The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
92
|
sequence length |
283
|
structure length |
279
|
Chain Sequence |
MRVGFIGLGIMGGPMATHLLKAGFLAAVYNRTREKTKPFAEAGVYVAESPADLAKRVDVVIVMVSDAPDVEQVLFGPSGVVEGARPGLIVVDMSTNSPDWARKFAERLAQYGIEFLDAPVTGGQKGAIEGTLTIMVGGKEELFHRLLPIFKAMGRDIVYMGPVGYGQAMKLVNQVVVALNTVAMVEGLKLAKALGLDMDKVAEVLTRSGAIELYLPKLLKGDLSPGFKAEHLKKDLGYVLEEARKRGVKLPGAELAYELYRKMVEDGAGSLGIHALGFY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of the NADP+and tartrate-bound complex of L-serine 3-dehydrogenase from the hyperthermophilic archaeon Pyrobaculum calidifontis.
pubmed doi rcsb |
molecule tags |
Oxidoreductase
|
source organism |
Pyrobaculum calidifontis
|
molecule keywords |
6-phosphogluconate dehydrogenase, NAD-binding protein
|
total genus |
92
|
structure length |
279
|
sequence length |
283
|
ec nomenclature |
ec
1.1.1.276: Serine 3-dehydrogenase (NADP(+)). |
pdb deposition date | 2013-02-22 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03446 | NAD_binding_2 | NAD binding domain of 6-phosphogluconate dehydrogenase |
A | PF14833 | NAD_binding_11 | NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | NAD(P)-binding Rossmann-like Domain |