3W6UA

Crystal structure of nadp bound l-serine 3-dehydrogenase from hyperthermophilic archaeon pyrobaculum calidifontis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
283
structure length
279
Chain Sequence
MRVGFIGLGIMGGPMATHLLKAGFLAAVYNRTREKTKPFAEAGVYVAESPADLAKRVDVVIVMVSDAPDVEQVLFGPSGVVEGARPGLIVVDMSTNSPDWARKFAERLAQYGIEFLDAPVTGGQKGAIEGTLTIMVGGKEELFHRLLPIFKAMGRDIVYMGPVGYGQAMKLVNQVVVALNTVAMVEGLKLAKALGLDMDKVAEVLTRSGAIELYLPKLLKGDLSPGFKAEHLKKDLGYVLEEARKRGVKLPGAELAYELYRKMVEDGAGSLGIHALGFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase, NAD-binding protein
publication title Crystal structure of the NADP+and tartrate-bound complex of L-serine 3-dehydrogenase from the hyperthermophilic archaeon Pyrobaculum calidifontis.
pubmed doi rcsb
source organism Pyrobaculum calidifontis
molecule tags Oxidoreductase
total genus 92
structure length 279
sequence length 283
ec nomenclature ec 1.1.1.276: Serine 3-dehydrogenase (NADP(+)).
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3w6uA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3w6uA01
2GN6A 4J2OA 5I7SA 1NQAO 3LK7A 3SX2A 2ZTLA 3TF5A 1YL7A 3PZRA 3LSYA 3MJVA 3QA9A 1H6DA 1LSOA 4YRDA 3S1LA 3TN7A 4BNWA 4CMGA 3CPSA 4DMLA 1JTVA 1UAYA 3PHIA 4CLXA 5KJ1A 5A5EA 2O7SA 5A9TA 1PZEA 2ZB7A 3E5MA 3OJEA 3PGJA 4GH5A 4WLEA 4UVGA 4NU5A 1KVQA 4R3WA 4Z9XA 1UUFA 3S2GA 2H6EA 4LMPA 4PZCA 2NSDA 3QY9A 1PJ4A 3F3SA 5L51A 3QV1A 3KBOA 4NBUA 1NYTA 1BRMA 4B4UA 3E9QA 5C5IA 1GYQA 2NVUA 5T5QA 2V6FA 2J6IA 4W6ZA 4W99A 3D5QA 1S7CA 2IYPA 2D1YA 1ISMA 2AEFA 3DZIA 3MJCA 1E1KA 2HSDA 2PV7A 2FRDA 3E5RA 3GVPA 3MWEB 3AUUA 2I67A 2Q4EA 2W2LA 3QVOA 5BNFA 3WJAA 2PR2A 2BFAA 3ANLA 3FNHA 3PTZA 4IJVA 4B8WA 4EI2A 1R16A 2C0CA 5CFZA 3IL2A 3ZWXA 4W82A 4D44A 1N7HA 2BGKA 1ZO8A 5T67A 2YV1A 3ORFA 4BNXA 1X7GA 3PJEA 5TX7A 3WNVA 5AXBA 3D3EA 3RFTA 3MEQA 3UKOA 2A94A 2Q1UA 1F0YA 4MVJA 4CM7A 3A06A 4C4OA 1F12A 1DJQA 2B4RO 2NADA 4RPLA 1OC4A 3U4HA 4OQZA 1O8CA 2EKPA 1WXDA 2WE8A 3LLVA 3V5NA 5A02A 1DBVO 2CSUA 3ETGA 3JD1A 3PWSA 4DIFA 2Q3EA 3AOEA 3C1AA 1R15A 2WSBA 3I9KA 4Q3DA 1TT7A 1ZXLA 4CM3A 5JNLA 1P33A 4QQRA 4NR0A 3AM3A 4E4YA 5T6BA 3ZNNA 3RUAA 4YTEA 4CM8B 5T57A 3HSKA 1P1FA 4L76A 4MVJM 5I7VA 5U1PA 1N5DA 3ZZNA 4TRNA 1ZK4A 3Q6IA 2B83A 4DPLA 4PGFA 2H9IA 3EZYA 2Y99A 3DOJA 1H5QA 4J4HA 3BMNA 3EZLA 3OM9A 1BDBA 2NU7A 4IXTA 4W9NC 4ZGWA 4CMIB 4UEJA 4I1IA 3TOZA 1LC0A 1BWSA 5KVVA 4Z0PA 3VH4A 2JCXA 1VSVA 3NUGA 1JKJA 1HDRA 2B37A 3SBOA 3ZV5A 1N8KA 4GSLA 8ADHA 2HK7A 4PCVA 3WYCA 3H2ZA 3BHJA 3ANNA 3SC6A 1SB8A 1P74A 1XKQA 1HDGO 1VI2A 2HRZA 4AJEA 5AXAA 3JQDA 1PS9A 2FSVA 3ZH2A 2D2IA 5ER6A 1UZLA 4FIZA 2PKQP 4INAA 4MP3A 3FWZA 1XR3A 1LSUA 4GKBA 2X23A 5JCJD 4CR6A 2A92A 2OGUA 1TLTA 1XQ1A 3LC1O 1O94A 5ER9A 1YL6A 3DB2A 5L95A 1DEHA 1QV6A 4R68A 1KYQA 2WD7A 3CMCO 1A71A 3PQFA 3ZWBA 2B5VA 5JY1A 1Z7BA 4WNIA 2QRKA 2NUAA 2NVBA 3C8MA 3BIOA 3AI3A 5LCXA 4UUNA 4M1QA 1FDSA 4II2A 5JFOA 5JDIC 4HUJA 4IUYA 3QQPA 1IPFA 2CVQA 4Y6SA 1PIWA 3F5SA 3LT1A 2P5UA 4IGEA 3G0OA 4ZJUA 1YB1A 3ZNPA 1MC5A 4OO3A 2P9GA 3BYZA 2ZTMA 1ISHA 5ITVA 1M6WA 3HDHA 5JDCC 2EF1A 3BA1A 4B79A 4NDNE 3PZBA 1LRLA 3FN4A 3SLKA 5K6AC 3SXPA 1FMCA 5DCUA 3R6DA 1PL6A 3NJ4A 1VC2A 3WYEA 1Y9EA 2Q4BA 4UVIA 1ISGA 4MP6A 3H9EO 5IXSA 2EEZA 1TA4A 2HMVA 2NTJA 4HFJA 3GNQA 2BGLA 2VYVA 5TNXA 2G5CA 2Y93A 3GEMA 1NAIA 3K9QO 5G0UA 4NBRA 1H6CA 4DXHA 4Y9DA 1UXGA 3ROPA 1HEUA 3P2YA 3F6YA 4GQAA 1RJWA 4BO1A 3DQPA 4E33A 3G1UA 1U1IA 1OI7A 4FOOA 2EERA 5COAA 2X0RA 3PHLA 1AXGA 5FFFA 5I8WA 3ZV4A 4HWKA 3PRJA 2VYVD 3GRKA 3N58A 4DIOA 5HM8A 2PZKA 2FPPA 2FR0A 3Q3CA 1U7TA 4N18A 4XWYA 4BO6A 5AQ1A 1Z73A 4LCJA 4HXYA 1DRUA 1B7GO 3OETA 3VTZA 1AN9A 5G4KB 4AJJA 2PTGA 3H3FA 1U3TA 3X2FA 2FN7A 3KYCB 3DZKA 4EITA 1TT5B 4D45A 3ZHBA 1IPEA 3AU9A 3ST7A 3A14A 1G0NA 1P45A 5THQA 1W6UA 3EVNA 3QWAA 1IUKA 1P1KA 5T64A 4E5NA 3GMDA 4KQWA 2VRCD 3V8BA 4CLEA 1YQDA 1EEHA 4KWIA 3ADPA 1UJMA 1YDEA 3I4FA 3WGZA 1B16A 3PI7A 4YAJA 5HA5A 2W8ZA 1K0UA 1K6JA 4OJNA 2Z95A 3WLEA 1I3KA 3DOCA 3EY4A 5DP2A 2YYYA 1U28A 4YJGA 1ZJYA 4ZQGA 1GCUA 4BNYA 2QRLA 3IJPA 4W7IA 1P3DA 5I9MA 4DYDA 4R5MA 4XYBA 2Z1NA 2YY7A 4B7UA 4W7HA 1ZSVA 5JDCA 4U6SA 3I6IA 4ZQHA 1WW8A 4ZVVA 1PEDA 4E6PA 3HFGA 2BMAA 2DU8A 3AY6A 2HLPA 5BR7A 2UAGA 4I9UA 1X7HA 1PJQA 4E13A 3EAGA 2PD6A 4L4SA 3OQBA 4QUKA 4WOJA 4BNVA 5A9SB 3QVXA 5JAMA 4BO9A 3EMKA 3D5TA 2X8LA 2G1UA 3DFZA 1X1TA 3BTSA 3WIDA 4KUGA 5G0WA 4AJKA 1PU2A 1QKIA 1U8XX 2BFOA 3OEYA 3DHNA 3EHEA 4ILKA 2GRAA 1E5LA 4GI2A 1PWXA 3RUHA 3CKYA 4OAQA 3EGOA 1YRLA 3GHYA 1BGVA 2O2SA 3IP1A 4J6FA 4YJFA 3IIEA 1CERA 1Y8QB 3K73O 3KTDA 2QYTA 5K9ZA 5JMWA 2GD1O 1ULUA 3GHHA 3DHEA 4PLGA 3QIVA 1SOVA 4UREA 5GZ1A 2SCUA 5JMPA 1W0CA 3OBBA 4YCAA 3AM5A 3HNPA 3QVWA 6LDHA 3D7LA 3NT2A 4NK5A 3DDNA 4AJIA 3G3EA 2OMEA 4KZPA 3FR8A 3KSDO 3KSUA 2G82A 1NHGA 1SNYA 4EDFA 3OJ0A 1GADO 4JXKA 1N1GA 4JGBA 4J4TA 3BMQA 2C29D 1WP4A 1ZEJA 2EWMA 3WBFA 2HAEA 3VZSA 4BV9A 2O3RA 2V6GA 3GVXA 5MGBA 1R0KA 2CNBA 4CUZA 1WZEA 3DBRB 3ETDA 4BUCA 1BW9A 2XAAA 3IAHA 3ZDFA 3M1AA 3KB6A 1GR0A 3JYQA 4L4XA 4UEKA 2D4AA 3WGQA 4I9NA 1OOEA 2Y0EA 1VRWA 1A72A 4FJ2A 4BMNA 2EW8A 1PR9A 2Q1TA 3AW9A 4Y98A 3I1JA 4OGWA 4DQUA 2UV8A 3ZWYA 2B36A 3QLJA 4AL4A 3UAGA 3WR5A 4EW6A 3ZWCA 5U4QA 2HU2A 3STHA 3QJ5A 3D3WA 4NHEA 5ES3A 1XGKA 3H65A 2VHXA 1M75A 1KC1A 1UZMA 3JQ8B 4BO7A 4E5YA 1N2SA 4DPMA 1CYDA 4DQVA 4MKXA 1V6AA 4PFJA 4R3NA 2HK8A 4S1VA 4B7XA 1KVSA 5DBFA 4YRAA 4DRYA 1EDOA 3G1TA 4IDGA 4D43A 3PJGA 1GQ2A 1FDUA 2Q2VA 4E2WA 5CEEA 5AXDA 5TRTA 3EC7A 3Q2KA 2Q2QA 2V65A 3WGIA 4K6FA 3GAFA 3EW7A 2X86A 2YUTA 1HE2A 2VT3A 3LC2O 3Q1LA 4ZICA 3JQGA 1HE5A 1PJLA 2FR1A 4NJMB 5ENDA 3FCOA 1I2ZA 5HBRA 5HS6A 2Y1OA 3KXDA 3CIFA 1RPNA 3JV7A 3WGTA 1NVMB 1LI4A 1R4MA 4ID9A 4QX6A 2AXQA 2BD0A 4YA6A 3JQBC 4YQZA 1OC2A 1B8UA 3VKVA 4RVDA 1TVEA 1WLYA 1C0PA 3JQ6A 4OKNA 2I76A 4DA9A 3PIIA 3VVCA 3DEYX 3KYDB 3PIDA 4HNHA 1IY8A 4CV1A 2VOEA 3NTQA 1ONPA 5A3JA 5I9LA 5T8KC 1E6UA 3LF1A 3CZRA 5HTOA 5FWNA 2VZ9A 8LDHA 3U49A 3INGA 1Z7EA 1V3UA 4A5OA 4E3ZA 1QLHA 4DIBA 3GDOA 4WOKA 4AJHA 3IOYA 4TSKA 1A5ZA 1NQOA 2HRBA 1H94A 3ULKA 3BMCA 3GNSA 3WB9A 4DREA 5BSHA 1YWGO 4CJXA 1ML3A 3AK4A 2JCVA 4Z0HO 1WVGA 3R3SA 3S2IA 4HBGA 2ZB8A 3GY0A 2X6TA 3JD4A 3WOHA 3QP9A 4JK3A 3Q11A 4W4TA 4WCFA 2FR8A 1HF3A 2A9FA 1R4NB 1ZK1A 1LNQA 2VNAA 1Q7BA 4FOSA 1LUAA 3DZHA 4R1SA 4FD3A 4HFMA 3CUKA 3ICCA 3NGXA 2FSSA 2OP0A 3MOIA 4YJHA 2AG8A 3JQ7B 3MJSA 4WECA 1Z6ZA 3O38A 1R37A 1QYWA 3C7CB 4TKMA 1YJQA 4N7RA 2X9NA 3H9GA 4IJUA 1PGJA 4WK6A 4HV4A 5IN4A 1VKNA 2YFQA 4AJLA 3HB5X 1ZEMA 4CUJA 4E2ZA 4BS9A 4CLHA 2X0NA 1E7MA 4L75A 1LDEA 3UUWA 4XB2A 3RUCA 2OBYA 4FSHA 1RM3A 5B4VA 3IKTA 4NBWA 3ICPA 1ONNA 4RF5A 3K2BA 3WQRA 4YRBA 1DXYA 3GAZA 2VNSA 1I24A 1YL5A 2UUOA 3JQBA 4CLOB 5IDQA 3GZ4A 1A4UA 4YB8A 1DIHA 1YJ8A 1P0FA 2QQ5A 3DL2A 4WLUA 1RM0A 1XELA 1EQ2A 3TZKA 1ZVMA 5K0ZA 1PL8A 3AFMA 1E7QA 2GPTA 1JQBA 1YOVB 5T8KA 3AOGA 3FNEA 1NTOA 2VOJA 4LISA 3TFOA 2UUPA 3M1LA 5BT9A 1XU7A 2NU9A 3OJOA 3ZCXA 1PGNA 1LQUA 5B4UA 2RH8A 3GG9A 1SZJG 3FD8A 5DNAA 3UCEA 2RHRA 2EG9A 4G2NA 1J0XO 1CQJA 2CY0A 2ZCVA 1UXJA 3NYWA 1BXGB 1IZ0A 3PYLA 1KEVA 1WMAA 4TZTA 2Q2WA 1IHYA 1A9YA 5JW6A 2PZLA 3ENKA 1ZSNA 3DR3A 1Z45A 1XYGA 3NTRA 4OYRA 5KJFA 4J1TA 1U8FO 4AJ4A 4XZ3A 1LLQA 1M67A 2VZ8A 3OA2A 4FJ0A 4KDEA 4NG5A 4EJ6A 2DTEA 1JKIA 1Q7GA 1TB4A 1H6AA 1ZKMA 5F1OA 4ROSA 3FNGA 5EN4A 3ZW9A 1E7SA 3FPCA 1BG6A 3L9XA 4PG4A 4YACA 1VE9A 1EZ4A 2VRBA 3NAQA 1XG5A 3H2SA 1NPYA 3ITDA 2ZTUA 4LRSB 2I66A 3RFVA 4GLLA 4CMJA 2W2KA 4NBVA 1EK5A 2JD2A 1PJ2A 3WLFA 1S6YA 1Y9AA 4A03A 5J23A 4PG8A 2QHXA 3PP8A 2A4KA 5A1TA 1MLDA 2FP4A 1L1FA 1PJBA 3INTA 1CETA 1T2CA 1UZNA 2PH5A 3LZ6A 4ND1A 3ZWAA 3SVTA 4ND4A 5EQFA 2IZ1A 4BGVA 1U3UA 4P4GA 1XU9A 1AE1A 1DIAA 2WYVA 1I2CA 1U2DA 3HN2A 1PGOA 3VC7A 2FZWA 2VCYA 4RVSA 1RYDA 1SPXA 3RAJA 4GX0A 4E0BA 7ADHA 2R00C 1C1XB 1CF2O 3GEGA 5L7WA 3A28A 3HQ4O 3FRJA 1OMOA 1UAGA 4FR5A 2VUSA 1AHIA 4GKVA 1P9LA 4MIEA 4CPDA 1DIBA 1U4OA 4IY1A 1Z82A 1I2BA 1N9GB 1B14A 1GQQA 1AXEA 3TZCA 2NQTA 4U8GA 3HN7A 3RC1A 4AVYA 2R6JA 4JJIA 2QZ9A 3C7DB 2HQ1A 1N1EA 1LDGA 2OXIA 1WMBA 3KLMX 1DRVA 2XF8A 3B70A 3HG7A 2YDYA 3ZV3A 1VSUA 2YHUA 3U9LA 4B3HA 1P31A 2B69A 3ZV6A 2YFHA 4K1LA 1FDWA 1HE3A 1Y1PA 4BO8A 1AUPA 1LSSA 2ZJ1A 3V2HA 4E2YA 3ADOA 2D3TA 5DULA 4CLDA 5TT0A 2Z5LA 3PGXA 4J1QA 1HYEA 2NU6A 5CHEA 5HS4A 3OEWA 4IMPA 1Y8RA 3U09A 1KY5A 1ZCJA 4CQLA 3JYPA 4OXNA 4XGNA 4A0SA 4BNZA 1LBEA 3G79A 3BAZA 1KBZA 4JQCA 3ZU5A 4A73A 3MTJA 3W6UA 3PYMA 1EBUA 3AU8A 3O8QB 1T2DA 3DBHA 3KHUA 2X22A 2D59A 4YAKA 4RORA 3WJ7A 4L8VA 3LF2A 5DBIA 4BNLA 3PJDA 4XD2A 3WWYA 4FJ1A 4L74A 3PHJA 4N5NA 4BO4A 4II3A 1FDVA 1V3VA 1CWUA 3IUPA 4WEQA 2EKQA 1EBFA 4XIJA 2C2XA 2E37A 3RC7A 3RUFA 5CDUA 4MOWA 5CPFA 4G5HA 4BNTA 1UP7A 5AXCA 1Y5RA 1QMGA 4K9DA 4CV0A 3L4SO 1VKOA 5CG1A 4K28A 2ILTA 4FFLA 4P4LA 4B8ZA 1XLTA 5JAZA 4LCEA 3DAGA 4N5LA 3L07A 3S2EA 4CM8A 2E82A 4HFNA 5EERA 4WLNA 4QSMA 4WEOA 5IDYA 4IM7A 3TRIA 4CMCA 5CDGA 2GNAA 1C0LA 4MKRA 1IL0A 4KUHA 4R1UA 1LDMA 3OFSA 2I65A 5JXWA 1E0DA 4H3VA 3WX0A 5A06A 1NAHA 1J5PA 4GSKA 4PLTA 3L77A 2X0JA 1NBOA 1GUYA 2IZZA 2R00A 3DXFA 2GYYA 3MZ0A 4CQMB 5KVSA 1HDXA 1EQUA 1Y5MA 4RVFA 1JWBB 1I0ZA 5TJHA 3ZWOA 1JW9B 4D41A 1YBMA 3GMSA 2W90A 1MA0A 1YBAA 1ZNQO 2YV3A 5KNLA 1VJTA 4EUEA 4F45A 4F6LA 2VHWA 3GQVA 2ZTVA 3E82A 2O2YA 4CM4B 4NNJA 2FOIA 4CM5A 5JAQA 3GVIA 2NVUB 2O3SA 1HDCA 3IUSA 4M87A 5A05A 3P2OA 3R3JA 2OO5A 3ENNA 2HKIA 3AWDA 1KS9A 3TWOA 5KWEA 1T2AA 4GVXA 3BTOA 3RUEA 1T1RA 2AA3A 3HDQA 1ZJZA 3O03A 4TRJA 1YS4A 4YVFA 1CEQA 2BI7A 2C2YA 1P0CA 3DFUA 2HO5A 3L6EA 3NX4A 5JPIA 3QVSA 1NWCA 4CM9A 3GRPA 3IP3A 5JCJA 1KVUA 4FCCA 3M2TA 1YVEI 4A26A 3ROKA 4M54A 3AFNA 3ANMA 4IDDA 5JC1A 1I36A 2P2SA 4XGKA 2GR9A 1GPDG 2AQHA 1A7AA 4CM9D 4IPTA 4WASA 2B4TO 1NHWA 1QG6A 3SJ7A 4ZQEA 2B5WA 3IS3A 2HMTA 4DBZA 4XB1A 1R12A 3BMOB 3F4LA 4ALLA 4NJOA 1P1IA 1R66A 1SEPA 2DTXA 3VH1A 1LQTA 1WNTA 4CUKA 4D0RA 3O26A 4OHUA 3TL3A 2EV9A 2PH3A 5L4NA 4PLCA 1E3EA 2ZYGA 5H83A 4FC6A 4IQ8A 1LSJA 1NASA 1W4ZA 5KVQA 4TVBA 3JYOA 3KEOA 3UN1A 1NP3A 3UW3A 4E5KA 2OHXA 3DZJA 1I5RA 3FWNA 4XDZA 1JDJA 1XA0A 3GH3A 4YT8A 1UXIA 4BNKA 4RF4A 5IDWA 3L4BA 1WAMA 3FHLA 5LDHA 5CEFA 1EVIA 2CFCA 5LC1A 3CZMA 3RQSA 1HDZA 1GUFA 3RJ5A 2HCTA 1EE9A 4O59O 2AEMA 3LQFA 1GD1O 5G4KA 2OORA 2AE1A 3F4BA 4MVJG 2YHIB 1WDKA 1LRJA 3KYCA 1U2GA 2PNFA 3WG9A 4NQZA 1BTOA 1GDHA 2RH4A 1KEUA 5L7YA 1D8AA 1L7DA 2QX7A 4A27A 4ZRMA 3SJUA 3OQ1A 3JSAA 5F5LA 2NU8A 1ZFNA 4YEDA 1ZZEA 1YKFA 2O4UX 5DT9A 4UULA 3ZU4A 4Q3EA 4FFMA 2ZJ0A 2EGHA 4C7KA 1NR7A 3BTVA 5EPOA 4E31A 2DT5A 3UXYA 3ASUA 3VPFA 5G0TA 2B0JA 6ADHA 4BO3A 2EIHA 3PLRA 4Q39A 4AICA 4D3DA 2EP5A 3OJLA 2G0TA 4YBZA 1MV8A 2BHLA 1XHLA 4JLWA 5COQA 1X15A 3I52A 2VRCA 2FY8A 1QYXA 1XIVA 3RVDA 3VKUA 4YYZA 5A9RA 1X7DA 2OP1A 1E7WA 1PGPA 4EZBA 1PZGA 3OMLA 4PLPA 1DHRA 1CQIA 2PZMA 3N74A 1ENZA 1VPDA 4PRLA 4BMSA 1Y6JA 2I5PO 3LC7O 3IMFA 4NFSA 5BSEA 2C59A 4BGEA 1DFIA 5A9SA 1PS8A 2Y1CA 1H93A 5HRUA 1ISJA 1RYEA 3W1VA 3ZHXA 4KWHA 5IF3A 2DQ4A 1N7GA 2PK3A 4J2HA 4XQGA 3ZU2A 4Y8VA 2OBNA 1QLJA 2E49A 2IEBA 4GL4A 2DFVA 3LDHA 3EDMA 3VAZA 1PX0A 1VL0A 1GQYA 3INRA 2FHSA 4OOEA 3RD5A 4LGVA 2C5EA 4O5OA 4PZEA 3I9NA 4KDFA 3A4VA 4I08A 2HDHA 1ISFA 2DPGA 1UH5A 2C82A 5FEUA 4MJLA 1D1SA 5I9NA 3JYNA 2CDAA 4PLYA 1UP6A 3IQDB 2VUUA 3DC2A 1LEHA 1PJTA 2Q99A 3H5RA 3DMYA 5IG2A 4NFHA 5IFLA 1MP0A 2Y0DA 3OIGA 2JD1A 4BB5A 1DRWA 4JJFA 4YAIA 5C3MA 3HE3A 1X0VA 4IDEA 4B7CA 4R1NA 4QO8A 3UICA 1Q0QA 2VHZA 1LDBA 2Y1EA 5KKAA 3K30A 1PGQA 3WWZA 3QRWA 1LLDA 3D4NA 3WFJA 2DTDA 4XKJA 1H9BA 4ALKA 4J90A 3JQAD 5C7OO 3DBRA 1E1MA 2X1HA 1EMDA 3E8XA 4J16A 4AJPA 1AGNA 2CF6A 3DONA 5F21A 4PN3A 1QYCA 3A9WA 3NRCA 4J3FA 1BHSA 3TPCA 3DTYA 1GZ3A 4R51A 1V9LA 4YJGB 5GZ6A 4K6CA 3JQAB 3L6OO 2O7QA 4F46A 3G49A 4B4VA 3ABIA 2GSDA 3L9WA 5L7TA 3C24A 4RLSA 3FR7A 1NNUA 1HTBA 1UXHA 2H63A 1M76A 1B26A 3E18A 5L9AA 2YW9A 1V3TA 2JFFA 2DM6A 1E3IA 1I32A 4Z3DA 4CR7A 4OIMA 3JQ8A 3MOGA 4RPKA 3WGOA 4F3YA 1E6WA 3OECA 1BDMA 2C7VA 3PWKA 4G65A 4RPGA 2NVWA 2QZZA 3E48A 3UFXA 2B4QA 3RKRA 4CL3A 2X4GA 1MFPA 3QWHA 1GZ4A 2EGGA 4J7UA 2J3JA 2OL4A 4ZQBA 4QFCA 4NFYA 1RWBA 9LDBA 3VDQA 5BSFA 3UCXA 2FPIA 3ZN2A 4R9SA 5CPBA 4JX8A 5IAAA 3GN1A 4I5DA 3JYLA 5ICMA 4WCFC 1L7EA 4AJOA 4B3IA 3UVEA 4UVDA 4NJMA 4WPGA 3OSUA 4J9UE 5L3ZA 4FB5A 1WPQA 2GN9A 4L73A 3WQSB 2R2GA 1LLUA 4E12A 4ZRNA 1HT0A 1ZK2A 2J5KA 4R5HA 1HLPA 4QEDA 1X14A 1UDCA 4R41A 2IE0A 1GPJA 1EFLA 3KYDA 1PQWA 4EUHA 3QW2A 9LDTA 2J3HA 3ZI0A 2IZ0A 1N92A 3WGYA 2E6UX 2NV6A 5IN5A 3B20A 2GN4A 4JN6B 3OP4A 4J7XA 1KERA 3DZGA 3GK3A 4XQCA 1DOHA 3AY3A 3RUIA 3U4CA 3BMQB 1RM4A 3S2FA 3KLPX 2IYOA 1WDLA 1SOWA 4RCVA 5CG2A 1ORRA 2VQ3A 4MDHA 4NK4A 2IXBA 5EMHA 1ZMTA 4HKTA 2PD4A 3W4KA 2O50A 4ND5A 5G4LA 3NT5A 3F1LA 5JS6A 5H81A 2CUKA 2VWHA 3HADA 3RCBA 2Q1SA 2NWQA 4R16A 1KETA 1MX3A 2I99A 4D79A 4EJ0A 1DDOA 2Y68A 4I5EA 1OFGA 1NX6A 4RZIA 3ZWPA 5IDXA 4BNFA 1H6BA 1R4NA 2BELA 3GPIA 4Q3BA 4WCDA 1DC5A 4YQYA 3TSCA 4AG3A 4LRTB 1C0KA 1KVRA 2P9CA 3P5SA 1V35A 4J1SA 2OUIA 4MP8A 4R9RA 3TZQA 2IEDA 3AM4A 4U0KA 2WYWA 3D3WB 4OMUA 2IXAA 3LYLA 1PWZA 4RJTA 2JKVA 3ZWWA 1QR6A 3TQHA 4AFNA 4R01A 1YONA 1ENOA 5DOZA 3C7AA 3PLNA 4WLVA 2NNLD 3VDRA 2ZB3A 4BGIA 4GGPA 5ICSA 5ENVA 1DC4A 4ESOA 1EVZA 1NQ5A 3AI1A 2Y66A 1T1SA 4KTVE 3TZHA 1GU7A 1WZIA 5DBGA 1E1NA 1GV1A 1P1HA 3OQ6A 4RO0A 3GUCA 2Y0CA 3BHIA 4DQXA 5KVCA 5KJEA 4AJ2A 2BRUA 4ZU3A 4Z6KA 1O0SA 4LSMA 1SCUA 1ZBQA 4LK3A 3ZNOA 4P8RA 1YDWA 3U62A 1R4MB 2VZ0A 4H16A 4IDFA 3T4EA 4NMHA 1ADBA 3S55A 2BKAA 3FPLA 3O4RA 5EJ2A 3NEPX 1G1AA 1YOVA 2OOSA 1VM6A 2P4HX 3PHGA 2QG4A 1MFZA 3H7AA 2AQKA 1VL8A 3OJFA 4CV3A 4UVEA 3IDSA 3ZWMA 1HE4A 1JN0A 2PKRA 5L45A 4P22A 4JIGA 4NU6A 1E3SA 2YQ5A 3GOHA 2DBRA 1UXKA 4CLRB 3FTNA 3ONEA 3SC4A 2P4QA 4OH1A 5KJ6A 1Q0LA 1O95A 5C7LO 1B3BA 4DMMA 2QYSA 3CH6A 4MPDA 1DFGA 1LU9A 2P5YA 2GGSA 2Y1GA 1D3AA 4GVLA 1MG0A 5LDGA 3WQQA 4XX0A 4M49A 4BKPA 5KCZA 5I7FA 4IGFA 3GEDA 3DBLB 3VH3A 4XYGA 5BNIA 1ZH8A 4WLOA 3QVTA 4XJSA 2GUGA 5JYEA 3RU9A 4XRRA 3KEQA 4YAGA 1PZHA 3JQ9A 4KTTE 1E77A 4MVJP 3H4VA 1EUZA 3QWBA 5DZSA 3FTPA 4XA8A 7MDHA 4I5GA 1DO8A 2ZK7A 4PVCA 4D0SA 1C14A 4LSWA 1EDZA 1HZZA 2J5RA 1E6EA 1HYHA 3H9UA 4MO2A 3HDJA 1KY4A 1K6IA 1PTJA 4KMSA 4PVDA 4IIVA 3TZ6A 4D3SA 4IDCA 4XGIA 1JLLA 4GWGA 2CVOA 1V8BA 1B15A 1H0KA 4WUVA 4Q3AA 1GFSA 4Y6PA 1HDOA 3H9QA 2DFDA 1JKFA 5G0VA 5AOVA 3UGKA 2NTNA 4IQGA 3V1UA 1C1XA 4BNHA 4UVHA 1NPTO 2UYYA 1NFQA 4P38A 1B3RA 1E7YA 4J7CA 4BNIA 1C3VA 2X5JO 2ZB4A 4GMFA 3NJ8A 3LT2A 2ET6A 1N9GA 4R4JA 3U4DA 4R54A 1EVJA 1ZIDA 3HUDA 4FN4A 3L6DA 4DTIA 4QTZA 3WSVA 4CMBA 1M2WA 4O63O 3MJ4A 1NXQA 3B6ZA 2DVMA 4IDAA 3W6ZA 4H15A 1F06A 2B35A 1YB5A 2BI8A 2X7HA 4RQTA 1HZJA 4YT4A 4H7PA 2VUTA 3C3XA 3VOSA 1DIGA 4BGUA 4Z0TA 4GX1A 4C7JA 3DMTA 3PXXA 2C7GA 1E3WB 2JCYA 2HJRA 2GLXA 3W8EA 3D1LA 1DLJA 3K6JA 4KP7A 2GZ3A 5IXYA 5IZCC 1HYGA 3BXXA 3PQDA 4NZ9A 3Q0EA 3OIFA 4XIYA 1ZSYA 1C1DB 3H5AA 3DO5A 4MVJH 1A27A 2J3IA 4CV2A 3ROQA 2WTBA 1VLLA 5JSFA 2TMGA 1OZAA 2BGMA 1XSEA 4DYVA 1BMDA 5THKA 2UDPA 2AG5A 4HNGA 1PJCA 2W2KB 3H9JA 1BSVA 2XXBA 2VHVA 3HB4X 4R69A 4DGSA 3GDFA 3QE3A 4OOFA 4ALIA 4IS2A 2DUWA 4K26A 3WS7A 4FFOA 1ID1A 3AY7A 3ONDA 5AYVA 4XDYA 1ADFA 2JL1A 2EJVA 4PG5A 3MJTA 1EUCA 1B8VA 3RU7A 4M8SA 4D3FA 3PVZA 4U5QA 1YE3A 1JA9A 3KYBA 4LVCA 4XEHA 4HX5A 1XEAA 2NACA 2AQIA 3HFSA 1P1RA 4JROA 3CTVA 1Q7CA 4EJMA 1AHHA 1K3TA 1T4BA 3F46A 3JQFA 3MWDB 4CQMA 5KTKA 4XYEA 2Q49A 4L9RA 2ZYAA 2ZATA 3I3OA 5TSDA 3WSWA 1PS0A 1KOLA 3RI3A 2VWPA 3VH2A 1EVYA 2VHYA 3TJRA 2PLAA 4BMVA 2DBVO 1J6UA 2CDCA 3GZNB 3ROMA 4ITUA 4MVJE 3WNQA 4GMGA 4CM4A 1LA2A 4CQMD 4ZD6A 3LVFO 3U3XA 3GR6A 4OXKA 1GCOA 2FWMX 3OIDA 1DB3A 2X5KO 1HL3A 4DLBA 3WYBA 5U9CA 1DAPA 4KOAA 3EYWA 1R6DA 2QRJA 4BV8A 1FXSA 4RVUA 4WNCA 3WIEA 4EYEA 1Y8RB 1RKXA 1XCBA 4GAEA 3Q9NA 4CMIA 4NPCA 2YQ4A 1T2EA 3RJ9A 1A4IA 4CQLB 3ZGYA 3UCFA 1ULSA 4E30A 5IZCA 3L4BC 4ONEA 5F3RA 4QT0A 4EBFA 1K2WA 1UR5A 4M55A 3WTCA 1GTMA 1VJ0A 3FBTA 2NTVA 4J91A 2J3KA 1E5QA 3I23A 3DBHB 3ZU3A 2W2LD 3C1OA 4ALJA 3H6KA 3WTBA 1NFFA 2J8ZA 2Z1MA 1ZXBA 1SB9A 1ZW1A 2O3UA 3DZBA 2RAFA 1GV0A 3PFWO 4GX5A 4ALNA 2WD8A 4MKZA 4F6CA 2POQX 4QXMA 5BSGA 4YT5A 4Q3NA 2JJYA 1KIFA 2UVDA 4BNGA 5JE8A 5CDYA 3I5MA 4FPXA 1FK8A 3BMOA 2WDZA 2D5AA 3JD3A 4RZHA 4DUPA 3GVHA 4EUFA 1VJ1A 3RBVA 3LLSA 5JO9A 2YJZA 1P77A 2D0IA 4BO0A 3UH1A 1P1JA 4MVJD 1YBVA 5ITWA 1QORA 3GF4A 4QECA 4XQ9A 3WMWA 1IE3A 5JLAA 3OH8A 1A7KA 4O0LA 3KSZO 4AJNA 3ETEA 1YQXA 4RDHA 3DWFA 4Z9FA 4IJWA 4UUOA 2DKNA 2C5AA 3K2EA 4Q9NA 4Z9YA 5FYDA 1F8GA 1QXSA 4N54A 1B0AA 2C20A 3WGHA 2G76A 1FJHA 1UDBA 3NV9A 5L4SA 3B1JA 2HMWA 4UAGA 4FS3A 4RF2A 3I9LA 2PGLA 4WJZA 1HRDA 4TMFA 5EINA 4TVOA 3KUXA 5DF1A 4PLFA 4HADA 3F47A 3ZHZA 4JJGA 1DC3A 2DUUA 5B1YA 2WJPA 3T7EA 3NTOA 4J43A 3U4IA 4B4OA 2ZYDA 1T4DA 4FQ8A 1ADCA 1E1LA 1X0XA 4NIMA 2YHIA 4J0EA 1ISIA 2V7PA 2P68A 4FFRA 4BKUA 5JY6A 3OICA 3VPGA 1X13A 2Y67A 2C54A 3DTTA 1J49A 4PRKA 5KOIA 3M6IA 3IC5A 2ZIZA 3PWZA 2GASA 1DHTA 4BOYA 1HLDA 3GPDG 5DN9A 4M89A 1ZK3A 3BMNB 3ZW8A 5GZ3A 1LDNA 5KJCA 3RBZA 2PGJA 1G6KA 3PEFA 4ZHSA 3VPSA 2RIRA 1DAOA 3IKVA 5MDHA 3E9MA 3WICA 2JFHA 3LT0A 1KEWA 2QW8A 3PDJA 2Y1FA 5TGDA 1IB6A 5EL0A 4BQRA 4BL5A 4ZQFA 3U5TA 1PQPA 4DVJA 5F5NA 3AUSA 1Y81A 5JYDA 2IODA 3CMMA 1TT5A 2HJSA 1HETA 3R0IA 1Q0HA 4ZN6A 1NVGA 4CR8A 2Y05A 1DJNA 1CDOA 2EJWA 3ZWNA 1NFRA 2HUNA 1DIRA 3B1FA 3WMXA 1LJ8A 3HHPA 1O89A 2I6TA 1MXFA 4J0FA 4ALMA 3Q9UA 4LN1A 1YO6A 2BFMA 4JNKA 5TIIA 2WD7B 1F14A 4UUMA 3W4JA 1DFHA 3ITKA 4ZA2A 3WDSA 4A7PA 4BKRA 3KV3O 4XQEA 3WXBA 5TJ9A 5I7EA 2BH9A 5BQFA 2DAPA 2V6MA 3HDYA 4LVUA 2IRWA 4XRGA 5TQVA 1IULA 1XDWA 2WWRA 2X9VA 4PIVA 2PY6A 4L4RA 4TQGA 1U7HA 1I10A 2JHGA 4E5PA 3K8ZA 3KETA 1JAYA 2GCGA 3GGGA 4W9NA 2GDZA 1H2HA 2IDZA 1UDAA 1R0LA 1Z74A 1JAXA 4PLWA 1K89A 1E3LA 3WGGA 4PLVA 1ONOA 3VZQA 3RUDA 4A2CA 1SO8A 4J9VA 3MCVA 1X1EA 5ADHA 1U3WA 3M2PA 1I3LA 3BTUA 3JD0A 1QV7A 3L0DA 4RGBA 4BNMA 1JWAB 1EFKA 3TNLA 1I3MA 4Y6RA 4IDBA 3I9JA 4U7WA 5FI3A 1Q1NA 2PWZA 1NM5A 4OSOA 3GUYA 4G81A 3UF0A 4O6VA 3V1YA 1I33A 1O9BA 3A1NA 5G2OA 1EE2A 4OXYA 4GWKA 2Y1DA 4GX2A 4Z3KA 4FW8A 2RHCA 5EESA 3RC9A 4GPD1 5FF9A 4DWVA 2A35A 3DHYA 3ON5A 3FSRA 2EP7A 4BNJA 1YGYA 1BVRA 2FZEA 2EW2A 2GERA 1KEPA 4TWRA 1Y8QA 2LDXA 3EUWA 4BVAA 4LW8A 1GAEO 4MVJF 3D4OA 1Q2XA 3TOXA 1QRRA 2RCYA 2VTEA 3K31A 2BF7A 3PK0A 2I3GA 5DOVA 5JDIA 5GY7A 3VZPA 1U4SA 4JBGA 3JQAA 3LT4A 3NDJA 4WLFA 1LLCA 4RV9A 4BO2A 4OKIA 1V0JA 1CIVA 1HSOA 3B1KA 5GMOA 4YDRA 3SEFA 1M6HA 2GZ2A 1E3JA 5A4DA 5B4TA 1ADGA 2G17A 4RPHA 1YH3A 4DLLA 1SMKA 3WBBA 2CZCA 3DAPA 5F1PA 2D8AA 2ZQYA 2GZ1A 3NKLA 3UHAA 4CMAA 3MJEA 4YWJA 5K6AA 1UP4A 4BHTA 3GC6A 3AJRA 3V1TC 2AE2A 4RF3A 4ND2A 1RM5A 3VVBA 4IMRA 1NVTA 2X9GA 1K5HA 2PZJA 3E03A 3D0OA 4J49A 1IZ9A 1VL6A 3PHHA 4BQPA 1I01A 5I8ZA 1XWFA 2BFPA 3FBGA 3HJAA 4TROA 4UUPA 2CVZA 1W8DA 4O1MA 1ZK0A 3CE6A 3H5NA 2NM0A 3I4CA 3TL2A 2FMUA 2GF2A 4U6QA 3X2EA 2VWGA 2W4QA 4BNUA 4DC0A 2X0IA 3GNTA 2W98A 4RL6A 3PYXA 4WKGA 4IINA 3AUTA 4I9HA 1F8FA 1KC3A 1QP8A 4E32A 3CSDA 4OQYA 3GGPA 4XR9A 1IOLA 1T25A 4DPKA 1G0OA 4XCVA 1D1TA 5COBA 5A5FA 1A9ZA 1GYRA 4D42A 3F5QA 3KO8A 4UEOA 3COSA 1H2BA 3NGLA 4XYMA 5KIAA 3E1KA 3PPIA 1U5CA 3RC2A 4MIOA 1KVTA 3GFGA 3MTGA 2O4CA 2EHDA 3CXRA 1HWYA 4MINA 5FI5A 4RVGA 3GG2A 2ZKLA 5C7IO 3ZHYA 2H5LA 3EVTA 5TLSA 2O3TA 3I9OA 1I30A 1TI7A 2C07A 4B3JA 3K96A 1NR1A 4PG7A 4URFA 4YJFB 1GUZA 3KZVA 4OSPA 3GLQA 2O48X 2HK9A 3AI2A 2CMDA 3QHAA 3AUAA 3U0BA 4RLHA 3N7UA 3HWRA 4U0JA 2GO1A 2JHFA 3NDIA 4PG6A 2VN8A 1ENPA 1I3NA 3UOGA 1T26A 3H3JA 3V2UA 1GEEA 3OHSX 4IJKA 4DL9A 4N5MA 4EGFA 3RFXA 4BNNA 4OM8A 4MIYA 4J1NA 1Y7TA 2X58A 5CP8A 5ILOA 4CL8A 1I8TA 2QIOA 3GA0A 3PDUA 4FGSA 1BW9B 4YR9A 2Q1WA 3G17A 1T24A 4KUEA 5AVOA 3I83A 5B12A 2TMDA 5JAIA 3KOUA 1YXMA 2DLDA 1LC3A 4DC1A 1SC6A 3FI9A 2JFGA 2PKQO 1E7RA 4ND3A 3D64A 3RASA 4A10A 3QSGA 3JD2A 3JQCA 2PD3A 2OFPA 3Q2IA 3O9ZA 1MUUA 1ZUD1 4CODB 4EEXA 4E21A 3CEAA 1DC6A 4CMEC 2P91A 4TZKA 5BNTA 1JU9A 2DPHA 4BB6A 2XXJA 3JQ7A 3T7CA 1QYDA 3GDGA 3KRTA 4BIIA 3JQ9C 2O23A 2HMSA 2ZCUA 3LU1A 5L53A 4GBJA 3S8MA 4PLHA 2E48A 3ZNQA 4FFNA 2WMDA 4RQUA 2ZQZA 3R1IA 2CF5A 1MB4A 1JVBA 3TDKA 1U3VA 4AJ1A 4YPOA 2PA3A 4WGGA 2EXXA 1DSSG 2GN8A 2O3JA 1HXHA 4L0QA 1NQTA 5ILGA 4BKOA 3E9NA 1PJ3A 4NH4A 1MGOA 1SBYA 1F17A 2DBZA 3JQGB 3VPXA 4CLRA 1MC4A 4I8XA 5CDTA 2I3AA 4TRMA 5A3VA 4CLOA 2J5QA 3K5PA 2FPGA 4E5MA 3WFIA 1D7OA 3HZZA 2I9PA 3RWBA 1QYVA 1PQUA 2D5CA 1GEGA 3OF2A 3RROA 2LDBA 3OA0A 4CMKA 2NLOA 5HWSA 3JCZA 5F1KA 2F1KA 4LMRA 1M66A 2OZPA 2Q46A 3DBLA 1HKUA 1ZMOA 4RVHA 2NQ8A 4IIUA 2AMFA 4FFPA 5C37A 2XOXA 4X54A 4IS3A 4I5FA 1HSZA 3RSHA 4JBHA 4HP8A 4JBIA 5B37A 2YDXA 2RBEA 1B8PA 2CD9A 3VZRA 2AHRA 4FC7A 2H1SA 3DMTC 1BXGA 5JBIA 3KM0A 1K6XA 3GT0A 3BMCB 1PL7A 4TKLA 4CMHA 3IJRA 3SLGA 1WDMA 2WE7A 1PR3A 3PFFA 3FF4A 5A04A 3TFQA 1BVUA 2JAPA 5CDSA 3DBVO 4GGOA 1GYPA 4WCFB 1EK6A 3ASVA 4WE3A 3RKUA 1IYZA 4DBVO 1LDYA 4CMEA 4YXFA 4OL9A 3VPHA 5JO0A 3F1KA 4P4NA 3ZWVA 3EK2A 2AQ8A 4YJHB 2O3QA 1U5AA 3DOOA 3V2GA 3RIHA 4JP2A 5EQDA 1TEHA 4TRRA 3GGOA 5TS3A 3QWFA 3P7MA 5IZ4A 5IJZA 1SAYA 5A03A 1FF9A 2XPCA 4EEZA 5KKCA 4PLZA 2AW5A 1DPGA 3C85A 1DLIA 1SEVA 3FNFA 3ONFA 4HFRA 3GVCA 3QWIA 4BO5A 3CINA 1YB4A 4CM1A 4GLOA 1CJCA 1PSDA 4RPJA 3I6QA 1YQGA 4S3MA 4CM6A 4FBGA 1U9JA 5JC8A 1J4AA 4E2XA 1PZFA 4KQXA 3DAFA 1MXHA 2WM3A 4NI5A 5TF4A 1OBFO 1HDYA 2DBQA 1E3WA 1C0IA 4Y67A 3GFBA 3BZUA 4M86A 1E92A 1BXKA 3JQFC 3W8FA 2YV2A 3BHMA 2YZ7A 1LXCA 1LTHR 5JCXA 1P44A 2VYNA 2CDBA 4YAEA 5DDIP 4FGWA 1C1DA 4NBTA 1ENYA 1GY8A 2DC1A 4MVJI 1H9AA 1T2FA 4XYLA 4D7AA 2F00A 1FDTA 2HMUA 3KVOA 2Q50A 3NDRA 4QO7A 3K92A 2V6BA 3VTFA 2VT2A 5DP1A 3GN2A 4XR4A 1QSGA 1JVSA 4BKQA 2VYND 4R1TA 1LRKA 2P9EA 2AEJA 5EIOA 4JP3A 2PGDA 3PQEA 1WWKA 4D46A 4IZHA 4IXWA 4FDAA 4DLAA 1NPDA 1B2LA 1Z75A 2PFGA 5TT1A 5CAEA 4QFDA 5H82A 2VTDA 5L40A 2Q45A 4JCOA 4IZIA 3P19A 4IQ0A 3C1TA 1GZ6A 4IBOA 4YJDA 1O6ZA 2X5OA 1MG5A 1PJSA 2WEKA 3D4PA 3O8QA 4RDIA 1W73A 1ARZA 1GL3A 4Q3CA 3RBXA 1NWHA 2VWQA 3I9MA 5L4LA 1D4FA 2BLLA 1R0SA 1XQ6A 2EKLA 4XJTA 3PJFA 4YT2A 3H8VA 4PZDA 2JD0A 1O5IA 5G0SA 1CRWG 2WYUA 1EUDA 3T4XA 3VHRA 3W4IA 1OAAA 5CEJA 2E4AA 3F9IA 3AOEC 4B4WA 3GZNA 3NT4A 3W8DA 1IHXA 3E6AA 3JQEA 5DCYA 1TXGA 4J4BA 3JTMA 2JAHA 5TC4A 5DCWA 3CTMA 4HY3A 1LX6A 3DZFA 1BXZA
chains in the Genus database with same CATH superfamily
3SQLA 4RTLA 2DBYA 2YIJA 1R0CA 3W34A 5I7SA 3FB4A 2DUNA 5CYFA 1FP4B 1JFFB 3ZCQA 3LLUA 3L5OA 1YL7A 4JUCA 3PZRA 2DETA 1EESA 3SE7A 1PLKA 3FUCA 1N4DA 1YI0A 2XQJA 2R25B 4CTNA 1V16A 3CPSA 1J20A 2X2FA 1CFJA 1T1IA 2Z58A 5KJ1A 4CCAA 2EYQA 3OJEA 1Z47A 4P3XA 4Q3OA 2CJPA 1DDIA 1L7PA 2FG7C 4RUKA 4Z9XA 2HSZA 4FQ5A 3BRCA 1VTKA 2R4QA 3IB6A 4LMPA 2QRNA 3QY9A 4B3TB 2GFIA 2Q1XA 1HFJA 4NBUA 1NYTA 1GPWB 3VSEA 2X5XA 5BQOA 2JHCA 5HFJA 2QAIA 2YJTD 2X4DA 3SWWA 1GYQA 2BFBA 1RCTE 2BJWA 3VMMA 4YMGA 1P5RA 1NOIA 4RK1A 3DKPA 3JRWA 3NUZA 1F3LA 3Q98A 5C3UA 2VFAA 5AKGA 4CCYA 1S7CA 4IOMA 1RJ9A 1VPTA 1N8TA 2QV0A 1NVXQ 2IYTA 2UYOA 3HS3A 5DI3B 3DZIA 1NXXA 4EARA 5HHTA 1FFCA 3FOEC 5JEDA 3W06A 2FRDA 3V1NA 1J2JA 1QH9A 3RIYA 3KS9A 2XJ4A 3AUUA 4MULA 1UPCA 2I67A 2R5WA 5BNFA 4H31A 5K3BA 1FTGA 1DQNA 1GNRA 3ANLA 3PTZA 4IJVA 4UXIA 3ENWA 3TLZA 5JADA 1R16A 5CFZA 3IL2A 5CBKA 3U60B 4X7RA 4EH1A 3R9WA 1PT7A 4BXOA 1N7HA 4X1IB 2GPJA 5K8TA 1GGVA 2JGJA 1YASA 5DHSA 3VPCA 4BX2A 4ERNA 2O2EA 4I3GA 1XN1A 5MN5A 2G07A 3CKKA 3LHDA 4GBGA 1XVUA 3WISA 4CM7A 1L4UA 1AQUA 1ZI6A 3A06A 1UC4B 1XPOA 2KPOA 1PWHA 3N5KA 4JI4B 3MJRA 3RUPA 4UCFA 4F5EA 1MO5A 1O8CA 3G0DA 1CRPA 2B8TA 3R7LA 1JDSA 2CSUA 4FGJA 4PFSA 4QASA 2QR5A 3UY4A 4Q02A 1YVPA 3I2HA 2QT9A 4GI1A 3C1AA 4K03A 1UBGA 1E2LA 1X7ZB 1XD2B 1KU0A 5BQ5A 3TTVA 2ZJ8A 2R7MA 2A1IA 1SC1A 1ZXLA 4KXNA 1XZLA 4AS1A 2AZXA 3N5CA 1A76A 1OZGA 3IR5A 4JJ4A 5E7IA 2A57A 1G4AE 3OURA 2XCLA 2H5IA 2V7WA 3D6VA 1PG0A 4PPGA 4V0KA 2P75A 3H2YA 5T6BA 5AHKA 5KVSA 5FR2A 2ZT5A 4CM8B 2CBXA 5T57A 1P1FA 3Q72A 1F5NA 4L76A 4F4JA 4MCIA 3EMVA 1MV5A 3CLTC 3LBYA 3QGMA 3LPLA 3Q6IA 4EO7A 4RD3A 4YRJA 2FEKA 2H9IA 4FMCF 1H5QA 1U11A 1GZHB 2LIPA 3FKSD 2H1HA 3BMNA 3OM9A 4OHPA 4RYLA 1Z6QA 1NURA 1VZ3A 3N6RA 3BWBA 4WZ6A 4BLWA 4DZRA 4I1IA 4ZGWA 1LC0A 1BWSA 2OZLA 3JASB 5L6LB 2K87A 2JJMA 4MQ6A 1A77A 1HDRA 2B37A 3ELYA 3TZCA 2C1XA 8ADHA 3BL8A 2HK7A 3H2ZA 1WXHA 5KSPA 3N8HA 1RC1A 3SZLA 4ZDKA 3SC6A 1KZ6A 1HDGO 3KQMA 1RI3A 5EHGA 3JQDA 3RC3A 4OYLA 1ZD4A 2DR0A 2FSVA 5J2UF 4E7OA 2D2IA 2PUHA 1OXMA 1NM5C 1XT6A 4D3ZA 1RYMA 3EAFA 4INAA 5JQGA 2XDAA 3L8GA 3LRXA 4MP3A 2DUMA 4Z7QB 5B7GA 3R3UA 2N0SA 2ANCA 2X23A 2F9FA 3M7IA 5CJ2A 2A92A 1NIPA 3RRNA 4KKXB 2C88A 4HQNA 1FZTA 4HK4A 1W7AA 5HJ7A 2NAPA 3D1VA 1QIJA 7YASA 4G0VA 3LC1O 5A4IS 1YL6A 1W25A 2REBA 3PC7A 3VR6D 4RL4A 1RWWA 2C8LA 4WOPA 2HJ9A 1A71A 3CMCO 5JY1A 2B5VA 3E23A 1Z7BA 3CGGA 4WNIA 1L8OA 3DMFA 2FEXA 1VYVA 2Q62A 2AHOA 1DAGA 2QRKA 3C8MA 2WY2D 2R66A 3AI3A 4UUNA 1ZN2A 4M1QA 3AO0B 1JTEA 4HPJB 2YWXA 3HV2A 4X1YA 1R2QA 2Q9UA 4MLCA 4ZHQF 5HRAA 5JFOA 3A04A 4HUJA 4GLJA 1E9RA 1J2TA 5I4CA 3QQPA 3CG4A 4NH0A 1CG6A 1UT8A 2PCJA 4Y6SA 3RHTA 4IGEA 2HBYA 3G0GA 4ZJUA 4CKZA 4OO3A 4YO8A 1ZNYA 2YIMA 3F98A 4EA7A 5EFZA 3FFAA 1M33A 5ITVA 1M6WA 1S9DA 4D9FA 1GSOA 1FFWA 4EVIA 3UAYA 3BA1A 4B79A 3G9XA 2Z9DA 5DSXA 2GN2A 3FN4A 3LQ4A 3N2YA 1R0XA 3BH0A 2OBFA 3PUVA 4RA9A 4I50A 3NJ4A 4TQUS 1NX9A 3E7PA 5GIOE 3D81A 3TLGA 3ESBA 3ESCA 2P41A 2Q3LA 3FZEA 4P35A 2IHUA 3L8YA 4UHHA 3TDNA 5IXSA 5KTOA 3DLBA 1YZTA 3K09A 3WDLA 1BDJA 1MQAA 3GNQA 1E58A 1F0KA 3OVMA 4MV8A 2VYVA 1EU1A 5TNXA 4AZ0A 3GEMA 3LRTA 4JLBA 2GN1A 4NBRA 3SF0A 2PMKA 2W22A 3DLCA 3N6XA 5ED0A 1UXGA 4OQNA 5AW5A 3C5CA 5JTTA 5LZ2A 3AVXA 4GMXA 2ZRQA 1OHHA 3DQPA 2JJ1D 3GRZA 4OUKX 4E33A 2F62A 3IAEA 2SKCA 1KFCB 1JAIA 2V7QD 3PHLA 2J6BA 3M82A 2CLDX 3ZV4A 3IUNA 3OWXA 2Q5QA 1Z4KA 4GEGA 4N8SA 4B40A 1I13A 4RDXA 5IYZF 3AR7A 3CXUA 3A4MA 4HXYA 5LBTA 4YMVA 3FG9A 2FF7A 3I2IA 4UNIA 1DRUA 1M72A 2ILVA 4WA8A 4EG3A 2PTGA 3LHSA 4LYHA 5L3QB 5HPYB 3O8OA 3RJMA 1VJGA 2EBUA 2XZLA 3D3JA 2G6BA 4YCDA 1L5MA 4G1EB 1U02A 3PUYA 3JRXA 4KWCA 3V2IA 3ST7A 1G0NA 1JR3A 1Q77A 5D00A 3ELDA 3EVNA 4L5YA 1JHZA 1UF9A 1P1KA 2C3YA 2ISSD 4O4HA 2PX2A 1NQXA 4Q7JB 4WFIA 4XUCA 3H75A 5FD8A 4U00A 4AMBA 2BMEA 2Y9PB 3A2MA 3EHDA 3T7KA 1K06A 1C9KA 1V37A 1AQJA 1LGYA 4P86A 4OBEA 1NBEA 1EEHA 2M6LA 3PX7A 3AKZA 5DHAA 3VGJA 4HAWA 1YDEA 5LNK1 4YAJA 1LVGA 4ZVLA 2UVPB 4PQFA 1K6JA 1TKBA 2J4CA 3EF0A 2Z95A 1CQWA 3JAWA 4OJNA 3EY4A 2WIGA 3MFQA 5DP2A 4YJGA 1BD3A 1ZJYA 1Y42X 2OHHA 2PRYA 2QRLA 1FFHA 5D7NA 2YIDA 3FFXA 2MR6A 1M7BA 4HZUB 1SHLA 5DEOA 1WQ4A 2ZITA 2LV8A 1GKIA 2YY7A 2Z1NA 3HUEA 4B46A 4BQIA 1P2DA 4UU7A 3GD7A 1USUA 1Z8DA 4M9ZA 5AW3A 4DV4B 4ZQHA 3ICQB 2IGBA 1PEDA 4QBIA 4U2KA 4ZT5A 3VTAA 3FCSB 2C1EA 5HIKA 2Y76A 2DU8A 5ECYA 3AY6A 1MZPA 2ZJ2A 2YJ5A 3T3EA 4E13A 2PD6A 1KI1A 2EZ9A 2YZGA 1LBIA 1R6AA 3OZVA 4E94A 3CCCA 2I8AA 4QUKA 3PC2A 4BNVA 3FYUA 3QVXA 4EG1A 4BO9A 4CF4A 3D5TA 1IOZA 4AMGA 1N5IA 2QLNA 1NATA 1S2LA 4H4DA 5JZVA 1NE2A 4AJKA 2I62A 4QZVA 1I4TD 2JIZA 2R1TB 4RBNA 2BHSA 1X2EA 2GK7A 3PFNA 3RRZA 2KI5A 1PWXA 2W0MA 1V5GA 2BMVA 1YA4A 2DFLA 3NHPA 4L8WB 3LDFA 4U5XA 1TC1A 4J6FA 3IP1A 4YJFA 3JZAA 4RKFA 1Y8QB 1EH5A 2GD2A 3K73O 4DCSA 2WHPB 3KTDA 3SQMA 1L5OA 1IUNA 1LBTA 5EZSA 2Z2YA 5BV7A 1A5TA 1ONBA 4KN6A 1GILA 1FFSA 1OX4B 1FPQA 1RKBA 1ADYA 4KLCA 3EWAA 4N0DA 2D1QA 1YUBA 4EJ2A 5BURA 4AKHA 1MCZA 5JMPA 1W0CA 4XVQA 4TMXA 3ZE0B 4WY8A 2L18A 821PA 3M4NA 3ECSA 3A7DA 3DDNA 4Q1AA 4KZPA 2NT3A 3B6IA 2J9XB 3JATA 4KIJA 2CJWA 4YRSA 3D0KA 4EDFA 4RY9A 4JXKA 2OQ2A 4NMXB 2EBFX 4BE4A 1VOTA 4JGBA 4OL0A 2AI3A 3GJ6A 1WMSA 4J4TA 5HQJA 3UWSA 1CBUA 1U1FA 5IJ9B 1WP4A 2C4NA 3WBFA 5J5CA 3AR5A 3WKBA 2V6GA 5AKLA 1ECBA 2CNBA 4CUZA 3DBRB 2GSWA 4HJXA 2GARA 2Z04A 4R2WA 4BUCA 4QQ8A 4V0OA 3IAHA 1T5BA 1RABA 4F4HA 3OTHA 3KB6A 4HI0E 4HSGA 3GLGE 4B35A 1XK6A 2BJVA 4V0MA 1CE8A 2IOFA 2QUZA 2I6XA 1KI6B 3L8FA 4N3CA 2R5NA 1P4GA 1XQWA 3ENVA 5G1NA 1U4NA 3L82B 2V8OA 3BBLA 3IE1A 2Q0QA 1AQYA 1R6BX 3EDRA 1PFUA 1KJNA 2Y0EA 3I5AA 3L2OB 4PAWA 3MINA 3KELA 3V1KA 4BMNA 3K0AA 2WJJA 2OFXA 4EB3A 1RRGA 2AGVA 4OGWA 4D92A 2PGOA 4FYHA 1W2HA 3GPBA 4JY7A 5AVYA 5FWDA 3WYNA 3FPGA 2XUKA 5HE9A 1E1CB 3QJ5A 3L1IA 3KQQA 4QGHA 5LMUB 2O8CB 1FX1A 3Q3JB 2JKZA 1T9BA 1P3Y1 5DHQA 5EUMA 3JQ8B 4LRQA 4WKCA 4E5YA 4KJZA 3AHEA 1V5WA 1CQZA 1CYDA 2AFHE 3Q9SA 4TMTA 3VPAA 4F2WA 1V6AA 3O92A 2JFVA 3QKIA 4PFJA 5F78A 5IKEA 1PEAA 4IX9A 1FCJA 3DOUA 5TPWA 5DBFA 1DARA 3TAXA 4B7XA 4YRAA 1DXQA 3KQYA 3QFHA 4TKVB 4LWQA 3PJGA 1DUSA 3H5OA 2ODWA 2L2QA 2LVBA 5FOTA 2HMYB 4FYKA 5CEEA 4FONA 3MRVA 3GEPA 1VL2A 4TTIA 5AXDA 3T4PA 5KPJA 1IEVA 3EB9A 4ZOLA 4PSCA 1N9ZA 4BPRA 3T5PA 3THSA 3AUYA 5KC9A 4IDOA 2BGJA 5FEMA 4PC1A 3H1BA 2OGWA 2VF4X 1YD7A 2QD2A 4ZICA 1DV1A 3JQGA 2OHOA 1HE5A 3TJMA 3FPAA 1CUGA 4TLMB 3IELA 2FR1A 2V7TA 1XQXA 3UATA 4F21A 5GADl 3FCOA 4F97A 1G9XA 1SXJC 3CIFA 3WGTA 3JV7A 1TVCA 1R4MA 1CR2A 3HJCA 3GEIA 4YQZA 1OC2A 4QBHA 3VKVA 1SXQA 2O5EA 1BAPA 3CRNA 1H1LB 1C0PA 3DV9A 3JQ6A 3TW8B 3VBEA 2QRVB 3ZHCA 1L4BA 3C0KA 3BULA 3B7GA 3DEYX 3VVCA 4F93B 5IKMA 4WV3A 5E1OA 1JBQA 4S24A 1KY2A 3EQ6A 3NTQA 3ZR4B 1KPIA 2ZJBA 2ZUDA 1WUIS 4OSEA 5GV8A 1E6UA 5I9LA 5FOXA 2DXIA 5JASA 1V25A 4K1XA 4Q93A 2FEWB 2HFKA 1KSJA 2VZ9A 3Q8KA 2GAIA 2GXSA 4FSDA 2J0VA 5DK6A 2Q7DA 3RR2A 4EAAA 8LDHA 5AUNB 4RSGA 4E3ZA 3Q6MA 1EVQA 3DH0A 4HC4A 4DIBA 3NO4A 5BN5A 2Q0SA 3DMRA 1OR8A 1K6MA 4DMFA 1FBTA 3IOYA 4X8MA 2FWPA 3MOSA 2HJWA 4TSKA 1T43A 5D87A 3BMCA 4F2HA 1JQ5A 2HCRA 2J9FA 4FMBB 4Y9SA 2ZCJA 1Y37A 5BSHA 1GIAA 2H2DA 4LE1A 1K63A 1ML3A 5BNWA 3PLAE 1WVGA 2R1UA 1ZW6A 3JX9A 3S2IA 3OTOB 3EPKA 3GY0A 3VTKA 3JD4A 5KTNA 4JK3A 3Q11A 3V8NA 4WCFA 5BW6B 4KFSA 2AMLA 3RS2A 1LNQA 1OW3B 1WB4A 4HVTA 3DZHA 1CIJA 2HBQA 4F1KA 1UMBB 3T7SA 2CN1A 3UOWA 1VLHA 1TAUA 3NGXA 4HZIA 3NHLA 2OP0A 4BAUA 2VP9A 4ZEWA 4H7JA 3MOIA 5J5VA 1LPPA 521PA 4A92A 1OIWA 1ZVKA 4Q24A 3WE7A 1VFPA 2CK3A 4PZUA 4BEVA 3N07A 4BMYA 1CQXA 3AFHA 5F4ZA 2Z08A 3WLAA 4NESA 1Z34A 3WMFA 5C5CA 1L2TA 2O6LA 5EP4A 1JBEA 3O38A 4TQAA 4YRMA 4W63A 2ZTHA 2A3RA 1V1RA 4D9EA 3HDTA 3BEOA 3RYCB 1DT3A 2CL6X 1OF1A 2H57A 5B6JA 2PMFA 1PGJA 1IWBB 2B4AA 1JPUA 3O9MA 3TTYA 2RONA 5GGYA 3ILXA 3CNEA 4ER7A 4QTTB 9MHTA 3KX2A 2ECOA 5DX8A 4AJLA 2JAOA 4WZBA 4EF4A 4HDKA 1ZEMA 5FH9A 3PE3A 1NQUA 3L3BA 5IC5A 1NRJB 2V7XA 4DCOA 4E2ZA 5EIWA 1YR1A 3S2ZA 1FP7A 4NCKA 4RFSB 2BW0A 4BS9A 2X0NA 4L75A 3C6XA 5HCNA 2GBGA 1POXA 3GLHE 2OV1A 1DX9A 2WUVA 2YS6A 4BX9A 1QBKC 3RS8A 3ICPA 1P4JA 3WDMA 1KP3A 1EX1A 5K3FA 4YRBA 1EVKA 4KIFA 5AW8A 1DXYA 1E2HA 1I24A 1YL5A 2A9PA 2UUOA 5DNDA 3RSLA 2LTAA 3GZ4A 1LS6A 4S1OA 2HXGA 2C9MA 1QFXA 3RVRA 1BMFA 4WLUA 1NVWQ 2CJXA 3G7UA 3RPEA 3UEOA 1JZTA 1PL8A 2JANA 3AFMA 4GM0A 1W29A 1ECJA 1JQBA 4H0NA 3AOGA 3OJWA 4XUGB 1Z26A 1WOMA 3PQ5A 1T9ZA 1IHDA 2P77A 2PTHA 3GBPA 1Q0PA 3H4TA 2TSYB 3QPUA 5F1YA 3TFOA 4WBNB 2Q0HA 2NU9A 4TT3A 3OJOA 3IQWA 4WVLA 1W48A 4OLAA 1T4CB 1LQUA 2ORWA 4PTZA 3AONB 3IEIA 1UJBA 1NRWA 4MGIR 4MTCA 2X4LA 4Q3LA 4UAVA 1VJCA 1OFTA 5KYXB 2HV9A 2DLCX 3O2SB 2Z1DA 3UCEA 4NE2A 2RHRA 4RK5A 5LYJA 4RFVA 3RSZA 1P29A 5KINB 1KRXA 1N5LA 3T9EA 4RGVA 1HEIA 2ZCVA 1UXJA 3E7FA 4PZAA 3GLHA 1EK1A 1WMAA 1Y1KE 2ODTX 4LI0A 5D01A 4Y2TA 3NASA 5EHXA 1ZSNA 3NTRA 1VQ1A 4OYRA 2VDJA 2Y27A 3ZUPA 3TQCA 1M6VA 1X1CA 1L1EA 3ZY5A 4CDGA 1SQ5A 2PVCA 4FE3A 4OMDA 4URVR 1TMKA 5FYQA 2IK8A 3MNFA 4TS1A 1YDFA 1TB4A 1Z6GA 4UNQA 2WDPA 1ZKMA 4QLBA 5KNCA 4LY0A 1KP9A 3EUAA 2PGIA 5JD3A 2HRCA 4YV0A 1H2YA 1E4EA 1E7SA 2ACKA 1BG6A 4LWOA 4YACA 3AHJA 1EZ4A 5K0TA 1GU0A 3SNKA 3H2SA 4Y30A 2ZTUA 3TTXA 3NWBA 4WCVA 1WX1A 4OCZA 5CRIA 4LRSB 1MENA 2A5FA 4X1KB 2QVBA 4A0RA 3ZHUA 1XXLA 4C2TA 2J5XA 1J8VA 4Q9JA 4LZOA 2HYDA 3T1QA 2FRDC 4A03A 2AK3A 5J23A 4D25A 3PP8A 4GR4A 1CUWA 4RE6A 5A1TA 1HV8A 3NHBA 2IYEA 4K05A 1TQ4A 1QO0A 4X84A 1EXVA 2OWDA 1T2CA 1E96A 3ITEA 2V0NA 2E4UA 1EIWA 3LZ6A 1K7SN 4DF3A 1V7ZA 1SQ0A 2VH2A 5EQFA 4BGVA 5CMLA 1PI3A 4HGOA 1ZM3A 1PG2A 2IHYA 1G5FA 1NI4B 2AWOA 4N0QA 3VC7A 2FZWA 2AMYA 4DE5A 1Z0SA 2VNHA 3BAFA 1JIJA 1XXHE 3PDIB 3ZE6A 1X7WB 3KKPA 1Q7RA 3ZKWA 3A28A 4FR5A 1RBYA 2VUSA 2WU3A 4CFYA 1WXWA 3BQMB 4MIEA 4PHHA 4BLTA 2EWWA 2W6CX 1U4OA 4COOA 2C78A 1I2BA 1XTBA 2P9YA 1COZA 1M10A 1N9GB 1OIXA 1SVSA 4C6TA 4FM9A 3OMXA 1PDWA 3KT0A 5AK0A 1JEAA 2UYCA 5TF0A 2HQ1A 1N1EA 1LDGA 3N2GA 4Y0AA 5FWXB 3EPPA 3HG7A 3K6SB 2ZSEA 1KMCA 2B69A 2WJ4A 2YFHA 4K1LA 5JQWA 1OH6A 1Y1PA 1AUPA 1CXZA 1LSSA 2CNWA 2QAGA 2R86A 2Y4OA 2ZJ1A 3DT8A 4EUNA 4KNVA 3HXOA 2ZOSA 3QNUA 5LM3A 3PHBE 2NO5A 4DTCA 4P08A 4MITA 5CCBA 3UAWA 4FZ3A 5H9WA 1ZGAA 5CM9C 5KHOC 3U09A 1KY5A 3DCYA 2ZUTA 5ANRB 1XXHA 1PFWA 4JBNA 5HILA 1T9DA 3UPTA 5T4EA 5CHYA 4A0SA 1Q6YA 1E9DA 1E3MA 2JB9A 2ZSBA 3E27A 3M6VA 4ER0A 5E2IA 1NRXA 2VQSA 1BGXT 1TU3A 2B8WA 2OO3A 3AKYA 1M2OB 3IPRA 5EP3A 3W6UA 2OGTA 5LN1A 3AU8A 1IRXA 2W6JD 3O8QB 2GH1A 3ZHVA 4LJYA 2A0WA 4GZMA 4KQ6A 3DBHA 3KHUA 4PBSA 4EGSA 2ERXA 2IPMA 2YNMD 4A2WA 4ZYYA 3IPCA 1H4TA 1U9ZA 2D59A 3TBKA 4RORA 3TZLA 3WJ7A 2FSVC 1ATZA 1WUJS 3ER8A 2PKYX 1IBKB 4TKZA 2C4VA 4L74A 1J1ZA 1XZPA 4TMZA 5K2MA 3S40A 4N5NA 3THYB 4OHBA 4BO4A 2VP2A 3NOQA 1D4ZA 2RI1A 2EKQA 1ODLA 5ERXA 3ND5A 2QY9A 4XIJA 4G5FA 3RC7A 1UK8A 2H7CA 1T0IA 1F38A 2AKYA 3D54D 1NY5A 3IPAA 3PL1A 1ZLYA 4G24A 4G5HA 3M4ZA 3O4FA 3UT5A 4EGQA 1XDZA 5DNCA 5L8VA 2H2WA 3NPMA 2QTBA 1VKOA 5HOEA 2WHEA 1T10A 1LD3A 4F7DA 5JAZA 5EZQA 4N5LA 4EKEA 1EEXB 1KK0A 4PF1A 2PKWA 4I1UA 4HFNA 4N47A 5EERA 1ECPA 2PR7A 4WEOA 1LWOA 2DJIA 4WLNA 3TRIA 4YUZA 5I45A 1ZRMA 2NMVA 2I71A 1IL0A 4HEA1 1N6NA 4R1UA 1LDMA 5JXWA 5BN3B 1E0DA 1WU8A 3WX0A 5A06A 3VKHA 3GJSA 5CVDA 3SIXA 3BGDA 1J5PA 3BK1A 4U2FA 4LXYA 5SY4A 4C7OB 4IILA 8MHTA 1G1MA 2GJ9A 1J0BA 2FAXA 3DXFA 4M9CA 4AUKA 1SR8A 1UJ6A 1MAHA 1Y5MA 1JZQA 1VJDA 2NSYA 1I0ZA 3ILYA 4L7VA 1V26A 3DTVA 4UDNA 4QXAA 1PR5A 3NANA 1NVUQ 3V34A 3DEJA 1K8QA 2YV3A 1KORA 2BFCA 4F6LA 3THWB 2QT0A 2VHWA 2BGUA 1JFLA 2RBKA 2ZTVA 1MOZA 3N28A 4UD6A 1GU1A 1W19A 4NNJA 2FOIA 2HREA 5BR4A 2CC2A 1FS4A 4M87A 4Q1BA 1N0HA 4BRWA 5C32A 3KQUA 4JMPA 4QC2A 3TB6A 4CHGA 1EG2A 2P1DA 3IJEB 4EMTA 3RH0A 5A5VA 1GGNA 3BTOA 1KAOA 1WABA 4JSRA 5TQ2A 1L7AA 2QW0X 1PVVA 3O03A 4TRJA 2XMGA 3UGTA 1U81A 3QLVA 4TKUB 4RIIA 3KAQA 3NX4A 4L8GA 5CB0A 4QVIA 1DELA 3N39C 3I9V6 5KQMA 3CW8X 2B2XA 2QQGA 1QU2A 3GT4A 5JCJA 3HC7A 4QNRA 5AHXA 3TO5A 3M2TA 621PA 1JLRA 1QS0A 2HMAA 3FUWA 1W4AA 4OQDA 3ROKA 2WF9A 1N3YA 2ZIVB 2G9RA 1D07A 1R10A 3G7SA 4FEAA 3SK0A 1A82A 2YXNA 3ICOA 1A8IA 1PZXA 5B53A 4K7JA 1I9GA 4XGKA 3VI4B 2GR9A 3U3DA 4R98A 2R7KA 4LX8A 2CGEA 4X8LA 5FPPA 4QOSA 3ZQJA 1DKUA 1C3EA 1NMYA 2WB2A 7GPBA 2ZI3A 2B4TO 3DE6X 5DHRA 2BCGY 1NHWA 3A6ZA 3B85A 5HCUA 3G2OA 1M1ZA 3IS3A 2HMTA 4OHXA 3SHOA 4R1LA 1R12A 3OAAA 3F4LA 1RP1A 1SD1A 2QRHA 3NBUA 4NJOA 4Y9RA 4EOGA 1SEPA 2DTXA 3AB7A 3VH1A 2ZS8A 4DC9A 1WNTA 1Y6ZA 4TN1A 4CUKA 3O26A 3KC2A 4URUR 2QV7A 1UZAA 3TL3A 2CE7A 2V03A 3H17A 4ZO6A 5L4NA 3OE1A 5EA2A 2OM6A 2XSZA 4RIEA 1LNZA 1E3EA 1XD8A 2XUOA 3SZ3A 5KNBD 5LZ5A 1LSJA 1FYDA 1UOOA 1X9IA 2ID9A 4ND8B 1YFLA 3SGLA 4QYIA 3N59A 4G8JA 1W4ZA 2G63A 2BEVB 4TMYA 5LBIA 3JYOA 4UD2A 3R7AA 2E5FA 4C1BA 2HO4A 1VBMA 3QKRB 4X7BA 1ONSA 4XD7D 3UWKA 3UW3A 1NTRA 2JGFA 1SG9A 1N36B 2ABWA 4EFKA 1XA0A 4H77A 1FE8A 3HBNA 2H1VA 3E53A 3EXFA 4FW9A 1EINA 5D6NA 1ZNXA 1YHNA 4F3TA 1SD2A 1PK9A 1X80A 4OU4A 2AXEA 2ZBEA 3FHLA 3NXKA 1PLLA 5CEFA 1E2JA 5G53C 5H8WA 5DEIA 2YV5A 3RQSA 1HDZA 2G4VA 4LTDA 4R8RA 1R50A 4PX9A 4QBGB 3RJ5A 2A0FA 3EVBA 5DLEA 3V8PA 4PHTA 3LQFA 2PQ6A 3V3TA 1FYXA 3LUAA 3IALA 3K0EA 4K9LA 1UMKA 1W0KD 3F4BA 4D9NA 2XNDA 5BW4A 3S5JA 1LRJA 4HAUA 3WG9A 4X8OA 5IX8A 4W1QA 2ID8A 1EHYA 2DWOA 4A8JA 3FX2A 1WVIA 3TIVA 2B4YA 5EZYF 5L7YA 4OYHA 3QKTA 3E22B 5E95A 4A27A 5HZGA 1PKEA 3P5BA 5FPSA 1PV1A 1REQB 3JSAA 2K7ZA 5TQJA 5KTPA 1B76A 4YEDA 3MWYW 3ZU4A 1GPBA 2HIGA 3K1YA 2FSUA 1VBNA 4I4LA 3WQHA 2ZJ0A 3BTVA 3F6SA 3HPQA 3PCTA 5EPOA 3RSCA 4E31A 3I61A 4KAXA 1JP7A 4E4TA 2AN5A 3RVOA 1NJSA 1FFXB 4M88A 5B2ZA 5G0TA 3O31A 4AO7A 3CEPB 1M3SA 1X8KA 4BO3A 6ADHA 5DLQC 2P2DA 4Q39A 4AICA 1OLSA 3ND8A 4ZYVA 4TUYB 4PNEA 4KJXA 4L4ZA 1P2BA 4U2CA 2DH5A 1C30A 1Z0KA 4Q4JB 3BWXA 2VRCA 3I52A 5COQA 1TKAA 3H2GA 1XIVA 4YCSA 4FN5A 5JNUA 4MRMA 1E7WA 2OP1A 4EZBA 4ZCPA 4W8OA 1ODTC 2V7BA 4BMXA 2DCUA 4I4TF 4JVOA 3N74A 1ENZA 2DSTA 1OBVA 4NV1A 2QIPA 4UDXX 3RJZA 1JA0A 2HU5A 3HZRA 2D0PB 2O6HA 2H7XA 2I5PO 3FI0A 3L1UA 3LC7O 4ZVOA 3SXJA 3WAKA 4TT8A 5BSEA 2AK2A 1Z13A 4BGEA 1ES9A 1HH4A 5A9SA 1TW3A 1PS8A 5C81A 2J48A 3LNCA 3W1VA 4UOEA 5KQLA 1CS0A 4KWHA 4N3NA 4C5AA 2OBNA 5AK3A 1XEXB 2AR7A 3AF6A 1IJBA 3M6XA 2X0FA 2QTLA 2OEPA 3EDMA 1UM8A 3IODA 1S2IA 1PX0A 1VL0A 1DKMA 1GQYA 1NUTA 2QTAA 2XW6A 2YMMA 3G1WA 4G5XA 5AQEA 1N77A 3RD5A 4A6PA 4M7OA 3HXPA 4UE6A 2A9RA 2CBZA 3MTEA 4PZEA 1V7QA 2FUKA 4KDFA 1UMCB 1TOAA 1XF9A 3A4VA 4NYIQ 1GUAA 1YRHA 3GLKA 4NY1A 4YFYA 1IM5A 2C82A 3ZLUA 3ZVNA 2CDAA 1BU8A 4ABYA 3IQDB 3DC2A 3E9ZA 2Q99A 1N32B 1AJEA 2X3YA 3H5RA 3P9QA 4HWTA 3V8MA 1C8LA 5K4AA 5IG2A 2REXB 5IFLA 3W9UA 3L18A 4F5DA 3OIGA 4CKBA 1AA9A 1EAYA 3P0FA 3PNMA 4JLSA 4ACBA 5HKLA 4EA8A 2P6OA 4EO4A 3RFCA 3A26A 2K4MA 3DZCA 3K9LA 5IULC 4AG6A 5JNSA 3TDMA 3KWFA 3N0RA 1TCBA 1MOSA 2AYZA 3QEMB 3HKBB 3WZ2A 2F3SA 1LDBA 5K8IA 4KE8A 4MKGA 3K30A 4F9TA 3QRWA 1PTKA 5CVTA 1V8DA 1SBIA 2XYVA 1H9BA 1BH6A 1KXZA 2BP7B 4J90A 4M53A 5DH9A 4EPWA 5TVGA 4TLEA 2X1HA 1C9JA 1YB2A 1AGNA 2JAUA 4BYMA 2CF6A 4R8VA 4L5JA 3CFYA 1TM1E 1QRUA 4TXHA 1KMQA 5HJEA 3ILSA 2H3EA 5IVPA 4AG5A 1XL1A 3A9WA 1DBPA 1AF4A 3NRCA 3EWNA 4ME6A 2OQIA 4R54A 5SZHB 1JDNA 2Z2KA 3FCCA 4KQHA 5AM5A 1UEIA 1KO1A 2PMBA 3PQ6A 1QHHB 5CJPA 3ABIA 3L9WA 4UBKA 3GIDA 1RXSA 2F1RA 2YCLA 1XAJA 4UAUA 3FR7A 1T6NA 2I8CA 3SDSA 2GF9A 3DNFA 3FAKA 3PENA 4FGUA 4CFSA 1W1WA 3DVRX 3F2IA 2DEUA 1M76A 2A88A 3E18A 5DX1A 2X3UA 1Q91A 5DK4A 3EPHA 2DM6A 4LFBB 1HL7A 3NXSA 3LK6A 2YHAA 3IDAA 5L53A 3T5AA 1V5FA 4S1NA 2WT8A 2WWIA 2CFIA 2ECPA 2Q3BA 4YX9A 5EKUA 2QTFA 2MMCA 1G5RA 3ZY6A 3U4QB 3HVKA 3SR0A 1U3GA 4NLLA 4MUBA 2BSAA 5LA6F 2X4GA 2ZYRA 3QWHA 1GZ4A 1YK1A 4J7UA 2DWQA 2J3JA 4PN7A 1II8B 1RHKA 4F3CA 4IUBS 5BRJA 1K1EA 5A5GA 5JD6A 3DLIA 2C84A 3EH1A 1RWBA 9LDBA 4XVHA 3VDQA 1T5TA 4X61A 2C4HA 2FPIA 5CPBA 4I99A 3O4IA 5IAAA 5TMDA 5BRNA 3JYLA 1U8YA 4JGGA 4WCFC 5U4XA 4PWYA 5ICCA 4RAOA 2GYUA 3PICA 4AJOA 2C5SA 2PWPA 3W5AA 3H1TA 1AK1A 4NJMA 5ETJA 3DPIA 1KAEA 4XVRA 1XEWX 3ZGXA 1WPQA 4TUYF 3TTTA 4H7DA 3OUZA 5DISB 3GLUA 1LLUA 3FUXA 4FFBA 2JBWA 3WQSB 2AOTB 3FKJA 4ZRNA 3HK2A 1XQ9A 5JSZB 4LJRA 4L50A 1WM1A 1TA0A 1UDCA 2IE0A 5A0FA 1JZSA 2PSFA 2SCUB 3MSXA 1EFLA 3TLEA 3KYDA 2PRZA 3NTVA 4IIFA 4LHEA 2HA7A 2EG5A 1M34E 5FTJA 1ZY2A 2PZAA 3CTPA 5TDHA 1M5RA 2IZ0A 3WGYA 3IFSA 4JI8B 2NV6A 1UK7A 1Z28A 4P4UA 3O3CA 4JN6B 3REQB 5K5EA 1QGYA 4J7XA 1KI3A 3KB1A 3I62A 3U4CA 1DOHA 2QE7D 3AY3A 2BTQA 1GRNA 1YJAA 3BMQB 3G2NA 4L0MA 1CUZA 1HQYE 3LX4A 2Z30A 4A9AA 2BF4A 3FDZA 3S2FA 4B83A 1V48A 4RCVA 2IYOA 1JQEA 1SOWA 5CG2A 4BJHB 1ORRA 2QOEA 4Q1CA 3EVCA 4UQPA 5C35A 4UUAA 3W4KA 2O50A 3QBJA 4PR0A 4BFWA 4EZIA 4MH0R 2CXPA 4PAOA 3DWIA 5HYVA 4HAOA 3FVVA 3WWCA 4B6OA 4LBVA 2XLCA 2C3UA 4IDNA 4S1TA 4EP1A 5KNDH 2AUMA 4AY6A 3HADA 1IWOA 3QXHA 3KE9A 1XTZA 2NWQA 3EQ9A 4R81A 4DXAA 4EMUA 4ZGBA 2ECKA 4GKKB 2O1WA 1N8SA 2YZ2A 2QPOA 2I99A 1ULTA 4KVAA 4D79A 2JRCA 2WJAA 2B82A 4YJKA 4I5EA 2BBOA 5CNIA 3LYHA 1SXGA 3SYMA 5GONB 4I0WB 3V4ZA 1CUVA 1R4NA 2FPOA 4IDHA 4Q3BA 5FKJA 4BCDA 4C3ZA 3DT6A 4PZ0A 2EZTA 3PFIA 2P9CA 3ISTA 4IGKA 4S12A 3W2TA 1V35A 5KOYA 4ZCMA 5UKDA 1E8MA 3N0WA 1FY2A 1ZIOA 3GP3A 4O4IF 5FJJA 5CA0A 1GXSA 3LI2A 4JI6B 4ARAA 4ZJZA 3IUQA 3AM4A 3RTEA 4U0KA 2GS9A 2PUCA 2LNDA 5CYOA 4ZEXA 4MR8B 1B0ZA 2CUZA 5TV2A 3VC3A 4QBFA 3MMPA 3R0VA 4XIFA 3U4MA 3ZWWA 3U9SA 2CHGA 2FSHA 4I1VA 3U31A 1UANA 4GIBA 2PUVA 1CY8A 5CXQA 4UMFA 3UPUA 3C7AA 1HRKA 4NQRA 3PLNA 4JQYA 2NNLD 1DX4A 4WLVA 2AYYA 2ZB3A 1AQ6A 3VDRA 4DWOA 3I1IA 4GGPA 5HZMA 4ZARA 2XMZA 2H4YA 2GX6A 3UXMA 4ZVSA 3UGQA 5B7QA 1EVZA 2AG6A 3E9EA 3GGDA 2IY9A 2X0KA 2Y66A 1T1SA 3L93A 4M0FA 2C31A 4Q82A 4EFNA 4RSRA 1E1QA 3ED5A 3HVRA 2VBGA 4O3FA 1T36B 3K94A 3DWGA 1R0RE 4HTFA 1RHRA 1GV1A 2XMDA 1E8NA 3F5FA 1P1HA 1BN7A 3WK8A 4B73A 3QEAZ 4JODA 2Y0CA 3FIJA 3GDWA 4DQXA 5KVCA 2VRNA 4YRTA 3PSAA 5KJEA 1XRQA 4PCLA 1IY0A 4L5CA 4Q4LA 2F3UA 1O0SA 4U2EA 4LSMA 5A2GA 1ZBQA 4C0BA 3ZNOA 1N8NA 4G4IA 4P8RA 1IXYA 3D2BA 2XMRA 4F8EA 1XNGA 1A04A 4Y9UA 4HDMA 5EE1A 5F51A 2IXGA 3TGWA 3EVAA 4IDFA 3E1SA 4GECA 2BKAA 3O4RA 5JPCA 2G0AA 1X1QA 2QTWB 3IKJA 3KT8A 5CH5A 4BLRA 1CULC 3DXYA 5LD2C 2OOSA 3C3YA 3O1HB 3M5PA 1E20A 3B1ZA 1M5UA 4NNOA 3C6YA 2P4HX 2SECE 2VHQA 3FUVA 4BNDA 2PAAA 2QD3A 1XTRA 1PR6A 3GJTA 4I3FA 4JR2A 1EGHA 3GRYA 3QVUA 3T1OA 5EYPB 1T9HA 4F92B 4FEYA 4LHZA 1YI1A 1IBLB 2PBRA 5B1DA 1IZYA 1LQ2A 2X1MA 4FDVA 1W2GA 1ZVQA 1M1YE 3WGLA 1HE4A 1JN0A 1IBCA 2AI1A 2JEZA 1U8UA 4RQAA 4V0NA 4FE4A 3ZKAA 5IJ0B 3X1JA 1V71A 1E3SA 5AI6A 2WU4A 2H8GA 5IBPA 3WV4A 4CW7A 4EG8A 4CLRB 4JYBA 3ISVA 1JPVA 3FTNA 1KZ1A 3BCSA 1IRIA 4ZCRA 5IABA 1OBOA 5KJ6A 4TWJA 3AV0B 2QQ0A 3ELBA 1TCVA 1B3BA 3H11A 4WY2A 3E7DA 2IU3A 2QYSA 4DMMA 4EHJA 3U4QA 1Y0BA 3JVEA 3MWJA 3K8QA 4FUQA 1MOQA 1MJ5A 4B3GA 2FWBA 3I45A 1D3AA 1IBSA 4WXMA 3L7BA 5LDGA 2WZBA 4MZDA 4WD3A 5B58C 4DB2A 4KC0A 4XX0A 5AK5A 2BZ1A 4BKPA 4IGFA 3VH3A 3SKYA 1GTG1 2GBPA 3ZZMA 1H4VB 3QVTA 5J59A 1ECCA 4Y6QA 2FWRA 2PSDA 1Q22A 1MB2A 1NT4A 2D2FA 3QUCA 3HJBA 3KJFA 4XRRA 3TCNA 4CKXA 2Z6QA 1C3OB 4LAFA 2PA0A 1GRCA 1E77A 1QRAA 5K8VA 4EY4A 1EUZA 3QWBA 5DZSA 4TYQA 2GYVA 1BVHA 3W7BA 1T4GA 2XTMA 1JLHA 5LJLA 3UPDA 4DVGA 7MDHA 3PA6A 4BX3A 1WY5A 1D2CA 3EPJA 2QPTA 5HX7A 4JS0A 3CUWA 1EDZA 2J5RA 5J47A 5IJXA 1NMQA 1N3BA 2VT7A 3G2MA 3V4VB 2GM4A 1QX3A 4IIEA 3HDJA 2O8BB 1XA4A 2BEJA 3KUDA 3TQFA 4D3SA 1U90A 3UK0A 2Z6UA 4RLFA 1E61A 4K2AA 1T91A 2CVOA 2HLDD 4TTPA 1NJ1A 5ABPA 2TECE 5J1SB 4WUVA 2C83A 1FFEA 1GFSA 1EB8A 1TUGA 4YMLA 3H9QA 5F9HA 2JIDA 4N4AA 3WRYA 4EELA 4G1VA 3LH5A 1SXJB 4MPPA 2OB1A 3UGKA 1A88A