3W6XA

Yeast n-acetyltransferase mpr1 in complex with chop
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
225
structure length
225
Chain Sequence
SIEWKLTANLRNGPTFFQPLADSIEPLQFKLIGSDTVATAFPVFDTKYIPDSLINYLFKLFNLEIESGKTYPQLHSLTKQGFLNYWFHSFAVVVLQTDEKFIQDNQDWNSVLLGTFYIKPNYAPRCSHNCNAGFLVNGAHRGQKVGYRLAQVYLNWAPLLGYKYSIFNLVFVTNQASWKIWDKLNFQRIGLVPHAGILNGFSEPVDAIIYGKDLTKIEPEFLSME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MPR1 protein
publication title Structural and functional analysis of the yeast N-acetyltransferase Mpr1 involved in oxidative stress tolerance via proline metabolism
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 63
structure length 225
sequence length 225
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.271: L-glutamate-5-semialdehyde N-acetyltransferase.
pdb deposition date 2013-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3w6xA00
3S6HA 1YVOA 3D2PA 4PK3A 1RO5A 4AG9A 1XMTA 2CNMA 2R1IA 3PZJA 3D8PA 2Q4VA 4UWJA 4PSWA 4UA3A 2GE3A 4I49A 1S7LA 1YR0A 3BLNA 5HMNA 4DNCA 1KZFA 2HQYA 3V8IA 4K30A 3D3SA 2FIWA 3TO6A 4CAXA 2D4PA 3DNSA 2VZYA 1PU9A 2FS5A 3SHPA 5H84A 4IF5A 4AVCA 2P6FA 4JWPA 2B4BA 3EO4A 3W6XA 4E8OA 1CJWA 3TE4A 1Y9KA 3GYAA 2AJ6A 3EC4A 3E0KA 4KZTA 1S7NA 4XNHB 4KOVA 3EFAA 4RI1A 1Y9WA 5F46A 2VBQA 1IYLA 1Q2YA 4AG7A 2HUZA 2D4OA 5H86A 3CXPA 4KLWA 2QMLA 1S5KA 1Q2CA 2ZW5A 4XPDB 2VI7A 3BJ8A 4R9MA 4GS4A 5F49A 1XF8A 3R9EA 3R1KA 1QSNA 4U9ZA 4YGOA 2ZW7A 4KOSA 2B5GB 4II9A 1B6BA 4R57A 3W6SA 1XIXA 1S60A 2RC4A 5C88A 1M1DA 2J8RA 1R57A 2Y0MA 2CY2A 2PDOA 1IICA 2FSRA 5F48A 4NCZA 4NF1A 2Q04A 2KCWA 3RYOA 4E0AA 4B5OA 2PR8A 2Q4YA 3VWEA 1U6MA 3DR6A 4ORFA 1MJ9A 2AE6A 2A4NA 1MK4A 1MJAA 4AVAA 3S6KA 4KOWA 1K4JA 4R87A 5EBVA 1BOBA 5KTCA 4HNXB 3TOBA 1QSRA 1V0CA 3G8WA 1BO4A 2P0WA 2REEA 3KKWA 1QSMA 4QB9A 2R98A 4MY3A 5EC4A 4L8AA 1GHEA 1M4IA 2BUEA 2FE7A 4R3LA 1P4NA 2QECA 3FNCA 1M4DA 2FXFA 1IIDA 5GCNA 1XE4A 1YK3A 2Z0ZA 4E2AA 2B3VA 5E96A 4LUAA 1YGHA 4F0YA 3R95A 1XEBA 2VXKA 2IL4A 4FD5A 4YFJA 2BSWA 4B5PA 2G3AA 3DSBA 3D2MA 1P0HA 2CNSA 4PSXA 2GANA 4PV6A 2PR1A 2ZW4A 3S6GA 4KOXA 1PUAA 1QSOA 3F0AA 3GY9A 3F5BA 5DWNA 4NSQA 1Z9UA 4KVME 4JJXA 2G3TA 3TFYA 3W91A 2VZZA 1M4GA 1Q2DA 3BJ7A 2WPXA 1I12A 4KOUA 4F6AA 3S6FA 3TCVA 4JXRA 2OZUA 2C27A 3ZJ0A 1Z4EA 1I1DA 2FT0A 3R96A 5J8CA 1Y7RA 4NEXA 4CRZB 1Z4RA 2R8VA 2BL1A 3FBUA 3R9FA 4LX9A 2F5IA 3IWGA 4Y49B 2Q7BA 3OWCA 2DXQA 2K5TA 3QAHA 1N71A 4X5KA 3WR7A 3JVNA 4JLYA 4U5YA 4UWIA 3T9YA 3I9SA 3T90A 4J3GA 3TO7A 3I3GA 4FD6A 5J8FA 3TTHA 2JEVA 2I79A 4H89A 3EY5A 3H4QA 1WK4A 2Q0YA 3MGDA 5IX3A 2BEIA 4PK2A 2ZPAA 4R3KA 3C26A 4JD6A 2NMTA 2REFA 1FY7A 1NE9A 1YLEA 2PRBA 4XNHC 2Q44A 4XPKA 2PQ8A 4H6UA 1I21A 1YREA 4KORA 4ONUA 3EXNA 2WPWA 4H6ZA 4HNYB 3P2FA 2ARHA 2VEZA 5F47A 1NMTA 3LD2A 1M44A 3CXSA 4YRHA 4FD4A 4XPDC 4KOYA 1OZPA 1SQHA 2HV2A 5KTDA 1IYKA 2B3UA 2PSWA 4OAEA 5IV0A 2B4DA 5JPHA 1UFHA 3NE7A 4ZBGA 4Y49C 2OZHA 4M3SA 3PGPA 4MI4A 4UBRA 3QB8A 2H5MA 1B87A 3FB3A 1RXTA 2OH1A 2Z10A 4OADA 4KOTA 4B5PB 2JDDA 4NXYA 4BMHA 1LRZA 4MHDA 4FD7A 1KUXA 2EVNA 4QUSA 4KVXA 2P6GA 5FVJA 2FL4A 2VQYA 5IB0A 2B58A 3FXTA 1MJBA 4AVBA 1WWZA 2X7BA 2J8NA 3FYNA 4EVYA 5C82A 4AB7A 4XPLA 4HNWB 2OZGA 2G0BA 2PC1A 2OB0A 2JDCA 3TOAA 3SXNA 3SXOA 4KVOE 1TIQA 5HH1A 4KUAA 1S7KA 3B8GA 3DR8A 1L0CA 4QC6A 1VHSA 2JLMA 3IGRA 1KUVA 3TO9A 2CNTA 2O28A 5JQ4A 5KTAA 4CAWA 1IB1E 5CNPA 3R9GA 2ZXVA 1YVKA 3LODA 3CXQA 2FCKA 1VKCA 1S7FA 4L89A 5ISVA 1J4JA 4KUBA 5I0CA 2Z11A 3GKRA 4QVTA 4OLLA 2P6EA 2J8MA 4IUSA 3PP9A 4CS0B 4RS2A 3N7ZA 2B5GA 1CM0A 3FRMA 3FIXA 5DWMA 1YX0A 4MJ8A 3ZZIA 4QBJA 1S3ZA 3F8KA 2QIRA 4M85A 4KLVA 1ON0A 3VWDA 1NSLA 2ATRA 3JUWA 1KUYA 3K9UA 4MY0A 3G3SA 4HKFA 1QSTA 3TT2A 2R7HA 2FIAA 3UY5A 2I00A 4JXQA 2GIVA 4CAVA 4CRYB 3P2HA 2OU2A 2EUIA 2B4DB 3DDDA 4MBUA 2ZW6A 4U9YA
chains in the Genus database with same CATH superfamily
3S6HA 3IIBA 5LYDA 4KSIA 1YVOA 3D2PA 4UIBA 4B13A 4PK3A 1RO5A 3D7FA 1Z8XA 1UWYA 3PB6X 1XMTA 2PJ0A 3SI2A 4AG9A 3NH8A 4NGPA 2CNMA 4P6YA 2R1IA 3PZJA 1HDUA 2F7VA 3D8PA 3JTKA 4ZX8A 1CP6A 2EK8A 2Q4VA 2QJ8A 1YW4A 3PFEA 3L2NA 4UWJA 4PSWA 2O53A 2FVGA 4G1PA 1TKHA 5D8NA 3HLPA 1VHOA 3QAYA 4UA3A 3KHXA 4A95A 2GE3A 1XFOA 2XEFA 2QVPA 4UCPA 4I49A 1S7LA 3NA6A 1YR0A 1IGBA 2AFUA 3BLNA 3RO0A 5HMNA 5JM6A 4JZ0A 4DNCA 5ELYA 2GFQA 4DYOA 3IFEA 1KZFA 2V8DA 2HQYA 3V8IA 1RTQA 3NFZA 3CPXA 4K30A 3D3SA 4MFKA 4FBEA 2Z3KA 2FIWA 2VL1A 3TO6A 1CBXA 4CAXA 1CP7A 1QQ9A 1ELMP 2ZOFA 5G20A 2D4PA 3DNSA 1XRYA 4CYNA 1BPMA 2VZYA 1PU9A 2FS5A 4UCMA 4UFVA 3SHPA 2PJ4A 3TC8A 5H84A 4BBHA 2Z3OA 3WT4A 4W9YA 5G22A 3VH9A 1Z8LA 4IF5A 3CDXA 4AVCA 2P6FA 4JWPA 2B4BA 4UEFA 2GLJA 1LFWA 4P44A 4TNUA 3WABA 4EMEA 3EO4A 3B7IA 1PCAA 3W6XA 3CPAA 5THWA 4CPAA 3FX6A 4E8OA 1CJWA 5AG4A 2PIZA 3MN8A 3RNZA 2PJ3A 2ZEMA 5IB9A 3TE4A 1CPXA 5AGEA 1Y9KA 4X2TA 3GYAA 2AJ6A 3IU1A 3KASA 2AFZA 3B3SA 3EC4A 3E0KA 4KZTA 1S7NA 2C6GA 4XNHB 4KOVA 3EFAA 3PBBA 4RI1A 4OC3A 2Z3MA 1Y9WA 2EO8A 2PJ8A 5F46A 2C6CA 2ZENA 2VBQA 1IYLA 1Q2YA 4ZX9A 4AG7A 4NFRA 2GREA 4F9VA 1IOIA 1ZLIA 1H8LA 2HUZA 1ZG8A 4OIWA 2PJ5A 5EMIA 4C2XA 2D4OA 2ZEHA 3FECA 2CIJA 5H86A 3CXPA 4KLWA 1FT7A 4ONWA 3GUXA 2QMLA 1S5KA 1Q2CA 1QMUA 2ZW5A 4YU9A 2IMOA 4XPDB 2VI7A 3HUVA 4DJLA 3GIUA 5CPAA 3BJ8A 3B3WA 4R9MA 2AFOA 1X10A 4FUUA 4GS4A 4MCQA 1XF8A 2Q43A 5F49A 4BD9A 4C68A 3R9EA 3R1KA 5CBMA 3FEEA 1QSNA 4U9ZA 4YGOA 2ZW7A 3PRTA 2C1CA 2B5GB 2Q7SA 4IK2A 4KOSA 4II9A 1Q7LA 3KQZA 1B6BA 5HXDA 4NGTA 4R57A 3B3VA 3W6SA 1XIXA 2IQ6A 1S60A 1XBUA 1TKFA 3S9NA 5LRKA 2JEWA 2RC4A 5C88A 4CGMA 1M1DA 1ZO0A 2J8RA 1TF9A 1R57A 2Y0MA 2CY2A 2YNCC 2PDOA 2XEJA 1IICA 1LCPA 3TX8A 2FSRA 4X3RA 4TWEA 5F48A 4NCZA 1Z8WA 2Q51A 2Q04A 4NF1A 2KCWA 2YNDA 3RYOA 4E0AA 4MCSA 4B5OA 4R6TA 2PR8A 4ZY1A 1YMEA 2Q4YA 3QNVA 3VWEA 1CPSA 1U6MA 2WUUA 3DR6A 5LRJA 4F0XA 3D4UA 2G9DA 4ORFA 4MHNA 1MJ9A 4UF4A 5DS0A 2XEGA 3IO1A 2AE6A 3BHXA 4UEZA 1OBRA 2A4NA 3PB4X 1MK4A 1MJAA 4MHYA 4AVAA 1Y0RA 4MMOA 4M6HA 3BXMA 2WSAA 4KOWA 1GYTA 1K4JA 4R87A 5EBVA 3S6KA 3V38A 4CGLA 1BOBA 3GLJA 5KTCA 4HNXB 3TOBA 4UIAA 1QSRA 1V0CA 1DE4C 4DUKA 1AYEA 3G8WA 1BO4A 2P0WA 2REEA 3KKWA 1ZG9A 4RUHA 1QSMA 4QB9A 5G1ZA 3PEIA 4PXDA 2C6PA 3KL9A 2R98A 4MY3A 4UFXA 4A32A 3FVLA 2CTBA 5EC4A 2NSMA 1NSAA 1VIXA 4L8AA 1GHEA 1M4IA 2BUEA 2I3CA 1R43A 2FE7A 2ZOGA 3D7DA 4OC2A 4ZY0A 4R3LA 1P4NA 2QECA 3FNCA 4H2KA 1M4DA 1X12A 2CXAA 5JH9A 2FXFA 4MHPA 1IIDA 4P4EA 5AG6A 1XE4A 5GCNA 3V7ZA 1BPNA 1YK3A 2DEAA 2Z0ZA 3I1UA 4E2AA 2BO9A 1XMBA 3NH5A 2B3VA 5E96A 4LUAA 3CT9A 2ZEOA 2ZEGA 4HPSA 4MFQA 4P45A 1BAVA 1YGHA 3KI9A 2Z3LA 4ZI6A 4NGQA 3R95A 4F0YA 3VATA 4B10A 1XEBA 2EBJA 2VXKA 4B12A 2IL4A 3B3TA 3JRUA 4P10A 4FD5A 3LMSA 3PBEA 4NGNA 4YFJA 2BSWA 2CTCA 2G3AA 3SJGA 4B5PA 2JBJA 4NGSA 3DSBA 3D2MA 2Z3PA 4KS9A 1P0HA 3RBUA 3IJ3A 2CNSA 4CYQA 3FH4A 4OC4A 1XOVA 2Q4ZA 4PSXA 2GANA 2ANPA 2PR1A 4P4DA 4PV6A 3LACA 4P4IA 2ZW4A 2OR4A 3S6GA 2EK9A 4KOXA 4MFZA 5J1QA 1PUAA 1QSOA 3F0AA 3GY9A 2JBKA 3F5BA 1DTDA 3FJUA 3WC7A 5DWNA 1ELLP 4NSQA 3SI1A 4A33A 4AXVA 1Z9UA 4KVME 2RB7A 4JJXA 1LAMA 2IJZA 1ZG7A 2WZNA 2ODFA 1AMPA 3K9TA 1Y0YA 4PPZA 2G3TA 2YNCA 3TFYA 1JQGA 4LQ6A 3W91A 2VZZA 3H8FA 1M4GA 1Q2DA 3SJEA 3BJ7A 4NJQA 2WPXA 1BLLE 4MFPA 1YLOA 4A94A 1VHEA 2DPTA 3PB8X 1I12A 4KOUA 3IC1A 4C7HA 4F6AA 3FF3A 3S6FA 3TCVA 4JXRA 4MCRA 2OZUA 4MRIA 2C27A 4PXEA 3GB0A 4P4JA 2ZEEA 3ZJ0A 1Z4EA 4K3NA 1I1DA 2FT0A 3R96A 3KQXA 5J8CA 5D29A 1LOKA 1Y7RA 4P4BA 5LYIA 3KGQA 2V77A 4NEXA 4CRZB 1Z4RA 2R8VA 2BL1A 3FBUA 3R9FA 4LX9A 2F5IA 2ZELA 3IWGA 1F2PA 3D7GA 3MRUA 2YNEA 3OWCA 4Y49B 4M6IA 2Q7BA 2DXQA 4GM5A 1LANA 2K5TA 2J9AA 3QAHA 1N71A 4X5KA 5HVFA 5AG5A 3NE8A 3WR7A 1XJOA 3JVNA 1A2ZA 4JLYA 2PJ9A 4U5YA 3I9SA 4MFLA 4UWIA 3T9YA 4J3GA 3T90A 4OP4A 4X8IA 3TO7A 3I3GA 4FD6A 4OKOA 4M6GA 5J8FA 3TTHA 3RZAA 2WYRA 2JEVA 3PFOA 2I79A 4H89A 1YQEA 3EY5A 3H4QA 1Z2LA 2QYVA 1WK4A 2Q0YA 3MGDA 4ZY2A 5IX3A 4LQGA 2BEIA 4PK2A 4CGPA 2ZPAA 4R3KA 3C26A 2V8HA 4JD6A 3SJFA 3ISZA 2NMTA 2PIYA 2REFA 1FY7A 1NE9A 1YLEA 2PJ2A 2PRBA 4XNHC 2Q44A 4XPKA 4P4FA 2BCOA 2PQ8A 4H6UA 1I21A 1YREA 3K2KA 1PYTB 4KORA 4ONUA 3EXNA 2WPWA 3FMCA 4H6ZA 5HVHA 4HNYB 3P2FA 6CPAA 2ARHA 2VEZA 5F47A 2PJ1A 2PJ6A 1NMTA 3LD2A 2ABZA 5K8MA 5K8OA 1M44A 1HEEA 3CXSA 4YRHA 3IEHA 4CYPA 4FD4A 4F9UA 4XPDC 4KOYA 3D68A 1OZPA 1SQHA 1ARLA 2HV2A 4RN7A 4A2ZA 4C2YA 4CAEA 5KTDA 3S9LA 4NGMA 1IYKA 2B3UA 2PSWA 3LWUA 4OAEA 4CYOA 5IV0A 4IHMA 2B4DA 4R8FA 7CPAA 3IU2A 5JPHA 1UFHA 2PJ7A 2PJBA 3NE7A 4ZBGA 1ARMA 4A30A 4Y49C 1F57A 1EE3P 2PE3A 2OZHA 4A39A 4M3SA 3PGPA 4MI4A 1IU8A 3QB8A 4OMEA 4UBRA 2EWBA 5I4MA 2H5MA 1IY7A 3B2YA 1B87A 3FB3A 5HVGA 3CZXA 1RXTA 2OH1A 2Z10A 4OADA 2HB6A 2PVVA 2Z3NA 4KOTA 2HC9A 2CF4A 4CGNA 3D67A 4OC1A 4B5PB 2JDDA 4NXYA 4BMHA 1LRZA 4MHDA 4MCPA 1YW6A 4FD7A 1KUXA 4PXCA 2EVNA 4QUSA 4KVXA 4EFDA 2P6GA 4OC0A 3PB9X 3H5ZA 5FVJA 2FL4A 2VQYA 2PRQA 2B58A 3FXTA 5IB0A 5LYFA 4Z65A 1MJBA 4AVBA 1WWZA 4UEEA 1Z5RA 4PXBA 2X7BA 2J8NA 5LYLA 3FYNA 4YWYA 5AG7A 1IOFA 4EWTA 4R7MA 4EVYA 5C82A 2AFMA 2YGWA 4KSAA 2ZEFA 4AB7A 4UCNA 4HNWB 4WWVA 2OZGA 2G0BA 4IAVA 4XPLA 2PC1A 3SJXA 3T8WA 2OB0A 2PJCA 3ISXA 2JDCA 3TOAA 5K8NA 3SXNA 2XEIA 3SXOA 4KVOE 4MFJA 2GU2A 1TIQA 3IWEA 2PVWA 2PCUA 4UFWA 5HH1A 4OIDA 4B14A 3BI0A 4KUAA 1S7KA 4WJBA 2GLFA 3D66A 3B8GA 2DPSA 4Q38A 4MHZA 3D7HA 1JWQA 3DR8A 5K8PA 4ZYQA 1L0CA 1KWMA 2AFSA 3KR4A 1TXRA 4KSFA 4PQAA 3VARA 4QC6A 1HDQA 1VHSA 2JLMA 4BINA 3IGRA 1VGYA 2PJAA 2RFHA 1KUVA 3KHZA 4R76A 3H8GA 1F2OA 3TO9A 2CNTA 5BWAB 2O28A 4GXHA 5JQ4A 4CAWA 5KTAA 1IB1E 1ZLHA 2ZEDA 1Z8TA 5CNPA 3R9GA 2ZXVA 3PB7X 1M4LA 4ZGYB 1YVKA 3LODA 3CXQA 2FCKA 8CPAA 4C2ZA 3KZWA 4FAIA 1VKCA 1S7FA 3N5FA 4A37A 4L89A 5ISVA 1J4JA 4KUBA 4CAFA 5I0CA 3BI1A 4C7IA 2ZEPA 2Z11A 3GKRA 4QVTA 4OLLA 2P6EA 2J8MA 4IUSA 3PP9A 2OOTA 1Y7EA 4CS0B 3H8EA 4RS2A 3WC6A 4A38A 3N7ZA 5A28A 2B5GA 1CM0A 4OC5A 5G21A 3FRMA 3FIXA 5DWMA 1TF8A 3RAMA 2V8GA 3SI0A 1YX0A 4CGOA 1CG2A 4NJRA 5A27A 4MJ8A 3ZZIA 4A31A 4QBJA 1S3ZA 3F8KA 2QIRA 4M85A 4KLVA 1ON0A 4O23A 3B35A 2F8HA 3VWDA 1NSLA 4B11A 2POKA 2ATRA 4FWUA 3JUWA 1KUYA 3A9LA 4NGRA 3K9UA 1AUGA 3S9MA 4MY0A 3G3SA 4HKFA 5F09A 1QSTA 3TT2A 3DLJA 3NH4A 1CX8A 2R7HA 4F8ZA 3KR5A 2DF5A 2V8VA 3WC5A 2AFXA 2FIAA 3IWWA 2I00A 4JXQA 4Q36A 1LAPA 2GIVA 3UY5A 2BOAA 4MXUA 5JGFA 4CAVA 4B6ZA 1FNOA 4JYWA 3FEDA 1R3NA 3DGVA 4CRYB 5LRGA 3P2HA 1TKJA 2AFWA 2OU2A 2EUIA 4Q7AA 2B4DB 2O4HA 3DDDA 4MBUA 1YSJA 2NYQA 2ZW6A 3B3CA 4U9YA
chains in the Genus database with same CATH topology
3S6HA 1YVOA 3D2PA 4B13A 4PK3A 1RO5A 4AG9A 1XMTA 2CNMA 2R1IA 3PZJA 3D8PA 3JTKA 2Q4VA 4UWJA 4PSWA 4UA3A 4A95A 2GE3A 4UCPA 4I49A 1S7LA 1YR0A 3BLNA 5HMNA 4DNCA 1KZFA 2HQYA 3V8IA 4K30A 3D3SA 4MFKA 2Z3KA 2FIWA 3TO6A 4CAXA 5G20A 2D4PA 3DNSA 4CYNA 2VZYA 1PU9A 2FS5A 4UCMA 4UFVA 3SHPA 5H84A 4BBHA 2Z3OA 5G22A 4IF5A 4AVCA 2P6FA 4JWPA 2B4BA 3EO4A 3W6XA 4E8OA 1CJWA 5AG4A 3TE4A 5AGEA 1Y9KA 3GYAA 2AJ6A 3IU1A 3EC4A 3E0KA 4KZTA 1S7NA 4XNHB 4KOVA 3EFAA 4RI1A 2Z3MA 1Y9WA 5F46A 2VBQA 1IYLA 1Q2YA 4AG7A 4C2XA 2HUZA 2D4OA 5H86A 3CXPA 4KLWA 2QMLA 1S5KA 1Q2CA 2ZW5A 4XPDB 2VI7A 3BJ8A 4R9MA 4GS4A 5F49A 1XF8A 4C68A 3R9EA 3R1KA 1QSNA 4U9ZA 4YGOA 2ZW7A 4KOSA 2B5GB 4II9A 1B6BA 4R57A 3W6SA 1XIXA 1S60A 2RC4A 5C88A 4CGMA 1M1DA 1ZO0A 2J8RA 1R57A 2Y0MA 2CY2A 2YNCC 2PDOA 1IICA 2FSRA 5F48A 4NCZA 4NF1A 2Q04A 2KCWA 2YNDA 3RYOA 4E0AA 4B5OA 2PR8A 2Q4YA 3VWEA 1U6MA 2WUUA 3DR6A 4F0XA 4ORFA 1MJ9A 2AE6A 2A4NA 1MK4A 1MJAA 4AVAA 2WSAA 4KOWA 1K4JA 4R87A 5EBVA 3S6KA 4CGLA 1BOBA 5KTCA 4HNXB 3TOBA 1QSRA 1V0CA 3G8WA 1BO4A 2P0WA 2REEA 3KKWA 1QSMA 4QB9A 5G1ZA 2R98A 4MY3A 4UFXA 4A32A 5EC4A 4L8AA 1GHEA 1M4IA 2BUEA 2FE7A 4R3LA 1P4NA 2QECA 3FNCA 1M4DA 2CXAA 2FXFA 1IIDA 5AG6A 5GCNA 1XE4A 1YK3A 2Z0ZA 4E2AA 2B3VA 5E96A 4LUAA 4MFQA 1YGHA 2Z3LA 4F0YA 3R95A 4B10A 1XEBA 2VXKA 4B12A 2IL4A 4FD5A 4YFJA 2BSWA 4B5PA 2G3AA 3DSBA 3D2MA 2Z3PA 4KS9A 1P0HA 2CNSA 4CYQA 4PSXA 2GANA 4PV6A 2PR1A 2ZW4A 3S6GA 4KOXA 4MFZA 1PUAA 1QSOA 3F0AA 3GY9A 3F5BA 5DWNA 4NSQA 4A33A 1Z9UA 4KVME 4JJXA 2G3TA 2YNCA 3TFYA 3W91A 2VZZA 1M4GA 1Q2DA 3BJ7A 2WPXA 4MFPA 2DPTA 1I12A 4KOUA 4C7HA 4F6AA 3S6FA 3TCVA 4JXRA 2OZUA 2C27A 3ZJ0A 1Z4EA 1I1DA 2FT0A 3R96A 5J8CA 1Y7RA 4NEXA 4CRZB 1Z4RA 2R8VA 2BL1A 3FBUA 3R9FA 4LX9A 2F5IA 3IWGA 4Y49B 2YNEA 3OWCA 2Q7BA 2DXQA 2K5TA 3QAHA 1N71A 4X5KA 5AG5A 3WR7A 3JVNA 4JLYA 4U5YA 4UWIA 3T9YA 3I9SA 4MFLA 3T90A 4J3GA 3TO7A 3I3GA 4FD6A 5J8FA 3TTHA 2JEVA 2I79A 4H89A 3EY5A 3H4QA 1WK4A 2Q0YA 3MGDA 5IX3A 2BEIA 4PK2A 4CGPA 2ZPAA 4R3KA 3C26A 4JD6A 2NMTA 2REFA 1FY7A 1NE9A 1YLEA 2PRBA 4XNHC 2Q44A 4XPKA 2PQ8A 4H6UA 1I21A 1YREA 4KORA 4ONUA 3EXNA 2WPWA 4H6ZA 4HNYB 3P2FA 2ARHA 2VEZA 5F47A 1NMTA 3LD2A 1M44A 3CXSA 4YRHA 4CYPA 4FD4A 4XPDC 4KOYA 1OZPA 1SQHA 2HV2A 4A2ZA 4C2YA 4CAEA 5KTDA 1IYKA 2B3UA 2PSWA 4OAEA 4CYOA 5IV0A 2B4DA 3IU2A 5JPHA 1UFHA 3NE7A 4ZBGA 4A30A 4Y49C 2OZHA 4M3SA 3PGPA 4MI4A 4UBRA 3QB8A 2H5MA 1B87A 3FB3A 1RXTA 2OH1A 2Z10A 4OADA 2Z3NA 4KOTA 4CGNA 4B5PB 2JDDA 4NXYA 4BMHA 1LRZA 4MHDA 4FD7A 1KUXA 2EVNA 4QUSA 4KVXA 2P6GA 3H5ZA 5FVJA 2FL4A 2VQYA 5IB0A 2B58A 3FXTA 1MJBA 4AVBA 1WWZA 2X7BA 2J8NA 3FYNA 5AG7A 4EVYA 5C82A 2YGWA 4KSAA 4AB7A 4UCNA 4HNWB 4XPLA 2OZGA 2G0BA 2PC1A 2OB0A 2JDCA 3TOAA 3SXNA 3SXOA 4KVOE 4MFJA 1TIQA 3IWEA 4UFWA 5HH1A 4B14A 4KUAA 1S7KA 3B8GA 2DPSA 4Q38A 3DR8A 1L0CA 4KSFA 4QC6A 1VHSA 2JLMA 3IGRA 1KUVA 3TO9A 2CNTA 5BWAB 2O28A 5JQ4A 5KTAA 4CAWA 1IB1E 5CNPA 3R9GA 2ZXVA 4ZGYB 1YVKA 3LODA 3CXQA 2FCKA 4C2ZA 1VKCA 1S7FA 4L89A 5ISVA 1J4JA 4KUBA 4CAFA 5I0CA 4C7IA 2Z11A 3GKRA 4QVTA 4OLLA 2P6EA 2J8MA 4IUSA 3PP9A 4CS0B 4RS2A 3N7ZA 5A28A 2B5GA 1CM0A 5G21A 3FRMA 3FIXA 5DWMA 4CGOA 1YX0A 5A27A 4MJ8A 3ZZIA 4A31A 4QBJA 1S3ZA 3F8KA 2QIRA 4M85A 4KLVA 1ON0A 3VWDA 1NSLA 4B11A 2ATRA 3JUWA 1KUYA 3A9LA 3K9UA 4MY0A 3G3SA 4HKFA 1QSTA 3TT2A 2R7HA 2FIAA 3UY5A 2I00A 4JXQA 4Q36A 2GIVA 4CAVA 4CRYB 3P2HA 2OU2A 2EUIA 2B4DB 3DDDA 4MBUA 2ZW6A 4U9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6H A;  1YVO A;  3D2P A;  4PK3 A;  1RO5 A;  4AG9 A;  1XMT A;  2CNM A;  2R1I A;  3PZJ A;  3D8P A;  2Q4V A;  4UWJ A;  4PSW A;  4UA3 A;  2GE3 A;  4I49 A;  1S7L A;  1YR0 A;  3BLN A;  5HMN A;  4DNC A;  1KZF A;  2HQY A;  3V8I A;  4K30 A;  3D3S A;  2FIW A;  3TO6 A;  4CAX A;  2D4P A;  3DNS A;  2VZY A;  1PU9 A;  2FS5 A;  3SHP A;  5H84 A;  4IF5 A;  4AVC A;  2P6F A;  4JWP A;  2B4B A;  3EO4 A;  3W6X A;  4E8O A;  1CJW A;  3TE4 A;  1Y9K A;  3GYA A;  2AJ6 A;  3EC4 A;  3E0K A;  4KZT A;  1S7N A;  4XNH B;  4KOV A;  3EFA A;  4RI1 A;  1Y9W A;  5F46 A;  2VBQ A;  1IYL A;  1Q2Y A;  4AG7 A;  2HUZ A;  2D4O A;  5H86 A;  3CXP A;  4KLW A;  2QML A;  1S5K A;  1Q2C A;  2ZW5 A;  4XPD B;  2VI7 A;  3BJ8 A;  4R9M A;  4GS4 A;  5F49 A;  1XF8 A;  3R9E A;  3R1K A;  1QSN A;  4U9Z A;  4YGO A;  2ZW7 A;  4KOS A;  2B5G B;  4II9 A;  1B6B A;  4R57 A;  3W6S A;  1XIX A;  1S60 A;  2RC4 A;  5C88 A;  1M1D A;  2J8R A;  1R57 A;  2Y0M A;  2CY2 A;  2PDO A;  1IIC A;  2FSR A;  5F48 A;  4NCZ A;  4NF1 A;  2Q04 A;  2KCW A;  3RYO A;  4E0A A;  4B5O A;  2PR8 A;  2Q4Y A;  3VWE A;  1U6M A;  3DR6 A;  4ORF A;  1MJ9 A;  2AE6 A;  2A4N A;  1MK4 A;  1MJA A;  4AVA A;  3S6K A;  4KOW A;  1K4J A;  4R87 A;  5EBV A;  1BOB A;  5KTC A;  4HNX B;  3TOB A;  1QSR A;  1V0C A;  3G8W A;  1BO4 A;  2P0W A;  2REE A;  3KKW A;  1QSM A;  4QB9 A;  2R98 A;  4MY3 A;  5EC4 A;  4L8A A;  1GHE A;  1M4I A;  2BUE A;  2FE7 A;  4R3L A;  1P4N A;  2QEC A;  3FNC A;  1M4D A;  2FXF A;  1IID A;  5GCN A;  1XE4 A;  1YK3 A;  2Z0Z A;  4E2A A;  2B3V A;  5E96 A;  4LUA A;  1YGH A;  4F0Y A;  3R95 A;  1XEB A;  2VXK A;  2IL4 A;  4FD5 A;  4YFJ A;  2BSW A;  4B5P A;  2G3A A;  3DSB A;  3D2M A;  1P0H A;  2CNS A;  4PSX A;  2GAN A;  4PV6 A;  2PR1 A;  2ZW4 A;  3S6G A;  4KOX A;  1PUA A;  1QSO A;  3F0A A;  3GY9 A;  3F5B A;  5DWN A;  4NSQ A;  1Z9U A;  4KVM E;  4JJX A;  2G3T A;  3TFY A;  3W91 A;  2VZZ A;  1M4G A;  1Q2D A;  3BJ7 A;  2WPX A;  1I12 A;  4KOU A;  4F6A A;  3S6F A;  3TCV A;  4JXR A;  2OZU A;  2C27 A;  3ZJ0 A;  1Z4E A;  1I1D A;  2FT0 A;  3R96 A;  5J8C A;  1Y7R A;  4NEX A;  4CRZ B;  1Z4R A;  2R8V A;  2BL1 A;  3FBU A;  3R9F A;  4LX9 A;  2F5I A;  3IWG A;  4Y49 B;  2Q7B A;  3OWC A;  2DXQ A;  2K5T A;  3QAH A;  1N71 A;  4X5K A;  3WR7 A;  3JVN A;  4JLY A;  4U5Y A;  4UWI A;  3T9Y A;  3I9S A;  3T90 A;  4J3G A;  3TO7 A;  3I3G A;  4FD6 A;  5J8F A;  3TTH A;  2JEV A;  2I79 A;  4H89 A;  3EY5 A;  3H4Q A;  1WK4 A;  2Q0Y A;  3MGD A;  5IX3 A;  2BEI A;  4PK2 A;  2ZPA A;  4R3K A;  3C26 A;  4JD6 A;  2NMT A;  2REF A;  1FY7 A;  1NE9 A;  1YLE A;  2PRB A;  4XNH C;  2Q44 A;  4XPK A;  2PQ8 A;  4H6U A;  1I21 A;  1YRE A;  4KOR A;  4ONU A;  3EXN A;  2WPW A;  4H6Z A;  4HNY B;  3P2F A;  2ARH A;  2VEZ A;  5F47 A;  1NMT A;  3LD2 A;  1M44 A;  3CXS A;  4YRH A;  4FD4 A;  4XPD C;  4KOY A;  1OZP A;  1SQH A;  2HV2 A;  5KTD A;  1IYK A;  2B3U A;  2PSW A;  4OAE A;  5IV0 A;  2B4D A;  5JPH A;  1UFH A;  3NE7 A;  4ZBG A;  4Y49 C;  2OZH A;  4M3S A;  3PGP A;  4MI4 A;  4UBR A;  3QB8 A;  2H5M A;  1B87 A;  3FB3 A;  1RXT A;  2OH1 A;  2Z10 A;  4OAD A;  4KOT A;  4B5P B;  2JDD A;  4NXY A;  4BMH A;  1LRZ A;  4MHD A;  4FD7 A;  1KUX A;  2EVN A;  4QUS A;  4KVX A;  2P6G A;  5FVJ A;  2FL4 A;  2VQY A;  5IB0 A;  2B58 A;  3FXT A;  1MJB A;  4AVB A;  1WWZ A;  2X7B A;  2J8N A;  3FYN A;  4EVY A;  5C82 A;  4AB7 A;  4XPL A;  4HNW B;  2OZG A;  2G0B A;  2PC1 A;  2OB0 A;  2JDC A;  3TOA A;  3SXN A;  3SXO A;  4KVO E;  1TIQ A;  5HH1 A;  4KUA A;  1S7K A;  3B8G A;  3DR8 A;  1L0C A;  4QC6 A;  1VHS A;  2JLM A;  3IGR A;  1KUV A;  3TO9 A;  2CNT A;  2O28 A;  5JQ4 A;  5KTA A;  4CAW A;  1IB1 E;  5CNP A;  3R9G A;  2ZXV A;  1YVK A;  3LOD A;  3CXQ A;  2FCK A;  1VKC A;  1S7F A;  4L89 A;  5ISV A;  1J4J A;  4KUB A;  5I0C A;  2Z11 A;  3GKR A;  4QVT A;  4OLL A;  2P6E A;  2J8M A;  4IUS A;  3PP9 A;  4CS0 B;  4RS2 A;  3N7Z A;  2B5G A;  1CM0 A;  3FRM A;  3FIX A;  5DWM A;  1YX0 A;  4MJ8 A;  3ZZI A;  4QBJ A;  1S3Z A;  3F8K A;  2QIR A;  4M85 A;  4KLV A;  1ON0 A;  3VWD A;  1NSL A;  2ATR A;  3JUW A;  1KUY A;  3K9U A;  4MY0 A;  3G3S A;  4HKF A;  1QST A;  3TT2 A;  2R7H A;  2FIA A;  3UY5 A;  2I00 A;  4JXQ A;  2GIV A;  4CAV A;  4CRY B;  3P2H A;  2OU2 A;  2EUI A;  2B4D B;  3DDD A;  4MBU A;  2ZW6 A;  4U9Y A; 
#chains in the Genus database with same CATH topology
 3S6H A;  3IIB A;  5LYD A;  4KSI A;  1YVO A;  3D2P A;  4UIB A;  4B13 A;  4PK3 A;  1RO5 A;  3D7F A;  1Z8X A;  1UWY A;  3PB6 X;  1XMT A;  2PJ0 A;  3SI2 A;  4AG9 A;  3NH8 A;  4NGP A;  2CNM A;  4P6Y A;  2R1I A;  3PZJ A;  1HDU A;  2F7V A;  3D8P A;  3JTK A;  4ZX8 A;  1CP6 A;  2EK8 A;  2Q4V A;  2QJ8 A;  1YW4 A;  3PFE A;  3L2N A;  4UWJ A;  4PSW A;  2O53 A;  2FVG A;  4G1P A;  1TKH A;  5D8N A;  3HLP A;  1VHO A;  3QAY A;  4UA3 A;  3KHX A;  4A95 A;  2GE3 A;  1XFO A;  2XEF A;  2QVP A;  4UCP A;  4I49 A;  1S7L A;  3NA6 A;  1YR0 A;  1IGB A;  2AFU A;  3BLN A;  3RO0 A;  5HMN A;  5JM6 A;  4JZ0 A;  4DNC A;  5ELY A;  2GFQ A;  4DYO A;  3IFE A;  1KZF A;  2V8D A;  2HQY A;  3V8I A;  1RTQ A;  3NFZ A;  3CPX A;  4K30 A;  3D3S A;  4MFK A;  4FBE A;  2Z3K A;  2FIW A;  2VL1 A;  3TO6 A;  1CBX A;  4CAX A;  1CP7 A;  1QQ9 A;  1ELM P;  2ZOF A;  5G20 A;  2D4P A;  3DNS A;  1XRY A;  4CYN A;  1BPM A;  2VZY A;  1PU9 A;  2FS5 A;  4UCM A;  4UFV A;  3SHP A;  2PJ4 A;  3TC8 A;  5H84 A;  4BBH A;  2Z3O A;  3WT4 A;  4W9Y A;  5G22 A;  3VH9 A;  1Z8L A;  4IF5 A;  3CDX A;  4AVC A;  2P6F A;  4JWP A;  2B4B A;  4UEF A;  2GLJ A;  1LFW A;  4P44 A;  4TNU A;  3WAB A;  4EME A;  3EO4 A;  3B7I A;  1PCA A;  3W6X A;  3CPA A;  5THW A;  4CPA A;  3FX6 A;  4E8O A;  1CJW A;  5AG4 A;  2PIZ A;  3MN8 A;  3RNZ A;  2PJ3 A;  2ZEM A;  5IB9 A;  3TE4 A;  1CPX A;  5AGE A;  1Y9K A;  4X2T A;  3GYA A;  2AJ6 A;  3IU1 A;  3KAS A;  2AFZ A;  3B3S A;  3EC4 A;  3E0K A;  4KZT A;  1S7N A;  2C6G A;  4XNH B;  4KOV A;  3EFA A;  3PBB A;  4RI1 A;  4OC3 A;  2Z3M A;  1Y9W A;  2EO8 A;  2PJ8 A;  5F46 A;  2C6C A;  2ZEN A;  2VBQ A;  1IYL A;  1Q2Y A;  4ZX9 A;  4AG7 A;  4NFR A;  2GRE A;  4F9V A;  1IOI A;  1ZLI A;  1H8L A;  2HUZ A;  1ZG8 A;  4OIW A;  2PJ5 A;  5EMI A;  4C2X A;  2D4O A;  2ZEH A;  3FEC A;  2CIJ A;  5H86 A;  3CXP A;  4KLW A;  1FT7 A;  4ONW A;  3GUX A;  2QML A;  1S5K A;  1Q2C A;  1QMU A;  2ZW5 A;  4YU9 A;  2IMO A;  4XPD B;  2VI7 A;  3HUV A;  4DJL A;  3GIU A;  5CPA A;  3BJ8 A;  3B3W A;  4R9M A;  2AFO A;  1X10 A;  4FUU A;  4GS4 A;  4MCQ A;  1XF8 A;  2Q43 A;  5F49 A;  4BD9 A;  4C68 A;  3R9E A;  3R1K A;  5CBM A;  3FEE A;  1QSN A;  4U9Z A;  4YGO A;  2ZW7 A;  3PRT A;  2C1C A;  2B5G B;  2Q7S A;  4IK2 A;  4KOS A;  4II9 A;  1Q7L A;  3KQZ A;  1B6B A;  5HXD A;  4NGT A;  4R57 A;  3B3V A;  3W6S A;  1XIX A;  2IQ6 A;  1S60 A;  1XBU A;  1TKF A;  3S9N A;  5LRK A;  2JEW A;  2RC4 A;  5C88 A;  4CGM A;  1M1D A;  1ZO0 A;  2J8R A;  1TF9 A;  1R57 A;  2Y0M A;  2CY2 A;  2YNC C;  2PDO A;  2XEJ A;  1IIC A;  1LCP A;  3TX8 A;  2FSR A;  4X3R A;  4TWE A;  5F48 A;  4NCZ A;  1Z8W A;  2Q51 A;  2Q04 A;  4NF1 A;  2KCW A;  2YND A;  3RYO A;  4E0A A;  4MCS A;  4B5O A;  4R6T A;  2PR8 A;  4ZY1 A;  1YME A;  2Q4Y A;  3QNV A;  3VWE A;  1CPS A;  1U6M A;  2WUU A;  3DR6 A;  5LRJ A;  4F0X A;  3D4U A;  2G9D A;  4ORF A;  4MHN A;  1MJ9 A;  4UF4 A;  5DS0 A;  2XEG A;  3IO1 A;  2AE6 A;  3BHX A;  4UEZ A;  1OBR A;  2A4N A;  3PB4 X;  1MK4 A;  1MJA A;  4MHY A;  4AVA A;  1Y0R A;  4MMO A;  4M6H A;  3BXM A;  2WSA A;  4KOW A;  1GYT A;  1K4J A;  4R87 A;  5EBV A;  3S6K A;  3V38 A;  4CGL A;  1BOB A;  3GLJ A;  5KTC A;  4HNX B;  3TOB A;  4UIA A;  1QSR A;  1V0C A;  1DE4 C;  4DUK A;  1AYE A;  3G8W A;  1BO4 A;  2P0W A;  2REE A;  3KKW A;  1ZG9 A;  4RUH A;  1QSM A;  4QB9 A;  5G1Z A;  3PEI A;  4PXD A;  2C6P A;  3KL9 A;  2R98 A;  4MY3 A;  4UFX A;  4A32 A;  3FVL A;  2CTB A;  5EC4 A;  2NSM A;  1NSA A;  1VIX A;  4L8A A;  1GHE A;  1M4I A;  2BUE A;  2I3C A;  1R43 A;  2FE7 A;  2ZOG A;  3D7D A;  4OC2 A;  4ZY0 A;  4R3L A;  1P4N A;  2QEC A;  3FNC A;  4H2K A;  1M4D A;  1X12 A;  2CXA A;  5JH9 A;  2FXF A;  4MHP A;  1IID A;  4P4E A;  5AG6 A;  1XE4 A;  5GCN A;  3V7Z A;  1BPN A;  1YK3 A;  2DEA A;  2Z0Z A;  3I1U A;  4E2A A;  2BO9 A;  1XMB A;  3NH5 A;  2B3V A;  5E96 A;  4LUA A;  3CT9 A;  2ZEO A;  2ZEG A;  4HPS A;  4MFQ A;  4P45 A;  1BAV A;  1YGH A;  3KI9 A;  2Z3L A;  4ZI6 A;  4NGQ A;  3R95 A;  4F0Y A;  3VAT A;  4B10 A;  1XEB A;  2EBJ A;  2VXK A;  4B12 A;  2IL4 A;  3B3T A;  3JRU A;  4P10 A;  4FD5 A;  3LMS A;  3PBE A;  4NGN A;  4YFJ A;  2BSW A;  2CTC A;  2G3A A;  3SJG A;  4B5P A;  2JBJ A;  4NGS A;  3DSB A;  3D2M A;  2Z3P A;  4KS9 A;  1P0H A;  3RBU A;  3IJ3 A;  2CNS A;  4CYQ A;  3FH4 A;  4OC4 A;  1XOV A;  2Q4Z A;  4PSX A;  2GAN A;  2ANP A;  2PR1 A;  4P4D A;  4PV6 A;  3LAC A;  4P4I A;  2ZW4 A;  2OR4 A;  3S6G A;  2EK9 A;  4KOX A;  4MFZ A;  5J1Q A;  1PUA A;  1QSO A;  3F0A A;  3GY9 A;  2JBK A;  3F5B A;  1DTD A;  3FJU A;  3WC7 A;  5DWN A;  1ELL P;  4NSQ A;  3SI1 A;  4A33 A;  4AXV A;  1Z9U A;  4KVM E;  2RB7 A;  4JJX A;  1LAM A;  2IJZ A;  1ZG7 A;  2WZN A;  2ODF A;  1AMP A;  3K9T A;  1Y0Y A;  4PPZ A;  2G3T A;  2YNC A;  3TFY A;  1JQG A;  4LQ6 A;  3W91 A;  2VZZ A;  3H8F A;  1M4G A;  1Q2D A;  3SJE A;  3BJ7 A;  4NJQ A;  2WPX A;  1BLL E;  4MFP A;  1YLO A;  4A94 A;  1VHE A;  2DPT A;  3PB8 X;  1I12 A;  4KOU A;  3IC1 A;  4C7H A;  4F6A A;  3FF3 A;  3S6F A;  3TCV A;  4JXR A;  4MCR A;  2OZU A;  4MRI A;  2C27 A;  4PXE A;  3GB0 A;  4P4J A;  2ZEE A;  3ZJ0 A;  1Z4E A;  4K3N A;  1I1D A;  2FT0 A;  3R96 A;  3KQX A;  5J8C A;  5D29 A;  1LOK A;  1Y7R A;  4P4B A;  5LYI A;  3KGQ A;  2V77 A;  4NEX A;  4CRZ B;  1Z4R A;  2R8V A;  2BL1 A;  3FBU A;  3R9F A;  4LX9 A;  2F5I A;  2ZEL A;  3IWG A;  1F2P A;  3D7G A;  3MRU A;  2YNE A;  3OWC A;  4Y49 B;  4M6I A;  2Q7B A;  2DXQ A;  4GM5 A;  1LAN A;  2K5T A;  2J9A A;  3QAH A;  1N71 A;  4X5K A;  5HVF A;  5AG5 A;  3NE8 A;  3WR7 A;  1XJO A;  3JVN A;  1A2Z A;  4JLY A;  2PJ9 A;  4U5Y A;  3I9S A;  4MFL A;  4UWI A;  3T9Y A;  4J3G A;  3T90 A;  4OP4 A;  4X8I A;  3TO7 A;  3I3G A;  4FD6 A;  4OKO A;  4M6G A;  5J8F A;  3TTH A;  3RZA A;  2WYR A;  2JEV A;  3PFO A;  2I79 A;  4H89 A;  1YQE A;  3EY5 A;  3H4Q A;  1Z2L A;  2QYV A;  1WK4 A;  2Q0Y A;  3MGD A;  4ZY2 A;  5IX3 A;  4LQG A;  2BEI A;  4PK2 A;  4CGP A;  2ZPA A;  4R3K A;  3C26 A;  2V8H A;  4JD6 A;  3SJF A;  3ISZ A;  2NMT A;  2PIY A;  2REF A;  1FY7 A;  1NE9 A;  1YLE A;  2PJ2 A;  2PRB A;  4XNH C;  2Q44 A;  4XPK A;  4P4F A;  2BCO A;  2PQ8 A;  4H6U A;  1I21 A;  1YRE A;  3K2K A;  1PYT B;  4KOR A;  4ONU A;  3EXN A;  2WPW A;  3FMC A;  4H6Z A;  5HVH A;  4HNY B;  3P2F A;  6CPA A;  2ARH A;  2VEZ A;  5F47 A;  2PJ1 A;  2PJ6 A;  1NMT A;  3LD2 A;  2ABZ A;  5K8M A;  5K8O A;  1M44 A;  1HEE A;  3CXS A;  4YRH A;  3IEH A;  4CYP A;  4FD4 A;  4F9U A;  4XPD C;  4KOY A;  3D68 A;  1OZP A;  1SQH A;  1ARL A;  2HV2 A;  4RN7 A;  4A2Z A;  4C2Y A;  4CAE A;  5KTD A;  3S9L A;  4NGM A;  1IYK A;  2B3U A;  2PSW A;  3LWU A;  4OAE A;  4CYO A;  5IV0 A;  4IHM A;  2B4D A;  4R8F A;  7CPA A;  3IU2 A;  5JPH A;  1UFH A;  2PJ7 A;  2PJB A;  3NE7 A;  4ZBG A;  1ARM A;  4A30 A;  4Y49 C;  1F57 A;  1EE3 P;  2PE3 A;  2OZH A;  4A39 A;  4M3S A;  3PGP A;  4MI4 A;  1IU8 A;  3QB8 A;  4OME A;  4UBR A;  2EWB A;  5I4M A;  2H5M A;  1IY7 A;  3B2Y A;  1B87 A;  3FB3 A;  5HVG A;  3CZX A;  1RXT A;  2OH1 A;  2Z10 A;  4OAD A;  2HB6 A;  2PVV A;  2Z3N A;  4KOT A;  2HC9 A;  2CF4 A;  4CGN A;  3D67 A;  4OC1 A;  4B5P B;  2JDD A;  4NXY A;  4BMH A;  1LRZ A;  4MHD A;  4MCP A;  1YW6 A;  4FD7 A;  1KUX A;  4PXC A;  2EVN A;  4QUS A;  4KVX A;  4EFD A;  2P6G A;  4OC0 A;  3PB9 X;  3H5Z A;  5FVJ A;  2FL4 A;  2VQY A;  2PRQ A;  2B58 A;  3FXT A;  5IB0 A;  5LYF A;  4Z65 A;  1MJB A;  4AVB A;  1WWZ A;  4UEE A;  1Z5R A;  4PXB A;  2X7B A;  2J8N A;  5LYL A;  3FYN A;  4YWY A;  5AG7 A;  1IOF A;  4EWT A;  4R7M A;  4EVY A;  5C82 A;  2AFM A;  2YGW A;  4KSA A;  2ZEF A;  4AB7 A;  4UCN A;  4HNW B;  4WWV A;  2OZG A;  2G0B A;  4IAV A;  4XPL A;  2PC1 A;  3SJX A;  3T8W A;  2OB0 A;  2PJC A;  3ISX A;  2JDC A;  3TOA A;  5K8N A;  3SXN A;  2XEI A;  3SXO A;  4KVO E;  4MFJ A;  2GU2 A;  1TIQ A;  3IWE A;  2PVW A;  2PCU A;  4UFW A;  5HH1 A;  4OID A;  4B14 A;  3BI0 A;  4KUA A;  1S7K A;  4WJB A;  2GLF A;  3D66 A;  3B8G A;  2DPS A;  4Q38 A;  4MHZ A;  3D7H A;  1JWQ A;  3DR8 A;  5K8P A;  4ZYQ A;  1L0C A;  1KWM A;  2AFS A;  3KR4 A;  1TXR A;  4KSF A;  4PQA A;  3VAR A;  4QC6 A;  1HDQ A;  1VHS A;  2JLM A;  4BIN A;  3IGR A;  1VGY A;  2PJA A;  2RFH A;  1KUV A;  3KHZ A;  4R76 A;  3H8G A;  1F2O A;  3TO9 A;  2CNT A;  5BWA B;  2O28 A;  4GXH A;  5JQ4 A;  4CAW A;  5KTA A;  1IB1 E;  1ZLH A;  2ZED A;  1Z8T A;  5CNP A;  3R9G A;  2ZXV A;  3PB7 X;  1M4L A;  4ZGY B;  1YVK A;  3LOD A;  3CXQ A;  2FCK A;  8CPA A;  4C2Z A;  3KZW A;  4FAI A;  1VKC A;  1S7F A;  3N5F A;  4A37 A;  4L89 A;  5ISV A;  1J4J A;  4KUB A;  4CAF A;  5I0C A;  3BI1 A;  4C7I A;  2ZEP A;  2Z11 A;  3GKR A;  4QVT A;  4OLL A;  2P6E A;  2J8M A;  4IUS A;  3PP9 A;  2OOT A;  1Y7E A;  4CS0 B;  3H8E A;  4RS2 A;  3WC6 A;  4A38 A;  3N7Z A;  5A28 A;  2B5G A;  1CM0 A;  4OC5 A;  5G21 A;  3FRM A;  3FIX A;  5DWM A;  1TF8 A;  3RAM A;  2V8G A;  3SI0 A;  1YX0 A;  4CGO A;  1CG2 A;  4NJR A;  5A27 A;  4MJ8 A;  3ZZI A;  4A31 A;  4QBJ A;  1S3Z A;  3F8K A;  2QIR A;  4M85 A;  4KLV A;  1ON0 A;  4O23 A;  3B35 A;  2F8H A;  3VWD A;  1NSL A;  4B11 A;  2POK A;  2ATR A;  4FWU A;  3JUW A;  1KUY A;  3A9L A;  4NGR A;  3K9U A;  1AUG A;  3S9M A;  4MY0 A;  3G3S A;  4HKF A;  5F09 A;  1QST A;  3TT2 A;  3DLJ A;  3NH4 A;  1CX8 A;  2R7H A;  4F8Z A;  3KR5 A;  2DF5 A;  2V8V A;  3WC5 A;  2AFX A;  2FIA A;  3IWW A;  2I00 A;  4JXQ A;  4Q36 A;  1LAP A;  2GIV A;  3UY5 A;  2BOA A;  4MXU A;  5JGF A;  4CAV A;  4B6Z A;  1FNO A;  4JYW A;  3FED A;  1R3N A;  3DGV A;  4CRY B;  5LRG A;  3P2H A;  1TKJ A;  2AFW A;  2OU2 A;  2EUI A;  4Q7A A;  2B4D B;  2O4H A;  3DDD A;  4MBU A;  1YSJ A;  2NYQ A;  2ZW6 A;  3B3C A;  4U9Y A; 
#chains in the Genus database with same CATH homology
 3S6H A;  1YVO A;  3D2P A;  4B13 A;  4PK3 A;  1RO5 A;  4AG9 A;  1XMT A;  2CNM A;  2R1I A;  3PZJ A;  3D8P A;  3JTK A;  2Q4V A;  4UWJ A;  4PSW A;  4UA3 A;  4A95 A;  2GE3 A;  4UCP A;  4I49 A;  1S7L A;  1YR0 A;  3BLN A;  5HMN A;  4DNC A;  1KZF A;  2HQY A;  3V8I A;  4K30 A;  3D3S A;  4MFK A;  2Z3K A;  2FIW A;  3TO6 A;  4CAX A;  5G20 A;  2D4P A;  3DNS A;  4CYN A;  2VZY A;  1PU9 A;  2FS5 A;  4UCM A;  4UFV A;  3SHP A;  5H84 A;  4BBH A;  2Z3O A;  5G22 A;  4IF5 A;  4AVC A;  2P6F A;  4JWP A;  2B4B A;  3EO4 A;  3W6X A;  4E8O A;  1CJW A;  5AG4 A;  3TE4 A;  5AGE A;  1Y9K A;  3GYA A;  2AJ6 A;  3IU1 A;  3EC4 A;  3E0K A;  4KZT A;  1S7N A;  4XNH B;  4KOV A;  3EFA A;  4RI1 A;  2Z3M A;  1Y9W A;  5F46 A;  2VBQ A;  1IYL A;  1Q2Y A;  4AG7 A;  4C2X A;  2HUZ A;  2D4O A;  5H86 A;  3CXP A;  4KLW A;  2QML A;  1S5K A;  1Q2C A;  2ZW5 A;  4XPD B;  2VI7 A;  3BJ8 A;  4R9M A;  4GS4 A;  5F49 A;  1XF8 A;  4C68 A;  3R9E A;  3R1K A;  1QSN A;  4U9Z A;  4YGO A;  2ZW7 A;  4KOS A;  2B5G B;  4II9 A;  1B6B A;  4R57 A;  3W6S A;  1XIX A;  1S60 A;  2RC4 A;  5C88 A;  4CGM A;  1M1D A;  1ZO0 A;  2J8R A;  1R57 A;  2Y0M A;  2CY2 A;  2YNC C;  2PDO A;  1IIC A;  2FSR A;  5F48 A;  4NCZ A;  4NF1 A;  2Q04 A;  2KCW A;  2YND A;  3RYO A;  4E0A A;  4B5O A;  2PR8 A;  2Q4Y A;  3VWE A;  1U6M A;  2WUU A;  3DR6 A;  4F0X A;  4ORF A;  1MJ9 A;  2AE6 A;  2A4N A;  1MK4 A;  1MJA A;  4AVA A;  2WSA A;  4KOW A;  1K4J A;  4R87 A;  5EBV A;  3S6K A;  4CGL A;  1BOB A;  5KTC A;  4HNX B;  3TOB A;  1QSR A;  1V0C A;  3G8W A;  1BO4 A;  2P0W A;  2REE A;  3KKW A;  1QSM A;  4QB9 A;  5G1Z A;  2R98 A;  4MY3 A;  4UFX A;  4A32 A;  5EC4 A;  4L8A A;  1GHE A;  1M4I A;  2BUE A;  2FE7 A;  4R3L A;  1P4N A;  2QEC A;  3FNC A;  1M4D A;  2CXA A;  2FXF A;  1IID A;  5AG6 A;  5GCN A;  1XE4 A;  1YK3 A;  2Z0Z A;  4E2A A;  2B3V A;  5E96 A;  4LUA A;  4MFQ A;  1YGH A;  2Z3L A;  4F0Y A;  3R95 A;  4B10 A;  1XEB A;  2VXK A;  4B12 A;  2IL4 A;  4FD5 A;  4YFJ A;  2BSW A;  4B5P A;  2G3A A;  3DSB A;  3D2M A;  2Z3P A;  4KS9 A;  1P0H A;  2CNS A;  4CYQ A;  4PSX A;  2GAN A;  4PV6 A;  2PR1 A;  2ZW4 A;  3S6G A;  4KOX A;  4MFZ A;  1PUA A;  1QSO A;  3F0A A;  3GY9 A;  3F5B A;  5DWN A;  4NSQ A;  4A33 A;  1Z9U A;  4KVM E;  4JJX A;  2G3T A;  2YNC A;  3TFY A;  3W91 A;  2VZZ A;  1M4G A;  1Q2D A;  3BJ7 A;  2WPX A;  4MFP A;  2DPT A;  1I12 A;  4KOU A;  4C7H A;  4F6A A;  3S6F A;  3TCV A;  4JXR A;  2OZU A;  2C27 A;  3ZJ0 A;  1Z4E A;  1I1D A;  2FT0 A;  3R96 A;  5J8C A;  1Y7R A;  4NEX A;  4CRZ B;  1Z4R A;  2R8V A;  2BL1 A;  3FBU A;  3R9F A;  4LX9 A;  2F5I A;  3IWG A;  4Y49 B;  2YNE A;  3OWC A;  2Q7B A;  2DXQ A;  2K5T A;  3QAH A;  1N71 A;  4X5K A;  5AG5 A;  3WR7 A;  3JVN A;  4JLY A;  4U5Y A;  4UWI A;  3T9Y A;  3I9S A;  4MFL A;  3T90 A;  4J3G A;  3TO7 A;  3I3G A;  4FD6 A;  5J8F A;  3TTH A;  2JEV A;  2I79 A;  4H89 A;  3EY5 A;  3H4Q A;  1WK4 A;  2Q0Y A;  3MGD A;  5IX3 A;  2BEI A;  4PK2 A;  4CGP A;  2ZPA A;  4R3K A;  3C26 A;  4JD6 A;  2NMT A;  2REF A;  1FY7 A;  1NE9 A;  1YLE A;  2PRB A;  4XNH C;  2Q44 A;  4XPK A;  2PQ8 A;  4H6U A;  1I21 A;  1YRE A;  4KOR A;  4ONU A;  3EXN A;  2WPW A;  4H6Z A;  4HNY B;  3P2F A;  2ARH A;  2VEZ A;  5F47 A;  1NMT A;  3LD2 A;  1M44 A;  3CXS A;  4YRH A;  4CYP A;  4FD4 A;  4XPD C;  4KOY A;  1OZP A;  1SQH A;  2HV2 A;  4A2Z A;  4C2Y A;  4CAE A;  5KTD A;  1IYK A;  2B3U A;  2PSW A;  4OAE A;  4CYO A;  5IV0 A;  2B4D A;  3IU2 A;  5JPH A;  1UFH A;  3NE7 A;  4ZBG A;  4A30 A;  4Y49 C;  2OZH A;  4M3S A;  3PGP A;  4MI4 A;  4UBR A;  3QB8 A;  2H5M A;  1B87 A;  3FB3 A;  1RXT A;  2OH1 A;  2Z10 A;  4OAD A;  2Z3N A;  4KOT A;  4CGN A;  4B5P B;  2JDD A;  4NXY A;  4BMH A;  1LRZ A;  4MHD A;  4FD7 A;  1KUX A;  2EVN A;  4QUS A;  4KVX A;  2P6G A;  3H5Z A;  5FVJ A;  2FL4 A;  2VQY A;  5IB0 A;  2B58 A;  3FXT A;  1MJB A;  4AVB A;  1WWZ A;  2X7B A;  2J8N A;  3FYN A;  5AG7 A;  4EVY A;  5C82 A;  2YGW A;  4KSA A;  4AB7 A;  4UCN A;  4HNW B;  4XPL A;  2OZG A;  2G0B A;  2PC1 A;  2OB0 A;  2JDC A;  3TOA A;  3SXN A;  3SXO A;  4KVO E;  4MFJ A;  1TIQ A;  3IWE A;  4UFW A;  5HH1 A;  4B14 A;  4KUA A;  1S7K A;  3B8G A;  2DPS A;  4Q38 A;  3DR8 A;  1L0C A;  4KSF A;  4QC6 A;  1VHS A;  2JLM A;  3IGR A;  1KUV A;  3TO9 A;  2CNT A;  5BWA B;  2O28 A;  5JQ4 A;  5KTA A;  4CAW A;  1IB1 E;  5CNP A;  3R9G A;  2ZXV A;  4ZGY B;  1YVK A;  3LOD A;  3CXQ A;  2FCK A;  4C2Z A;  1VKC A;  1S7F A;  4L89 A;  5ISV A;  1J4J A;  4KUB A;  4CAF A;  5I0C A;  4C7I A;  2Z11 A;  3GKR A;  4QVT A;  4OLL A;  2P6E A;  2J8M A;  4IUS A;  3PP9 A;  4CS0 B;  4RS2 A;  3N7Z A;  5A28 A;  2B5G A;  1CM0 A;  5G21 A;  3FRM A;  3FIX A;  5DWM A;  4CGO A;  1YX0 A;  5A27 A;  4MJ8 A;  3ZZI A;  4A31 A;  4QBJ A;  1S3Z A;  3F8K A;  2QIR A;  4M85 A;  4KLV A;  1ON0 A;  3VWD A;  1NSL A;  4B11 A;  2ATR A;  3JUW A;  1KUY A;  3A9L A;  3K9U A;  4MY0 A;  3G3S A;  4HKF A;  1QST A;  3TT2 A;  2R7H A;  2FIA A;  3UY5 A;  2I00 A;  4JXQ A;  4Q36 A;  2GIV A;  4CAV A;  4CRY B;  3P2H A;  2OU2 A;  2EUI A;  2B4D B;  3DDD A;  4MBU A;  2ZW6 A;  4U9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...