3W6UA

Crystal structure of nadp bound l-serine 3-dehydrogenase from hyperthermophilic archaeon pyrobaculum calidifontis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
283
structure length
279
Chain Sequence
b'MRVGFIGLGIMGGPMATHLLKAGFLAAVYNRTREKTKPFAEAGVYVAESPADLAKRVDVVIVMVSDAPDVEQVLFGPSGVVEGARPGLIVVDMSTNSPDWARKFAERLAQYGIEFLDAPVTGGQKGAIEGTLTIMVGGKEELFHRLLPIFKAMGRDIVYMGPVGYGQAMKLVNQVVVALNTVAMVEGLKLAKALGLDMDKVAEVLTRSGAIELYLPKLLKGDLSPGFKAEHLKKDLGYVLEEARKRGVKLPGAELAYELYRKMVEDGAGSLGIHALGFY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase, NAD-binding protein
publication title Crystal structure of the NADP+and tartrate-bound complex of L-serine 3-dehydrogenase from the hyperthermophilic archaeon Pyrobaculum calidifontis.
pubmed doi rcsb
source organism Pyrobaculum calidifontis
molecule tags Oxidoreductase
total genus 92
structure length 279
sequence length 283
ec nomenclature ec 1.1.1.276: Serine 3-dehydrogenase (NADP(+)).
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3w6uA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3w6uA01
1H5QA 2CF5A 1HDOA 2Q46A 1DAPA 2B36A 4RPGA 3D0OA 3JQAA 1Y8QA 4IINA 4RVDA 5CDSA 4NBUA 3VPXA 1V9LA 3S8MA 4A0SA 4MVJD 4QO7A 4G65A 2PKQO 2LDXA 3G1TA 1VPDA 3ZWWA 4G2NA 1UXHA 2BFPA 1PTJA 4S1VA 4I5GA 4F6LA 4JXKA 3A4VA 5A03A 1B14A 3RROA 5CG1A 1FDSA 4WASA 3QE3A 3OM9A 4NFHA 2HLPA 2VNAA 1MXFA 1R12A 2YV3A 4H16A 3RC2A 2ZYDA 5JXWA 1ADGA 5JPIA 5JE8A 3QQPA 1ZCJA 3H9UA 2I99A 5DNAA 2R00A 4OM8A 5MDHA 1Y9EA 1DRWA 5EPOA 4A26A 2B35A 1QLJA 3PJDA 4JBGA 4XIYA 3PGJA 5DOVA 1NQ5A 2A9FA 1M66A 2Y67A 3BMOB 4M54A 4AJ1A 4A2CA 2HMVA 4E5PA 3HB5X 1KVQA 5CDGA 5K6AA 4XDZA 3P2YA 4Z9XA 4U7WA 2HKIA 3HFSA 4BO4A 1IPFA 3K6JA 5L3ZA 1U9JA 1PGNA 1K6IA 4XRRA 1NVMB 5C3MA 3EMKA 3PIDA 3EZYA 4D3DA 3OSUA 4YAKA 1RJWA 3WQRA 5AYVA 4BNVA 3RC7A 3W8FA 2QZ9A 3X2EA 1DLJA 2ZKLA 2NU7A 4GX2A 4HFMA 3ZW8A 3RFTA 5BSGA 3GFBA 2WWRA 3IC5A 4E2ZA 1Y5RA 2BFMA 1QV6A 2C0CA 3EW7A 3Q6IA 1I2CA 2EKLA 2FMUA 2W90A 4ZU3A 5BQFA 3AWDA 5TX7A 1U1IA 4CQMB 3PXXA 3VKUA 4R1TA 1OI7A 3WDSA 1XU9A 3DAGA 5JMPA 3D3WB 3ZCXA 1IL0A 2CUKA 3MCVA 2Z95A 4OGWA 3KVOA 1YJ8A 1E6EA 3AU8A 3QV1A 2O3QA 2WTBA 3JSAA 4NI5A 2HK8A 4GSLA 1EBFA 4LVUA 1E1MA 4ILKA 3D64A 3STHA 3WBFA 2VHXA 2WMDA 4BNWA 3GGGA 3VHRA 5JDIC 1N9GA 4D3FA 4YCAA 3GR6A 3DZIA 3DTTA 2Q4BA 3H5NA 4DREA 1E7RA 4D41A 1N1EA 2YHIB 5HS6A 1K0UA 4OXYA 3EHEA 2NACA 1GQQA 3PLNA 5DN9A 3PTZA 4AJIA 3F5SA 2GPTA 3LVFO 1YS4A 4TRNA 3D4NA 1I2ZA 5AXDA 1LDBA 2Q2WA 4P4NA 4RF4A 1JKIA 2O3SA 3ETEA 1HT0A 3F1LA 3UF0A 1A4UA 3D7LA 1PZFA 2OORA 3OHSX 4IZIA 1U3UA 2QX7A 4PRKA 3RFVA 3UH1A 4F3YA 4XDYA 1MV8A 5IZ4A 1H2HA 1NTOA 4FN4A 4DQVA 4GGPA 4YJFB 4I8XA 5HTOA 5A02A 3I5MA 5JAIA 3N74A 3FPLA 4UVDA 1FK8A 3H9QA 3AI3A 3DMYA 4J9UE 3ZHXA 4DBZA 2VWPA 2UV8A 4BL5A 1CYDA 1UP6A 2Y0EA 1W0CA 1Q1NA 1H0KA 1XLTA 1K3TA 1J4AA 3UUWA 1RKXA 2A94A 4B4UA 5I9MA 2YQ4A 4YT2A 1VL8A 1LC3A 3JQAB 3S2FA 1DAOA 1P0FA 1B3RA 4LK3A 2GZ3A 3L4BC 5IN4A 4QT0A 2EGGA 2HMSA 1M76A 1LDGA 3OA2A 1I8TA 3KLMX 4WLVA 3GNQA 2NM0A 1QYDA 4E6PA 1L7DA 3GLQA 4Y98A 4EI2A 3GF4A 1DXYA 3K9QO 4J2OA 5TQVA 5KWEA 1BXZA 3FBTA 3KSUA 4PLYA 4CM7A 2J8ZA 5DCWA 2C07A 1FDWA 2FSVA 1WWKA 4KZPA 4Z9YA 4ITUA 2IXAA 4UVHA 4OSPA 4HADA 4H3VA 3KOUA 3AU9A 1PGPA 3PP8A 4BGUA 3NT2A 5HWSA 1NVGA 4M87A 4LGVA 1IPEA 3MJEA 4I1IA 5H83A 1LLQA 4LISA 2NU9A 3DBLA 2O3RA 4DYVA 2HMWA 2NTNA 3RASA 1NQTA 3U49A 4FIZA 3CPSA 3UHAA 1U5AA 2JFGA 3H6KA 2Z1NA 4CR8A 3H2ZA 3HZZA 3ICCA 2NTJA 4L4SA 2FPPA 2O2YA 3VDQA 1BWSA 2IEBA 3UCEA 3GAFA 4W82A 2C5AA 3ZWCA 1YO6A 2JCXA 2AW5A 4D3SA 4IDCA 4BNTA 5KVVA 1P33A 4XRGA 4R51A 3E5MA 4M55A 3JQ8A 1YQGA 2G5CA 5I7VA 2Y66A 5ES3A 4FD3A 4YA6A 3PWZA 3M1LA 4CM9D 2ZTLA 1BMDA 3KYCB 3AUUA 5JNLA 4JX8A 1WDMA 1LC0A 3WG9A 3UGKA 1V8BA 2RHRA 2ZB7A 3ICPA 1GADO 1NAHA 1Z74A 3KYBA 4M1QA 3MJCA 3EC7A 2EP7A 4NU5A 4XA8A 4XYEA 3Q9NA 3BIOA 4ZRNA 5BNFA 5B12A 3ZU3A 1W4ZA 5KVSA 3OECA 2NQTA 3NAQA 4YDRA 3WSVA 4B3JA 1GPDG 4R16A 5KJEA 3JQBA 2Y1CA 3CINA 4D79A 4Q3BA 1B15A 2BRUA 3RUIA 3F6YA 4BV9A 3E6AA 3JQEA 3ANMA 2CVZA 4KUHA 4CMIB 1H6BA 4B79A 3WYBA 4IJUA 1EZ4A 4BNKA 3H7AA 1VSUA 5JLAA 4XGKA 1O0SA 5A05A 2H5LA 3GVPA 3QWAA 1EDOA 2RAFA 2HCTA 4I5DA 4EGFA 1WNTA 3KEOA 2X0JA 3F5QA 3KLPX 3GG2A 4FFRA 4CLXA 4D0RA 3GOHA 1U7HA 1PL7A 1JW9B 5I8WA 3ORFA 1UUFA 5DP2A 1MGOA 1B26A 2P5UA 5FI3A 5L4NA 1VI2A 3I9JA 2CDAA 1TLTA 5L7WA 3DO5A 4N5LA 3PYMA 1PWXA 1ZK3A 3O03A 1GUFA 5IFLA 1P31A 2EW2A 2EGHA 3KETA 5DULA 3JQ9C 4WEQA 4CM8A 4QECA 4KUGA 4DQUA 3MEQA 3UCFA 4I5FA 8LDHA 4IDDA 3A14A 4MKXA 1SEVA 2CY0A 5T64A 1S7CA 3R0IA 4L74A 3VOSA 4TZTA 4A73A 4Q3EA 4ZGWA 2W4QA 4J7XA 3VDRA 3TRIA 4E3ZA 1RPNA 5L45A 4EJ6A 2D2IA 5BNIA 3ASVA 4P38A 3RBXA 4ALLA 2DT5A 4B8ZA 3WWZA 5AVOA 5AQ1A 4PLPA 1JVSA 2AEFA 4MIOA 1BXKA 3NEPX 3AOGA 1KY4A 2GNAA 2GN4A 2PNFA 5G4KB 4DMLA 2JCYA 2Y1EA 1I5RA 1LQUA 1PQPA 1T2AA 4DL9A 4ZICA 1PR9A 1ZJZA 3N7UA 1UXGA 4OMUA 3UKOA 4WE3A 3WGYA 1ZEJA 3ZV3A 3E82A 2QQ5A 3BHMA 1LRKA 4OKNA 3S2GA 1GU7A 4O0LA 4W9NA 3ZZNA 1BXGA 3AI1A 4UUNA 1GTMA 1XG5A 1JN0A 2R2GA 4KTVE 3SBOA 1U5CA 1X7HA 3JD4A 1YWGO 1XU7A 3AM3A 4Z0PA 1UDCA 1BHSA 5IXSA 3GT0A 5EESA 4LVCA 3WXBA 5ITVA 3IIEA 3Q9UA 1B8PA 1Q7CA 4YR9A 2YQ5A 4J1NA 2FZWA 3JQDA 3ZNNA 4CMHA 4AJOA 3SLGA 1VRWA 1EMDA 2AG5A 2HDHA 1K5HA 1DSSG 2HMTA 3DTYA 3IUPA 4J91A 1E7YA 1PQUA 2ZCUA 1I32A 1TT7A 4YJGA 3UW3A 1GD1O 3QVOA 1DLIA 2XAAA 4FBGA 2O4CA 1F06A 3I9LA 1DC3A 3DZKA 4IY1A 3QLJA 2ZIZA 4N5MA 3W4JA 3ZU2A 3ZWYA 3M2TA 2X0RA 4CUZA 1XR3A 1EQ2A 3N58A 4NJMA 4XWYA 3EYWA 3RC9A 3GVHA 2VUTA 3QVSA 4E13A 3WFJA 1YVEI 1VM6A 2X0IA 1GZ4A 4XR4A 1QYCA 5JCJD 2IDZA 3DXFA 1RM3A 2AA3A 3FPCA 4JNKA 3PLRA 2W2LA 1OFGA 4FJ0A 4J43A 3I52A 2X5JO 4B4OA 3FI9A 3OQBA 4CMBA 1U4OA 2CDBA 1NASA 4CM6A 1U28A 1HTBA 1VKNA 4D42A 3JD2A 4EUFA 1D1TA 1I2BA 3PVZA 3U4DA 4EITA 4QTZA 3LK7A 3ITDA 1KY5A 4BO2A 1DRVA 3ULKA 2B4QA 2W2KB 3C24A 4XQ9A 4WOKA 1R4NB 1PZHA 3SJUA 1KVUA 2J3HA 2W98A 1PSDA 2CSUA 5CDTA 2JJYA 1ISGA 3AFNA 1HSZA 5A9SA 4Y6RA 4EUHA 2SCUA 2GN9A 3LF2A 3ANNA 1E3JA 1NR7A 3RUEA 3B1KA 3WBBA 3A1NA 2C54A 3INRA 4PZDA 1PU2A 1Y8RB 2GGSA 5GY7A 1UDBA 2IODA 3DR3A 3H4VA 5TF4A 3LSYA 1U7TA 1FDTA 2H9IA 4RPJA 1B0AA 4RGBA 4ZQGA 5B1YA 3E03A 1J5PA 2Q1SA 4MP3A 4LSMA 1BW9B 1KVTA 5A5EA 1Q7BA 2CZCA 2NTVA 1V3TA 1P1KA 2NWQA 4WK6A 4ZRMA 3S2IA 3TJRA 4ZQHA 2OBNA 5TSDA 3WGZA 3JD3A 1X7DA 1DDOA 3F47A 1EK6A 3BMNA 2OUIA 3ZV5A 1QSGA 2C7VA 3KSDO 3FCOA 1T1SA 1ZFNA 3FHLA 3H5RA 4MKZA 3GUYA 3OIDA 1QMGA 4WLEA 1C14A 1TI7A 1D4FA 1GCUA 4RZIA 3R3SA 4N54A 3F46A 3S55A 1QV7A 3GPIA 4JJFA 5COQA 3DAFA 4W4TA 2FY8A 4KDEA 3S1LA 2JD1A 1N5DA 2QYTA 3PHIA 1W6UA 4PG6A 2BH9A 5IDYA 3DMTC 5JDIA 5BSHA 1ONOA 2DU8A 1DJQA 1SEPA 3V2GA 3WNVA 5IJZA 4DBVO 3MJVA 3NV9A 2DTXA 2POQX 3NGXA 2AEMA 1FMCA 3WGHA 4EZBA 4LW8A 3VVBA 3GGOA 3ZU4A 1E3WB 2FP4A 3ANLA 2ZK7A 3CMCO 1P1HA 2RCYA 3DQPA 3I9KA 3ZWNA 5KKAA 3MJSA 4BGEA 3NTRA 4BKRA 1YXMA 5HM8A 3GVXA 3E5RA 1HE2A 1WMAA 1B3BA 3HWRA 3BMOA 4EJMA 2FR8A 3C3XA 1ZK2A 4PLFA 3QRWA 1J0XO 3ADPA 3G17A 2DAPA 4IS3A 2VYVA 1LU9A 1Y1PA 1P74A 3ZNPA 2GCGA 2D59A 3G3EA 3LLVA 2RHCA 4J90A 3SC6A 4UEKA 3DFUA 4CV0A 1EFKA 2X5KO 3KB6A 2HSDA 3JYOA 3LT4A 1MC5A 2O2SA 3I4CA 3PFWO 1O89A 1H6CA 4RF5A 3HUDA 5TRTA 1PS8A 1VSVA 1YJQA 2ZTUA 4BHTA 4OJNA 4R3NA 3E9MA 3B6ZA 5TC4A 5IDQA 1CRWG 2EJWA 1L7EA 2NU6A 4ALJA 3DOOA 3W6UA 1VJ0A 4LRTB 1MG0A 3K31A 3BXXA 3ENKA 4R54A 1LEHA 3WFIA 2P2SA 4IIVA 4HV4A 4CQMA 1RM5A 3L4BA 5JS6A 3UICA 3K96A 1EBUA 4Z3DA 5T6BA 3VZSA 3A9WA 1HL3A 2PGDA 2YDXA 3D3WA 4PG5A 4E0BA 3H8VA 1HYGA 1PS9A 4MVJE 4J7CA 2F1KA 2ZTVA 2BFAA 5EQFA 2C2YA 5G0SA 4BNIA 3ZWOA 2Q45A 4GH5A 5GZ1A 1EDZA 1ISHA 4MIEA 3HADA 3AI2A 2Q2VA 4MP6A 1Y7TA 4P22A 4BNJA 4YYZA 1KS9A 3NT4A 2ZJ0A 4TZKA 4XYBA 3NDJA 3JQ6A 4M89A 1GEEA 1WAMA 2YHIA 1LDYA 4BNMA 3HHPA 3BTSA 1LSSA 1GEGA 1E1LA 1GYPA 2WD8A 1NNUA 5LC1A 1X0VA 3FWNA 5KTKA 1YONA 2YFQA 5A9TA 3BHIA 1A71A 3RUAA 1E3SA 2EP5A 5KIAA 1H93A 2EF1A 1ZIDA 4RJTA 1I10A 1E7QA 5CAEA 2UUOA 3H5AA 1NFFA 3MWEB 1ZMOA 2X7HA 4IUYA 1E92A 3BMQB 5COAA 1A5ZA 4NPCA 4GX0A 4DWVA 2EKPA 1E1KA 4YJFA 4CL8A 3DZFA 3OJOA 2DBVO 1NQOA 2GSDA 3QWBA 1LSOA 1DJNA 5F5LA 4BKOA 1EUCA 2AMFA 4L75A 5BNTA 3QW2A 2PWZA 1P9LA 3O8QB 4O63O 3PPIA 4YVFA 4BQRA 1MG5A 4CODB 1ONNA 1IE3A 1XQ1A 4TROA 4CPDA 4Z3KA 3O26A 9LDBA 4OO3A 3OIGA 1BSVA 2ZCVA 5THKA 2B69A 1Y81A 3H3JA 1R0LA 2EEZA 4IJKA 4JJIA 3V2HA 4MDHA 5IN5A 3MOGA 3RKRA 2O4UX 3DZJA 4NR0A 3DHYA 4MOWA 4BO3A 3KM0A 3HSKA 3PZBA 1GV0A 4HNHA 2DFVA 4D43A 4RF3A 1EUDA 2ZQZA 3OJEA 1ID1A 1HLDA 4FC7A 5T67A 3ADOA 1T25A 4PLGA 4RVFA 4BIIA 3NUGA 3MOIA 2E6UX 4PG4A 3I1JA 2X22A 3QVWA 1PJTA 1XELA 2B4RO 4RZHA 1WDLA 3I4FA 2NVUB 5BT9A 4B8WA 4E5NA 3IJPA 1MP0A 2G82A 4UEOA 1R16A 4FGWA 3DBVO 1XGKA 2P4HX 2QRKA 3CE6A 4K28A 1S6YA 3RD5A 2Y0DA 3GDFA 4BB6A 1YGYA 2BGKA 1HDCA 2BFOA 1M2WA 4BNLA 2DLDA 2UDPA 3ZN2A 3COSA 4DA9A 3RVDA 2PH5A 4RVUA 3WGQA 4OXNA 2O50A 4J0FA 1Q0HA 3R3JA 1DIRA 1HE5A 9LDTA 4XZ3A 4RPKA 1M67A 2GERA 2IE0A 4YAEA 1NPDA 3FNEA 3GRKA 4J49A 2VTDA 4YBZA 4NU6A 4IGFA 5F1KA 2G17A 3UFXA 3WQSB 5FYDA 4GWKA 4WUVA 3FR8A 1ORRA 1NR1A 3C1TA 4CV3A 1Y9AA 3SC4A 1PS0A 4OIMA 4G5HA 6ADHA 1ZSYA 4G81A 3PIIA 3AUTA 2JFFA 1ZNQO 4JBHA 2Z1MA 3V1YA 2YUTA 3KUXA 2PY6A 1XCBA 2FRDA 1EVJA 2YFHA 4GAEA 3U4HA 1KBZA 4FPXA 1GAEO 5DCYA 3JQ9A 3JQGA 5U1PA 1I3MA 1Q0QA 2Q1UA 3L6EA 4Q3DA 4XB2A 4HFRA 3KYCA 4E31A 1MFPA 3OJ0A 4PLZA 1Z75A 1KIFA 4JCOA 4PIVA 2QRLA 4EUEA 1BGVA 4E2XA 4TRRA 4HNGA 2PR2A 2JHGA 3NDRA 4R01A 2B5VA 3JD0A 4BO9A 3BAZA 4ZA2A 4ZHSA 2AE1A 4UVGA 2TMGA 2FN7A 3B1FA 3BMCB 4P8RA 4Q3AA 2D5AA 4CMGA 3IJRA 1JKJA 3HG7A 4DC1A 3O9ZA 4GVXA 3R6DA 1A27A 4MVJF 4Y9DA 1MFZA 3WLEA 4PZEA 1HXHA 1UZMA 3CH6A 3ONDA 4RV9A 3TN7A 5JMWA 2O3TA 4HXYA 2EWMA 4YAIA 4CMIA 4W7HA 1AN9A 3GNTA 4GBJA 2O23A 4HY3A 1HE3A 3QWIA 4HX5A 4BKUA 3PHLA 4E5MA 1UXJA 4FSHA 1NX6A 3PHHA 2G0TA 5TGDA 1Y5MA 1DO8A 1H6DA 1TVEA 4L8VA 2PTGA 3WGOA 3GG9A 2HJRA 4U6QA 5HA5A 3OJFA 3D4OA 4J1SA 5HRUA 5DP1A 3PDUA 3PRJA 1YE3A 4IDGA 5EJ2A 1GZ6A 5ER6A 4WLFA 2GLXA 3TOXA 1SOVA 1EUZA 1LLUA 2VOEA 4R9SA 1IY8A 3WJ7A 3UVEA 2A92A 3ETGA 4RCVA 4ND2A 1TB4A 2P4QA 4YWJA 1R6DA 3CKYA 1SBYA 4IBOA 5KJ1A 3LF1A 2B4TO 4B7UA 1RYEA 2XXJA 3ZW9A 4NBVA 3EY4A 3GN1A 3RI3A 1YBVA 5JAZA 2YV2A 5B4TA 4XB1A 5IZCC 2X4GA 3I3OA 3M6IA 1UAYA 4ZQFA 3IKTA 3TL3A 4II2A 2IEDA 2D1YA 2GRAA 3FNHA 2OFPA 2HJSA 1EVYA 2P9CA 3SVTA 1JAYA 1NWHA 3OEWA 1XDWA 4YT8A 3HJAA 3ZWMA 4FCCA 4NBTA 5ADHA 4J4TA 5I7SA 2Z5LA 4PVCA 1C0PA 3IS3A 4CMCA 4NBRA 4DXHA 1ADFA 3KV3O 5HS4A 2J3KA 2IZ0A 4PFJA 3C7AA 1IYZA 3AY3A 4KTTE 3VH3A 3JYPA 4U6SA 1F0YA 3C7DB 1H9BA 5IXYA 4DLBA 4CLHA 4RLHA 5G4KA 3NDIA 3U0BA 4F45A 1ADBA 4CR6A 3IQDB 5L4SA 3TZQA 2Y05A 2V6MA 4YJDA 1C0KA 4BNXA 4J4BA 1UH5A 1V0JA 4FJ1A 1HWYA 3Q0EA 4MIYA 4YRAA 4C4OA 1PL6A 1CF2O 1ULUA 3HFGA 4U0KA 4MVJA 2VHZA 1DC4A 1GFSA 4Z9FA 2BGLA 4AJPA 1K6XA 3TL2A 5TJHA 4ALKA 2WM3A 3C1AA 2EG9A 4E5KA 5ILOA 1T1RA 1SZJG 4CLOB 3D5QA 2VHYA 3VVCA 5JO0A 5JYDA 3KTDA 1WPQA 5H81A 3AJRA 1AUPA 1CDOA 4XGIA 4IIUA 3TZHA 3F9IA 1DPGA 3TZKA 4CL3A 4YT4A 4MVJG 3KZVA 5G0WA 3ROQA 4LN1A 5JY6A 3F1KA 3T7CA 1HDYA 3JQGB 4RPHA 5L7YA 1MA0A 4OXKA 4IDAA 3WR5A 3WICA 2RH8A 1PJQA 1JAXA 4BO6A 4K6CA 4JP2A 5EINA 5THQA 4J0EA 2JHFA 4FFLA 4IJWA 1LDMA 4UEJA 4WCFB 3VH1A 3HDQA 1VJ1A 5LDGA 3K2EA 1H2BA 4AVYA 3WS7A 3I9OA 2FHSA 3L9XA 2DBRA 5IDXA 2GASA 2DUUA 1RYDA 1A4IA 3OFSA 1PL8A 2CVQA 4PRLA 1AXEA 2ZB4A 1A9YA 5JSFA 3DC2A 2BHLA 1TT5B 4Z0TA 3TSCA 1B8UA 1AGNA 1ISFA 3O38A 1P1IA 3WMXA 1QYXA 4YEDA 1PEDA 2I9PA 1DIGA 3DMTA 3OQ1A 1E3LA 3NRCA 4MVJH 5AOVA 2I3AA 4CM3A 4YACA 1ENYA 5IAAA 4IM7A 2B5WA 1DRUA 4FFOA 4GQAA 4IGEA 4QQRA 5KJCA 4H7PA 2YW9A 4FQ8A 1C1DB 1ARZA 1C0IA 2Y1GA 1OAAA 2W2KA 2BD0A 3TZCA 3D5TA 2VZ0A 1R4NA 1KOLA 3DZGA 4CMKA 4YTEA 4PN3A 2VZ9A 4J16A 4BO1A 1M75A 1A9ZA 1GUZA 2EXXA 3P2OA 2FSSA 4RO0A 3ZWVA 4DC0A 1GYRA 4OL9A 1Y8RA 3B70A 4MVJP 5EN4A 1ZZEA 3RUDA 2CFCA 1PJLA 1WZIA 3WQQA 2QZZA 1U8XX 1E7WA 3GQVA 3AW9A 1Z45A 1QYWA 1BW9A 4U0JA 4J3FA 1VKOA 1ISJA 2ZJ1A 3V1UA 4CQLB 1ZBQA 1I01A 2HK7A 2PKQP 4BQPA 4L0QA 4D44A 2C5EA 5EQDA 2PD6A 3NJ4A 4WCFC 1N2SA 2DTEA 4MP8A 2QRJA 3JQCA 1SPXA 4UREA 4CLDA 4MPDA 1YQDA 5GZ6A 4AL4A 2WE7A 4YJHB 3FD8A 5I7EA 4QEDA 3NKLA 1I0ZA 1IB6A 2TMDA 3D1LA 1KETA 3ZNQA 4I08A 2Q1WA 4BUCA 4ALIA 2X6TA 1EK5A 4LMRA 4GWGA 1SOWA 1LXCA 1UZNA 3PHJA 5KJ6A 3IOYA 4RL6A 2E48A 3I23A 3V2UA 4F46A 1NM5A 5A1TA 2AEJA 4AICA 5L53A 3U3XA 1O8CA 3H2SA 3NTQA 1YB1A 1AE1A 3CSDA 1ZK1A 1E3WA 2QHXA 2XF8A 4UVEA 4PLHA 3PJFA 2AG8A 2EW8A 3M1AA 3SLKA 4B4WA 1C0LA 4DUPA 1E3EA 2CF6A 4Y6PA 2W8ZA 3JYQA 4GVLA 1ZK4A 3GZNB 4BO5A 2GO1A 5GZ3A 3I9NA 4LCEA 2RBEA 2J3JA 1HLPA 5JC8A 5FEUA 1ENPA 5BSFA 3JYNA 1YH3A 1N92A 3BHJA 4RPLA 3RFXA 1ONPA 3UN1A 3QP9A 1JDJA 3TZ6A 3ROMA 4IPTA 4A7PA 3LT0A 2O7SA 2PGLA 3VZRA 1O9BA 3Q1LA 3SX2A 4KOAA 1G0NA 4OOFA 2GF2A 2OOSA 2QG4A 4E30A 4E21A 3RSHA 2DQ4A 3MZ0A 4HBGA 3TQHA 2ZYGA 3E9NA 4RQTA 1ZKMA 2E37A 3PK0A 4O1MA 1NPTO 4EEZA 2GDZA 2DBQA 1YL6A 2VUSA 2X8LA 3GMSA 1P77A 1PGOA 1PJ4A 3EAGA 4WLUA 4FB5A 1GL3A 5I9LA 2HRBA 2VHWA 2VOJA 2O3UA 3GH3A 4HFNA 1U2GA 1IUKA 3BTUA 5CP8A 4NQZA 4XYLA 2P5YA 2P9GA 2C2XA 3QVXA 4CMJA 3JQFC 3R1IA 1XKQA 3ITKA 4OQZA 1YBAA 2PLAA 4CM9A 2GZ2A 5CDUA 2VZ8A 1QORA 4NFSA 5C7IO 2PA3A 3FN4A 2PZMA 2ZATA 3CIFA 1CQIA 2X23A 1CJCA 3IP3A 2BLLA 1PJ2A 1GCOA 2GR9A 3RU9A 2VYND 1IULA 1BDMA 1PJCA 3WYCA 3HQ4O 3TFQA 5CPBA 4I9UA 2FR1A 1YKFA 2I65A 2X5OA 4CMAA 2DKNA 1LI4A 1UP4A 3BMQA 4YXFA 2ILTA 2HMUA 4UUPA 3PZRA 1QG6A 3W6ZA 2RH4A 4DYDA 4A10A 4BNZA 1Z7EA 2PD4A 2DBZA 3PHGA 2WD7B 1X1TA 3O8QA 1P45A 1LA2A 1PJ3A 1NQAO 5G0UA 2H1SA 1G6KA 3HB4X 3UOGA 4URFA 4L4XA 3FNGA 2FPGA 3WWYA 1FJHA 2Y99A 5JAQA 4GPD1 1ZXLA 4GSKA 3PWKA 3ZHBA 1YB4A 4XJTA 1QKIA 1SCUA 4TQGA 3LDHA 3PQFA 2G76A 2HK9A 3C85A 3KYDA 3LC1O 5DBFA 4Z6KA 1X14A 3DAPA 1SMKA 1T2DA 1I33A 2VWGA 2NLOA 4I9HA 3JCZA 4E2YA 4NK4A 3GDOA 1OMOA 2AXQA 2V7PA 4BNGA 1VLLA 4P4GA 5AXAA 3IAHA 1IZ9A 2BI8A 2AQIA 3GGPA 2BMAA 1ZUD1 3EZLA 2NVUA 4J6FA 3JV7A 4BO7A 2C82A 2HQ1A 4RDIA 1R0KA 4RORA 3W8EA 1HDXA 5A04A 1UR5A 4N18A 3K92A 4YQZA 3GAZA 1DIHA 1E6WA 3DBRB 4PVDA 4X54A 5CEEA 4D0SA 2GYYA 3FNFA 3WMWA 2X9VA 1IHYA 2GD1O 2NSDA 4GKBA 3MJ4A 3DZBA 3ONFA 5TT0A 1FDUA 2PKRA 4KP7A 4OSOA 5JO9A 4WNCA 3IP1A 3SJ7A 1B2LA 2OL4A 3QY9A 1WDKA 1YDEA 3K5PA 4LSWA 5ENVA 2DPGA 3I6IA 5T5QA 2D0IA 1LRLA 1DEHA 5L7TA 2RIRA 1DC6A 4FJ2A 1R66A 3GHYA 3JD1A 3ZDFA 3VPHA 2UVDA 3AFMA 1HDGO 4MINA 3ZI0A 2Q50A 4MJLA 4YRBA 2VCYA 1KERA 3AM4A 3NYWA 3QIVA 2VWQA 2CDCA 4L4RA 4UUMA 4AJKA 5DOZA 3PYLA 1U3VA 5LCXA 1NP3A 8ADHA 4BV8A 2VRBA 5IZCA 3WX0A 3Q11A 2VHVA 3EDMA 2VNSA 4U8GA 1HKUA 5JAMA 3VKVA 5A4DA 3DZHA 2C59A 3WYEA 3SXPA 4BMNA 4Y8VA 1E5QA 4KDFA 4ONEA 3RUHA 5I9NA 1J6UA 3HE3A 5KNLA 1G1AA 4TVBA 3VH4A 4PG7A 3C8MA 4PLCA 4BMSA 3BMCA 3L9WA 1VE9A 1SO8A 2EKQA 1BRMA 1F12A 1TEHA 3KO8A 2R6JA 3AUAA 1A72A 3OMLA 4K26A 6LDHA 2XPCA 3P19A 1JWBB 5COBA 1MXHA 4KWHA 4QX6A 1NYTA 5DCUA 5KVQA 5T57A 2PV7A 1R4MB 1KC3A 1LBEA 4R68A 3VH2A 1DC5A 2DVMA 3ETDA 5L9AA 3RWBA 1HSOA 1QXSA 5JDCC 2I6TA 5IDWA 3V1TC 5CPFA 5KCZA 1HEUA 1HRDA 4W6ZA 4CMEC 1GZ3A 3NX4A 4NBWA 4XIJA 5CEJA 3IUSA 5JCJA 2VRCD 4R4JA 2UUPA 3ON5A 2X1HA 4FOOA 2AQKA 4DLLA 4BNUA 4F6CA 5K9ZA 1DIAA 4W99A 3GVIA 4PZCA 1ISIA 1GUYA 2JKVA 3I9MA 4L9RA 4TWRA 4WLNA 2X58A 2FWMX 4DIFA 5I8ZA 1LQTA 5ICMA 2B83A 3PI7A 1I3KA 1U3TA 1LDNA 4IQ0A 1J49A 4OOEA 1YOVB 5GMOA 5BR7A 5G2OA 4N5NA 3V8BA 3ZGYA 3OF2A 1NXQA 3CTMA 2BI7A 1ZEMA 5G0TA 4YT5A 3K8ZA 3VZPA 3NT5A 2IRWA 4R5HA 3QHAA 3KYDB 4ND4A 3ZNOA 5CG2A 1VC2A 3PYXA 3KSZO 1F17A 5DF1A 1OC4A 1ENZA 1KEVA 3JQ7B 5U4QA 3RCBA 3DOJA 2DUWA 4ALNA 1PZEA 4CM4B 4A5OA 4EYEA 4JIGA 5KOIA 2JFHA 4D45A 3EK2A 4HP8A 4O6VA 3EVTA 2H6EA 3DBHB 3TWOA 3VTFA 4MKRA 3CEAA 1LTHR 4RQUA 4PLVA 2GN8A 4YPOA 2Q3EA 3OQ6A 3L6OO 4ND5A 1C3VA 3EGOA 5B37A 1A7AA 2D3TA 3OICA 2X86A 2OMEA 3JYLA 1SB9A 2ZYAA 3OH8A 4JP3A 2D5CA 3K73O 5K0ZA 2X0NA 1MC4A 4EJ0A 3WNQA 1VJTA 1GR0A 5F1OA 1YDWA 2CMDA 2OXIA 1T2EA 4KMSA 1NPYA 3CZRA 4PLTA 4RVHA 4AJHA 4CLOA 1T24A 3PEFA 3HDHA 5ER9A 4B3IA 2BF7A 5A5FA 1X0XA 3QWFA 1GV1A 1ZSNA 3UCXA 5T8KC 1XHLA 2CD9A 3CUKA 4JJGA 1Z82A 1P0CA 3DHEA 1WVGA 3ONEA 3U4IA 3BZUA 1HYEA 1ZMTA 1G0OA 2AHRA 4ND1A 1Z7BA 1PQWA 1T4DA 2NU8A 3ZHZA 5C5IA 2GN6A 1ZK0A 2H63A 2GZ1A 4WLOA 1UZLA 2WYWA 3MWDB 4L76A 1GQ2A 1NVTA 2Q49A 1UDAA 2JAPA 3T4EA 4YAGA 2Q99A 4WCFA 3WJAA 4FC6A 3RKUA 4BNHA 3WOHA 3PWSA 2E82A 3QJ5A 4NG5A 2HO5A 2E4AA 1UXKA 1LSJA 3AK4A 3PJEA 3RBVA 4DMMA 5ENDA 1SC6A 5HBRA 2NQ8A 3ZV6A 1EFLA 5KJFA 2YYYA 5U9CA 3BA1A 3WTCA 4CLRB 1TT5A 3MTGA 4K1LA 1IHXA 1GY8A 3DB2A 5CHEA 2ZB8A 1IOLA 2FOIA 4JN6B 1Z6ZA 4IZHA 3VPFA 1MX3A 1X7GA 3RU7A 3GEMA 4LMPA 4KQWA 3L6DA 4N7RA 2Y1DA 1C1DA 3GDGA 3VC7A 4AJNA 4KWIA 3OBBA 4RLSA 1B16A 4IQ8A 1O95A 3UXYA 2HRZA 2PGJA 3GVCA 1O6ZA 1UAGA 5FFFA 4ZN6A 1K89A 2YZ7A 3QA9A 4L73A 5A3VA 3E8XA 1WXDA 4BOYA 4IDBA 3H9EO 3B1JA 1EE2A 5A9RA 1AXGA 4U5QA 2DM6A 2NVWA 1FDVA 2FZEA 3HN7A 3HDYA 4DIOA 2WYUA 1A7KA 3B20A 1HETA 3W4IA 1CQJA 1GQYA 2O48X 1PWZA 3Q2IA 3RJ5A 4YRDA 4E12A 2FR0A 2QW8A 3E9QA 4MVJM 1OC2A 4PCVA 1BVUA 2D4AA 3BTOA 1LX6A 4CQLA 5TLSA 5J23A 1V6AA 3WGIA 4IDFA 1B7GO 3GPDG 2VRCA 3E48A 3TNLA 1HF3A 4TMFA 2V6GA 4WNIA 4BNNA 2PZKA 3C1OA 5DZSA 1Y8QB 2AE2A 3AOEC 2AQ8A 4YJHA 5TNXA 4HUJA 5TIIA 5EIOA 4XD2A 3NJ8A 4AJ2A 3I6QA 4HKTA 4IXTA 4FW8A 1H9AA 4BO0A 4GKVA 1EEHA 3G49A 3JQFA 2BKAA 2J6IA 2WYVA 5A3JA 3HDJA 2VN8A 3CXRA 3T4XA 4CV1A 1DFGA 1JKFA 1FF9A 1I24A 3ROKA 1GYQA 3U4CA 1MLDA 5F21A 4XQEA 3ZV4A 2NADA 2X9NA 3KHUA 1D1SA 1C1XA 3WGGA 5EERA 3IL2A 3ASUA 4K6FA 4NJOA 1KEUA 5DDIP 1GPJA 2VT2A 3EUWA 1H6AA 1P1JA 2P9EA 5G4LA 3RUCA 5JYEA 3GZNA 1E77A 3G1UA 3HNPA 1KC1A 2NV6A 1DHTA 1SB8A 2Q2QA 4NZ9A 3IMFA 2HAEA 3RIHA 3L07A 2UYYA 2YY7A 4D46A 1DFIA 1PGJA 5JW6A 2ZQYA 5CFZA 3KRTA 1DIBA 1Q2XA 1QRRA 3GNSA 1TA4A 3ROPA 4FFMA 1XEAA 4XKJA 3D3EA 2YV1A 4GLOA 1I36A 3H9GA 3H3FA 3E18A 2W2LD 3JTMA 1T26A 3LZ6A 3K2BA 1I3NA 4BKPA 1DB3A 3ENNA 5DBIA 4IQGA 4FDAA 2VTEA 4FOSA 4CR7A 4YQYA 1LJ8A 4E4YA 4QO8A 4RDHA 1JVBA 2I66A 1VL0A 2WDZA 3OP4A 2C29D 1U8FO 3OA0A 4HFJA 2PZJA 1EE9A 2O7QA 3FF4A 2GUGA 5ITWA 3CMMA 4IMRA 3K30A 5CEFA 1CERA 4Q3NA 1EVIA 1V35A 1N9GB 4RF2A 1SAYA 4TKLA 1X1EA 2OP1A 1BVRA 5AXCA 4DIBA 3ABIA 4D7AA 2R00C 3G79A 2DFDA 5F5NA 4S3MA 1YBMA 4QFDA 1BG6A 5ICSA 3GMDA 4AJEA 5L4LA 2UAGA 2JL1A 2YJZA 4J1QA 1YQXA 3U9LA 3ZHYA 2AQHA 2NNLD 3ZWAA 4AJ4A 1HZZA 3O4RA 5AXBA 3W8DA 5KVCA 4H15A 1I3LA 4YAJA 5K6AC 4IMPA 4CV2A 1MUUA 4UULA 5KKCA 2FPIA 2V6FA 3AY6A 2CNBA 4BS9A 2PZLA 3INGA 5C7OO 1PIWA 4UUOA 2WD7A 3L0DA 2HUNA 1MB4A 4NMHA 1E7MA 4OAQA 1ZJYA 1QP8A 3GC6A 4IXWA 4WPGA 4ZVVA 2YHUA 1WMBA 3TPCA 3LT2A 4ESOA 5CDYA 3D4PA 2X9GA 3NGLA 1BDBA 3VTZA 4GLLA 7ADHA 3F4BA 4I5EA 3VPSA 3RAJA 3RC1A 1N7HA 4BGIA 4BGVA 2Y93A 1VL6A 4UAGA 4LRSB 4E5YA 4Q3CA 2J3IA 3DDNA 4CUJA 1P44A 1P1FA 3LC7O 4K9DA 2VYVD 1FXSA 2JD2A 4R9RA 4ZQBA 1R37A 3MTJA 1NHWA 3A06A 3ZU5A 4PLWA 1QLHA 1C1XB 5IG2A 3WLFA 1B8VA 2CVOA 2J5KA 4TRJA 3DBRA 3UAGA 5C37A 4TKMA 1XA0A 2EV9A 5IF3A 5LDHA 4P4LA 4PGFA 5JDCA 3F4LA 1E6UA 1JA9A 5H82A 2J5RA 3DONA 4DGSA 4CMEA 4OQYA 4GL4A 3GZ4A 4A27A 2LDBA 3DBLB 1H94A 1KEPA 5DT9A 4XQCA 1Q0LA 5G0VA 4B7XA 2JCVA 1ADCA 4XYMA 3WIDA 3HN2A 1D8AA 1PX0A 3KXDA 4I9NA 4NHEA 4XYGA 1LDEA 2BGMA 4CQMD 1W8DA 2V65A 4UVIA 1GDHA 4M86A 3H65A 3WTBA 5B4VA 2WSBA 4JROA 5F1PA 4E33A 3QWHA 4WOJA 3VZQA 1OZAA 4C7KA 1YL5A 2QYSA 3FBGA 1BTOA 1I30A 4ND3A 2PD3A 3GRPA 3JQ8B 4BO8A 3W1VA 1E1NA 1PJBA 2JD0A 3PDJA 3WB9A 4OHUA 3PQEA 1XQ6A 1XWFA 3ZWXA 3RQSA 4GGOA 4MVJI 5ILGA 1X15A 2J5QA 4KUEA 1ZVMA 1PZGA 1WP4A 4NK5A 4OYRA 1LSUA 4ROSA 1O94A 2IYOA 3VPGA 3CTVA 2XXBA 1R0SA 3LQFA 3NTOA 4E32A 4INAA 4M8SA 1T4BA 1E7SA 1U3WA 4TRMA 4BNFA 2WJPA 1M6WA 1CIVA 4J1TA 3E1KA 4M49A 3GA0A 3EVNA 3M2PA 3L4SO 4XJSA 3GUCA 2ZB3A 3KEQA 5JC1A 2D8AA 4NIMA 2C7GA 3OEYA 4PG8A 1Y6JA 5L51A 4DQXA 3RBZA 2V6BA 5I7FA 2Q1TA 3TDKA 2C20A 4B3HA 1AHHA 3ST7A 1Z73A 3GN2A 3GFGA 1R4MA 2DPHA 2P91A 5JBIA 3TFOA 4GMFA 1KVSA 3OIFA 1LLDA 4WJZA 3AUSA 1QR6A 1V3UA 1NWCA 4FGSA 4FS3A 4DPLA 2JAHA 4QFCA 4R3WA 1KEWA 2ET6A 5JCXA 1NHGA 3A28A 4GI2A 4DVJA 3GK3A 4BVAA 2EERA 3JQAD 4YB8A 4CUKA 4DTIA 3QSGA 3ZWPA 5T8KA 1XSEA 4XCVA 4CJXA 2YDYA 2G1UA 4OKIA 1EQUA 3WGTA 5FWNA 1YOVA 4WKGA 3GEGA 1UJMA 4J9VA 5TS3A 2WEKA 2OHXA 1LNQA 1T2CA 3AY7A 3G0OA 4J7UA 1HYHA 2QIOA 1JU9A 2B37A 4RVSA 1L1FA 4CM8B 3FRJA 3U62A 4XX0A 1YL7A 2Q4EA 3LC2O 5FI5A 3S2EA 5JFOA 5EMHA 3P7MA 4R1NA 3LU1A 1K6JA 5EL0A 2OO5A 3JQ7A 3QVTA 2Y1FA 4CM4A 3LYLA 3DOCA 5B4UA 4JLWA 1LRJA 1E3IA 4NFYA 4FFNA 4QXMA 4GX5A 4WEOA 4NDNE 4ZQEA 1WW8A 3DBHA 3DWFA 1OOEA 1T2FA 1F8FA 2NUAA 4Q39A 3JQBC 2NVBA 1HDRA 2IYPA 2EJVA 3L77A 5C7LO 1D7OA 4EEXA 2OP0A 3IKVA 1W73A 1Q7GA 4O59O 1KYQA 1PGQA 1JWAB 1EVZA 2OZPA 1ZW1A 4J2HA 4IS2A 3W4KA 1PJSA 1CEQA 2O3JA 4XGNA 4B4VA 1WLYA 4BB5A 4CM5A 4NNJA 4RVGA 4AJJA 4JBIA 3DHNA 1O5IA 2I76A 4TSKA 1JTVA 4LCJA 2HU2A 2Y1OA 4XQGA 1HZJA 1BXGB 1D3AA 4IDEA 1JQBA 4ZD6A 4B7CA 1DBVO 2A35A 3U5TA 5BSEA 4A03A 2I67A 1UXIA 1RM4A 1M6HA 2DC1A 4Z0HO 3PJGA 3U09A 1IZ0A 4JGBA 1E0DA 3H9JA 3F3SA 3KBOA 3Q2KA 2VWHA 2ZTMA 2EHDA 4KQXA 4DPMA 2Y68A 3Q3CA 4AFNA 1YRLA 2Y0CA 1N7GA 3FTNA 2E49A 1HDZA 2IZ1A 1RM0A 2PH3A 4JQCA 4ZJUA 1XYGA 3X2FA 1DFHA 1LLCA 3V5NA 4R1SA 4Y6SA 3DEYX 4DLAA 5L95A 3SEFA 4WCDA 2DTDA 1LUAA 1N1GA 3ZH2A 4CLEA 4FR5A 2VUUA 2OBYA 2B0JA 1NAIA 3OETA 5L40A 1DOHA 5FF9A 3GHHA 4YJGB 3T7EA 4AJLA 3WSWA 2IXBA 1RWBA 3CZMA 1ZH8A 4EW6A 1E5LA 1ENOA 2XOXA 3LLSA 3INTA 3PQDA 4GMGA 1OBFO 3AOEA 1YB5A 4J4HA 4NJMB 2I5PO 3OJLA 5A06A 1F14A 4DPKA 1ML3A 1HE4A 4TVOA 1DHRA 4CLRA 1AHIA 4O5OA 4E2WA 2VQ3A 4R5MA 2IZZA 1ZXBA 4NH4A 4CM1A 1JLLA 4OH1A 5F3RA 3RUFA 2F00A 2A4KA 4ID9A 3C7CB 3DL2A 1NFRA 2P68A 3AM5A 3FTPA 4EBFA 1R15A 2BELA 4R41A 1PR3A 2EIHA 3FSRA 4Q9NA 1U4SA 3RJ9A 3PFFA 4BKQA 1N8KA 3FWZA 1WZEA 7MDHA 4GX1A 3I83A 4II3A 4BMVA 1ZO8A 1NFQA 3BYZA 1K2WA 4FFPA 1ULSA 4AG3A 5A9SB 1QYVA 3IDSA 4W9NC 1P1RA 2I3GA 3MJTA 2PFGA 2WE8A 2OGUA 4WECA 1U2DA 3DFZA 1X13A 3TOZA 1XIVA 3BTVA 4Y67A 3VAZA 4IJVA 1V3VA 4MO2A 4HWKA 4QSMA 1ISMA 3LT1A 5MGBA 1F8GA 3PGXA 4XEHA 1TXGA 1NBOA 4W7IA 4QUKA 5JY1A 3TF5A 5DBGA 1UP7A 1CWUA 2VYNA 3GY0A 1ZSVA 3GEDA 4JK3A 2PK3A 3FR7A 1P3DA 3P5SA 3ZWBA 2VT3A 4C7JA 4R1UA 1KVRA 4WGGA 3BMNB 4XR9A 4R69A 4EDFA 5TJ9A 4DRYA 3WIEA 1CETA 5TT1A 4BNYA 4ALMA 1SNYA
chains in the Genus database with same CATH superfamily
1DAKA 1QIJA 1NJ1A 1S3GA 2CF5A 4Y9TA 2VEDA 4Y2XA 1YHNA 5FA8A 3TIXB 3RAEC 2ZE8A 4N0DA 3PQ6A 4NBUA 3VPXA 1V9LA 4M22A 4MVJD 3KKPA 4G65A 2ZU6A 2LDXA 3ZVKA 1VPDA 4FEGA 4LJ4A 3ZWWA 3ONWA 4BAGA 1JMYA 1UXHA 3EULA 4ZO4A 2HCFA 1Z3CA 4V02A 1GGEA 4G25A 5YASA 4JXKA 4MCIA 1B14A 2SICE 5FBVB 5CG1A 3BD9A 5FR1A 4TWAA 2XRFA 1GRVA 2Y8EA 3EGXA 4KLNA 1UM9B 3HB0A 4DQKA 3HGQA 1U28C 1XDBA 1KPHA 3HMQA 3PNBA 2ZYDA 1MV5A 4QNRA 1ADGA 4K9PA 3RC2A 4K2AA 3S27A 1NZJA 2A5GA 3L8ZA 3BRWD 1L4LA 1U3DA 3H1GA 3L5OA 3NHZA 1UPXA 1Y9EA 2OVBA 5C2JB 4EABA 2X77A 4ZTZB 4D57A 2OAEA 2DSNA 5M2QA 3UYKA 1TIKA 1ZD3A 3PJDA 3VMFA 3ZW7A 3IPRA 4A4DA 2Y67A 2XUQA 3LPNA 4ZOLF 4IZ6A 4LOHA 4A2CA 1T2UA 2HMVA 1W46A 2ODQA 1M2EA 4D3XA 1W34A 4PX5A 3LXXA 1ILWA 4LDZA 3Q9LA 1R3DA 2HDWA 4BE4A 1QWOA 1KVQA 1XKLA 2QLBA 4XDZA 1E4YA 3P2EA 2VPQA 1P5JA 1CHDA 3P2YA 2XLCA 5BVHB 1EDDA 1XV5A 2RK4A 3DNFA 5IXJA 3K6JA 4HLCA 5EVCA 1U9JA 1FP2A 13PKA 1EVEA 1IH8A 1RHQA 2QAGA 4YMVA 3EMKA 4E1AA 3PIDA 1YZFA 1ZI8A 3DF7A 4YAKA 2CHVA 3CW8X 1GPAA 5KYWB 3WQRA 1P5HA 4YUZA 2JANA 4GYYA 3KD2A 3G13A 3W8FA 3Q8KA 2HDNB 2GLTA 1R8SA 1FMFA 3PQ2A 1RE1A 3CNHA 4OQEA 3ANTA 4NMMA 2CMKA 3DO8A 4LDRA 3MSCA 4TL9A 3REGA 1JHQA 1Z2DA 3G0DA 3MGAA 3RFTA 3CONA 1TD9A 2WWRA 3GFBA 3LA6A 2IEAA 4YRJA 4OUDB 2BFMA 5CK4A 3A1UA 2VPYA 3ZCQA 3ABQB 2X0DA 2O05A 5BWBA 2OZEA 1XBTA 4X5OA 2QQGA 4LJ6A 2PT6A 5TX7A 3UM9A 1U1IA 2D00A 3AW8A 4NG4A 3EZ7A 1DQYA 4KXLA 1Z0ZA 1OLUB 3WIUA 2GF0A 3MXTA 3FHTA 2XT6A 1WCYA 3MCVA 1LPMA 1XC7A 4NMXB 2NZYA 1C9MA 4UZSA 4QLBA 2DHQA 1OW3B 4NI5A 2J67A 3OY7A 2C3OA 3TKYA 3GLUA 5EIEA 4UHKA 3GWZA 4EUSA 2R1ZA 2F9LA 3AFOA 4ILKA 4ZMBA 3I6BA 1IWOA 2JS7A 2VHXA 2WMDA 3F7MA 2AN1A 4YCAA 3ESBA 4MR8B 3CS3A 1YHYA 4QVGA 3TTTA 1Q2UA 1Y4SA 2ES4A 2O2ZA 2OECA 2YHIB 1FS4A 5AICA 5CA0F 1F1JA 4OXYA 3KZKA 3L1IA 1X3LA 1E79D 4R6WA 2HADA 2NACA 5DN9A 3W9UA 3PTZA 3BXFA 4OMFG 4AJIA 3IT0A 3DG9A 3F8TA 5E7QA 3F5SA 2TMKA 3D3JA 2CCJA 3Q98A 2G9ZA 5DGXA 1YS4A 1I2ZA 1F2DA 3A9VA 1WQ1R 2Q2WA 1Z0JA 4MYCA 2FR8C 4RF4A 1HFEL 3VUFA 3EEFA 1RLUA 1V1JA 3OT1A 4I2NA 3QZUA 3RVMA 1NN3A 4GC5A 1M6VA 4IIGA 1TIBA 1SHTX 4MUMA 1PZFA 2BM1A 3ER6A 4PRKA 3RFVA 3UH1A 1ZAYA 4F3YA 2XCRB 5IZ4A 4HWGA 1XZFA 5E6SB 2W42A 4DQVA 1VG9B 3JQQA 2CXRA 1E1QD 1P4SA 3IALA 4ZOLA 3V1KA 2ZRGA 3EXEB 3I5MA 1JG4A 2ECFA 5E6UB 5LQJA 1VGRA 4KGDA 5BWMA 1GM5A 4UVDA 4IJMA 5G1OA 3AI3A 4DBZA 2FN3A 3EEYA 5JS7A 1HNZB 2VWPA 1NJ6A 1DCTA 3PTLA 1T5IA 4BL5A 1RXEA 1LPOA 1JA1A 2ZITA 1C41A 2Y0EA 1W0CA 3OX2A 4OQFA 3CNBA 3VUEA 1H0KA 1DQSA 3RPEA 3UUWA 2B1IA 3GPLA 1P4GA 3CX3A 2O7VA 1JG7A 2YQ4A 4DSTA 4DR6B 3FPKA 1UWLA 3B3FA 2EATA 2O7NA 2H85A 1CS0A 1EJ6A 4MSUA 5E7IA 4ZYXA 1YNOA 1TF5A 3F3YA 3S2FA 1P0FA 1B3RA 2B8TA 3WB1A 4DDVA 1G8HA 2WJYA 1R8JA 2V4UA 4Y9SA 4HH3C 2BJWA 4BTVA 4QT0A 5AVSA 4KFUA 1KFEB 4DA4A 1UMKA 1CUUA 3PV0A 1XP8A 4TQAA 4OHCA 5EZYB 3A3NA 3SNHA 3UATA 3WLSA 3WSTA 4DCUA 3MAGA 2C1EA 5FAKA 3NHPA 4NAVA 3CVJA 4E6PA 4MRNA 4F4HA 3K7EA 2EZ4A 3DE1X 5IF9A 3GLQA 4EI2A 1U7OA 3GF4A 3FGNA 3O92A 5TQVA 5IAOA 2PH7A 1NVAA 2JHCA 3KJIA 3K0EA 1BXZA 2FAXA 3WRYC 2O07A 1Z0FA 4IHQA 4KWEA 3GWGA 2BGNA 5KWJA 3ILHA 2AI3A 4W6QA 3PI6A 3FTCA 5JYBA 4AXXA 3NH6A 1ISRA 1ODTC 1ID8A 2IEGA 4K0KB 1WHTB 3CRW1 4KZPA 5JSYA 1OU4A 2D1FA 3MD0A 1F0KA 1JBKA 3THWA 3BBLA 4MB6A 3AHHA 4B7AA 3OFKA 1G6Q1 1JXAA 1P1CA 3NHWA 1UT6A 4CYMA 4H3VA 3KOUA 2BFFA 5JS1A 4OK6A 2BIFA 2PLRA 1Z4QA 3WBJA 3QNMA 3AERA 4DMHA 2O8FB 2X1VA 1UJBA 4ZAZA 1XN1A 4LGVA 4I14A 3L8YA 4F5ZA 3MAAC 5AUNB 4I1IA 5H83A 1UC4B 2LPMA 4H3HB 4YRNA 4NCHA 3RRMA 1NQTA 2ST1A 5CA0A 2I7CA 3HTXA 5FQOA 1CUDA 3CPSA 2OEPA 2J9GA 3PQ3A 3CN9A 3UHAA 1WD7A 5EJ7A 2G08A 3JALB 3M81A 2PJUA 3ZYCA 4ACAA 2FPPA 5BRNA 2NXEA 2XGMA 5LKRA 3FZGA 4GG1A 1K7XB 4PZYA 4KO2S 3IDFA 5EIBD 3ZDBA 2XE6A 4AF6A 1YFKA 3KC2A 1Q5PA 3ZWCA 2PIDA 1EIZA 1MO2A 1Z6XA 5KVVA 4QHSA 4BNTA 5FPHA 5ALTA 1ISPA 2ZBQA 3LCCA 4UDYX 3L6UA 4BX2A 2XCLA 3C3AA 5I7VA 2G7MC 4MCHA 4H27A 1FJ2A 1FPMA 4FD3A 1UBGA 2QRZA 3PWZA 1VA5A 3M1LA 1L4BA 2CHFA 3ZX5A 2WJGA 5JADA 1BMDA 1NBHA 1OVGA 1SQ0A 3B9QA 3CA8A 3SF0A 3N76A 3RVSA 2DYKA 1PZMA 4FGUA 4BIMA 3QKIA 4XUEA 5JNLA 5GM2A 3WG9A 4CT0A 1G3UA 4V39A 2ONKA 1XMJA 3NH9A 4FHEA 2HL6A 1YQQA 3Q7EA 3ICPA 3WQHA 2WT8A 2X76A 1R6TA 3MJCA 3TLGB 5IUKC 3JWHA 4XFKA 1S2NA 2HF8A 4XA8A 4ZTUB 3FAKA 4XYEA 3LDGA 3JZFA 5I45A 3ZU3A 5J4VA 3S2UA 2C31A 1JKJB 1NDQA 2H48A 5AHXA 4YDRA 3OESA 1AKEA 4GYWA 4R16A 3JQBA 4WT7A 4MUXA 3CINA 4V0ME 4EHAA 3ZCVA 2YN0A 4X8MA 5A6SA 3P97A 1FTGA 3QI7A 3CVXA 3F6YA 3KSRA 4DLUA 3E6AA 1T1EA 2CVZA 4B79A 2I2XB 5FA5A 3M4YA 2XDYA 1HTTA 1TRHA 3W6PA 3LY8A 1KSGA 3U9TA 1VSUA 2A0XA 3RYIA 3EPHA 4OGLA 4U6NA 3AEKA 3BWBA 4WXYB 4WXMA 3HY6A 1EFVA 3HCOA 3QWAA 4KLCA 1EDOA 4OHBA 4XLTA 3WOVA 3G0GA 3OE4A 2HCTA 4O4HF 1IG3A 5EIHA 3ONNA 4ENPA 4BQNA 4EGFA 1WNTA 1L5HB 3F5QA 4LZNA 1HGXA 5CD1A 2C98A 4ZDKA 3N2LA 4E70A 3W5UA 5AW3A 1G20E 4G5XA 1TADA 3GOHA 1PL7A 2XXAB 1RWQA 3KKMA 1OXMA 3ORFA 1UUFA 2FDRA 3C6XA 4QYIB 3WLNA 1VG0B 4Z4CA 1BEZA 4HNRA 3KE9A 5FO0A 3I9JA 1U0TA 2VK2A 1EFUA 3E84A 4FDUA 3HO1A 3PYMA 4IWNA 2J5BA 5CYFA 1ZK3A 2PL1A 2QT0A 2FRDC 2HD4A 4YO8A 4O33A 3P5BA 1NU6A 2KPOA 4CM8A 4QECA 4KUGA 3KT8A 4FYKA 2NO5A 3ZHRA 3OIYA 8LDHA 2DHRA 4EKEA 2ZOSA 1MHTA 1S3FA 2G1JA 1Z25A 3EW9A 4WBNA 4L74A 5FLYA 3VKHA 4TZTA 4JVMA 2XIQA 1E98A 1IZ7A 4KKXB 1CUSA 2B0CA 1OX4B 2BCEA 2QMEA 4J7XA 4Q3EA 1NLZA 1NUHA 2Y6VA 4XPIA 3VR3D 4EJ6A 4C01A 5HOQA 3GXOA 4P38A 5LZ8A 5DE3A 4B6PA 1C4KA 2F3RA 5AQ1A 3DEAA 1CIPA 1VE6A 1BXKA 3LOQA 4H7HA 1X8JA 4OHWA 3AOGA 4O5AA 2GNAA 2PNFA 5G4KB 2HRRA 1YVPA 3BD6A 1SQ6A 3QE2A 4JT2A 4GM4A 3X43A 4ZICA 4DL9A 4G0OA 5HZKA 3N7UA 1IY0A 1G18A 4OMUA 3UKOA 1AN0A 3WGYA 1E0AA 4XVUA 4QQFA 2O0LA 4OH7A 4NJEA 3TK1A 2QR3A 3T6KA 2R8EA 3O4FA 3F6RA 4LF9B 2F8TA 4XD7D 4YCCA 4OY3A 2BMJA 3THXB 2R44A 1XZQA 3QENA 4EZEA 3TG2A 2QQ5A 1LRKA 4I66A 1FMJA 2J7KA 3KOZA 2FUKA 4N01A 4IDOA 1BXGA 5IYZF 2E3JA 1GTMA 1XG5A 4X84A 1ZW6A 3H8JA 1XRJA 3LXMA 3IFSA 4XUCA 2WTUA 3DOHA 2Q5IA 4L8WB 2IOQA 4YASA 1GRQA 4QTUB 1H8HD 2AOUB 5EOVA 5KU1A 1O4WA 2NXCA 4J94A 3GT0A 3IBCA 2RONA 5EESA 4LVCA 4KODA 5A03A 4V1CA 5ITVA 1KTVA 3IIEA 4AY5A 4PAMA 4X6YA 3M83A 5K8TA 4PY2A 1Z63A 2PV0A 4J1NA 1SOMA 3HH8A 4NBKA 1WSWA 3JQDA 4L9AA 1E6CA 5IAJA 2R7NA 5C1DA 1WXHA 2E89A 1WBJB 1HFWA 1O5OA 2D54A 2FPUA 2PGAA 4AJOA 4YR7A 1AKTA 1EMDA 1VRWA 1ZN2A 1W25A 2AGVA 2CL0X 2IU4A 2X3YA 3AJ9A 3LZCA 4J91A 1E7YA 1O08A 5FOVA 4YAFA 1K8RA 1F2VA 4YJGA 3H19A 2DFNA 1CB7A 1RBMA 3QVOA 3G9UA 4DE5A 1DMSA 1GT91 2YWEA 3D1VA 4HDQB 3DZKA 3N2KB 3BRCA 3QLJA 4HQRA 3ZU2A 3AG5A 1ZI6A 2IHZA 3M2TA 2X0RA 2D7DA 1Y4DE 1WUHS 1YVUA 1AZSC 1OLXB 3EFBA 1DTEA 5K3DA 4NJMA 2NVOA 3EYWA 4L57A 4R2JA 2RJ3A 4N6NA 3OMXA 2OVFA 1YVEI 4JSYA 1EFTA 3LOPA 1WMFA 5DU2A 5J63A 5BSUA 4MCJA 1GG2A 3DXFA 4RQAA 2EFYA 1YRYE 1ZCFA 4XPIB 1FRQA 3PLRA 2SKCA 1QS0B 1Y6ZA 3ZHSA 4H7FA 1NP6A 4KQKA 4CMBA 4KDCA 5G53C 2JGKA 1U28A 4WBSA 3JD2A 3TSZA 2ZB2A 4UC0A 4QXRA 1TGYA 4CHGA 5CFQA 3U4DA 3X2SA 1KY5A 3SX0A 3U61B 1DWOA 1CJTC 5AKJA 4LY0A 4UDNA 4XQ9A 3V8VA 3A6EA 5KWIA 3UJ9A 4EQ6B 2MYPA 3KX2A 3WL7A 1QTIA 2ACKA 4I4TB 3O4HA 3T1HB 5H3CA 5CDTA 2FWNA 2OCAA 4CLRA 3R6WA 5DYYA 3AFNA 3FOEC 5FV7A 2ZTSA 3FUWA 1FY2A 4C0HA 2ZAIA 3AR6A 2AYXA 2YWJA 1U6IA 1EWKA 4XTRA 3C3MA 1AU9A 3G7SA 4FGZA 1YUMA 3B1KA 4IOKA 2ARKA 4X7RA 2C77A 2M6RA 2OCBA 3KVYA 4KRGA 1J0BA 3AR3A 3SY8A 4PZDA 1B0ZA 3FDFA 1UDBA 3MWLA 3DR3A 3H4VA 3C5HA 3LSYA 1NMYA 1B41A 1U7TA 4RGBA 4EG4A 1B0AA 2Q07A 4AKSA 2W7TA 5B1YA 5IYZA 5H9VA 2Q1SA 2X9LA 3L01A 1Y6FA 1BW9B 2IX3A 1KY3A 2NTEA 3QBEA 3C3WA 4YQFA 1KVTA 3W3AH 1Q7BA 4B6FA 2J0UA 4D0NA 6CHYA 3WLRA 2NTVA 1V3TA 4QPZA 2B8NA 5CFOA 4TTJA 3TJRA 4LHWA 3ECAA 2OBNA 3IKJA 3C70A 3JD3A 4HYQA 2YWRA 2ZIVB 1DDOA 3DDUA 4I4IA 4ZWNA 3WGZA 4N82A 4S2EA 3ZV5A 1QPZA 2C7VA 2OM2A 3H5RA 1T1SA 1YGPA 2C8JA 4QWWA 1LGYA 4TL7A 3DYVA 1B42A 3CLUD 1RI1A 2JJ1A 2WIGA 1ETHA 3Q15C 3D3NA 3L2OB 1N4AA 3RSLA 5BQXA 1EWQA 2ZRCA 2P2NA 1H05A 3OIDA 3PD0A 4INJA 1TI7A 4DAEA 2JEYA 4FYXA 1E69A 3I2JA 3HCPA 1KZ9A 4AMZA 5CIQA 2BFEB 4PNHA 2W8BA 4HAWA 3LQRA 3DAFA 2VVTA 3MT7A 4FOLA 4W4TA 3WGMA 2FY8A 3CRNA 3S1LA 3TLYA 2R6HA 1EG7A 1RBQA 1OHHA 1W6UA 5IX8A 2BH9A 4TLBA 1OUMA 1DJQA 1UM9A 1WW3A 4OPMA 4TLLB 2WWGA 2C5SA 1FBNA 4F9EA 4ID3A 2AEMA 3R3VA 3WGHA 5CB4A 3VVBA 3ZU4A 4EG3A 3FLMA 1YR6A 1XZDA 3PRKE 2Q6TA 3MBKA 3ANLA 2XTAA 2RCYA 3SIXA 3MJSA 3D9QX 4BGEA 3NTRA 2Q8PA 2ONCA 4V0KA 4RXUA 2Q5QA 2PSJA 1WMAA 4JVNA 3KJFA 1T6ZA 3UNXA 2GWHA 3WMEA 1C3OB 2FR8A 1ZK2A 2IELA 2JJ2A 2MYUA 2GK3A 2WLSA 3C3XA 4PLFA 2Q21A 1J0XO 2I55A 4RMJA 1B0PA 4PBSA 5ALIA 2VYVA 1LU9A 2VDKB 4BYGA 5F3WB 1GRCA 3KT0A 5IC5A 2A6PA 3LLVA 3MCWA 3REOA 3D81A 3DFUA 4EP1A 1J00A 1EFKA 2QX8A 2HSDA 1DKPA 2M6SA 1VDZA 2R25B 2ZPUA 3LT4A 4I8DA 4OXXA 1ZCBA 2V3CC 5EEGA 4OBBA 4PYKA 1O89A 3AT1A 4S1OA 1BEEA 1K3UB 3NTVA 3OF3A 4JASB 1VSVA 4RD6A 1QFZA 1GARA 2FCAA 3P9IA 3QGMA 3U3KA 5EP2A 5KYWA 2Y27A 4QUIA 4OA5A 1X2BA 4R3NA 2B5OA 1KI4A 2YVAA 3OAAA 1XL0A 2XNSA 3B6ZA 3TVDA 4DSAA 2XSZD 4F5DA 2B92A 5HJ5A 4R8MA 1H66A 5KC9A 4ALJA 3T7DA 1PSWA 5EZYF 3PPYA 1PL0A 4OUDA 4QU9A 3K31A 2YWGA 1RIIA 4O1IA 4D9EA 1BD3A 4D0RA 3D02A 1KR5A 2P2SA 1Z35A 2RBKA 3CBQA 4RK4A 1EK1A 3GRAA 4N0PA 3O94A 5HIKA 1XNHA 5DMHA 1OLUA 3B12A 3A9WA 1ZY2A 2B61A 5B1HA 1HURA 2PGDA 2YDXA 3V7WA 3ZJVA 421PA 3IXLA 2NNWB 2Y9ZA 1FP6A 2BP7B 2L17A 1OF1A 2ZTVA 1D1QA 4J76A 3LHSA 1G5HA 1QGDA 2H5EA 4UNPA 1YRAA 5AKKA 1HE8B 2Q45A 4YGYA 3VBCA 5FBWB 1R88A 1FSFA 4S24A 3AI2A 4MYTA 2X8BA 1BC5A 3P2JA 5GQSA 5ILQA 4C4PA 4YYZA 2HN9A 2QW0X 3EXAA 4BV3A 2VYFA 4OLFA 4MR8A 2YXDA 4TZKA 1QB8A 2XQJA 3FJ1A 3NDJA 2H1IA 3B1XA 3QUTA 3JQ6A 1ZGCA 4TSFD 5HW0A 3MN1A 2PUAA 1WAMA 2YHIA 1LDYA 3DULA 1XZIA 1D2CA 4MW2A 4C0AC 1CF4A 3MLAA 2K2WA 1H42A 3STXA 3UTCA 1VSQA 3GBVA 1GYPA 2WD8A 5KTKA 1NNUA 1A96A 3G5AA 1JLKA 1RC1A 5FRDA 1YONA 3TIIA 3IQEA 3N0TA 1BH6A 1EWTA 1N5JA 3I2IA 1BX1A 3GT7A 4RJTA 1E7QA 1Z8DA 2UUOA 1NFFA 3ECSA 3QPBA 1IAVA 1ZMOA 4B46A 5K8VA 4PXAA 2YXLA 1Z6TA 3BMQB 3LNCA 1IRXA 3PWTA 3NHUA 1SXPA 1FBTA 5E6SA 1E1KA 1ODLA 2HJHA 3DZ8A 3PVSA 4NQRA 3S8EA 2QPLA 2COEA 3EXEA 5DTQA 1JHPA 3BL6A 2PKEA 5KDLA 4L7QA 4HLQB 5E6UA 5LBUA 4LZOA 5PNTA 4KB5A 5B6JA 2Q0QA 5BNTA 1D0IA 3U81A 4O63O 4XDGA 3KZNA 4YVFA 4I1VA 3IHWA 5LIPA 4CPDA 2Q4RA 4FX5A 2FPGB 4V2UA 4OO3A 3OZCA 5HXAA 5THKA 3NCTA 4M99A 5JD4A 2B69A 2E1PA 3DE6X 2EEZA 4DBLE 1V9CA 4KR3A 3RKRA 3MOGA 4KBGA 3DZJA 4BO3A 4H1VA 4MOWA 3PZBA 1SCUB 1MOQA 4HNHA 2DFVA 4BZPA 1D04A 4RF3A 4N0QA 4A0RA 4EPWA 4A91A 1UEIA 3VYRB 1E1CB 1PI3A 2PLWA 3KWJA 1A0OA 4C4TA 4RVFA 1OAKA 1JLMA 4LHVA 4WX2B 3I1JA 3HWSA 2DWCA 1KH3A 2HWUA 2WTEA 3QVWA 3BD8A 1PJTA 1XELA 3W9SA 4LF7B 2JPDA 2YXBA 3LRPA 2CJPA 1TM3E 2R7LA 2XAUA 5BT9A 821PA 3IJPA 3P0RA 2R6R1 4G01B 3K1AB 3FMPB 2FV8A 4WV3A 5I4BA 1KQFA 1U8ZA 1TYDE 4FGWA 1XGKA 3BFKA 1E2HA 4N3BA 1WHTA 1S6YA 3HBLA 4S35A 3RD5A 3MQFA 4EFNA 3ISVA 3OPXA 4HDOB 3GDFA 3TPFA 2IW3A 1F7UA 3R5TA 4ZVNA 1PYOA 2DLDA 4TLEA 5LQKA 2XUJA 2B6HA 3KXKA 1P81A 4HAUA 2O8FA 3GH1A 4OXNA 1ZRSA 2O50A 4J0FA 3IKLA 4URVR 1NW5A 2PBFA 1A4XA 2VKQA 4EB3A 2R6ZA 1BN6A 4HAOA 2GERA 2HLDD 4JZYA 3LV8A 4J49A 4RPKA 1O3YA 4YAEA 1TEXA 1GAWA 3ND5A 2G17A 3CZ5A 2A9OA 3WGNA 3WQSB 2QUKA 4FFSA 1M5RA 4GWKA 2B3DA 3ZGXA 2CK3D 3JALA 3BSYA 1HYBA 1RJDA 4A0GA 4R1OA 1MEOA 1Y9AA 3ICOA 4OB6A 4OQXA 3SC4A 4OIMA 4G5HA 2V7EA 1SKUA 3IEMA 1COWD 4LA4A 1K75A 2R3SA 2H11A 4NCNA 2MSCB 1P0MA 3AUTA 4FB4A 1E1RD 4HVTA 2F8SA 2JARA 1BD4A 2CVPA 1RJEA 5CLHA 1NBEA 1Z18A 2QT1A 2XMBA 4K87A 3KUXA 1F0NA 3WGJA 2M98A 2FRDA 3U4HA 2J7PD 2YFHA 1RWXA 2ZSKA 4QPNA 3RVOA 1GAEO 3V48A 4WXRA 5H80A 4JKIA 3W3ZB 4XB2A 2NG1A 3OZEA 1A9QA 3AEYA 3T4PA 4QOFA 3EVCA 1MFPA 1L6IA 2NSHA 2ZEJA 2OHOA 1Z75A 1KIFA 1WF3A 2F2TA 4JCOA 4EUNA 4MQBA 1R6UA 4RK0A 4C76A 1BGVA 3PDHA 4LQCA 3RIYA 2F1JA 4EUEA 1WCV1 2PX8A 2JHGA 3NDRA 2B5VA 2IQ5A 3I1YA 2AS0A 3TLGA 2C9DA 3H2KA 3ZE1B 1TYEB 2Q6VA 2Q0HA 5DHQA 1TM2A 3OLXA 1HOTA 3C8DA 4YAOA 4EJFA 4P33A 2ZIXB 1M9NA 2D5AA 5IASA 1JKJA 2GCPA 2PT9A 3KAKA 4ZO6A 5J9FA 4BAZA 1TM5E 4Q37A 4Y9DA 3U48A 1ZRMA 1I7NA 3IEVA 1QC5B 4UNSA 4C4SA 3S28A 1QE0A 2BM0A 4JR1A 4ZT3A 1MO6A 1UZMA 1TJPB 3RV4A 3K0HA 4MNTA 3TN7A 4EOGA 5A4JA 5JMWA 2PMFA 1E1DA 1ODJA 1RYYA 3U0VA 4NZYA 3GNTA 2P9YA 4ZI2A 4GBJA 1HE3A 4FGKA 3OC6A 4OQPA 4PQEA 4PQFA 4H4CA 4UOQA 1RWOA 3PHHA 2V45A 1QP7A 1NZFA 1Z6GA 2G0TA 2RK6A 4QLAA 2WFMA 3BIXA 3I92A 1P1BA 1H6DA 5CM2Z 5CGQB 1T3SA 1DKOA 2WWWA 1KMHB 3JZAA 3OJFA 4LYEA 4GR5A 3WGLA 1KU0A 5DP1A 1J23A 1XAHA 1XQXA 3CSUA 1L5HA 1GZ6A 5JD5A 4WLFA 1X7YB 3IO3A 4ZZ2A 4CIAA 3ROTA 2JIDA 3MQ4A 1EK2A 2WFAA 3DXXA 4JC8A 2XXAA 2CD7A 1H0HA 4QYIA 3WJ7A 3UVEA 5LR6A 5IDVA 1AA6A 4ND2A 1ZN7A 5K05A 4CG3A 3RRFA 4BMZA 4F86A 3DE5X 4B44A 3CKYA 9GPBA 2ZAYA 5IH7A 5KJ1A 1AJEA 2IOFK 2VPTA 2XCIA 4TT3D 1E20A 2PUEA 2C9OA 2X4GA 3I3OA 1H1DA 4ZQFA 4G8BA 3WYDA 1OWLA 5GJBA 1XT6A 4X65B 4OD0A 2IEDA 3LO8A 2D1YA 3QFSA 4X93A 5EJGA 2PH1A 3L8GA 4DR7B 3KG2A 1N2IA 1QHEA 5HZHA 2XF2A 4J0IA 3G2LA 1EK0A 1IXZA 5D6NA 3H42B 1WW2A 2QRPA 1SRRA 2OXFA 5U4XA 2Q3MA 1X9IA 3JX9A 2CV0A 3M5CA 3HJAA 2WW8A 4NBTA 5TQ0B 5ADHA 4J4TA 1C9KA 2GA9A 1CUVA 1OX4A 4PVCA 1WB6A 4KMRA 3V9PA 3R5XA 4NBRA 4DXHA 2QSYA 4H3KB 2MYNA 4BQEA 4H77A 2IZ0A 2QORA 1IYZA 3G8DA 2J0QA 4OJKA 1EVKA 2X1MA 2PEZA 1F0YA 2WTNA 2Q6LA 1FFGA 3JYPA 4TLDA 4U6SA 4ZAYA 4P7GA 4BKMA 3G6KA 5FFMA 2P67A 5G4KA 2IUUA 2DR0A 4ZVUA 3U0BA 1QX4A 5KS2A 4F45A 1ADBA 3UPUA 4I4TF 3IQDB 2IP1A 3IT3A 3HXQA 2XWSA 4YRZA 1J33A 3TRDA 1F8UA 1Y63A 2V6MA 4MITA 4BNXA 3H2JA 4QFBA 4TLMB 1E2QA 3MNFA 4YMWA 4C4OA 1CF2O 2HIGA 3QEAZ 4RANA 3HFGA 1EE1A 2Z0MA 1R18A 4MKGA 3THXA 4MYHA 3EMBA 4RACA 1W9HA 2BGLA 3BULA 3B5EA 1XYYA 3C1AA 5ILOA 1IWPB 1U80A 2BFBB 3KL2A 4ZZ0A 1KP2A 3MW8A 4DB2A 2XUFA 3BQNB 4MVYA 1U8UA 3I3SR 1TZMA 5E2BA 1E3DA 1CDOA 2AOUA 4DRZA 3FA2A 4M8LA 4RSMA 4KO4S 3F9IA 2RHTA 3LGXA 2JVIA 2YJ6A 2NOAA 4ZVPA 1L5GB 3TZKA 4CL3A 3H2GA 4K9KA 3KZVA 2EG5A 3AQIA 4GR4A 1T3LA 5G0WA 5JY6A 2OYRA 3ED1A 3F1KA 4ARZB 1A1SA 3KB2A 4RPHA 4NS1A 1MA0A 2BEVB 5L7YA 1NBME 3F7OA 3G1WA 3WR5A 4CGYA 4K6OA 1NI4B 1F0PA 1W9MA 4MLPA 4DHWA 2EW1A 5LZ2A 1JAXA 3Q6MA 3VR6D 5JYCA 4BO6A 1SA0B 2G5PA 4P2GA 4J0EA 2FU5C 1P7CA 3AUXA 1PFGA 1PR6A 1DUIA 1UJ5A 1A88A 1Z62A 2HTFA 2ZJFA 4JKOA 5T4HA 2IWHA 1VJDA 5A4MS 1IOZA 4TTPA 4ON9A 3K9FC 1H2BA 2B9EA 3N2KA 1ZUIA 4FEAA 3I9OA 2FHSA 4W8OA 4B33A 2FPMA 4F93B 1ZOPA 1C3XA 1YBHA 4Q1VA 2PQ0A 2CVQA 1A4RA 1TLFA 4PTYA 2KMLA 5LQDA 2LGJA 4WAUA 3RLIA 4RTMA 3SBDA 3KKOA 5AKXA 2R84A 3UOWA 3DV2A 5CFLA 3TSCA 2NZXA 3KDSE 3KIPA 1ISFA 1PV4A 3L1HA 3NOVA 2P35A 4YEDA 1PEDA 2HF2A 3O3CA 5HDBB 4E5DA 3LX4A 1U1DA 1QS0A 4M8KA 3MRVA 4GW3A 1E3LA 2QMOA 4KEAA 5DBEX 5JNWA 3EVZA 3IR5A 3OOHA 3ZQUA 4CM3A 1ENYA 4Z5XA 4KQ1A 1YBFA 3TNJA 2P5TB 2H2WA 2Z8YM 2I1LA 1ZOOA 2O06A 1C1DB 4FQ8A 1ARZA 4LXGA 5D3QA 3VX3A 2H3EA 2R97A 1N6PA 1N2HA 3T12A 4DLZA 3VR0A 2I2FA 2G4LA 4ASUD 5JAUA 4EQ6A 1AUOA 3DZGA 4I4TA 4YTEA 4F7WA 5ICCA 4PN3A 2VZ9A 4L72A 4GEGA 1UBKS 3IRVA 4BO1A 1GUDA 1TCUA 4MKFA 2I29A 3U37A 1GPNA 1MAVA 2V98A 3D0KA 3X1ZA 3LVBA 5C1OA 1KK1A 3QW4B 3WFZA 1T4CB 2YV5A 1NY6A 3ZWVA 5HKKA 1H3FA 1MD9A 2Q0XA 2XEDA 3B70A 3VYWA 4D3YA 1J2EA 1ZZEA 2ZM6B 1PJLA 2HYDA 3WQQA 4FE3A 1Q3KA 5AVRA 3LRXA 4FCVA 4M1ZA 4FEYA 4V0LA 4KE6A 1BW9A 2Q7DA 1UMCB 3NHJA 1CFZA 2RH5A 4KDRA 4QHYA 1PZXA 3V1UA 3WKDA 1W581 1QQBA 2HQOA 4JX9A 4CQLB 3V3TA 5G1PA 3H1FA 4L9WA 5C8XA 3EZNA 2OCXA 3VC3A 1I01A 2HK7A 3RYFB 1NLYA 4CXMA 3PF9A 2PD6A 3JW8A 2I22A 1YVDA 3TBHA 4MP8A 4XE5A 1W94A 4IL5A 4DV6B 4QULA 1FYWA 5GZ6A 3GJ5A 5JNUA 1J0AA 4A8HA 2L2QA 4RGYA 1KHTA 4MW4A 1RVDA 4YJHB 3FD8A 2WV7A 4K9QA 3P32A 1IB6A 4PO8A 4KN8A 2MSNA 4CKZA 4L28A 4BUCA 2BFEA 4IFBA 1EX9A 5IVDA 1JPJA 4XARA 2C2OA 2QSUA 2FOXA 2QV7A 2X6TA 2G8LA 1EK5A 4LMRA 4Q16A 3QY0A 4F4JA 1LXCA 1A95A 4YIKA 2H8KA 4M1WA 4RL6A 1G9SA 2E48A 4Y2JA 4Z4GA 1EDEA 1E66A 2AEJA 3NIWA 3O8LA 3KB8A 1VLQA 1BOOA 3ML1A 3LK6A 3H2SA 4EKIA 1VL5A 2W6NA 1ZK1A 1YU6A 4H6XA 1B23P 2XF8A 5ESWA 2D2EA 1YB7A 3WKCA 3HLKA 5LLSA 2FE1A 2ID9A 1QR2A 3DDWA 3PJFA 4G2TA 4C87A 3GX1A 4RH0A 4B4WA 2Q3CA 1VXRA 2JB9A 1WZ2A 4D9IA 2HXGA 4Y6PA 1N7IA 4MPPA 4EL0A 1C3OA 1S2LA 5KSOA 2VLBA 8AT1A 4AUKA 1ZK4A 4BO5A 3LCMA 4LCEA 3SKXA 3KQHA 3D0QA 1OV6A 5KAPA 5FEUA 3FWPA 1GPKA 3U6KA 1DG9A 4I3GA 5FTLA 2CLEB 1DWQA 1HQDA 4JJ8A 1N92A 3WC4A 1Y3IA 4BVGA 4EGJA 3RFXA 2F62A 5LQCA 5FHQA 2QN3A 3AHCA 1Z08A 1NW7A 1SUDA 2O8VA 4XASA 2O19A 1LB1B 4G67A 4IPTA 4WOPA 3LT0A 5D5QA 5HFNA 3V6MA 1TIPA 3VZRA 5THXA 4C4XA 4OU4A 1BGWA 3LBFA 3ZLUA 1SG0A 3H13A 2OOSA 1CEXA 1GCAA 4PSVA 4ENWA 4FP9A 3KV1A 2XT9A 3RSHA 5KYNA 3TQHA 2CWDA 2FEOA 4EWLA 3A9CA 3BGWA 4O1MA 3SS8A 1TX4B 4CCSA 2FDCA 4MAFA 1FYXA 3P8ZA 4RJIA 2ZDHA 2GZAA 3OJWA 3GMSA 4UNIA 4CE6A 4OFWA 4OI1A 3CVOA 3EAGA 2IH2A 1IHDA 5CH8A 2VHWA 4H4DA 2O3UA 3GH3A 2ATVA 3GP5A 3VSAA 4C3VA 1NN1A 2EARA 1QTQA 4A36A 2HLHA 1HRKA 1IUKA 4DLWA 4NQZA 5KYYB 5E9AA 1CE8B 2BP7A 1YKGA 3KUKA 1ZICA 1KARA 3IGFA 4AMUA 1G3IA 4MQFB 3CO5A 3ITKA 1L7RA 4HOYA 2WFLB 1LNZA 3LTEA 4QUEA 4Z0NA 4CM9A 1J2JA 3WL5A 2FZ5A 5M34A 3ZJ4A 5C7IO 2F6RA 2ZVPX 3OY2A 2IYFA 2WJHA 1O58A 1PVOA 3CIFA 3LRTA 2X23A 3F90A 1P7YA 3G82C 3OZIA 3Q3VA 4XOUA 1XZ8A 2BLLA 2GNOA 3EVEA 5DCLA 5LA6B 1ICIA 1GFWA 1R6VA 2Y1WA 1XPOA 3IJEB 1RQLA 1Z38A 2IYSA 3AKYA 1TQ8A 3ORRA 3AL3A 4HNAB 5JROA 1FW6A 5T6MA 3I05A 2FR1A 4ZCTA 5F2EA 1Y3DE 5EUMA 1S2MA 1VRCA 3CRVA 4D98A 3PGVA 4NEGA 4DYHA 1EGMB 3BMQA 4HSGA 4R8LA 3QKRB 3GO4A 4OHPA 4KH1A 4UUPA 3AEUB 3R0ZA 1ZX1A 1ACJA 2F3TA 4LV8B 2Z8ZA 3PGKA 1QQTA 1R3UA 1SC9A 3FKSA 3SVZA 3UUEA 3BB1A 3FRHA 5LQRA 2RKWA 3MS7A 4F72A 4A10A 2PD4A 1K63A 4MZDA 3AHFA 4CEHB 1MB0A 4GDMA 3RRNA 4QZVA 3ZD6A 5C32A 2A5LA 2PG3A 2YHAA 1X1TA 1C9NA 4MYRA 2C7PA 1DBIA 2ZJ8A 4A6DA 5KNDA 2JLXA 1NQAO 3MRXA 2H1SA 3OQMA 1HT3A 1G6KA 3HB4X 3NASA 3UOGA 2FPGA 1J2YA 1FJHA 1KAOA 1PDVA 1P7ZA 5JAQA 4ABTA 3GLFE 1QJCA 2O0MA 2QMZA 2WHPB 4LC0A 1MDBA 1ZXLA 2ICAA 5LDHA 1HR0B 3PWKA 1QUEA 3M6WA 3SBXA 2GEUA 2OHHA 3F7TA 1SCUA 1XDGA 4B40A 1UPAA 5AJZA 3PFHA 3FW1A 1JHXA 4Z6KA 1E1CA 5LXTA 1I33A 1D2GA 3AEZA 3JXEA 4G0QA 3A9TA 3OTIA 4X1KB 4E2YA 4QWMA 1UAAA 3HBFA 3HJGA 1T9GS 4RA6B 4PV7A 4FR0A 1T2VA 1TQ2A 1L4HA 3T7AA 5DISB 1AY0A 4Q7JB 2Z3ZA 3PGA1 5AXAA 4W5OA 4QUHA 5DJ5A 3IT1A 3ZIAD 1IZ9A 2BI8A 5TB5A 3GGPA 4CTKA 2W6ID 3ESDA 3EZLA 3WYGA 3EGEA 3JV7A 4BO7A 1TW2A 3H1PA 3ZJUA 2O2EA 4NLLA 3K1AA 1LFDB 4RDIA 3SR4A 4Y6GB 5IVPA 4JJ4A 2QS9A 3RSSA 4Q47A 2PEYA 3W8EA 4QPJC 3WIOA 4DEYA 1UR5A 2RD2A 4UARA 2J9XB 3K92A 1YDGA 3GAZA 1DIHA 1VIDA 3DBRB 3MM4A 1HUQA 3O3MB 5DM0A 3VR5D 4E5UA 1Z16A 1U81A 1TZCA 1PG5A 2YCLA 5EC8A 4RK6A 3SR0A 4I8IA 4EM6A 3FVTA 2GEVA 2P69A 2VAVA 1IHYA 1WY5A 5K8JB 2GD1O 4JB2A 3MJ4A 4PHCA 5J58A 3HY3A 1FDUA 4TLCA 5ECGC 5EJ8A 4ZK6A 1NVFA 5JXGA 3KOXA 5C52B 3IP1A 3SJ7A 5BW6B 3BCUA 1EZ1A 1ONBA 2LCIA 1N0IA 3ZCRA 2O5EA 1MZVA 2VJLA 3HACA 4U3JB 1DEHA 4YXWA 2RIRA 1ZN9A 1R66A 2FPRA 3JD1A 2B1RA 1ZCZA 2UVDA 3LZDA 5T41A 3R7SA 3VPHA 1LI7A 1BIFA 2PKWA 1RCTE 2CUTA 3CLRC 4D9BA 3A9SA 5IAEA 1YUBA 1N0WA 2R66A 3AI7A 3ZY5A 4ZHQB 5DEOA 2IZ7A 4REOA 2VWQA 4L4RA 3IODA 4AECA 1PYDA 3EC1A 2ID8A 1E2KA 1K7CA 2BI4A 3MB8A 3PYLA 2FEAA 3CX7A 1IC6A 1P3Y1 4Y2TA 3K1TA 3OZTA 3Q11A 4GT1A 4UUAA 1ZR2A 5EFOA 3AEQB 2WUGA 1WPGA 3AVOA 3FE2A 3DZHA 2YIDA 3SXPA 3WB2A 4PGGA 3N9IA 1RRGA 2BR4A 2ECPA 3HL0A 2OG2A 2ZYTX 3K9NA 4KJZA 4MPTA 2XGGA 3ANYB 2VKTA 4NBSA 4MICA 5KOYA 3GBSA 4KXMA 1ZXXA 2AC4A 2FEXA 1UWCA 3IKMB 3AZPA 1WF6A 1J6UA 2C9YA 3F6PA 5KNLA 2I4LA 3E7WA 2ZRJA 2VJCA 3EGCA 1Q1QA 1R5JA 3GJSA 3GMTA 3GUUA 3JPYA 4LTDA 1NM5C 1W6RA 1XTIA 2ZIXA