3W6XA

Yeast n-acetyltransferase mpr1 in complex with chop
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
225
structure length
225
Chain Sequence
SIEWKLTANLRNGPTFFQPLADSIEPLQFKLIGSDTVATAFPVFDTKYIPDSLINYLFKLFNLEIESGKTYPQLHSLTKQGFLNYWFHSFAVVVLQTDEKFIQDNQDWNSVLLGTFYIKPNYAPRCSHNCNAGFLVNGAHRGQKVGYRLAQVYLNWAPLLGYKYSIFNLVFVTNQASWKIWDKLNFQRIGLVPHAGILNGFSEPVDAIIYGKDLTKIEPEFLSME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MPR1 protein
publication title Structural and functional analysis of the yeast N-acetyltransferase Mpr1 involved in oxidative stress tolerance via proline metabolism
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 63
structure length 225
sequence length 225
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.271: L-glutamate-5-semialdehyde N-acetyltransferase.
pdb deposition date 2013-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3w6xA00
2OB0A 3W91A 4E2AA 4DNCA 3R9FA 1NE9A 4MJ8A 3FIXA 2OH1A 3GKRA 1IIDA 3PGPA 4GS4A 3W6XA 4B5PB 4KUAA 2VQYA 1S7KA 3EY5A 4IF5A 4HNYB 2O28A 4NSQA 2Q44A 3B8GA 2Z11A 2CY2A 4HKFA 3TFYA 2JEVA 4NCZA 1P4NA 3I9SA 3PP9A 2D4OA 2CNTA 1KZFA 3ZZIA 2R1IA 2FCKA 2WPWA 3PZJA 5HH1A 2NMTA 2P6FA 1IYLA 2FXFA 5HMNA 5IB0A 2PR8A 4U9ZA 2JDDA 3TT2A 4E0AA 3DR6A 3G3SA 1NMTA 3CXQA 4ONUA 2ZW6A 3P2FA 2J8RA 2ZXVA 3FYNA 4PSWA 4JXRA 4PK3A 4IUSA 1Z4EA 4FD4A 2F5IA 1RXTA 1MK4A 3DNSA 2HQYA 1SQHA 2J8MA 3D3SA 4EVYA 1IB1E 2Q04A 3CXPA 5F47A 1S60A 4UWJA 3F8KA 1YGHA 4H6UA 4U5YA 2QIRA 3FXTA 1KUXA 1S7FA 3S6KA 2PRBA 4KVME 2B3VA 4AB7A 5I0CA 1MJBA 4R87A 3F0AA 2R7HA 5J8CA 4QBJA 2B5GB 2REEA 2R98A 4CAXA 4KORA 4BMHA 5DWMA 4OLLA 4E8OA 1M4IA 3VWDA 4LUAA 1Q2DA 4PSXA 1QSTA 4U9YA 2FT0A 1M4GA 1Y9KA 2BUEA 2I00A 4J3GA 4JD6A 2VBQA 4XPLA 4JXQA 1NSLA 1YR0A 2A4NA 3C26A 4KOTA 1FY7A 1M1DA 5CNPA 4KVXA 2BSWA 1LRZA 3JUWA 2P0WA 2D4PA 3I3GA 3EXNA 3TCVA 2K5TA 3S6FA 1MJAA 3GY9A 3JVNA 2B4DB 1RO5A 1WWZA 4QC6A 4KVOE 4QVTA 3TOAA 1YK3A 1J4JA 4LX9A 4YRHA 4OADA 5ISVA 1XE4A 4XPKA 4CAVA 2PR1A 2G3AA 4PK2A 5C88A 2J8NA 4PV6A 4II9A 2VZZA 3TO6A 3CXSA 1QSOA 4UWIA 2OU2A 1Z4RA 2ZW7A 4OAEA 4CAWA 2ATRA 1L0CA 2PQ8A 4CRZB 3SHPA 4MHDA 1S5KA 2PDOA 3N7ZA 2FSRA 4HNWB 1QSNA 1Y9WA 2FL4A 2VZYA 4KOVA 1YLEA 4H6ZA 2JDCA 4QUSA 4XNHB 2GANA 2B5GA 2OZGA 5JPHA 4KLWA 2PSWA 4KZTA 1P0HA 4KOYA 4M85A 2C27A 2BL1A 5KTDA 1OZPA 2Z0ZA 2ZW5A 5FVJA 3RYOA 2FIWA 4AVCA 1IICA 2OZHA 5IX3A 1YX0A 3R96A 5JQ4A 2ARHA 3IGRA 3R9EA 2B3UA 2VXKA 4YGOA 3FB3A 4MI4A 5E96A 2VI7A 1KUYA 3D8PA 4NEXA 4UBRA 5F48A 1K4JA 3P2HA 4FD6A 1S7NA 2DXQA 4XNHC 4B5PA 3R9GA 2B4DA 2VEZA 4RI1A 1N71A 1VKCA 1YREA 4R3KA 1S7LA 4NXYA 4K30A 3D2MA 3E0KA 1YVKA 1I21A 2BEIA 4JLYA 2QMLA 4RS2A 2QECA 4KOXA 4UA3A 1Q2YA 1KUVA 3FBUA 3K9UA 3TO7A 1PU9A 3TE4A 4MY3A 1BOBA 5F49A 2Y0MA 3F5BA 4AVBA 4L89A 4Y49B 2REFA 2JLMA 1XF8A 3TTHA 1B6BA 2FE7A 2H5MA 4KUBA 5EBVA 3BJ7A 4CS0B 1I12A 5C82A 4QB9A 1M4DA 2HUZA 2Q4VA 4JWPA 3G8WA 4R57A 1BO4A 2I79A 1MJ9A 4KLVA 1PUAA 3LODA 3R1KA 3DSBA 1GHEA 3BJ8A 4FD5A 1M44A 4FD7A 2KCWA 3LD2A 2G3TA 3TOBA 4NF1A 4F0YA 2CNMA 3R95A 4Y49C 1TIQA 2B4BA 2GE3A 1Y7RA 2ZW4A 2Q4YA 1XEBA 2FS5A 1YVOA 2ZPAA 3WR7A 2X7BA 5DWNA 4L8AA 4KOWA 2EVNA 3EC4A 4I49A 1ON0A 1V0CA 2PC1A 5EC4A 4ZBGA 1QSRA 3D2PA 2GIVA 1Q2CA 3VWEA 3BLNA 4ORFA 2P6EA 2Q0YA 5J8FA 1S3ZA 5KTCA 3S6HA 5H84A 4H89A 4MY0A 1CM0A 3TO9A 3T90A 2FIAA 4XPDB 1XMTA 5F46A 3T9YA 5IV0A 3DR8A 5GCNA 5KTAA 2WPXA 2R8VA 3GYAA 3UY5A 4AG7A 2G0BA 4X5KA 2Q7BA 4F6AA 2HV2A 3EO4A 4R9MA 3IWGA 4AVAA 3SXOA 4AG9A 4KOUA 4CRYB 4YFJA 1XIXA 1VHSA 3OWCA 3V8IA 1I1DA 4KOSA 1QSMA 1CJWA 1UFHA 3SXNA 3S6GA 1R57A 1WK4A 1Z9UA 3KKWA 2AJ6A 1IYKA 2P6GA 3ZJ0A 2B58A 4M3SA 3W6SA 4B5OA 3QAHA 2IL4A 2AE6A 2EUIA 3H4QA 4MBUA 1U6MA 3QB8A 5H86A 4XPDC 2Z10A 3DDDA 3NE7A 3FNCA 2OZUA 3MGDA 4HNXB 3FRMA 1B87A 2RC4A 2CNSA 3EFAA 4R3LA 4JJXA
chains in the Genus database with same CATH superfamily
4MHYA 2OB0A 4YWYA 3W91A 1BLLE 2YNDA 2FVGA 2PVVA 3H8FA 3JTKA 1ZG9A 4C7HA 4E2AA 4DNCA 3R9FA 1NE9A 4MJ8A 5IB9A 1ARLA 3FIXA 2OH1A 3VARA 1CPXA 3GKRA 1IIDA 3KL9A 3RO0A 4HPSA 3PGPA 4GS4A 2O4HA 3W6XA 4B5PB 4JYWA 4NGTA 4IHMA 4KUAA 2EWBA 2VQYA 3IU2A 4LQGA 5JM6A 1R3NA 1S7KA 4PXBA 3EY5A 4IF5A 1Z2LA 4HNYB 1FT7A 2CIJA 3B3SA 4OC1A 2O28A 4PQAA 4NSQA 4UFWA 1H8LA 1XBUA 2Q44A 2EK9A 3B8GA 3GIUA 2CTBA 2Z11A 1VIXA 2CY2A 2QYVA 4HKFA 2JEVA 4A33A 3TFYA 4NCZA 1TKFA 2PJ8A 1P4NA 3I9SA 3PP9A 2PJ4A 2D4OA 2CNTA 2V8HA 7CPAA 2AFZA 4ZGYB 4X8IA 1AUGA 2Z3LA 3B35A 4MXUA 1KZFA 3ZZIA 2R1IA 4R8FA 2FCKA 3SI1A 3NH4A 2XEFA 3CZXA 5CBMA 5AG6A 3KHXA 2WPWA 3PZJA 5HH1A 2J9AA 2NMTA 3SJXA 5JH9A 3GB0A 2P6FA 2PJ9A 3WABA 5G20A 2ANPA 3SJGA 4A31A 1IYLA 2FXFA 4MHZA 2ZEOA 4P4JA 4EWTA 5HMNA 5IB0A 1UWYA 2PR8A 4U9ZA 2JDDA 3TT2A 1PYTB 4ZX9A 3TC8A 1IY7A 5K8OA 4E0AA 3DR6A 3G3SA 1NMTA 4Z65A 3CXQA 4ONUA 2ZW6A 2WYRA 3P2FA 6CPAA 1CP6A 2J8RA 2ZXVA 3FYNA 4PSWA 1RTQA 4JXRA 3FJUA 4PK3A 4IUSA 2PJAA 1Z4EA 1ZO0A 2F5IA 2PRQA 1RXTA 4FD4A 2CF4A 1MK4A 3DNSA 3BI0A 2CXAA 5AGEA 5D29A 2HQYA 1SQHA 2J8MA 3WT4A 3D3SA 4EFDA 4EVYA 2PJ2A 1IB1E 2Q04A 4ZY0A 3CXPA 4PXDA 1S60A 2XEGA 5F47A 4UWJA 3F8KA 4Q38A 2AFWA 3ISZA 1YGHA 4H6UA 4U5YA 2QIRA 3D4UA 1KUXA 3BXMA 3FXTA 1S7FA 3PB7X 4MFZA 3S6KA 3T8WA 4OC0A 1TF8A 2PRBA 4W9YA 4KVME 2B3VA 4AB7A 5I0CA 1MJBA 4R87A 3F0AA 4UIAA 3FH4A 2R7HA 4NFRA 4MHNA 4QBJA 4DUKA 5J8CA 2B5GB 1QQ9A 4BD9A 3NE8A 2R98A 2REEA 4CAXA 1XRYA 2YNEA 5K8PA 2PJCA 2RFHA 3V38A 4NGSA 4A2ZA 2YNCA 3KASA 4A37A 4CYNA 4KORA 5DS0A 4BMHA 4M6IA 3SI2A 1ZLIA 4P4IA 1YSJA 2C1CA 2PE3A 2EK8A 3H8GA 4OLLA 1TKHA 2ZEHA 5DWMA 1HDUA 3NH5A 4AXVA 4E8OA 1M4IA 4YU9A 2ZEEA 4LUAA 3VWDA 5HVFA 4MHPA 3D7FA 1Q2DA 4PSXA 1QSTA 2IJZA 2F7VA 2PCUA 2HB6A 4U9YA 2FT0A 4OMEA 1M4GA 1Y9KA 2BUEA 2I00A 3QAYA 4FAIA 4J3GA 2V8GA 4JD6A 1IU8A 4OC4A 2EBJA 2VBQA 4XPLA 5CPAA 4JXQA 1NSLA 1YR0A 2Z3OA 4DJLA 2A4NA 2EO8A 3C26A 4FBEA 4P4DA 4KOTA 2POKA 3MN8A 3PB8X 1FY7A 2AFUA 1M1DA 4OIWA 5CNPA 4FUUA 3D67A 3PBBA 4KVXA 4UEZA 2BSWA 2PJ6A 1LRZA 1XJOA 4Q36A 3DLJA 5HVGA 3JUWA 1OBRA 2P0WA 4UFVA 1EE3P 2D4PA 4ZYQA 2Z3KA 3EXNA 3B3VA 3I3GA 3TCVA 1QMUA 4B13A 2K5TA 1VGYA 3S6FA 1NSAA 1MJAA 1ELLP 3GY9A 3JVNA 4F0XA 2B4DB 1RO5A 1CG2A 1Z8XA 1WWZA 4QC6A 2C6CA 4KSFA 4KVOE 4QVTA 3TOAA 4BBHA 4FWUA 1YK3A 3HUVA 1J4JA 2ZELA 4LX9A 4X2TA 5AG7A 4O23A 4P4FA 4OADA 4YRHA 4CGNA 4BINA 4M6HA 3IWWA 2V8VA 2DEAA 4NGRA 1BAVA 4KS9A 1ARMA 5ISVA 3WC6A 1XE4A 4XPKA 4CAVA 2PR1A 3IC1A 1ZLHA 3FF3A 2G3AA 4PK2A 5C88A 4ONWA 2J8NA 4PV6A 4II9A 2VZZA 3KQZA 3TO6A 3FEEA 3PFEA 4MFLA 3CXSA 4P44A 4PXEA 4CGPA 1QSOA 4UWIA 2OU2A 1Z4RA 4F8ZA 1XOVA 2ZW7A 3PBEA 4MCQA 4OAEA 4P45A 2NYQA 2ATRA 4CAWA 3PB9X 4A32A 1L0CA 2PQ8A 3GLJA 2PJ1A 3SHPA 4CRZB 3FMCA 2OR4A 4MHDA 3SI0A 1S5KA 2PDOA 4P10A 2PJ7A 4LQ6A 4CAEA 3N7ZA 2FSRA 5EMIA 4HNWB 3NFZA 5BWAB 2JEWA 2ODFA 1QSNA 1LOKA 3QNVA 3FX6A 4NGNA 4WJBA 4A38A 3KI9A 4P4BA 5LYDA 2QVPA 5LRJA 5LYFA 1Y9WA 2FL4A 2VZYA 4G1PA 4KOVA 2OOTA 3LMSA 1YLEA 4H6ZA 2YGWA 3L2NA 2JDCA 4QUSA 4XNHB 8CPAA 4UEFA 2GANA 3B3CA 2B5GA 2OZGA 3FEDA 3KZWA 5JGFA 1Z8LA 1Y0RA 2AFSA 2ZEDA 3ISXA 3V7ZA 5JPHA 3B7IA 3IEHA 4KLWA 2PSWA 1Z8WA 2ZEGA 4KZTA 1P0HA 4KOYA 2C6GA 4M85A 2CTCA 4NJQA 4B12A 2C27A 2PJBA 4MCSA 2BL1A 5KTDA 1OZPA 2Z0ZA 3PEIA 4R7MA 2ZW5A 1LCPA 3A9LA 5FVJA 1BPMA 2FIWA 3RYOA 4AVCA 4B11A 3HLPA 3S9LA 3SJEA 1IICA 4A30A 2OZHA 4MFKA 5IX3A 1YX0A 4X3RA 3R96A 3D7HA 2Z3MA 1YW4A 5JQ4A 1LANA 2ARHA 3IGRA 4NGMA 4PPZA 5G21A 3R9EA 4CGMA 4F9VA 3SJFA 2B3UA 2VXKA 3B3WA 4PXCA 1CX8A 4YGOA 4KSAA 3FB3A 4MI4A 1CPSA 4C7IA 5LRGA 5E96A 3BI1A 2Z3NA 3FECA 2VI7A 1KUYA 3D8PA 4NEXA 1ELMP 3IO1A 4UBRA 4A95A 3H8EA 5AG4A 4IAVA 4CYQA 3IFEA 3S9MA 4UCPA 3NH8A 4B10A 1X10A 2PIZA 2ZEFA 5F48A 5J1QA 1K4JA 2GLJA 2XEJA 3P2HA 1S7NA 2DXQA 4FD6A 4XNHC 4B14A 4TWEA 2C6PA 4B5PA 3R9GA 2B4DA 1Y7EA 2VEZA 4RI1A 1N71A 1GYTA 1VKCA 1YREA 3VATA 4A39A 5K8NA 1TKJA 2PIYA 4R3KA 1S7LA 4NXYA 4K30A 4GM5A 4K3NA 3RAMA 4RN7A 2JBJA 3D2MA 2G9DA 2V77A 3PB4X 2RB7A 1IGBA 3E0KA 3WC7A 1YVKA 2Q51A 1I21A 5HXDA 2BEIA 4JLYA 1AYEA 3BHXA 3KHZA 2IQ6A 1TXRA 2QMLA 5HVHA 4H2KA 4B6ZA 3CPXA 4OIDA 4RS2A 2QECA 4C2YA 3RNZA 4KOXA 2PVWA 3D68A 4UA3A 1Q2YA 4UEEA 1KUVA 1X12A 3FBUA 4ZY1A 3B2YA 1F2OA 3K9UA 3GUXA 3TO7A 5LRKA 1PU9A 3PFOA 3TE4A 4MY3A 2DPSA 4UFXA 1BOBA 3NA6A 3IWEA 2QJ8A 4P4EA 5F49A 1XMBA 2Y0MA 3F5BA 4ZX8A 4CGOA 4AVBA 4L89A 2PJ5A 3KR4A 2REFA 4Y49B 2JLMA 1XF8A 1Q7LA 3TTHA 4TNUA 1Z8TA 2XEIA 2V8DA 2WZNA 1B6BA 4WWVA 2FE7A 2H5MA 4KUBA 5AG5A 1CP7A 1VHEA 2VL1A 5EBVA 3BJ7A 4Q7AA 5F09A 1Y0YA 4CS0B 1I12A 2Q4ZA 5C82A 4QB9A 1M4DA 2GU2A 2GREA 4CYOA 2I3CA 2HUZA 4MMOA 5K8MA 2Q4VA 2O53A 3N5FA 4JWPA 4M6GA 3G8WA 5A28A 4R57A 1BO4A 2I79A 3K2KA 4OC2A 4UIBA 1MJ9A 2PJ3A 4KLVA 1PUAA 3LODA 3R1KA 3DSBA 1GHEA 1A2ZA 3BJ8A 4RUHA 3CT9A 1M44A 4FD5A 4FD7A 2ZOGA 2DF5A 4KSIA 2KCWA 3LD2A 2G3TA 4NGQA 3RZAA 3D7DA 4DYOA 4R76A 1HEEA 1PCAA 4UCNA 1IOIA 3H5ZA 4MCRA 3TOBA 3IIBA 4MFQA 4NF1A 1LFWA 1YQEA 4F0YA 5G22A 2BO9A 3KQXA 4C68A 3RBUA 2CNMA 2GLFA 3R95A 1XFOA 4C2ZA 4Y49C 1DE4C 1TIQA 2B4BA 4C2XA 3PRTA 3JRUA 2GE3A 4MFJA 1FNOA 1M4LA 1Y7RA 3D66A 4R6TA 4OKOA 4CYPA 4A94A 1AMPA 2DPTA 2Q4YA 2ZW4A 3KGQA 1XEBA 2FS5A 1YVOA 2ZPAA 3WR7A 3IU1A 4OC3A 2AFXA 2X7BA 3B3TA 5LYIA 5DWNA 4L8AA 1BPNA 4KOWA 2EVNA 3EC4A 4I49A 1ON0A 1V0CA 2PC1A 2Q43A 2YNCC 5EC4A 3D7GA 5ELYA 4ZBGA 5G1ZA 1QSRA 3D2PA 5I4MA 2ZEPA 2GIVA 1Q2CA 3VWEA 1IOFA 3BLNA 3KR5A 4ORFA 4NGPA 4CAFA 2JBKA 2P6EA 2Q0YA 1HDQA 5J8FA 1S3ZA 5KTCA 3S9NA 3S6HA 5H84A 4H89A 4MY0A 1DTDA 4F9UA 1CBXA 1CM0A 1F57A 3K9TA 3T90A 3TO9A 2FIAA 4XPDB 4P6YA 1XMTA 3IJ3A 1JQGA 3LWUA 5F46A 3T9YA 5IV0A 3DR8A 5GCNA 4MFPA 5A27A 2ZOFA 5KTAA 2WPXA 2R8VA 3GYAA 2NSMA 3UY5A 1LAMA 2G0BA 4AG7A 4MRIA 4X5KA 2Q7BA 1YW6A 4F6AA 2HV2A 3DGVA 2ABZA 3EO4A 1VHOA 2AFOA 3TX8A 2HC9A 4R9MA 4EMEA 1KWMA 2Q7SA 3IWGA 4AVAA 3SXOA 4AG9A 4KOUA 3PB6X 4CRYB 2BOAA 4GXHA 4JZ0A 1TF9A 2Z3PA 1YLOA 4YFJA 1XIXA 1VHSA 3OWCA 3V8IA 1I1DA 1QSMA 4KOSA 1CJWA 1UFHA 2WSAA 4CPAA 3SXNA 4OP4A 3S6GA 4MCPA 1R57A 5LYLA 1WK4A 1Z9UA 3KKWA 2PJ0A 2AJ6A 2ZENA 1IYKA 1F2PA 2P6GA 3ZJ0A 2B58A 4UF4A 4NJRA 4M3SA 2WUUA 3W6SA 3VH9A 4B5OA 3QAHA 2IL4A 2AE6A 3CDXA 4IK2A 2EUIA 2F8HA 2IMOA 3H4QA 5D8NA 1JWQA 4MBUA 1U6MA 1Z5RA 3QB8A 5H86A 4XPDC 2BCOA 4ZY2A 3FVLA 3MRUA 1LAPA 2Z10A 3DDDA 3FNCA 2OZUA 3NE7A 1R43A 3LACA 1ZG8A 3MGDA 4HNXB 3FRMA 3I1UA 4ZI6A 1B87A 3CPAA 2GFQA 2RC4A 2ZEMA 1YMEA 2CNSA 4CGLA 1ZG7A 3EFAA 2AFMA 3WC5A 4UCMA 5THWA 4OC5A 4R3LA 4JJXA
chains in the Genus database with same CATH topology
2OB0A 3W91A 2YNDA 3JTKA 4E2AA 4C7HA 4DNCA 3R9FA 1NE9A 4MJ8A 3FIXA 2OH1A 3GKRA 1IIDA 3PGPA 4GS4A 3W6XA 4B5PB 4KUAA 2VQYA 3IU2A 1S7KA 3EY5A 4IF5A 4HNYB 2O28A 4NSQA 4UFWA 2Q44A 3B8GA 2Z11A 2CY2A 4HKFA 3TFYA 2JEVA 4A33A 4NCZA 1P4NA 3I9SA 3PP9A 2D4OA 2CNTA 4ZGYB 2Z3LA 1KZFA 3ZZIA 2R1IA 2FCKA 5AG6A 2WPWA 3PZJA 5HH1A 2NMTA 2P6FA 5G20A 4A31A 1IYLA 2FXFA 5HMNA 5IB0A 2PR8A 4U9ZA 2JDDA 3TT2A 4E0AA 3DR6A 3G3SA 1NMTA 3CXQA 4ONUA 2ZW6A 3P2FA 2J8RA 2ZXVA 3FYNA 4PSWA 4JXRA 4PK3A 4IUSA 1Z4EA 1ZO0A 2F5IA 4FD4A 1RXTA 1MK4A 3DNSA 2CXAA 5AGEA 2HQYA 1SQHA 2J8MA 3D3SA 4EVYA 1IB1E 2Q04A 3CXPA 5F47A 1S60A 4UWJA 3F8KA 4Q38A 1YGHA 4H6UA 4U5YA 2QIRA 3FXTA 1KUXA 4MFZA 1S7FA 3S6KA 2PRBA 4KVME 2B3VA 4AB7A 5I0CA 1MJBA 4R87A 3F0AA 2R7HA 5J8CA 4QBJA 2B5GB 2REEA 2R98A 4CAXA 2YNEA 4A2ZA 4CYNA 2YNCA 4KORA 4BMHA 5DWMA 4OLLA 4E8OA 1M4IA 3VWDA 4LUAA 1Q2DA 4PSXA 1QSTA 4U9YA 2FT0A 1M4GA 1Y9KA 2BUEA 2I00A 4J3GA 4JD6A 2VBQA 4XPLA 4JXQA 1NSLA 1YR0A 2Z3OA 2A4NA 3C26A 4KOTA 1FY7A 1M1DA 5CNPA 4KVXA 2BSWA 1LRZA 4Q36A 3JUWA 2P0WA 4UFVA 2D4PA 2Z3KA 3EXNA 3I3GA 3TCVA 4B13A 2K5TA 3S6FA 1MJAA 3GY9A 3JVNA 4F0XA 2B4DB 1RO5A 1WWZA 4QC6A 4KSFA 4KVOE 4QVTA 3TOAA 4BBHA 1YK3A 1J4JA 4LX9A 5AG7A 4CGNA 4YRHA 4OADA 4KS9A 5ISVA 1XE4A 4XPKA 4CAVA 2PR1A 2G3AA 4PK2A 5C88A 2J8NA 4PV6A 4II9A 2VZZA 3TO6A 4MFLA 3CXSA 4CGPA 1QSOA 4UWIA 2OU2A 1Z4RA 2ZW7A 4OAEA 4CAWA 2ATRA 4A32A 1L0CA 2PQ8A 4CRZB 3SHPA 4MHDA 1S5KA 2PDOA 4CAEA 3N7ZA 2FSRA 4HNWB 5BWAB 1QSNA 1Y9WA 2FL4A 2VZYA 4KOVA 1YLEA 4H6ZA 2YGWA 2JDCA 4QUSA 4XNHB 2GANA 2B5GA 2OZGA 5JPHA 4KLWA 2PSWA 4KZTA 1P0HA 4KOYA 4M85A 4B12A 2C27A 2BL1A 5KTDA 1OZPA 2Z0ZA 2ZW5A 3A9LA 5FVJA 3RYOA 2FIWA 4B11A 4AVCA 1IICA 4A30A 2OZHA 4MFKA 5IX3A 1YX0A 3R96A 2Z3MA 5JQ4A 2ARHA 3IGRA 5G21A 3R9EA 4CGMA 2B3UA 2VXKA 4YGOA 4KSAA 3FB3A 4MI4A 4C7IA 5E96A 2Z3NA 2VI7A 1KUYA 3D8PA 4NEXA 4UBRA 4A95A 5AG4A 4CYQA 4UCPA 4B10A 5F48A 1K4JA 3P2HA 4FD6A 1S7NA 2DXQA 4XNHC 4B14A 4B5PA 3R9GA 2B4DA 2VEZA 4RI1A 1N71A 1VKCA 1YREA 4R3KA 1S7LA 4NXYA 4K30A 3D2MA 3E0KA 1YVKA 1I21A 2BEIA 4JLYA 2QMLA 4RS2A 2QECA 4C2YA 4KOXA 4UA3A 1Q2YA 1KUVA 3FBUA 3K9UA 3TO7A 1PU9A 3TE4A 4MY3A 2DPSA 4UFXA 1BOBA 5F49A 3IWEA 4CGOA 2Y0MA 3F5BA 4AVBA 4L89A 4Y49B 2REFA 2JLMA 1XF8A 3TTHA 1B6BA 2FE7A 2H5MA 4KUBA 5AG5A 5EBVA 3BJ7A 4CS0B 1I12A 5C82A 4QB9A 1M4DA 4CYOA 2HUZA 2Q4VA 4JWPA 3G8WA 5A28A 4R57A 1BO4A 2I79A 1MJ9A 4KLVA 1PUAA 3LODA 3R1KA 3DSBA 1GHEA 3BJ8A 4FD5A 1M44A 4FD7A 2KCWA 3LD2A 2G3TA 4UCNA 3H5ZA 3TOBA 4MFQA 4NF1A 4F0YA 5G22A 4C68A 4C2ZA 2CNMA 3R95A 4Y49C 1TIQA 4C2XA 2B4BA 2GE3A 4MFJA 1Y7RA 4CYPA 2DPTA 2ZW4A 2Q4YA 1XEBA 2FS5A 1YVOA 2ZPAA 3WR7A 3IU1A 2X7BA 5DWNA 4L8AA 4KOWA 2EVNA 3EC4A 4I49A 1ON0A 1V0CA 2PC1A 2YNCC 5EC4A 4ZBGA 5G1ZA 1QSRA 3D2PA 2GIVA 1Q2CA 3VWEA 3BLNA 4ORFA 4CAFA 2P6EA 2Q0YA 5J8FA 1S3ZA 5KTCA 3S6HA 5H84A 4H89A 4MY0A 1CM0A 3TO9A 3T90A 2FIAA 4XPDB 1XMTA 5F46A 3T9YA 5IV0A 3DR8A 5GCNA 4MFPA 5A27A 5KTAA 2WPXA 2R8VA 3GYAA 3UY5A 4AG7A 2G0BA 4X5KA 2Q7BA 4F6AA 2HV2A 3EO4A 4R9MA 3IWGA 4AVAA 3SXOA 4AG9A 4KOUA 4CRYB 2Z3PA 4YFJA 1XIXA 1VHSA 3OWCA 3V8IA 1I1DA 1QSMA 4KOSA 1CJWA 1UFHA 2WSAA 3SXNA 3S6GA 1R57A 1WK4A 1Z9UA 3KKWA 2AJ6A 1IYKA 2P6GA 3ZJ0A 2B58A 4M3SA 2WUUA 3W6SA 4B5OA 3QAHA 2IL4A 2AE6A 2EUIA 3H4QA 4MBUA 1U6MA 3QB8A 5H86A 4XPDC 2Z10A 3DDDA 3NE7A 3FNCA 2OZUA 3MGDA 4HNXB 3FRMA 1B87A 2RC4A 2CNSA 4CGLA 3EFAA 4UCMA 4R3LA 4JJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OB0 A;  3W91 A;  4E2A A;  4DNC A;  3R9F A;  1NE9 A;  4MJ8 A;  3FIX A;  2OH1 A;  3GKR A;  1IID A;  3PGP A;  4GS4 A;  3W6X A;  4B5P B;  4KUA A;  2VQY A;  1S7K A;  3EY5 A;  4IF5 A;  4HNY B;  2O28 A;  4NSQ A;  2Q44 A;  3B8G A;  2Z11 A;  2CY2 A;  4HKF A;  3TFY A;  2JEV A;  4NCZ A;  1P4N A;  3I9S A;  3PP9 A;  2D4O A;  2CNT A;  1KZF A;  3ZZI A;  2R1I A;  2FCK A;  2WPW A;  3PZJ A;  5HH1 A;  2NMT A;  2P6F A;  1IYL A;  2FXF A;  5HMN A;  5IB0 A;  2PR8 A;  4U9Z A;  2JDD A;  3TT2 A;  4E0A A;  3DR6 A;  3G3S A;  1NMT A;  3CXQ A;  4ONU A;  2ZW6 A;  3P2F A;  2J8R A;  2ZXV A;  3FYN A;  4PSW A;  4JXR A;  4PK3 A;  4IUS A;  1Z4E A;  4FD4 A;  2F5I A;  1RXT A;  1MK4 A;  3DNS A;  2HQY A;  1SQH A;  2J8M A;  3D3S A;  4EVY A;  1IB1 E;  2Q04 A;  3CXP A;  5F47 A;  1S60 A;  4UWJ A;  3F8K A;  1YGH A;  4H6U A;  4U5Y A;  2QIR A;  3FXT A;  1KUX A;  1S7F A;  3S6K A;  2PRB A;  4KVM E;  2B3V A;  4AB7 A;  5I0C A;  1MJB A;  4R87 A;  3F0A A;  2R7H A;  5J8C A;  4QBJ A;  2B5G B;  2REE A;  2R98 A;  4CAX A;  4KOR A;  4BMH A;  5DWM A;  4OLL A;  4E8O A;  1M4I A;  3VWD A;  4LUA A;  1Q2D A;  4PSX A;  1QST A;  4U9Y A;  2FT0 A;  1M4G A;  1Y9K A;  2BUE A;  2I00 A;  4J3G A;  4JD6 A;  2VBQ A;  4XPL A;  4JXQ A;  1NSL A;  1YR0 A;  2A4N A;  3C26 A;  4KOT A;  1FY7 A;  1M1D A;  5CNP A;  4KVX A;  2BSW A;  1LRZ A;  3JUW A;  2P0W A;  2D4P A;  3I3G A;  3EXN A;  3TCV A;  2K5T A;  3S6F A;  1MJA A;  3GY9 A;  3JVN A;  2B4D B;  1RO5 A;  1WWZ A;  4QC6 A;  4KVO E;  4QVT A;  3TOA A;  1YK3 A;  1J4J A;  4LX9 A;  4YRH A;  4OAD A;  5ISV A;  1XE4 A;  4XPK A;  4CAV A;  2PR1 A;  2G3A A;  4PK2 A;  5C88 A;  2J8N A;  4PV6 A;  4II9 A;  2VZZ A;  3TO6 A;  3CXS A;  1QSO A;  4UWI A;  2OU2 A;  1Z4R A;  2ZW7 A;  4OAE A;  4CAW A;  2ATR A;  1L0C A;  2PQ8 A;  4CRZ B;  3SHP A;  4MHD A;  1S5K A;  2PDO A;  3N7Z A;  2FSR A;  4HNW B;  1QSN A;  1Y9W A;  2FL4 A;  2VZY A;  4KOV A;  1YLE A;  4H6Z A;  2JDC A;  4QUS A;  4XNH B;  2GAN A;  2B5G A;  2OZG A;  5JPH A;  4KLW A;  2PSW A;  4KZT A;  1P0H A;  4KOY A;  4M85 A;  2C27 A;  2BL1 A;  5KTD A;  1OZP A;  2Z0Z A;  2ZW5 A;  5FVJ A;  3RYO A;  2FIW A;  4AVC A;  1IIC A;  2OZH A;  5IX3 A;  1YX0 A;  3R96 A;  5JQ4 A;  2ARH A;  3IGR A;  3R9E A;  2B3U A;  2VXK A;  4YGO A;  3FB3 A;  4MI4 A;  5E96 A;  2VI7 A;  1KUY A;  3D8P A;  4NEX A;  4UBR A;  5F48 A;  1K4J A;  3P2H A;  4FD6 A;  1S7N A;  2DXQ A;  4XNH C;  4B5P A;  3R9G A;  2B4D A;  2VEZ A;  4RI1 A;  1N71 A;  1VKC A;  1YRE A;  4R3K A;  1S7L A;  4NXY A;  4K30 A;  3D2M A;  3E0K A;  1YVK A;  1I21 A;  2BEI A;  4JLY A;  2QML A;  4RS2 A;  2QEC A;  4KOX A;  4UA3 A;  1Q2Y A;  1KUV A;  3FBU A;  3K9U A;  3TO7 A;  1PU9 A;  3TE4 A;  4MY3 A;  1BOB A;  5F49 A;  2Y0M A;  3F5B A;  4AVB A;  4L89 A;  4Y49 B;  2REF A;  2JLM A;  1XF8 A;  3TTH A;  1B6B A;  2FE7 A;  2H5M A;  4KUB A;  5EBV A;  3BJ7 A;  4CS0 B;  1I12 A;  5C82 A;  4QB9 A;  1M4D A;  2HUZ A;  2Q4V A;  4JWP A;  3G8W A;  4R57 A;  1BO4 A;  2I79 A;  1MJ9 A;  4KLV A;  1PUA A;  3LOD A;  3R1K A;  3DSB A;  1GHE A;  3BJ8 A;  4FD5 A;  1M44 A;  4FD7 A;  2KCW A;  3LD2 A;  2G3T A;  3TOB A;  4NF1 A;  4F0Y A;  2CNM A;  3R95 A;  4Y49 C;  1TIQ A;  2B4B A;  2GE3 A;  1Y7R A;  2ZW4 A;  2Q4Y A;  1XEB A;  2FS5 A;  1YVO A;  2ZPA A;  3WR7 A;  2X7B A;  5DWN A;  4L8A A;  4KOW A;  2EVN A;  3EC4 A;  4I49 A;  1ON0 A;  1V0C A;  2PC1 A;  5EC4 A;  4ZBG A;  1QSR A;  3D2P A;  2GIV A;  1Q2C A;  3VWE A;  3BLN A;  4ORF A;  2P6E A;  2Q0Y A;  5J8F A;  1S3Z A;  5KTC A;  3S6H A;  5H84 A;  4H89 A;  4MY0 A;  1CM0 A;  3TO9 A;  3T90 A;  2FIA A;  4XPD B;  1XMT A;  5F46 A;  3T9Y A;  5IV0 A;  3DR8 A;  5GCN A;  5KTA A;  2WPX A;  2R8V A;  3GYA A;  3UY5 A;  4AG7 A;  2G0B A;  4X5K A;  2Q7B A;  4F6A A;  2HV2 A;  3EO4 A;  4R9M A;  3IWG A;  4AVA A;  3SXO A;  4AG9 A;  4KOU A;  4CRY B;  4YFJ A;  1XIX A;  1VHS A;  3OWC A;  3V8I A;  1I1D A;  4KOS A;  1QSM A;  1CJW A;  1UFH A;  3SXN A;  3S6G A;  1R57 A;  1WK4 A;  1Z9U A;  3KKW A;  2AJ6 A;  1IYK A;  2P6G A;  3ZJ0 A;  2B58 A;  4M3S A;  3W6S A;  4B5O A;  3QAH A;  2IL4 A;  2AE6 A;  2EUI A;  3H4Q A;  4MBU A;  1U6M A;  3QB8 A;  5H86 A;  4XPD C;  2Z10 A;  3DDD A;  3NE7 A;  3FNC A;  2OZU A;  3MGD A;  4HNX B;  3FRM A;  1B87 A;  2RC4 A;  2CNS A;  3EFA A;  4R3L A;  4JJX A; 
#chains in the Genus database with same CATH topology
 4MHY A;  2OB0 A;  4YWY A;  3W91 A;  1BLL E;  2YND A;  2FVG A;  2PVV A;  3H8F A;  3JTK A;  1ZG9 A;  4C7H A;  4E2A A;  4DNC A;  3R9F A;  1NE9 A;  4MJ8 A;  5IB9 A;  1ARL A;  3FIX A;  2OH1 A;  3VAR A;  1CPX A;  3GKR A;  1IID A;  3KL9 A;  3RO0 A;  4HPS A;  3PGP A;  4GS4 A;  2O4H A;  3W6X A;  4B5P B;  4JYW A;  4NGT A;  4IHM A;  4KUA A;  2EWB A;  2VQY A;  3IU2 A;  4LQG A;  5JM6 A;  1R3N A;  1S7K A;  4PXB A;  3EY5 A;  4IF5 A;  1Z2L A;  4HNY B;  1FT7 A;  2CIJ A;  3B3S A;  4OC1 A;  2O28 A;  4PQA A;  4NSQ A;  4UFW A;  1H8L A;  1XBU A;  2Q44 A;  2EK9 A;  3B8G A;  3GIU A;  2CTB A;  2Z11 A;  1VIX A;  2CY2 A;  2QYV A;  4HKF A;  2JEV A;  4A33 A;  3TFY A;  4NCZ A;  1TKF A;  2PJ8 A;  1P4N A;  3I9S A;  3PP9 A;  2PJ4 A;  2D4O A;  2CNT A;  2V8H A;  7CPA A;  2AFZ A;  4ZGY B;  4X8I A;  1AUG A;  2Z3L A;  3B35 A;  4MXU A;  1KZF A;  3ZZI A;  2R1I A;  4R8F A;  2FCK A;  3SI1 A;  3NH4 A;  2XEF A;  3CZX A;  5CBM A;  5AG6 A;  3KHX A;  2WPW A;  3PZJ A;  5HH1 A;  2J9A A;  2NMT A;  3SJX A;  5JH9 A;  3GB0 A;  2P6F A;  2PJ9 A;  3WAB A;  5G20 A;  2ANP A;  3SJG A;  4A31 A;  1IYL A;  2FXF A;  4MHZ A;  2ZEO A;  4P4J A;  4EWT A;  5HMN A;  5IB0 A;  1UWY A;  2PR8 A;  4U9Z A;  2JDD A;  3TT2 A;  1PYT B;  4ZX9 A;  3TC8 A;  1IY7 A;  5K8O A;  4E0A A;  3DR6 A;  3G3S A;  1NMT A;  4Z65 A;  3CXQ A;  4ONU A;  2ZW6 A;  2WYR A;  3P2F A;  6CPA A;  1CP6 A;  2J8R A;  2ZXV A;  3FYN A;  4PSW A;  1RTQ A;  4JXR A;  3FJU A;  4PK3 A;  4IUS A;  2PJA A;  1Z4E A;  1ZO0 A;  2F5I A;  2PRQ A;  1RXT A;  4FD4 A;  2CF4 A;  1MK4 A;  3DNS A;  3BI0 A;  2CXA A;  5AGE A;  5D29 A;  2HQY A;  1SQH A;  2J8M A;  3WT4 A;  3D3S A;  4EFD A;  4EVY A;  2PJ2 A;  1IB1 E;  2Q04 A;  4ZY0 A;  3CXP A;  4PXD A;  1S60 A;  2XEG A;  5F47 A;  4UWJ A;  3F8K A;  4Q38 A;  2AFW A;  3ISZ A;  1YGH A;  4H6U A;  4U5Y A;  2QIR A;  3D4U A;  1KUX A;  3BXM A;  3FXT A;  1S7F A;  3PB7 X;  4MFZ A;  3S6K A;  3T8W A;  4OC0 A;  1TF8 A;  2PRB A;  4W9Y A;  4KVM E;  2B3V A;  4AB7 A;  5I0C A;  1MJB A;  4R87 A;  3F0A A;  4UIA A;  3FH4 A;  2R7H A;  4NFR A;  4MHN A;  4QBJ A;  4DUK A;  5J8C A;  2B5G B;  1QQ9 A;  4BD9 A;  3NE8 A;  2R98 A;  2REE A;  4CAX A;  1XRY A;  2YNE A;  5K8P A;  2PJC A;  2RFH A;  3V38 A;  4NGS A;  4A2Z A;  2YNC A;  3KAS A;  4A37 A;  4CYN A;  4KOR A;  5DS0 A;  4BMH A;  4M6I A;  3SI2 A;  1ZLI A;  4P4I A;  1YSJ A;  2C1C A;  2PE3 A;  2EK8 A;  3H8G A;  4OLL A;  1TKH A;  2ZEH A;  5DWM A;  1HDU A;  3NH5 A;  4AXV A;  4E8O A;  1M4I A;  4YU9 A;  2ZEE A;  4LUA A;  3VWD A;  5HVF A;  4MHP A;  3D7F A;  1Q2D A;  4PSX A;  1QST A;  2IJZ A;  2F7V A;  2PCU A;  2HB6 A;  4U9Y A;  2FT0 A;  4OME A;  1M4G A;  1Y9K A;  2BUE A;  2I00 A;  3QAY A;  4FAI A;  4J3G A;  2V8G A;  4JD6 A;  1IU8 A;  4OC4 A;  2EBJ A;  2VBQ A;  4XPL A;  5CPA A;  4JXQ A;  1NSL A;  1YR0 A;  2Z3O A;  4DJL A;  2A4N A;  2EO8 A;  3C26 A;  4FBE A;  4P4D A;  4KOT A;  2POK A;  3MN8 A;  3PB8 X;  1FY7 A;  2AFU A;  1M1D A;  4OIW A;  5CNP A;  4FUU A;  3D67 A;  3PBB A;  4KVX A;  4UEZ A;  2BSW A;  2PJ6 A;  1LRZ A;  1XJO A;  4Q36 A;  3DLJ A;  5HVG A;  3JUW A;  1OBR A;  2P0W A;  4UFV A;  1EE3 P;  2D4P A;  4ZYQ A;  2Z3K A;  3EXN A;  3B3V A;  3I3G A;  3TCV A;  1QMU A;  4B13 A;  2K5T A;  1VGY A;  3S6F A;  1NSA A;  1MJA A;  1ELL P;  3GY9 A;  3JVN A;  4F0X A;  2B4D B;  1RO5 A;  1CG2 A;  1Z8X A;  1WWZ A;  4QC6 A;  2C6C A;  4KSF A;  4KVO E;  4QVT A;  3TOA A;  4BBH A;  4FWU A;  1YK3 A;  3HUV A;  1J4J A;  2ZEL A;  4LX9 A;  4X2T A;  5AG7 A;  4O23 A;  4P4F A;  4OAD A;  4YRH A;  4CGN A;  4BIN A;  4M6H A;  3IWW A;  2V8V A;  2DEA A;  4NGR A;  1BAV A;  4KS9 A;  1ARM A;  5ISV A;  3WC6 A;  1XE4 A;  4XPK A;  4CAV A;  2PR1 A;  3IC1 A;  1ZLH A;  3FF3 A;  2G3A A;  4PK2 A;  5C88 A;  4ONW A;  2J8N A;  4PV6 A;  4II9 A;  2VZZ A;  3KQZ A;  3TO6 A;  3FEE A;  3PFE A;  4MFL A;  3CXS A;  4P44 A;  4PXE A;  4CGP A;  1QSO A;  4UWI A;  2OU2 A;  1Z4R A;  4F8Z A;  1XOV A;  2ZW7 A;  3PBE A;  4MCQ A;  4OAE A;  4P45 A;  2NYQ A;  2ATR A;  4CAW A;  3PB9 X;  4A32 A;  1L0C A;  2PQ8 A;  3GLJ A;  2PJ1 A;  3SHP A;  4CRZ B;  3FMC A;  2OR4 A;  4MHD A;  3SI0 A;  1S5K A;  2PDO A;  4P10 A;  2PJ7 A;  4LQ6 A;  4CAE A;  3N7Z A;  2FSR A;  5EMI A;  4HNW B;  3NFZ A;  5BWA B;  2JEW A;  2ODF A;  1QSN A;  1LOK A;  3QNV A;  3FX6 A;  4NGN A;  4WJB A;  4A38 A;  3KI9 A;  4P4B A;  5LYD A;  2QVP A;  5LRJ A;  5LYF A;  1Y9W A;  2FL4 A;  2VZY A;  4G1P A;  4KOV A;  2OOT A;  3LMS A;  1YLE A;  4H6Z A;  2YGW A;  3L2N A;  2JDC A;  4QUS A;  4XNH B;  8CPA A;  4UEF A;  2GAN A;  3B3C A;  2B5G A;  2OZG A;  3FED A;  3KZW A;  5JGF A;  1Z8L A;  1Y0R A;  2AFS A;  2ZED A;  3ISX A;  3V7Z A;  5JPH A;  3B7I A;  3IEH A;  4KLW A;  2PSW A;  1Z8W A;  2ZEG A;  4KZT A;  1P0H A;  4KOY A;  2C6G A;  4M85 A;  2CTC A;  4NJQ A;  4B12 A;  2C27 A;  2PJB A;  4MCS A;  2BL1 A;  5KTD A;  1OZP A;  2Z0Z A;  3PEI A;  4R7M A;  2ZW5 A;  1LCP A;  3A9L A;  5FVJ A;  1BPM A;  2FIW A;  3RYO A;  4AVC A;  4B11 A;  3HLP A;  3S9L A;  3SJE A;  1IIC A;  4A30 A;  2OZH A;  4MFK A;  5IX3 A;  1YX0 A;  4X3R A;  3R96 A;  3D7H A;  2Z3M A;  1YW4 A;  5JQ4 A;  1LAN A;  2ARH A;  3IGR A;  4NGM A;  4PPZ A;  5G21 A;  3R9E A;  4CGM A;  4F9V A;  3SJF A;  2B3U A;  2VXK A;  3B3W A;  4PXC A;  1CX8 A;  4YGO A;  4KSA A;  3FB3 A;  4MI4 A;  1CPS A;  4C7I A;  5LRG A;  5E96 A;  3BI1 A;  2Z3N A;  3FEC A;  2VI7 A;  1KUY A;  3D8P A;  4NEX A;  1ELM P;  3IO1 A;  4UBR A;  4A95 A;  3H8E A;  5AG4 A;  4IAV A;  4CYQ A;  3IFE A;  3S9M A;  4UCP A;  3NH8 A;  4B10 A;  1X10 A;  2PIZ A;  2ZEF A;  5F48 A;  5J1Q A;  1K4J A;  2GLJ A;  2XEJ A;  3P2H A;  1S7N A;  2DXQ A;  4FD6 A;  4XNH C;  4B14 A;  4TWE A;  2C6P A;  4B5P A;  3R9G A;  2B4D A;  1Y7E A;  2VEZ A;  4RI1 A;  1N71 A;  1GYT A;  1VKC A;  1YRE A;  3VAT A;  4A39 A;  5K8N A;  1TKJ A;  2PIY A;  4R3K A;  1S7L A;  4NXY A;  4K30 A;  4GM5 A;  4K3N A;  3RAM A;  4RN7 A;  2JBJ A;  3D2M A;  2G9D A;  2V77 A;  3PB4 X;  2RB7 A;  1IGB A;  3E0K A;  3WC7 A;  1YVK A;  2Q51 A;  1I21 A;  5HXD A;  2BEI A;  4JLY A;  1AYE A;  3BHX A;  3KHZ A;  2IQ6 A;  1TXR A;  2QML A;  5HVH A;  4H2K A;  4B6Z A;  3CPX A;  4OID A;  4RS2 A;  2QEC A;  4C2Y A;  3RNZ A;  4KOX A;  2PVW A;  3D68 A;  4UA3 A;  1Q2Y A;  4UEE A;  1KUV A;  1X12 A;  3FBU A;  4ZY1 A;  3B2Y A;  1F2O A;  3K9U A;  3GUX A;  3TO7 A;  5LRK A;  1PU9 A;  3PFO A;  3TE4 A;  4MY3 A;  2DPS A;  4UFX A;  1BOB A;  3NA6 A;  3IWE A;  2QJ8 A;  4P4E A;  5F49 A;  1XMB A;  2Y0M A;  3F5B A;  4ZX8 A;  4CGO A;  4AVB A;  4L89 A;  2PJ5 A;  3KR4 A;  2REF A;  4Y49 B;  2JLM A;  1XF8 A;  1Q7L A;  3TTH A;  4TNU A;  1Z8T A;  2XEI A;  2V8D A;  2WZN A;  1B6B A;  4WWV A;  2FE7 A;  2H5M A;  4KUB A;  5AG5 A;  1CP7 A;  1VHE A;  2VL1 A;  5EBV A;  3BJ7 A;  4Q7A A;  5F09 A;  1Y0Y A;  4CS0 B;  1I12 A;  2Q4Z A;  5C82 A;  4QB9 A;  1M4D A;  2GU2 A;  2GRE A;  4CYO A;  2I3C A;  2HUZ A;  4MMO A;  5K8M A;  2Q4V A;  2O53 A;  3N5F A;  4JWP A;  4M6G A;  3G8W A;  5A28 A;  4R57 A;  1BO4 A;  2I79 A;  3K2K A;  4OC2 A;  4UIB A;  1MJ9 A;  2PJ3 A;  4KLV A;  1PUA A;  3LOD A;  3R1K A;  3DSB A;  1GHE A;  1A2Z A;  3BJ8 A;  4RUH A;  3CT9 A;  1M44 A;  4FD5 A;  4FD7 A;  2ZOG A;  2DF5 A;  4KSI A;  2KCW A;  3LD2 A;  2G3T A;  4NGQ A;  3RZA A;  3D7D A;  4DYO A;  4R76 A;  1HEE A;  1PCA A;  4UCN A;  1IOI A;  3H5Z A;  4MCR A;  3TOB A;  3IIB A;  4MFQ A;  4NF1 A;  1LFW A;  1YQE A;  4F0Y A;  5G22 A;  2BO9 A;  3KQX A;  4C68 A;  3RBU A;  2CNM A;  2GLF A;  3R95 A;  1XFO A;  4C2Z A;  4Y49 C;  1DE4 C;  1TIQ A;  2B4B A;  4C2X A;  3PRT A;  3JRU A;  2GE3 A;  4MFJ A;  1FNO A;  1M4L A;  1Y7R A;  3D66 A;  4R6T A;  4OKO A;  4CYP A;  4A94 A;  1AMP A;  2DPT A;  2Q4Y A;  2ZW4 A;  3KGQ A;  1XEB A;  2FS5 A;  1YVO A;  2ZPA A;  3WR7 A;  3IU1 A;  4OC3 A;  2AFX A;  2X7B A;  3B3T A;  5LYI A;  5DWN A;  4L8A A;  1BPN A;  4KOW A;  2EVN A;  3EC4 A;  4I49 A;  1ON0 A;  1V0C A;  2PC1 A;  2Q43 A;  2YNC C;  5EC4 A;  3D7G A;  5ELY A;  4ZBG A;  5G1Z A;  1QSR A;  3D2P A;  5I4M A;  2ZEP A;  2GIV A;  1Q2C A;  3VWE A;  1IOF A;  3BLN A;  3KR5 A;  4ORF A;  4NGP A;  4CAF A;  2JBK A;  2P6E A;  2Q0Y A;  1HDQ A;  5J8F A;  1S3Z A;  5KTC A;  3S9N A;  3S6H A;  5H84 A;  4H89 A;  4MY0 A;  1DTD A;  4F9U A;  1CBX A;  1CM0 A;  1F57 A;  3K9T A;  3T90 A;  3TO9 A;  2FIA A;  4XPD B;  4P6Y A;  1XMT A;  3IJ3 A;  1JQG A;  3LWU A;  5F46 A;  3T9Y A;  5IV0 A;  3DR8 A;  5GCN A;  4MFP A;  5A27 A;  2ZOF A;  5KTA A;  2WPX A;  2R8V A;  3GYA A;  2NSM A;  3UY5 A;  1LAM A;  2G0B A;  4AG7 A;  4MRI A;  4X5K A;  2Q7B A;  1YW6 A;  4F6A A;  2HV2 A;  3DGV A;  2ABZ A;  3EO4 A;  1VHO A;  2AFO A;  3TX8 A;  2HC9 A;  4R9M A;  4EME A;  1KWM A;  2Q7S A;  3IWG A;  4AVA A;  3SXO A;  4AG9 A;  4KOU A;  3PB6 X;  4CRY B;  2BOA A;  4GXH A;  4JZ0 A;  1TF9 A;  2Z3P A;  1YLO A;  4YFJ A;  1XIX A;  1VHS A;  3OWC A;  3V8I A;  1I1D A;  1QSM A;  4KOS A;  1CJW A;  1UFH A;  2WSA A;  4CPA A;  3SXN A;  4OP4 A;  3S6G A;  4MCP A;  1R57 A;  5LYL A;  1WK4 A;  1Z9U A;  3KKW A;  2PJ0 A;  2AJ6 A;  2ZEN A;  1IYK A;  1F2P A;  2P6G A;  3ZJ0 A;  2B58 A;  4UF4 A;  4NJR A;  4M3S A;  2WUU A;  3W6S A;  3VH9 A;  4B5O A;  3QAH A;  2IL4 A;  2AE6 A;  3CDX A;  4IK2 A;  2EUI A;  2F8H A;  2IMO A;  3H4Q A;  5D8N A;  1JWQ A;  4MBU A;  1U6M A;  1Z5R A;  3QB8 A;  5H86 A;  4XPD C;  2BCO A;  4ZY2 A;  3FVL A;  3MRU A;  1LAP A;  2Z10 A;  3DDD A;  3FNC A;  2OZU A;  3NE7 A;  1R43 A;  3LAC A;  1ZG8 A;  3MGD A;  4HNX B;  3FRM A;  3I1U A;  4ZI6 A;  1B87 A;  3CPA A;  2GFQ A;  2RC4 A;  2ZEM A;  1YME A;  2CNS A;  4CGL A;  1ZG7 A;  3EFA A;  2AFM A;  3WC5 A;  4UCM A;  5THW A;  4OC5 A;  4R3L A;  4JJX A; 
#chains in the Genus database with same CATH homology
 2OB0 A;  3W91 A;  2YND A;  3JTK A;  4E2A A;  4C7H A;  4DNC A;  3R9F A;  1NE9 A;  4MJ8 A;  3FIX A;  2OH1 A;  3GKR A;  1IID A;  3PGP A;  4GS4 A;  3W6X A;  4B5P B;  4KUA A;  2VQY A;  3IU2 A;  1S7K A;  3EY5 A;  4IF5 A;  4HNY B;  2O28 A;  4NSQ A;  4UFW A;  2Q44 A;  3B8G A;  2Z11 A;  2CY2 A;  4HKF A;  3TFY A;  2JEV A;  4A33 A;  4NCZ A;  1P4N A;  3I9S A;  3PP9 A;  2D4O A;  2CNT A;  4ZGY B;  2Z3L A;  1KZF A;  3ZZI A;  2R1I A;  2FCK A;  5AG6 A;  2WPW A;  3PZJ A;  5HH1 A;  2NMT A;  2P6F A;  5G20 A;  4A31 A;  1IYL A;  2FXF A;  5HMN A;  5IB0 A;  2PR8 A;  4U9Z A;  2JDD A;  3TT2 A;  4E0A A;  3DR6 A;  3G3S A;  1NMT A;  3CXQ A;  4ONU A;  2ZW6 A;  3P2F A;  2J8R A;  2ZXV A;  3FYN A;  4PSW A;  4JXR A;  4PK3 A;  4IUS A;  1Z4E A;  1ZO0 A;  2F5I A;  4FD4 A;  1RXT A;  1MK4 A;  3DNS A;  2CXA A;  5AGE A;  2HQY A;  1SQH A;  2J8M A;  3D3S A;  4EVY A;  1IB1 E;  2Q04 A;  3CXP A;  5F47 A;  1S60 A;  4UWJ A;  3F8K A;  4Q38 A;  1YGH A;  4H6U A;  4U5Y A;  2QIR A;  3FXT A;  1KUX A;  4MFZ A;  1S7F A;  3S6K A;  2PRB A;  4KVM E;  2B3V A;  4AB7 A;  5I0C A;  1MJB A;  4R87 A;  3F0A A;  2R7H A;  5J8C A;  4QBJ A;  2B5G B;  2REE A;  2R98 A;  4CAX A;  2YNE A;  4A2Z A;  4CYN A;  2YNC A;  4KOR A;  4BMH A;  5DWM A;  4OLL A;  4E8O A;  1M4I A;  3VWD A;  4LUA A;  1Q2D A;  4PSX A;  1QST A;  4U9Y A;  2FT0 A;  1M4G A;  1Y9K A;  2BUE A;  2I00 A;  4J3G A;  4JD6 A;  2VBQ A;  4XPL A;  4JXQ A;  1NSL A;  1YR0 A;  2Z3O A;  2A4N A;  3C26 A;  4KOT A;  1FY7 A;  1M1D A;  5CNP A;  4KVX A;  2BSW A;  1LRZ A;  4Q36 A;  3JUW A;  2P0W A;  4UFV A;  2D4P A;  2Z3K A;  3EXN A;  3I3G A;  3TCV A;  4B13 A;  2K5T A;  3S6F A;  1MJA A;  3GY9 A;  3JVN A;  4F0X A;  2B4D B;  1RO5 A;  1WWZ A;  4QC6 A;  4KSF A;  4KVO E;  4QVT A;  3TOA A;  4BBH A;  1YK3 A;  1J4J A;  4LX9 A;  5AG7 A;  4CGN A;  4YRH A;  4OAD A;  4KS9 A;  5ISV A;  1XE4 A;  4XPK A;  4CAV A;  2PR1 A;  2G3A A;  4PK2 A;  5C88 A;  2J8N A;  4PV6 A;  4II9 A;  2VZZ A;  3TO6 A;  4MFL A;  3CXS A;  4CGP A;  1QSO A;  4UWI A;  2OU2 A;  1Z4R A;  2ZW7 A;  4OAE A;  4CAW A;  2ATR A;  4A32 A;  1L0C A;  2PQ8 A;  4CRZ B;  3SHP A;  4MHD A;  1S5K A;  2PDO A;  4CAE A;  3N7Z A;  2FSR A;  4HNW B;  5BWA B;  1QSN A;  1Y9W A;  2FL4 A;  2VZY A;  4KOV A;  1YLE A;  4H6Z A;  2YGW A;  2JDC A;  4QUS A;  4XNH B;  2GAN A;  2B5G A;  2OZG A;  5JPH A;  4KLW A;  2PSW A;  4KZT A;  1P0H A;  4KOY A;  4M85 A;  4B12 A;  2C27 A;  2BL1 A;  5KTD A;  1OZP A;  2Z0Z A;  2ZW5 A;  3A9L A;  5FVJ A;  3RYO A;  2FIW A;  4B11 A;  4AVC A;  1IIC A;  4A30 A;  2OZH A;  4MFK A;  5IX3 A;  1YX0 A;  3R96 A;  2Z3M A;  5JQ4 A;  2ARH A;  3IGR A;  5G21 A;  3R9E A;  4CGM A;  2B3U A;  2VXK A;  4YGO A;  4KSA A;  3FB3 A;  4MI4 A;  4C7I A;  5E96 A;  2Z3N A;  2VI7 A;  1KUY A;  3D8P A;  4NEX A;  4UBR A;  4A95 A;  5AG4 A;  4CYQ A;  4UCP A;  4B10 A;  5F48 A;  1K4J A;  3P2H A;  4FD6 A;  1S7N A;  2DXQ A;  4XNH C;  4B14 A;  4B5P A;  3R9G A;  2B4D A;  2VEZ A;  4RI1 A;  1N71 A;  1VKC A;  1YRE A;  4R3K A;  1S7L A;  4NXY A;  4K30 A;  3D2M A;  3E0K A;  1YVK A;  1I21 A;  2BEI A;  4JLY A;  2QML A;  4RS2 A;  2QEC A;  4C2Y A;  4KOX A;  4UA3 A;  1Q2Y A;  1KUV A;  3FBU A;  3K9U A;  3TO7 A;  1PU9 A;  3TE4 A;  4MY3 A;  2DPS A;  4UFX A;  1BOB A;  5F49 A;  3IWE A;  4CGO A;  2Y0M A;  3F5B A;  4AVB A;  4L89 A;  4Y49 B;  2REF A;  2JLM A;  1XF8 A;  3TTH A;  1B6B A;  2FE7 A;  2H5M A;  4KUB A;  5AG5 A;  5EBV A;  3BJ7 A;  4CS0 B;  1I12 A;  5C82 A;  4QB9 A;  1M4D A;  4CYO A;  2HUZ A;  2Q4V A;  4JWP A;  3G8W A;  5A28 A;  4R57 A;  1BO4 A;  2I79 A;  1MJ9 A;  4KLV A;  1PUA A;  3LOD A;  3R1K A;  3DSB A;  1GHE A;  3BJ8 A;  4FD5 A;  1M44 A;  4FD7 A;  2KCW A;  3LD2 A;  2G3T A;  4UCN A;  3H5Z A;  3TOB A;  4MFQ A;  4NF1 A;  4F0Y A;  5G22 A;  4C68 A;  4C2Z A;  2CNM A;  3R95 A;  4Y49 C;  1TIQ A;  4C2X A;  2B4B A;  2GE3 A;  4MFJ A;  1Y7R A;  4CYP A;  2DPT A;  2ZW4 A;  2Q4Y A;  1XEB A;  2FS5 A;  1YVO A;  2ZPA A;  3WR7 A;  3IU1 A;  2X7B A;  5DWN A;  4L8A A;  4KOW A;  2EVN A;  3EC4 A;  4I49 A;  1ON0 A;  1V0C A;  2PC1 A;  2YNC C;  5EC4 A;  4ZBG A;  5G1Z A;  1QSR A;  3D2P A;  2GIV A;  1Q2C A;  3VWE A;  3BLN A;  4ORF A;  4CAF A;  2P6E A;  2Q0Y A;  5J8F A;  1S3Z A;  5KTC A;  3S6H A;  5H84 A;  4H89 A;  4MY0 A;  1CM0 A;  3TO9 A;  3T90 A;  2FIA A;  4XPD B;  1XMT A;  5F46 A;  3T9Y A;  5IV0 A;  3DR8 A;  5GCN A;  4MFP A;  5A27 A;  5KTA A;  2WPX A;  2R8V A;  3GYA A;  3UY5 A;  4AG7 A;  2G0B A;  4X5K A;  2Q7B A;  4F6A A;  2HV2 A;  3EO4 A;  4R9M A;  3IWG A;  4AVA A;  3SXO A;  4AG9 A;  4KOU A;  4CRY B;  2Z3P A;  4YFJ A;  1XIX A;  1VHS A;  3OWC A;  3V8I A;  1I1D A;  1QSM A;  4KOS A;  1CJW A;  1UFH A;  2WSA A;  3SXN A;  3S6G A;  1R57 A;  1WK4 A;  1Z9U A;  3KKW A;  2AJ6 A;  1IYK A;  2P6G A;  3ZJ0 A;  2B58 A;  4M3S A;  2WUU A;  3W6S A;  4B5O A;  3QAH A;  2IL4 A;  2AE6 A;  2EUI A;  3H4Q A;  4MBU A;  1U6M A;  3QB8 A;  5H86 A;  4XPD C;  2Z10 A;  3DDD A;  3NE7 A;  3FNC A;  2OZU A;  3MGD A;  4HNX B;  3FRM A;  1B87 A;  2RC4 A;  2CNS A;  4CGL A;  3EFA A;  4UCM A;  4R3L A;  4JJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...