3W6XA

Yeast n-acetyltransferase mpr1 in complex with chop
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
225
structure length
225
Chain Sequence
b'SIEWKLTANLRNGPTFFQPLADSIEPLQFKLIGSDTVATAFPVFDTKYIPDSLINYLFKLFNLEIESGKTYPQLHSLTKQGFLNYWFHSFAVVVLQTDEKFIQDNQDWNSVLLGTFYIKPNYAPRCSHNCNAGFLVNGAHRGQKVGYRLAQVYLNWAPLLGYKYSIFNLVFVTNQASWKIWDKLNFQRIGLVPHAGILNGFSEPVDAIIYGKDLTKIEPEFLSME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MPR1 protein
molecule tags Transferase
source organism Saccharomyces cerevisiae
publication title Structural and functional analysis of the yeast N-acetyltransferase Mpr1 involved in oxidative stress tolerance via proline metabolism
pubmed doi rcsb
total genus 63
structure length 225
sequence length 225
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.271: L-glutamate-5-semialdehyde N-acetyltransferase.
pdb deposition date 2013-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3w6xA00
2AJ6A 3TFYA 2FL4A 1Q2YA 4Y49C 5J8CA 2JDCA 2JLMA 5KTCA 3DSBA 1NMTA 1J4JA 3S6KA 2EUIA 4B5PB 4IF5A 2PDOA 2HQYA 5JPHA 4K30A 5E96A 1UFHA 2OZHA 3BLNA 3PGPA 3C26A 4MJ8A 4RS2A 4U9YA 3FRMA 4PSXA 1S7FA 1Q2DA 3VWEA 4L89A 5IB0A 1S5KA 3PP9A 1BOBA 4PK2A 3DR8A 4KLVA 2R98A 5ISVA 2C27A 2Q7BA 4AVBA 4E0AA 5CNPA 3SXOA 5IV0A 5EC4A 4ORFA 1IIDA 4HNXB 4E8OA 2ZXVA 1NE9A 3G8WA 5F47A 4CAXA 1RO5A 4PK3A 4XPLA 4DNCA 3H4QA 3R9EA 3N7ZA 2GE3A 2PSWA 2DXQA 2OH1A 1FY7A 2PR8A 1Y9KA 4KORA 1YVOA 2JEVA 4PSWA 1QSOA 1Q2CA 1XE4A 2FS5A 2BUEA 1VKCA 2WPXA 4XNHC 1K4JA 1QSNA 3D2PA 3W91A 4MHDA 4F0YA 1YK3A 1QSTA 4KOVA 4CAWA 1YVKA 4R3KA 3DR6A 4R3LA 1SQHA 4JWPA 1N71A 1GHEA 3LODA 4UWIA 4KOYA 1S3ZA 3T9YA 2ARHA 4HNYB 2F5IA 2Q4VA 5F49A 4R87A 4U5YA 4E2AA 2FXFA 1V0CA 3F0AA 2ATRA 2Z0ZA 2FIWA 2VXKA 3WR7A 4ONUA 2Q0YA 4KOXA 1WWZA 4JXQA 2RC4A 2B3VA 1XMTA 3P2FA 4KVOE 4CS0B 2GIVA 4UWJA 2B4DA 3CXPA 4NXYA 3NE7A 3I9SA 4YGOA 1NSLA 2J8MA 3EY5A 3R95A 1S7NA 1S60A 3GYAA 2I00A 2ZW7A 2FT0A 2REFA 3KKWA 3S6FA 2QECA 1Y9WA 2REEA 5I0CA 4F6AA 5DWMA 1IB1E 1S7LA 1OZPA 2VZYA 3FXTA 3TO7A 4OADA 3TO9A 4B5PA 1QSMA 4II9A 4QBJA 5GCNA 4KZTA 4J3GA 5C88A 1MK4A 4Y49B 3DDDA 2I79A 3R1KA 1I12A 1MJ9A 4KUAA 4EVYA 4CAVA 3EFAA 3JVNA 3W6SA 4XNHB 2OZGA 1I21A 4NSQA 3QB8A 4MBUA 3EO4A 2B4DB 1B87A 4UA3A 4PV6A 2VZZA 2ZPAA 3P2HA 2HV2A 4KUBA 2J8RA 4CRZB 4XPKA 4JD6A 1PUAA 4FD7A 3T90A 3QAHA 1VHSA 2P6FA 2ZW6A 3R96A 2NMTA 2EVNA 2G3AA 3CXSA 3D2MA 5C82A 4QVTA 3ZJ0A 1I1DA 3D3SA 3IWGA 4KVME 5DWNA 4KOWA 3F8KA 3F5BA 2FSRA 3I3GA 3B8GA 5HH1A 2P6GA 3GY9A 2CY2A 4M85A 4NCZA 2Z11A 3FIXA 3TOBA 2O28A 1ON0A 4OLLA 2AE6A 4AG7A 1IYKA 3BJ8A 2PR1A 3JUWA 2HUZA 2VQYA 3FBUA 2FCKA 4NEXA 2CNSA 1XEBA 2B3UA 1XF8A 4H6UA 2PRBA 1M4GA 1M44A 1CJWA 2J8NA 1YGHA 3FNCA 4OAEA 1KZFA 4I49A 2B58A 2D4PA 3GKRA 5H86A 3IGRA 4FD6A 1KUYA 3E0KA 2BEIA 2R7HA 2ZW4A 2Q4YA 2H5MA 5KTAA 1S7KA 4KLWA 3FB3A 2OZUA 5HMNA 1R57A 1U6MA 1P4NA 4BMHA 2Y0MA 2VEZA 3EXNA 4XPDB 3SHPA 2QIRA 4JJXA 1B6BA 2Q04A 1YX0A 2BSWA 4H6ZA 3W6XA 4XPDC 1Y7RA 3OWCA 4MY0A 5KTDA 4JXRA 4X5KA 3LD2A 2Z10A 2X7BA 4HNWB 3TOAA 5EBVA 1QSRA 4NF1A 2JDDA 2A4NA 4ZBGA 2OB0A 3SXNA 4MI4A 3TE4A 1XIXA 1BO4A 1TIQA 4KOUA 3MGDA 2IL4A 4RI1A 3ZZIA 1IYLA 4KVXA 4R9MA 1L0CA 1CM0A 2K5TA 4HKFA 2R8VA 3DNSA 2D4OA 4IUSA 4FD5A 4AB7A 3TCVA 1YLEA 1M4IA 3TO6A 5F48A 2B5GB 2P6EA 1Z4RA 3VWDA 2G0BA 5H84A 1P0HA 2G3TA 2OU2A 4U9ZA 4KOSA 1MJAA 3EC4A 4LX9A 3S6GA 3R9GA 5JQ4A 4GS4A 2FE7A 4AG9A 5IX3A 1MJBA 1RXTA 3RYOA 4QUSA 1YR0A 2WPWA 1Z4EA 2VI7A 4YFJA 1WK4A 3D8PA 4YRHA 5FVJA 1KUVA 3FYNA 3V8IA 4R57A 4B5OA 1KUXA 2BL1A 2PQ8A 4QB9A 4JLYA 2B4BA 4LUAA 3TT2A 3UY5A 1M1DA 1Z9UA 3G3SA 2Q44A 2QMLA 4QC6A 2ZW5A 1PU9A 3BJ7A 3TTHA 1IICA 3S6HA 4UBRA 4FD4A 2GANA 2PC1A 2CNTA 2VBQA 2R1IA 3K9UA 4MY3A 2P0WA 4KOTA 3R9FA 4M3SA 4AVAA 4H89A 2FIAA 1M4DA 2CNMA 4CRYB 3PZJA 3CXQA 5F46A 1YREA 4AVCA 2KCWA 2B5GA 1LRZA 4L8AA 5J8FA
chains in the Genus database with same CATH superfamily
2AJ6A 4H2KA 4MHPA 1FNOA 2PJ3A 3TFYA 5ELYA 2FL4A 2PJ7A 1Q2YA 4Y49C 5J8CA 2CF4A 2JDCA 2JLMA 4MFZA 4R76A 4X2TA 5KTCA 3RAMA 3DSBA 3N5FA 3NE8A 2WSAA 4R7MA 3PB9X 3NH5A 1Z8XA 3H8EA 1NMTA 1J4JA 1VHOA 4OP4A 4P45A 3S6KA 4PPZA 2EUIA 3FEEA 3CDXA 4NGNA 4B5PB 4Q7AA 4IF5A 4Q36A 2PIZA 2PDOA 3BI0A 2G9DA 2HQYA 1QQ9A 5JPHA 2V8VA 3IC1A 4K30A 4UEZA 4HPSA 5E96A 1VGYA 1UFHA 2OZHA 3BLNA 3PGPA 3C26A 4A30A 4MJ8A 4RS2A 3KHZA 4NGSA 3T8WA 4U9YA 4MCPA 1CP7A 3SI0A 3FRMA 4PSXA 1S7FA 2J9AA 3ISZA 1Q2DA 4ONWA 5LRJA 5LYIA 2BO9A 2EO8A 1Y7EA 2EK8A 2ZENA 4UEFA 3VWEA 4L89A 5IB0A 3B3CA 3PEIA 1IGBA 1S5KA 4UCPA 3PP9A 3LACA 1BOBA 2XEIA 4PK2A 3DR8A 4KLVA 2R98A 4MCSA 2C27A 5THWA 5ISVA 2Q7BA 4AVBA 2ODFA 3V7ZA 4E0AA 4P4EA 2IJZA 5CNPA 3SXOA 5IV0A 5EC4A 4O23A 2CXAA 4ORFA 1IIDA 1LANA 4HNXB 3ISXA 3D7HA 2IMOA 3S9MA 4E8OA 3B35A 1ZLIA 2EK9A 2PVWA 1HEEA 8CPAA 2ZXVA 3FECA 4MXUA 1IU8A 3WC6A 2O4HA 1NE9A 2YGWA 3G8WA 5F47A 3IU1A 4CAXA 1LFWA 4KSIA 4CYPA 3CZXA 1RO5A 4PK3A 4XPLA 4ZYQA 1HDUA 2PIYA 4DNCA 3H4QA 3R9EA 3N7ZA 4KSAA 4B6ZA 5J8FA 5A28A 2PJ8A 4M6GA 2GE3A 2PSWA 2DXQA 2OH1A 1FY7A 4YU9A 2PR8A 1Y9KA 4KORA 1LCPA 1YVOA 5J1QA 2JEVA 2AFXA 3HUVA 4IHMA 3IFEA 4JYWA 4PSWA 1QSOA 3TC8A 2F7VA 4R6TA 4FAIA 1Q2CA 4PXEA 1XE4A 2FS5A 2Z3OA 3QAYA 2BUEA 1VKCA 2WPXA 4WJBA 1K4JA 4XNHC 2HB6A 4ZX9A 2ZEDA 4BINA 2DPSA 3IIBA 1QSNA 3D2PA 3W91A 3D7DA 1XOVA 4NGQA 4MHDA 4F0YA 2PJAA 3MN8A 1YK3A 1QSTA 3KZWA 4B13A 2AFZA 4TWEA 4KOVA 4CAWA 1YVKA 4R3KA 3DR6A 4R3LA 2Z3LA 3K2KA 1SQHA 4JWPA 1N71A 1GHEA 4NGRA 4B10A 3GUXA 2F8HA 4P4FA 3LODA 3D7FA 4M6HA 4KS9A 2AFSA 4A2ZA 4FBEA 4P4BA 4UWIA 4KOYA 1S3ZA 2PJ9A 2YNCA 3PBEA 4P4DA 3T9YA 2ARHA 4X3RA 3WC5A 1F2OA 4HNYB 4CYQA 4ZY1A 2RFHA 3CT9A 2F5IA 2Q4VA 5F49A 2DEAA 4R87A 4C7HA 4U5YA 4PQAA 2FXFA 1XRYA 4E2AA 2GLJA 4F9UA 4OC1A 4ZY0A 1V0CA 1JQGA 4MHYA 2YNCC 1XJOA 4P44A 3PBBA 4CYNA 3F0AA 3GB0A 4Q38A 2ATRA 4FUUA 3WABA 2Z0ZA 3KQZA 2FIWA 5LRKA 2VXKA 3LMSA 3SJFA 3WR7A 4ONUA 3S9NA 2Q0YA 4KOXA 1WWZA 4Z65A 1R3NA 2OOTA 1TXRA 3FMCA 3FVLA 4MFLA 5CBMA 1XBUA 1QMUA 4WWVA 4JXQA 3SJXA 2GLFA 2RC4A 1ZO0A 2B3VA 4OIDA 1XMTA 2ZEMA 2OR4A 2ZEOA 4UFXA 3NA6A 1TKJA 1CP6A 2Q7SA 3P2FA 2ZEFA 4KVOE 3PRTA 5F09A 1ARMA 4B11A 4CS0B 2GIVA 4W9YA 1YW6A 2JBKA 4UWJA 2B4DA 5G20A 3CXPA 2ZEGA 4NXYA 3KGQA 2AFWA 3NE7A 4PXCA 3D68A 5A27A 1BAVA 3I9SA 4YGOA 3NH8A 1NSLA 2J8MA 4UFVA 3S9LA 1ELMP 2PJ4A 4K3NA 3EY5A 3H8FA 3R95A 5G21A 1S7NA 5BWAB 3B2YA 4RN7A 1S60A 1DTDA 1YMEA 3GYAA 2I00A 2ZW7A 3FX6A 2FT0A 5JM6A 1LAMA 1XMBA 1H8LA 2REFA 1IOIA 3GLJA 3B3SA 3KKWA 4EWTA 4NGMA 2QYVA 3S6FA 3PFOA 5DS0A 5LYLA 3JTKA 1YSJA 1Y9WA 2QECA 2REEA 5I0CA 2ZEPA 1VIXA 1AYEA 2WYRA 3PB6X 4F6AA 5DWMA 1GYTA 1IB1E 1S7LA 1CBXA 2NYQA 3K9TA 4AXVA 2PE3A 1OZPA 3WT4A 2VZYA 4NJRA 4UIBA 3FXTA 3BI1A 3PB4X 3SI2A 3TO7A 4EMEA 3DLJA 4ZX8A 4OADA 4MHNA 3NH4A 5EMIA 3TO9A 4B5PA 5G1ZA 1OBRA 1QSMA 4OIWA 3D67A 4II9A 2O53A 1UWYA 4LQGA 2V8DA 5AGEA 5LRGA 1ARLA 5GCNA 4QBJA 1TF9A 4KZTA 4MRIA 4J3GA 5C88A 1MK4A 4Y49B 3DDDA 1YW4A 1LAPA 2I79A 3R1KA 3WC7A 2PJCA 4MFQA 1I12A 1MJ9A 1Z8LA 3KHXA 5AG5A 4KUAA 4A32A 4EVYA 2IQ6A 4CAVA 3EFAA 3JVNA 3W6SA 4XNHB 3PB8X 4UCNA 2OZGA 4RUHA 1I21A 5D8NA 4NSQA 3VATA 3QB8A 4MBUA 3V38A 2PCUA 3RNZA 1F2PA 1Z8TA 3EO4A 2ZEEA 4GXHA 2B4DB 1B87A 5HVFA 4UA3A 4YWYA 2JEWA 4UEEA 5G22A 3FF3A 1TF8A 4PV6A 2VZZA 2ZPAA 3P2HA 2HV2A 4KUBA 2J8RA 4CRZB 4XPKA 5K8OA 4IK2A 4JD6A 1PUAA 2XEFA 4FD7A 3T90A 4C68A 3QAHA 4MCRA 2GU2A 1VHSA 2JBJA 2P6FA 2ZW6A 4OC2A 3R96A 7CPAA 3H5ZA 2NMTA 2EVNA 2G3AA 3CXSA 3D2MA 4CAFA 5C82A 2V8GA 4QVTA 2POKA 3ZJ0A 1I1DA 5HXDA 1ZG8A 3PFEA 2AFMA 2C6CA 3D3SA 1Z8WA 4P10A 3IWGA 4MFJA 5AG7A 2VL1A 1ZG9A 4KVME 2AFOA 4UF4A 4A39A 5DWNA 3KR4A 4MMOA 4EFDA 4KOWA 4B12A 4CAEA 3F8KA 3QNVA 3F5BA 4P4JA 2BOAA 3PB7X 2FSRA 3I3GA 3B8GA 5HH1A 3KI9A 3LWUA 4A33A 2P6GA 3GY9A 2CY2A 4M85A 2PJ5A 4NCZA 4NFRA 3IWWA 2Z11A 3FIXA 3IJ3A 2Q51A 2YNEA 3TOBA 2O28A 2PRQA 1ON0A 4ZI6A 4OLLA 1TKHA 5D29A 1F57A 2AE6A 4AG7A 5AG4A 2ZOFA 1IYKA 3BJ8A 3B3TA 5HVHA 2PR1A 3JUWA 3BHXA 4CPAA 2HUZA 2VQYA 3FBUA 2FCKA 4NEXA 2CNSA 3DGVA 5JH9A 1XEBA 3NFZA 4BBHA 2B3UA 4R8FA 4X8IA 1XF8A 4H6UA 2RB7A 3VH9A 5LYDA 2CTCA 2PRBA 1Y0YA 1M4GA 1M44A 2V8HA 2Z3KA 4DUKA 4TNUA 3FH4A 1YQEA 1CJWA 2J8NA 2AFUA 1YGHA 2CIJA 4MHZA 3FNCA 2GFQA 3FEDA 4OAEA 3RBUA 1KZFA 4I49A 4OC0A 4MFPA 2B58A 2D4PA 3GKRA 1BLLE 5H86A 4OC3A 3IGRA 4LQ6A 4F9VA 1Z2LA 4FD6A 1M4LA 1CPXA 1KUYA 2BEIA 2R7HA 2ZW4A 3E0KA 3GIUA 2Q4YA 2ANPA 2NSMA 4MFKA 2H5MA 5AG6A 1BPNA 1LOKA 4FWUA 1S7KA 5KTAA 4KLWA 3FB3A 3IEHA 2PJ1A 2OZUA 5HMNA 1R57A 1JWQA 3JRUA 1U6MA 1P4NA 3B3WA 2Z3NA 3I1UA 2Y0MA 2DF5A 4BMHA 2VEZA 3EXNA 4C2ZA 4XPDB 1Z5RA 3SHPA 2QIRA 4JJXA 2PJ6A 1B6BA 1YX0A 2BSWA 2Q04A 2Q43A 4H6ZA 3W6XA 4C7IA 2ZEHA 3D4UA 2GREA 4XPDC 4CGMA 1CPSA 1NSAA 1VHEA 4PXBA 5LYFA 1AUGA 4P6YA 1Y7RA 1ZG7A 3OWCA 4UIAA 1PCAA 2QJ8A 3B7IA 3D66A 4MY0A 4NJQA 5KTDA 4CGNA 3BXMA 4JXRA 4X5KA 3HLPA 3LD2A 2Z10A 2X7BA 3A9LA 4HNWB 4OC5A 3TOAA 5EBVA 1EE3P 3H8GA 2YNDA 1QSRA 4NF1A 1X12A 2JDDA 4A37A 2A4NA 4A94A 1KWMA 2ABZA 4ZBGA 2OB0A 3SXNA 5K8PA 4MI4A 3TE4A 4F8ZA 1FT7A 1XIXA 1BO4A 4CGPA 1IOFA 4GM5A 4CGLA 1TIQA 2XEGA 4KOUA 2DPTA 3KQXA 1Q7LA 2IL4A 3MGDA 4RI1A 3ZZIA 2Z3MA 2EBJA 1IYLA 3CPXA 4KVXA 3SI1A 1DE4C 4R9MA 3SJGA 6CPAA 4OMEA 1A2ZA 4UFWA 1L0CA 1CM0A 1CG2A 1CX8A 1YLOA 2K5TA 4A38A 2CTBA 4HKFA 4ZGYB 3RZAA 2R8VA 3DNSA 4A31A 2D4OA 4IUSA 1AMPA 4FD5A 3TCVA 4AB7A 1YLEA 4C2XA 4OC4A 1M4IA 3TO6A 3FJUA 5F48A 1BPMA 2B5GB 2P6EA 1Z4RA 3D7GA 3KASA 2PVVA 4C2YA 3MRUA 3VWDA 2G0BA 1XFOA 3IU2A 1P0HA 2HC9A 1HDQA 2G3TA 2I3CA 2OU2A 4MCQA 5H84A 4U9ZA 4KOSA 4JZ0A 1MJAA 3EC4A 4LX9A 3S6GA 5CPAA 5IB9A 5K8MA 4KSFA 1R43A 3VARA 3R9GA 5JQ4A 2Q4ZA 4GS4A 2FE7A 2C6PA 4AG9A 2PJ2A 3RO0A 5IX3A 1MJBA 4ZY2A 3KL9A 5K8NA 1RXTA 2FVGA 3RYOA 4QUSA 1YR0A 2WPWA 4DJLA 5JGFA 1Z4EA 2VI7A 4YFJA 2QVPA 4BD9A 1WK4A 3D8PA 5I4MA 2ZELA 4OKOA 4CYOA 4YRHA 5FVJA 4CGOA 1ZLHA 1KUVA 3FYNA 3V8IA 4A95A 4UCMA 4R57A 4B5OA 1KUXA 2BL1A 2PQ8A 4JLYA 4PXDA 4QB9A 4P4IA 2B4BA 4LUAA 3TT2A 3UY5A 1M1DA 2PJ0A 3L2NA 1Z9UA 3G3SA 2Z3PA 3B3VA 4G1PA 1IY7A 2Q44A 2QMLA 4QC6A 2ZW5A 1PU9A 1ELLP 3BJ7A 3TTHA 4DYOA 1IICA 3S6HA 2XEJA 4NGPA 2WUUA 2BCOA 3IO1A 4FD4A 4UBRA 3SJEA 1TKFA 2GANA 4NGTA 3TX8A 2PC1A 4F0XA 2ZOGA 5HVGA 2CNTA 2VBQA 2R1IA 3K9UA 2C1CA 4MY3A 4IAVA 3IWEA 3KR5A 2P0WA 4KOTA 3R9FA 4M3SA 4AVAA 4H89A 4M6IA 2FIAA 1M4DA 2CNMA 1PYTB 1RTQA 3PZJA 4CRYB 2C6GA 1Y0RA 2V77A 3CXQA 3CPAA 5F46A 1YREA 4AVCA 2EWBA 2KCWA 1X10A 2B5GA 1LRZA 2PJBA 2WZNA 4L8AA 4B14A
chains in the Genus database with same CATH topology
2AJ6A 3TFYA 2FL4A 1Q2YA 4Y49C 5J8CA 2JDCA 2JLMA 4MFZA 5KTCA 3DSBA 2WSAA 1NMTA 1J4JA 3S6KA 2EUIA 4B5PB 4IF5A 4Q36A 2PDOA 2HQYA 5JPHA 4K30A 5E96A 1UFHA 2OZHA 3BLNA 3PGPA 3C26A 4A30A 4MJ8A 4RS2A 4U9YA 3FRMA 4PSXA 1S7FA 1Q2DA 3VWEA 4L89A 5IB0A 1S5KA 4UCPA 3PP9A 1BOBA 4PK2A 3DR8A 4KLVA 2R98A 5ISVA 2C27A 2Q7BA 4AVBA 4E0AA 5CNPA 3SXOA 5IV0A 5EC4A 2CXAA 4ORFA 1IIDA 4HNXB 4E8OA 2ZXVA 1NE9A 2YGWA 3G8WA 5F47A 3IU1A 4CAXA 4CYPA 1RO5A 4PK3A 4XPLA 4DNCA 3H4QA 3R9EA 3N7ZA 4KSAA 5J8FA 5A28A 2GE3A 2PSWA 2DXQA 2OH1A 1FY7A 2PR8A 1Y9KA 4KORA 1YVOA 2JEVA 4PSWA 1QSOA 1Q2CA 1XE4A 2FS5A 2Z3OA 2BUEA 1VKCA 2WPXA 4XNHC 1K4JA 2DPSA 1QSNA 3D2PA 3W91A 4MHDA 4F0YA 1YK3A 1QSTA 4B13A 4KOVA 4CAWA 1YVKA 4R3KA 3DR6A 4R3LA 2Z3LA 1SQHA 4JWPA 1N71A 1GHEA 4B10A 3LODA 4KS9A 4A2ZA 4UWIA 4KOYA 1S3ZA 2YNCA 3T9YA 2ARHA 4HNYB 4CYQA 2F5IA 2Q4VA 5F49A 4R87A 4C7HA 4U5YA 4E2AA 2FXFA 1V0CA 2YNCC 4CYNA 3F0AA 4Q38A 2ATRA 2Z0ZA 2FIWA 2VXKA 3WR7A 4ONUA 2Q0YA 4KOXA 1WWZA 4MFLA 4JXQA 2RC4A 1ZO0A 2B3VA 1XMTA 4UFXA 3P2FA 4KVOE 4CS0B 4B11A 2GIVA 4UWJA 2B4DA 5G20A 3CXPA 4NXYA 3NE7A 5A27A 3I9SA 4YGOA 1NSLA 2J8MA 4UFVA 3EY5A 3R95A 5G21A 1S7NA 5BWAB 1S60A 3GYAA 2I00A 2ZW7A 2FT0A 2REFA 3KKWA 3S6FA 3JTKA 2QECA 1Y9WA 2REEA 5I0CA 4F6AA 5DWMA 1IB1E 1S7LA 1OZPA 2VZYA 3FXTA 3TO7A 4OADA 3TO9A 4B5PA 5G1ZA 1QSMA 4II9A 5AGEA 4QBJA 5GCNA 4KZTA 4J3GA 5C88A 1MK4A 4Y49B 3DDDA 2I79A 3R1KA 4MFQA 1I12A 1MJ9A 5AG5A 4KUAA 4A32A 4EVYA 4CAVA 3EFAA 3JVNA 3W6SA 4XNHB 4UCNA 2OZGA 1I21A 4NSQA 3QB8A 4MBUA 3EO4A 2B4DB 1B87A 4UA3A 5G22A 4PV6A 2VZZA 2ZPAA 3P2HA 2HV2A 4KUBA 2J8RA 4CRZB 4XPKA 4JD6A 1PUAA 4FD7A 3T90A 4C68A 3QAHA 1VHSA 2P6FA 2ZW6A 3R96A 3H5ZA 2NMTA 2EVNA 2G3AA 3CXSA 3D2MA 4CAFA 5C82A 4QVTA 3ZJ0A 1I1DA 3D3SA 3IWGA 4MFJA 5AG7A 4KVME 5DWNA 4KOWA 4B12A 4CAEA 3F8KA 3F5BA 2FSRA 3I3GA 3B8GA 5HH1A 4A33A 2P6GA 3GY9A 2CY2A 4M85A 4NCZA 2Z11A 3FIXA 2YNEA 3TOBA 2O28A 1ON0A 4OLLA 2AE6A 4AG7A 5AG4A 1IYKA 3BJ8A 2PR1A 3JUWA 2HUZA 2VQYA 3FBUA 2FCKA 4NEXA 2CNSA 1XEBA 4BBHA 2B3UA 1XF8A 4H6UA 2PRBA 1M4GA 1M44A 2Z3KA 1CJWA 2J8NA 1YGHA 3FNCA 4OAEA 1KZFA 4I49A 4MFPA 2B58A 2D4PA 3GKRA 5H86A 3IGRA 4FD6A 1KUYA 3E0KA 2BEIA 2R7HA 2ZW4A 2Q4YA 4MFKA 2H5MA 5AG6A 5KTAA 1S7KA 4KLWA 3FB3A 2OZUA 5HMNA 1R57A 1U6MA 1P4NA 2Z3NA 4BMHA 2Y0MA 2VEZA 3EXNA 4C2ZA 4XPDB 3SHPA 2QIRA 4JJXA 1B6BA 2Q04A 1YX0A 2BSWA 4H6ZA 3W6XA 4C7IA 4XPDC 4CGMA 1Y7RA 3OWCA 4MY0A 5KTDA 4CGNA 4JXRA 4X5KA 3LD2A 2Z10A 2X7BA 3A9LA 4HNWB 3TOAA 5EBVA 2YNDA 1QSRA 4NF1A 2JDDA 2A4NA 4ZBGA 2OB0A 3SXNA 4MI4A 3TE4A 1XIXA 1BO4A 4CGPA 4CGLA 1TIQA 4KOUA 2DPTA 3MGDA 2IL4A 4RI1A 3ZZIA 2Z3MA 1IYLA 4KVXA 4R9MA 4UFWA 1L0CA 1CM0A 2K5TA 4HKFA 4ZGYB 2R8VA 3DNSA 4A31A 2D4OA 4IUSA 4FD5A 4AB7A 3TCVA 1YLEA 4C2XA 1M4IA 3TO6A 5F48A 2B5GB 2P6EA 1Z4RA 4C2YA 3VWDA 2G0BA 3IU2A 1P0HA 5H84A 2G3TA 2OU2A 4U9ZA 4KOSA 1MJAA 3EC4A 4LX9A 3S6GA 4KSFA 3R9GA 5JQ4A 4GS4A 2FE7A 4AG9A 5IX3A 1MJBA 1RXTA 3RYOA 4QUSA 1YR0A 2WPWA 1Z4EA 2VI7A 4YFJA 1WK4A 3D8PA 4CYOA 4YRHA 5FVJA 4CGOA 1KUVA 3FYNA 3V8IA 4A95A 4UCMA 4R57A 4B5OA 1KUXA 2BL1A 2PQ8A 4JLYA 4QB9A 2B4BA 4LUAA 3TT2A 3UY5A 1M1DA 1Z9UA 3G3SA 2Z3PA 2Q44A 2QMLA 4QC6A 2ZW5A 1PU9A 3BJ7A 3TTHA 1IICA 3S6HA 2WUUA 4UBRA 4FD4A 2GANA 2PC1A 4F0XA 2CNTA 2VBQA 2R1IA 3K9UA 4MY3A 3IWEA 2P0WA 4KOTA 3R9FA 4M3SA 4AVAA 4H89A 2FIAA 1M4DA 2CNMA 4CRYB 3PZJA 3CXQA 5F46A 1YREA 4AVCA 2KCWA 2B5GA 1LRZA 4L8AA 4B14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AJ6 A;  3TFY A;  2FL4 A;  1Q2Y A;  4Y49 C;  5J8C A;  2JDC A;  2JLM A;  5KTC A;  3DSB A;  1NMT A;  1J4J A;  3S6K A;  2EUI A;  4B5P B;  4IF5 A;  2PDO A;  2HQY A;  5JPH A;  4K30 A;  5E96 A;  1UFH A;  2OZH A;  3BLN A;  3PGP A;  3C26 A;  4MJ8 A;  4RS2 A;  4U9Y A;  3FRM A;  4PSX A;  1S7F A;  1Q2D A;  3VWE A;  4L89 A;  5IB0 A;  1S5K A;  3PP9 A;  1BOB A;  4PK2 A;  3DR8 A;  4KLV A;  2R98 A;  5ISV A;  2C27 A;  2Q7B A;  4AVB A;  4E0A A;  5CNP A;  3SXO A;  5IV0 A;  5EC4 A;  4ORF A;  1IID A;  4HNX B;  4E8O A;  2ZXV A;  1NE9 A;  3G8W A;  5F47 A;  4CAX A;  1RO5 A;  4PK3 A;  4XPL A;  4DNC A;  3H4Q A;  3R9E A;  3N7Z A;  2GE3 A;  2PSW A;  2DXQ A;  2OH1 A;  1FY7 A;  2PR8 A;  1Y9K A;  4KOR A;  1YVO A;  2JEV A;  4PSW A;  1QSO A;  1Q2C A;  1XE4 A;  2FS5 A;  2BUE A;  1VKC A;  2WPX A;  4XNH C;  1K4J A;  1QSN A;  3D2P A;  3W91 A;  4MHD A;  4F0Y A;  1YK3 A;  1QST A;  4KOV A;  4CAW A;  1YVK A;  4R3K A;  3DR6 A;  4R3L A;  1SQH A;  4JWP A;  1N71 A;  1GHE A;  3LOD A;  4UWI A;  4KOY A;  1S3Z A;  3T9Y A;  2ARH A;  4HNY B;  2F5I A;  2Q4V A;  5F49 A;  4R87 A;  4U5Y A;  4E2A A;  2FXF A;  1V0C A;  3F0A A;  2ATR A;  2Z0Z A;  2FIW A;  2VXK A;  3WR7 A;  4ONU A;  2Q0Y A;  4KOX A;  1WWZ A;  4JXQ A;  2RC4 A;  2B3V A;  1XMT A;  3P2F A;  4KVO E;  4CS0 B;  2GIV A;  4UWJ A;  2B4D A;  3CXP A;  4NXY A;  3NE7 A;  3I9S A;  4YGO A;  1NSL A;  2J8M A;  3EY5 A;  3R95 A;  1S7N A;  1S60 A;  3GYA A;  2I00 A;  2ZW7 A;  2FT0 A;  2REF A;  3KKW A;  3S6F A;  2QEC A;  1Y9W A;  2REE A;  5I0C A;  4F6A A;  5DWM A;  1IB1 E;  1S7L A;  1OZP A;  2VZY A;  3FXT A;  3TO7 A;  4OAD A;  3TO9 A;  4B5P A;  1QSM A;  4II9 A;  4QBJ A;  5GCN A;  4KZT A;  4J3G A;  5C88 A;  1MK4 A;  4Y49 B;  3DDD A;  2I79 A;  3R1K A;  1I12 A;  1MJ9 A;  4KUA A;  4EVY A;  4CAV A;  3EFA A;  3JVN A;  3W6S A;  4XNH B;  2OZG A;  1I21 A;  4NSQ A;  3QB8 A;  4MBU A;  3EO4 A;  2B4D B;  1B87 A;  4UA3 A;  4PV6 A;  2VZZ A;  2ZPA A;  3P2H A;  2HV2 A;  4KUB A;  2J8R A;  4CRZ B;  4XPK A;  4JD6 A;  1PUA A;  4FD7 A;  3T90 A;  3QAH A;  1VHS A;  2P6F A;  2ZW6 A;  3R96 A;  2NMT A;  2EVN A;  2G3A A;  3CXS A;  3D2M A;  5C82 A;  4QVT A;  3ZJ0 A;  1I1D A;  3D3S A;  3IWG A;  4KVM E;  5DWN A;  4KOW A;  3F8K A;  3F5B A;  2FSR A;  3I3G A;  3B8G A;  5HH1 A;  2P6G A;  3GY9 A;  2CY2 A;  4M85 A;  4NCZ A;  2Z11 A;  3FIX A;  3TOB A;  2O28 A;  1ON0 A;  4OLL A;  2AE6 A;  4AG7 A;  1IYK A;  3BJ8 A;  2PR1 A;  3JUW A;  2HUZ A;  2VQY A;  3FBU A;  2FCK A;  4NEX A;  2CNS A;  1XEB A;  2B3U A;  1XF8 A;  4H6U A;  2PRB A;  1M4G A;  1M44 A;  1CJW A;  2J8N A;  1YGH A;  3FNC A;  4OAE A;  1KZF A;  4I49 A;  2B58 A;  2D4P A;  3GKR A;  5H86 A;  3IGR A;  4FD6 A;  1KUY A;  3E0K A;  2BEI A;  2R7H A;  2ZW4 A;  2Q4Y A;  2H5M A;  5KTA A;  1S7K A;  4KLW A;  3FB3 A;  2OZU A;  5HMN A;  1R57 A;  1U6M A;  1P4N A;  4BMH A;  2Y0M A;  2VEZ A;  3EXN A;  4XPD B;  3SHP A;  2QIR A;  4JJX A;  1B6B A;  2Q04 A;  1YX0 A;  2BSW A;  4H6Z A;  3W6X A;  4XPD C;  1Y7R A;  3OWC A;  4MY0 A;  5KTD A;  4JXR A;  4X5K A;  3LD2 A;  2Z10 A;  2X7B A;  4HNW B;  3TOA A;  5EBV A;  1QSR A;  4NF1 A;  2JDD A;  2A4N A;  4ZBG A;  2OB0 A;  3SXN A;  4MI4 A;  3TE4 A;  1XIX A;  1BO4 A;  1TIQ A;  4KOU A;  3MGD A;  2IL4 A;  4RI1 A;  3ZZI A;  1IYL A;  4KVX A;  4R9M A;  1L0C A;  1CM0 A;  2K5T A;  4HKF A;  2R8V A;  3DNS A;  2D4O A;  4IUS A;  4FD5 A;  4AB7 A;  3TCV A;  1YLE A;  1M4I A;  3TO6 A;  5F48 A;  2B5G B;  2P6E A;  1Z4R A;  3VWD A;  2G0B A;  5H84 A;  1P0H A;  2G3T A;  2OU2 A;  4U9Z A;  4KOS A;  1MJA A;  3EC4 A;  4LX9 A;  3S6G A;  3R9G A;  5JQ4 A;  4GS4 A;  2FE7 A;  4AG9 A;  5IX3 A;  1MJB A;  1RXT A;  3RYO A;  4QUS A;  1YR0 A;  2WPW A;  1Z4E A;  2VI7 A;  4YFJ A;  1WK4 A;  3D8P A;  4YRH A;  5FVJ A;  1KUV A;  3FYN A;  3V8I A;  4R57 A;  4B5O A;  1KUX A;  2BL1 A;  2PQ8 A;  4QB9 A;  4JLY A;  2B4B A;  4LUA A;  3TT2 A;  3UY5 A;  1M1D A;  1Z9U A;  3G3S A;  2Q44 A;  2QML A;  4QC6 A;  2ZW5 A;  1PU9 A;  3BJ7 A;  3TTH A;  1IIC A;  3S6H A;  4UBR A;  4FD4 A;  2GAN A;  2PC1 A;  2CNT A;  2VBQ A;  2R1I A;  3K9U A;  4MY3 A;  2P0W A;  4KOT A;  3R9F A;  4M3S A;  4AVA A;  4H89 A;  2FIA A;  1M4D A;  2CNM A;  4CRY B;  3PZJ A;  3CXQ A;  5F46 A;  1YRE A;  4AVC A;  2KCW A;  2B5G A;  1LRZ A;  4L8A A;  5J8F A; 
#chains in the Genus database with same CATH topology
 2AJ6 A;  4H2K A;  4MHP A;  1FNO A;  2PJ3 A;  3TFY A;  5ELY A;  2FL4 A;  2PJ7 A;  1Q2Y A;  4Y49 C;  5J8C A;  2CF4 A;  2JDC A;  2JLM A;  4MFZ A;  4R76 A;  4X2T A;  5KTC A;  3RAM A;  3DSB A;  3N5F A;  3NE8 A;  2WSA A;  4R7M A;  3PB9 X;  3NH5 A;  1Z8X A;  3H8E A;  1NMT A;  1J4J A;  1VHO A;  4OP4 A;  4P45 A;  3S6K A;  4PPZ A;  2EUI A;  3FEE A;  3CDX A;  4NGN A;  4B5P B;  4Q7A A;  4IF5 A;  4Q36 A;  2PIZ A;  2PDO A;  3BI0 A;  2G9D A;  2HQY A;  1QQ9 A;  5JPH A;  2V8V A;  3IC1 A;  4K30 A;  4UEZ A;  4HPS A;  5E96 A;  1VGY A;  1UFH A;  2OZH A;  3BLN A;  3PGP A;  3C26 A;  4A30 A;  4MJ8 A;  4RS2 A;  3KHZ A;  4NGS A;  3T8W A;  4U9Y A;  4MCP A;  1CP7 A;  3SI0 A;  3FRM A;  4PSX A;  1S7F A;  2J9A A;  3ISZ A;  1Q2D A;  4ONW A;  5LRJ A;  5LYI A;  2BO9 A;  2EO8 A;  1Y7E A;  2EK8 A;  2ZEN A;  4UEF A;  3VWE A;  4L89 A;  5IB0 A;  3B3C A;  3PEI A;  1IGB A;  1S5K A;  4UCP A;  3PP9 A;  3LAC A;  1BOB A;  2XEI A;  4PK2 A;  3DR8 A;  4KLV A;  2R98 A;  4MCS A;  2C27 A;  5THW A;  5ISV A;  2Q7B A;  4AVB A;  2ODF A;  3V7Z A;  4E0A A;  4P4E A;  2IJZ A;  5CNP A;  3SXO A;  5IV0 A;  5EC4 A;  4O23 A;  2CXA A;  4ORF A;  1IID A;  1LAN A;  4HNX B;  3ISX A;  3D7H A;  2IMO A;  3S9M A;  4E8O A;  3B35 A;  1ZLI A;  2EK9 A;  2PVW A;  1HEE A;  8CPA A;  2ZXV A;  3FEC A;  4MXU A;  1IU8 A;  3WC6 A;  2O4H A;  1NE9 A;  2YGW A;  3G8W A;  5F47 A;  3IU1 A;  4CAX A;  1LFW A;  4KSI A;  4CYP A;  3CZX A;  1RO5 A;  4PK3 A;  4XPL A;  4ZYQ A;  1HDU A;  2PIY A;  4DNC A;  3H4Q A;  3R9E A;  3N7Z A;  4KSA A;  4B6Z A;  5J8F A;  5A28 A;  2PJ8 A;  4M6G A;  2GE3 A;  2PSW A;  2DXQ A;  2OH1 A;  1FY7 A;  4YU9 A;  2PR8 A;  1Y9K A;  4KOR A;  1LCP A;  1YVO A;  5J1Q A;  2JEV A;  2AFX A;  3HUV A;  4IHM A;  3IFE A;  4JYW A;  4PSW A;  1QSO A;  3TC8 A;  2F7V A;  4R6T A;  4FAI A;  1Q2C A;  4PXE A;  1XE4 A;  2FS5 A;  2Z3O A;  3QAY A;  2BUE A;  1VKC A;  2WPX A;  4WJB A;  1K4J A;  4XNH C;  2HB6 A;  4ZX9 A;  2ZED A;  4BIN A;  2DPS A;  3IIB A;  1QSN A;  3D2P A;  3W91 A;  3D7D A;  1XOV A;  4NGQ A;  4MHD A;  4F0Y A;  2PJA A;  3MN8 A;  1YK3 A;  1QST A;  3KZW A;  4B13 A;  2AFZ A;  4TWE A;  4KOV A;  4CAW A;  1YVK A;  4R3K A;  3DR6 A;  4R3L A;  2Z3L A;  3K2K A;  1SQH A;  4JWP A;  1N71 A;  1GHE A;  4NGR A;  4B10 A;  3GUX A;  2F8H A;  4P4F A;  3LOD A;  3D7F A;  4M6H A;  4KS9 A;  2AFS A;  4A2Z A;  4FBE A;  4P4B A;  4UWI A;  4KOY A;  1S3Z A;  2PJ9 A;  2YNC A;  3PBE A;  4P4D A;  3T9Y A;  2ARH A;  4X3R A;  3WC5 A;  1F2O A;  4HNY B;  4CYQ A;  4ZY1 A;  2RFH A;  3CT9 A;  2F5I A;  2Q4V A;  5F49 A;  2DEA A;  4R87 A;  4C7H A;  4U5Y A;  4PQA A;  2FXF A;  1XRY A;  4E2A A;  2GLJ A;  4F9U A;  4OC1 A;  4ZY0 A;  1V0C A;  1JQG A;  4MHY A;  2YNC C;  1XJO A;  4P44 A;  3PBB A;  4CYN A;  3F0A A;  3GB0 A;  4Q38 A;  2ATR A;  4FUU A;  3WAB A;  2Z0Z A;  3KQZ A;  2FIW A;  5LRK A;  2VXK A;  3LMS A;  3SJF A;  3WR7 A;  4ONU A;  3S9N A;  2Q0Y A;  4KOX A;  1WWZ A;  4Z65 A;  1R3N A;  2OOT A;  1TXR A;  3FMC A;  3FVL A;  4MFL A;  5CBM A;  1XBU A;  1QMU A;  4WWV A;  4JXQ A;  3SJX A;  2GLF A;  2RC4 A;  1ZO0 A;  2B3V A;  4OID A;  1XMT A;  2ZEM A;  2OR4 A;  2ZEO A;  4UFX A;  3NA6 A;  1TKJ A;  1CP6 A;  2Q7S A;  3P2F A;  2ZEF A;  4KVO E;  3PRT A;  5F09 A;  1ARM A;  4B11 A;  4CS0 B;  2GIV A;  4W9Y A;  1YW6 A;  2JBK A;  4UWJ A;  2B4D A;  5G20 A;  3CXP A;  2ZEG A;  4NXY A;  3KGQ A;  2AFW A;  3NE7 A;  4PXC A;  3D68 A;  5A27 A;  1BAV A;  3I9S A;  4YGO A;  3NH8 A;  1NSL A;  2J8M A;  4UFV A;  3S9L A;  1ELM P;  2PJ4 A;  4K3N A;  3EY5 A;  3H8F A;  3R95 A;  5G21 A;  1S7N A;  5BWA B;  3B2Y A;  4RN7 A;  1S60 A;  1DTD A;  1YME A;  3GYA A;  2I00 A;  2ZW7 A;  3FX6 A;  2FT0 A;  5JM6 A;  1LAM A;  1XMB A;  1H8L A;  2REF A;  1IOI A;  3GLJ A;  3B3S A;  3KKW A;  4EWT A;  4NGM A;  2QYV A;  3S6F A;  3PFO A;  5DS0 A;  5LYL A;  3JTK A;  1YSJ A;  1Y9W A;  2QEC A;  2REE A;  5I0C A;  2ZEP A;  1VIX A;  1AYE A;  2WYR A;  3PB6 X;  4F6A A;  5DWM A;  1GYT A;  1IB1 E;  1S7L A;  1CBX A;  2NYQ A;  3K9T A;  4AXV A;  2PE3 A;  1OZP A;  3WT4 A;  2VZY A;  4NJR A;  4UIB A;  3FXT A;  3BI1 A;  3PB4 X;  3SI2 A;  3TO7 A;  4EME A;  3DLJ A;  4ZX8 A;  4OAD A;  4MHN A;  3NH4 A;  5EMI A;  3TO9 A;  4B5P A;  5G1Z A;  1OBR A;  1QSM A;  4OIW A;  3D67 A;  4II9 A;  2O53 A;  1UWY A;  4LQG A;  2V8D A;  5AGE A;  5LRG A;  1ARL A;  5GCN A;  4QBJ A;  1TF9 A;  4KZT A;  4MRI A;  4J3G A;  5C88 A;  1MK4 A;  4Y49 B;  3DDD A;  1YW4 A;  1LAP A;  2I79 A;  3R1K A;  3WC7 A;  2PJC A;  4MFQ A;  1I12 A;  1MJ9 A;  1Z8L A;  3KHX A;  5AG5 A;  4KUA A;  4A32 A;  4EVY A;  2IQ6 A;  4CAV A;  3EFA A;  3JVN A;  3W6S A;  4XNH B;  3PB8 X;  4UCN A;  2OZG A;  4RUH A;  1I21 A;  5D8N A;  4NSQ A;  3VAT A;  3QB8 A;  4MBU A;  3V38 A;  2PCU A;  3RNZ A;  1F2P A;  1Z8T A;  3EO4 A;  2ZEE A;  4GXH A;  2B4D B;  1B87 A;  5HVF A;  4UA3 A;  4YWY A;  2JEW A;  4UEE A;  5G22 A;  3FF3 A;  1TF8 A;  4PV6 A;  2VZZ A;  2ZPA A;  3P2H A;  2HV2 A;  4KUB A;  2J8R A;  4CRZ B;  4XPK A;  5K8O A;  4IK2 A;  4JD6 A;  1PUA A;  2XEF A;  4FD7 A;  3T90 A;  4C68 A;  3QAH A;  4MCR A;  2GU2 A;  1VHS A;  2JBJ A;  2P6F A;  2ZW6 A;  4OC2 A;  3R96 A;  7CPA A;  3H5Z A;  2NMT A;  2EVN A;  2G3A A;  3CXS A;  3D2M A;  4CAF A;  5C82 A;  2V8G A;  4QVT A;  2POK A;  3ZJ0 A;  1I1D A;  5HXD A;  1ZG8 A;  3PFE A;  2AFM A;  2C6C A;  3D3S A;  1Z8W A;  4P10 A;  3IWG A;  4MFJ A;  5AG7 A;  2VL1 A;  1ZG9 A;  4KVM E;  2AFO A;  4UF4 A;  4A39 A;  5DWN A;  3KR4 A;  4MMO A;  4EFD A;  4KOW A;  4B12 A;  4CAE A;  3F8K A;  3QNV A;  3F5B A;  4P4J A;  2BOA A;  3PB7 X;  2FSR A;  3I3G A;  3B8G A;  5HH1 A;  3KI9 A;  3LWU A;  4A33 A;  2P6G A;  3GY9 A;  2CY2 A;  4M85 A;  2PJ5 A;  4NCZ A;  4NFR A;  3IWW A;  2Z11 A;  3FIX A;  3IJ3 A;  2Q51 A;  2YNE A;  3TOB A;  2O28 A;  2PRQ A;  1ON0 A;  4ZI6 A;  4OLL A;  1TKH A;  5D29 A;  1F57 A;  2AE6 A;  4AG7 A;  5AG4 A;  2ZOF A;  1IYK A;  3BJ8 A;  3B3T A;  5HVH A;  2PR1 A;  3JUW A;  3BHX A;  4CPA A;  2HUZ A;  2VQY A;  3FBU A;  2FCK A;  4NEX A;  2CNS A;  3DGV A;  5JH9 A;  1XEB A;  3NFZ A;  4BBH A;  2B3U A;  4R8F A;  4X8I A;  1XF8 A;  4H6U A;  2RB7 A;  3VH9 A;  5LYD A;  2CTC A;  2PRB A;  1Y0Y A;  1M4G A;  1M44 A;  2V8H A;  2Z3K A;  4DUK A;  4TNU A;  3FH4 A;  1YQE A;  1CJW A;  2J8N A;  2AFU A;  1YGH A;  2CIJ A;  4MHZ A;  3FNC A;  2GFQ A;  3FED A;  4OAE A;  3RBU A;  1KZF A;  4I49 A;  4OC0 A;  4MFP A;  2B58 A;  2D4P A;  3GKR A;  1BLL E;  5H86 A;  4OC3 A;  3IGR A;  4LQ6 A;  4F9V A;  1Z2L A;  4FD6 A;  1M4L A;  1CPX A;  1KUY A;  2BEI A;  2R7H A;  2ZW4 A;  3E0K A;  3GIU A;  2Q4Y A;  2ANP A;  2NSM A;  4MFK A;  2H5M A;  5AG6 A;  1BPN A;  1LOK A;  4FWU A;  1S7K A;  5KTA A;  4KLW A;  3FB3 A;  3IEH A;  2PJ1 A;  2OZU A;  5HMN A;  1R57 A;  1JWQ A;  3JRU A;  1U6M A;  1P4N A;  3B3W A;  2Z3N A;  3I1U A;  2Y0M A;  2DF5 A;  4BMH A;  2VEZ A;  3EXN A;  4C2Z A;  4XPD B;  1Z5R A;  3SHP A;  2QIR A;  4JJX A;  2PJ6 A;  1B6B A;  1YX0 A;  2BSW A;  2Q04 A;  2Q43 A;  4H6Z A;  3W6X A;  4C7I A;  2ZEH A;  3D4U A;  2GRE A;  4XPD C;  4CGM A;  1CPS A;  1NSA A;  1VHE A;  4PXB A;  5LYF A;  1AUG A;  4P6Y A;  1Y7R A;  1ZG7 A;  3OWC A;  4UIA A;  1PCA A;  2QJ8 A;  3B7I A;  3D66 A;  4MY0 A;  4NJQ A;  5KTD A;  4CGN A;  3BXM A;  4JXR A;  4X5K A;  3HLP A;  3LD2 A;  2Z10 A;  2X7B A;  3A9L A;  4HNW B;  4OC5 A;  3TOA A;  5EBV A;  1EE3 P;  3H8G A;  2YND A;  1QSR A;  4NF1 A;  1X12 A;  2JDD A;  4A37 A;  2A4N A;  4A94 A;  1KWM A;  2ABZ A;  4ZBG A;  2OB0 A;  3SXN A;  5K8P A;  4MI4 A;  3TE4 A;  4F8Z A;  1FT7 A;  1XIX A;  1BO4 A;  4CGP A;  1IOF A;  4GM5 A;  4CGL A;  1TIQ A;  2XEG A;  4KOU A;  2DPT A;  3KQX A;  1Q7L A;  2IL4 A;  3MGD A;  4RI1 A;  3ZZI A;  2Z3M A;  2EBJ A;  1IYL A;  3CPX A;  4KVX A;  3SI1 A;  1DE4 C;  4R9M A;  3SJG A;  6CPA A;  4OME A;  1A2Z A;  4UFW A;  1L0C A;  1CM0 A;  1CG2 A;  1CX8 A;  1YLO A;  2K5T A;  4A38 A;  2CTB A;  4HKF A;  4ZGY B;  3RZA A;  2R8V A;  3DNS A;  4A31 A;  2D4O A;  4IUS A;  1AMP A;  4FD5 A;  3TCV A;  4AB7 A;  1YLE A;  4C2X A;  4OC4 A;  1M4I A;  3TO6 A;  3FJU A;  5F48 A;  1BPM A;  2B5G B;  2P6E A;  1Z4R A;  3D7G A;  3KAS A;  2PVV A;  4C2Y A;  3MRU A;  3VWD A;  2G0B A;  1XFO A;  3IU2 A;  1P0H A;  2HC9 A;  1HDQ A;  2G3T A;  2I3C A;  2OU2 A;  4MCQ A;  5H84 A;  4U9Z A;  4KOS A;  4JZ0 A;  1MJA A;  3EC4 A;  4LX9 A;  3S6G A;  5CPA A;  5IB9 A;  5K8M A;  4KSF A;  1R43 A;  3VAR A;  3R9G A;  5JQ4 A;  2Q4Z A;  4GS4 A;  2FE7 A;  2C6P A;  4AG9 A;  2PJ2 A;  3RO0 A;  5IX3 A;  1MJB A;  4ZY2 A;  3KL9 A;  5K8N A;  1RXT A;  2FVG A;  3RYO A;  4QUS A;  1YR0 A;  2WPW A;  4DJL A;  5JGF A;  1Z4E A;  2VI7 A;  4YFJ A;  2QVP A;  4BD9 A;  1WK4 A;  3D8P A;  5I4M A;  2ZEL A;  4OKO A;  4CYO A;  4YRH A;  5FVJ A;  4CGO A;  1ZLH A;  1KUV A;  3FYN A;  3V8I A;  4A95 A;  4UCM A;  4R57 A;  4B5O A;  1KUX A;  2BL1 A;  2PQ8 A;  4JLY A;  4PXD A;  4QB9 A;  4P4I A;  2B4B A;  4LUA A;  3TT2 A;  3UY5 A;  1M1D A;  2PJ0 A;  3L2N A;  1Z9U A;  3G3S A;  2Z3P A;  3B3V A;  4G1P A;  1IY7 A;  2Q44 A;  2QML A;  4QC6 A;  2ZW5 A;  1PU9 A;  1ELL P;  3BJ7 A;  3TTH A;  4DYO A;  1IIC A;  3S6H A;  2XEJ A;  4NGP A;  2WUU A;  2BCO A;  3IO1 A;  4FD4 A;  4UBR A;  3SJE A;  1TKF A;  2GAN A;  4NGT A;  3TX8 A;  2PC1 A;  4F0X A;  2ZOG A;  5HVG A;  2CNT A;  2VBQ A;  2R1I A;  3K9U A;  2C1C A;  4MY3 A;  4IAV A;  3IWE A;  3KR5 A;  2P0W A;  4KOT A;  3R9F A;  4M3S A;  4AVA A;  4H89 A;  4M6I A;  2FIA A;  1M4D A;  2CNM A;  1PYT B;  1RTQ A;  3PZJ A;  4CRY B;  2C6G A;  1Y0R A;  2V77 A;  3CXQ A;  3CPA A;  5F46 A;  1YRE A;  4AVC A;  2EWB A;  2KCW A;  1X10 A;  2B5G A;  1LRZ A;  2PJB A;  2WZN A;  4L8A A;  4B14 A; 
#chains in the Genus database with same CATH homology
 2AJ6 A;  3TFY A;  2FL4 A;  1Q2Y A;  4Y49 C;  5J8C A;  2JDC A;  2JLM A;  4MFZ A;  5KTC A;  3DSB A;  2WSA A;  1NMT A;  1J4J A;  3S6K A;  2EUI A;  4B5P B;  4IF5 A;  4Q36 A;  2PDO A;  2HQY A;  5JPH A;  4K30 A;  5E96 A;  1UFH A;  2OZH A;  3BLN A;  3PGP A;  3C26 A;  4A30 A;  4MJ8 A;  4RS2 A;  4U9Y A;  3FRM A;  4PSX A;  1S7F A;  1Q2D A;  3VWE A;  4L89 A;  5IB0 A;  1S5K A;  4UCP A;  3PP9 A;  1BOB A;  4PK2 A;  3DR8 A;  4KLV A;  2R98 A;  5ISV A;  2C27 A;  2Q7B A;  4AVB A;  4E0A A;  5CNP A;  3SXO A;  5IV0 A;  5EC4 A;  2CXA A;  4ORF A;  1IID A;  4HNX B;  4E8O A;  2ZXV A;  1NE9 A;  2YGW A;  3G8W A;  5F47 A;  3IU1 A;  4CAX A;  4CYP A;  1RO5 A;  4PK3 A;  4XPL A;  4DNC A;  3H4Q A;  3R9E A;  3N7Z A;  4KSA A;  5J8F A;  5A28 A;  2GE3 A;  2PSW A;  2DXQ A;  2OH1 A;  1FY7 A;  2PR8 A;  1Y9K A;  4KOR A;  1YVO A;  2JEV A;  4PSW A;  1QSO A;  1Q2C A;  1XE4 A;  2FS5 A;  2Z3O A;  2BUE A;  1VKC A;  2WPX A;  4XNH C;  1K4J A;  2DPS A;  1QSN A;  3D2P A;  3W91 A;  4MHD A;  4F0Y A;  1YK3 A;  1QST A;  4B13 A;  4KOV A;  4CAW A;  1YVK A;  4R3K A;  3DR6 A;  4R3L A;  2Z3L A;  1SQH A;  4JWP A;  1N71 A;  1GHE A;  4B10 A;  3LOD A;  4KS9 A;  4A2Z A;  4UWI A;  4KOY A;  1S3Z A;  2YNC A;  3T9Y A;  2ARH A;  4HNY B;  4CYQ A;  2F5I A;  2Q4V A;  5F49 A;  4R87 A;  4C7H A;  4U5Y A;  4E2A A;  2FXF A;  1V0C A;  2YNC C;  4CYN A;  3F0A A;  4Q38 A;  2ATR A;  2Z0Z A;  2FIW A;  2VXK A;  3WR7 A;  4ONU A;  2Q0Y A;  4KOX A;  1WWZ A;  4MFL A;  4JXQ A;  2RC4 A;  1ZO0 A;  2B3V A;  1XMT A;  4UFX A;  3P2F A;  4KVO E;  4CS0 B;  4B11 A;  2GIV A;  4UWJ A;  2B4D A;  5G20 A;  3CXP A;  4NXY A;  3NE7 A;  5A27 A;  3I9S A;  4YGO A;  1NSL A;  2J8M A;  4UFV A;  3EY5 A;  3R95 A;  5G21 A;  1S7N A;  5BWA B;  1S60 A;  3GYA A;  2I00 A;  2ZW7 A;  2FT0 A;  2REF A;  3KKW A;  3S6F A;  3JTK A;  2QEC A;  1Y9W A;  2REE A;  5I0C A;  4F6A A;  5DWM A;  1IB1 E;  1S7L A;  1OZP A;  2VZY A;  3FXT A;  3TO7 A;  4OAD A;  3TO9 A;  4B5P A;  5G1Z A;  1QSM A;  4II9 A;  5AGE A;  4QBJ A;  5GCN A;  4KZT A;  4J3G A;  5C88 A;  1MK4 A;  4Y49 B;  3DDD A;  2I79 A;  3R1K A;  4MFQ A;  1I12 A;  1MJ9 A;  5AG5 A;  4KUA A;  4A32 A;  4EVY A;  4CAV A;  3EFA A;  3JVN A;  3W6S A;  4XNH B;  4UCN A;  2OZG A;  1I21 A;  4NSQ A;  3QB8 A;  4MBU A;  3EO4 A;  2B4D B;  1B87 A;  4UA3 A;  5G22 A;  4PV6 A;  2VZZ A;  2ZPA A;  3P2H A;  2HV2 A;  4KUB A;  2J8R A;  4CRZ B;  4XPK A;  4JD6 A;  1PUA A;  4FD7 A;  3T90 A;  4C68 A;  3QAH A;  1VHS A;  2P6F A;  2ZW6 A;  3R96 A;  3H5Z A;  2NMT A;  2EVN A;  2G3A A;  3CXS A;  3D2M A;  4CAF A;  5C82 A;  4QVT A;  3ZJ0 A;  1I1D A;  3D3S A;  3IWG A;  4MFJ A;  5AG7 A;  4KVM E;  5DWN A;  4KOW A;  4B12 A;  4CAE A;  3F8K A;  3F5B A;  2FSR A;  3I3G A;  3B8G A;  5HH1 A;  4A33 A;  2P6G A;  3GY9 A;  2CY2 A;  4M85 A;  4NCZ A;  2Z11 A;  3FIX A;  2YNE A;  3TOB A;  2O28 A;  1ON0 A;  4OLL A;  2AE6 A;  4AG7 A;  5AG4 A;  1IYK A;  3BJ8 A;  2PR1 A;  3JUW A;  2HUZ A;  2VQY A;  3FBU A;  2FCK A;  4NEX A;  2CNS A;  1XEB A;  4BBH A;  2B3U A;  1XF8 A;  4H6U A;  2PRB A;  1M4G A;  1M44 A;  2Z3K A;  1CJW A;  2J8N A;  1YGH A;  3FNC A;  4OAE A;  1KZF A;  4I49 A;  4MFP A;  2B58 A;  2D4P A;  3GKR A;  5H86 A;  3IGR A;  4FD6 A;  1KUY A;  3E0K A;  2BEI A;  2R7H A;  2ZW4 A;  2Q4Y A;  4MFK A;  2H5M A;  5AG6 A;  5KTA A;  1S7K A;  4KLW A;  3FB3 A;  2OZU A;  5HMN A;  1R57 A;  1U6M A;  1P4N A;  2Z3N A;  4BMH A;  2Y0M A;  2VEZ A;  3EXN A;  4C2Z A;  4XPD B;  3SHP A;  2QIR A;  4JJX A;  1B6B A;  2Q04 A;  1YX0 A;  2BSW A;  4H6Z A;  3W6X A;  4C7I A;  4XPD C;  4CGM A;  1Y7R A;  3OWC A;  4MY0 A;  5KTD A;  4CGN A;  4JXR A;  4X5K A;  3LD2 A;  2Z10 A;  2X7B A;  3A9L A;  4HNW B;  3TOA A;  5EBV A;  2YND A;  1QSR A;  4NF1 A;  2JDD A;  2A4N A;  4ZBG A;  2OB0 A;  3SXN A;  4MI4 A;  3TE4 A;  1XIX A;  1BO4 A;  4CGP A;  4CGL A;  1TIQ A;  4KOU A;  2DPT A;  3MGD A;  2IL4 A;  4RI1 A;  3ZZI A;  2Z3M A;  1IYL A;  4KVX A;  4R9M A;  4UFW A;  1L0C A;  1CM0 A;  2K5T A;  4HKF A;  4ZGY B;  2R8V A;  3DNS A;  4A31 A;  2D4O A;  4IUS A;  4FD5 A;  4AB7 A;  3TCV A;  1YLE A;  4C2X A;  1M4I A;  3TO6 A;  5F48 A;  2B5G B;  2P6E A;  1Z4R A;  4C2Y A;  3VWD A;  2G0B A;  3IU2 A;  1P0H A;  5H84 A;  2G3T A;  2OU2 A;  4U9Z A;  4KOS A;  1MJA A;  3EC4 A;  4LX9 A;  3S6G A;  4KSF A;  3R9G A;  5JQ4 A;  4GS4 A;  2FE7 A;  4AG9 A;  5IX3 A;  1MJB A;  1RXT A;  3RYO A;  4QUS A;  1YR0 A;  2WPW A;  1Z4E A;  2VI7 A;  4YFJ A;  1WK4 A;  3D8P A;  4CYO A;  4YRH A;  5FVJ A;  4CGO A;  1KUV A;  3FYN A;  3V8I A;  4A95 A;  4UCM A;  4R57 A;  4B5O A;  1KUX A;  2BL1 A;  2PQ8 A;  4JLY A;  4QB9 A;  2B4B A;  4LUA A;  3TT2 A;  3UY5 A;  1M1D A;  1Z9U A;  3G3S A;  2Z3P A;  2Q44 A;  2QML A;  4QC6 A;  2ZW5 A;  1PU9 A;  3BJ7 A;  3TTH A;  1IIC A;  3S6H A;  2WUU A;  4UBR A;  4FD4 A;  2GAN A;  2PC1 A;  4F0X A;  2CNT A;  2VBQ A;  2R1I A;  3K9U A;  4MY3 A;  3IWE A;  2P0W A;  4KOT A;  3R9F A;  4M3S A;  4AVA A;  4H89 A;  2FIA A;  1M4D A;  2CNM A;  4CRY B;  3PZJ A;  3CXQ A;  5F46 A;  1YRE A;  4AVC A;  2KCW A;  2B5G A;  1LRZ A;  4L8A A;  4B14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...