B;  2R32 A;  1IN4 A;  4DR2 M;  1VQ4 P;  5KLI B;  2DWZ B;  4B3S M;  2ZAM A;  1JY2 N;  1J1D B;  1OJL A;  2QIW A;  1L0N J;  3D70 A;  4KO8 A;  1FU1 A;  4BB9 A;  5A2Q S;  4I4L A;  3J81 S;  2XFT A;  2WPV B;  2JNH A;  3NWL A;  1SLQ A;  2Y9Y A;  2DI0 A;  5ITT A;  4K0K M;  1SQB D;  2JUJ A;  1RF0 A;  3B8E B;  3LID A;  3WU2 H;  1NTZ K;  4HKZ H;  3H1J G;  2HHH M;  1KIL A;  4GOF A;  2IZ1 A;  1KYO E;  3CLQ A;  3L70 G;  4GC5 A;  5AW9 B;  2AEJ A;  4ANR A;  2ZXX A;  1IY2 A;  3KYQ A;  2QPA A;  5CCH C;  1NV8 A;  3HJQ A;  2UUC M;  3V2Q A;  2W82 A;  1NTK G;  1N73 A;  3BCC G;  2BAS A;  4H44 D;  4XFJ A;  2DNA A;  3BBZ A;  1JB0 F;  1W5T A;  3N4X A;  1HJP A;  3CF2 A;  2DWN A;  2K9J B;  1ZMV A;  5KO3 A;  2I1K A;  4LRT A;  1SQQ E;  2PP6 A;  1XHB A;  2W6A A;  3HUS C;  1OLM A;  2QP9 X;  2V4H A;  4NOO B;  1GL2 B;  4LZJ A;  1TR8 A;  3WUU A;  2IBZ I;  4IBI A;  5KLI C;  2QSF X;  3CC7 P;  1J1D C;  4DV3 M;  1L0N D;  3HHW A;  1L0L K;  4M9Z A;  2YMY A;  4OVZ B;  4JYB A;  3F5H A;  1PPJ D;  1CI6 B;  3W68 A;  4PT5 A;  2N9Y B;  1M8O B;  3JR5 A;  1D0M A;  3A42 A;  1LP1 B;  3GMA A;  5KAI E;  3KSJ A;  1QZE A;  2LR2 A;  1S9K E;  4N78 E;  1MUU A;  3H1H G; 
#chains in the Genus database with same CATH homology
 1R5L A;  3Q8G A;  3B74 A;  3PG7 A;  4FMM A;  2E2X A;  1AUA A;  4CJ6 A;  3B7Q A;  1OIZ A;  3B7N A;  3B7Z A;  3W67 A;  4TLG A;  4CIZ A;  4J7P A;  4J7Q A;  1OIP A;  3W68 A;  3HY5 A;  4OMJ A;  1O6U A;  3P7Z A;  2D4Q A;  3PEG A;  3HX3 A;  4UYB A;  1OLM E;  4OMK A;  4M8Z A;  1OLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...