3W6YA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with tt2-2-199
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with TT2-2-199
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w6yA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w6yA01
1EPXA 4Y9AA 2FPVA 1VHNA 2ABBA 3CEPA 4RX0A 3DXIA 4YWIA 2X1SA 3THAA 1XCFA 3P8IA 3AO0A 1VYRA 4PH6A 3L21A 2DZWA 3W7MA 1YTKA 1M7OA 4L4MA 3ZFHA 1TPUA 2ZFAA 3G1AA 3PULA 1KTCA 3IVTA 2DU2A 4LWWA 4R33A 5CKSA 3W7OA 4PL1A 2A6NA 3RLVA 1JUBA 3PM6A 1LYXA 3KVJA 1FWSA 1DBTA 3PAJA 3VFLA 4FNTA 3KRUA 3Q58A 4UTLA 5F4SA 2CWNA 1KM4A 4WY0F 3PR2A 1QR7A 4U28A 5F2MA 3C52A 2TSYA 1LOQA 4H6KA 4IMDA 3W7IA 4EOUA 1LM1A 4FO4A 3HG4A 3QPZA 2KZHA 4X22A 2QUVA 4NQ1A 4NU7A 3BGJA 3DFOA 3I65A 1J5TA 3M16A 4QQ3A 1FCVA 4QAIA 2E6DA 3PB0A 1OF6A 4OQVA 1SZEA 4R34A 2A5HA 2JKPA 3GK0A 4G1KA 4OGZA 4Z08A 1ME8A 2YZRA 3WK3A 4Z1DA 1TO3A 3PUEA 4IOTA 5HJLA 1UBSA 3JRKA 1GVRA 2UV8G 3EX1A 1YTDA 2CLHA 2WNQA 1RV8A 2HS6A 3QZEA 4NJGA 4JGDA 4UMBA 5FF4A 3TJLA 2Y61A 2DZSA 4YL2A 1SW0A 4HPJA 3N9SA 2Y7FA 4XQ6A 3E12A 2RDTA 3F1QA 4JY8A 3G1FA 1M5WA 2ZRZA 2RHGA 4K37A 4LVFA 2OMAA 2C0AA 2CW6A 3QMSA 3TNOA 2OT1A 4FIQA 3DFSA 3LCLA 4JIQA 4NJKA 2RDUA 1GVSA 4QIUA 3QMRA 1K03A 1WV2A 2J9ZA 3LRMA 1TJPA 4YCPA 4AWUA 1VLIA 1BKSA 4GNJA 2QCDA 4X3ZA 4N4QA 4ZQRA 3LCWA 2XFWA 1OX6A 5E0KA 3W76A 2QCEA 1FDJA 3S1VA 5K4ZA 3ABOA 3UWVA 4GXMA 1K3UA 2ZZ2A 5G4WA 2ABAA 4I7WA 4JDYA 4ONVA 3G0UA 3N3MA 1H63A 4JTLA 4BF9A 1A5SA 4GJ1A 1X8FA 3FA5A 2OCZA 5EA9A 3W7KA 1VHCA 1N8FA 4H4IA 1T0OA 3RLUA 4O57A 4LUJA 1H62A 1N55A 3IIOA 3L9CA 1XFBA 3HGSA 1ICQA 4MFEA 2WPBA 4PFMA 5DN1A 3UWQA 4LV4A 1M6JA 1U5JA 2Z2UA 2NXGA 4LOCA 1SSGA 4FX8A 4BR1A 1F2JA 4XKYA 3B04A 1LDCA 3W70A 4FIRA 1W3IA 3CWOX 5F4WA 4JTEA 3TJXA 3NO5A 5CPOA 4UFKA 3C4UA 4O14A 4OBTA 3S9YA 1JQXA 3OHIA 5GVJA 3TV8A 5U4NA 1JCLA 4KFPA 4JR5A 2OJPA 1TTQA 3UNDA 4UTTA 2Y89A 3W88A 3TA6A 1HO1A 2QCNA 1NEYA 2VEPA 1MXSA 2R94A 4RXFA 4N4PA 2Y63A 4AAJA 1S5VA 2NV2A 1Y0EA 4LNYA 3FLUA 1Q45A 4JTSA 2ZTKA 3NZRA 2Q8ZA 4DELA 5LNRA 1W5PA 2G95A 1IGSA 2JKEA 3SW6A 1G69A 2ZZ6A 3M41A 3Q94A 3O6DA 4H3DA 3P60A 2NXIA 2A21A 1AW5A 2VFHA 5F2IA 1LRNA 1DQWA 3ABSA 2TRSA 4MY1A 5LNWA 3W7GA 1G4TA 2BXVA 4AVFA 2JGQA 4WQ6A 3HMJG 3MBDA 1OYCA 1OFAA 2Z1BA 2B7OA 1OK4A 4POCA 2DJLA 1NF7A 2YPIA 4XUGA 4CCEA 4DBDA 4GUIA 1Z42A 1VH7A 1SQ7A 3TU9A 1B4KA 2V5LA 4FF7A 3QW4B 1SO5A 3PC0A 5D32A 4MYXA 1OFEA 1FWWA 1QCWA 4NUWA 4TX9A 1YXYA 5HR6A 4YCOA 1G4EA 3BLIA 2WSRA 2B0MA 4O12A 4K6AA 3DZ1A 2A1YA 2EAWA 3NQ8A 4BFAA 5BOOA 2YXGA 4O16A 1O60A 1RQEA 3OVPA 3PBYA 1QOQA 5IBXC 1GVQA 1K8YA 1A5CA 3W2LA 1O5KA 3QQ1A 2NX1A 3W1NA 5C5YA 4K8HA 2Z6JA 4EF9A 4ADTA 5DBUA 3RMJA 1F5ZA 1EA0A 3P82A 4UNKA 3W6YA 4PL2A 4S1FA 2WV8A 3M44A 2CZ5A 5G1TA 3ZWTA 1DQXA 2GVLA 3YPIA 1GQNA 2C18A 2ISSA 1YDNA 1K8ZA 4FNQA 5CZ0A 1YDOA 3IIVA 3R89A 3CEUA 5C6MA 3E96A 1KFBA 5BW6A 3PSVA 5BNKA 3DFNA 4X9SA 2E09A 1S5WA 3NL3A 2DJXA 5CSSA 5AYZA 2RFGA 2CZDA 3DU0A 2WNZA 5D38A 5AC6A 3S1WA 2W6RA 1FY6A 1P4CA 2A85A 1FUYA 3S5OA 4W9TA 5LNSA 2A4AA 1DV7A 1ME9A 2PRMA 3TDFA 4D2JA 1PCKA 1DKWA 1ML1A 3TSMA 3GYEA 4Z1BA 3C56A 3DHDA 4RJEA 1QO5A 4AHPA 1LBMA 4CQ9A 3A22A 3DFQA 3A9IA 4JXCA 1UB3A 3TSDA 3I68A 5I3KA 1RVGA 1H7XA 3B06A 1X6UA 3PG9A 1I45A 1B9BA 3O16A 4IUOA 5DY3A 3P62A 4O53A 3W23A 3NAVA 4QNWA 3QM3A 4DO4A 3SECA 3SI9A 1IXNA 3PVFA 4HKPA 1L9WA 2ZZ3A 4Z1CA 3LX9A 4NJIA 4A2SA 3MBFA 3NQ2A 3NM1A 2C16A 1KFEA 2QAPA 3EX2A 3BG9A 1KM3A 2HMCA 3NL6A 2FPTA 2C13A 5DCDA 4BK9A 3DI1A 4JTIA 3LXCA 3KVKA 2QCLA 5E93A 1RR2A 5CGQA 4JICA 4HN4A 3N2MA 2ZBTA 4RZ5A 2W79A 1GEQA 5T26A 3O6CA 3M7WA 5CPLA 5FF3A 3EX3A 1VZWA 4JTFA 3BW2A 1KFLA 3LTSA 3W1TA 5BMWA 3R5EA 1NFBA 1AL8A 3VNDA 5U7SA 1OFQA 1QDSA 4IMCA 4WY0B 3HPZA 1EIXA 4LS1A 2QKFA 3WJZA 2CFFA 3LXBA 3PBUA 2BX7A 2G97A 4UTMA 3CPRA 1JRCA 3W9ZA 2XN0A 3VKJA 3CQ0A 4HHPA 3SGZA 2Y7GA 1WDWA 1H5YA 1Q6QA 1YADA 4FHAA 3QMTA 1O5XA 3KRSA 3EEGA 4ZQOA 2F84A 5FF2A 4BI5A 3BVJA 1FCUA 5LNVA 1PS9A 4N6FA 4WJEA 4TMBA 3DGRA 4O54A 1EP3A 1H7NA 3CLMA 1ZNNA 3W83A 4DF0A 1LTDA 3KRZA 1Q6OA 2DZVA 1SUXA 2ALDA 3MMTA 1KV8A 3NPVA 1TPDA 1TRIA 4NNBA 1ALDA 3HGOA 3GAYA 3NQVA 1YYAA 5K9DA 3QJAA 1QNVA 1LOSA 3NQCA 2A6LA 3GDLA 2ZA1A 2G5WA 4O50A 3NQFA 3W7CA 1TPC1 1YLVA 1V7YA 1GTHA 3B0VC 1JCJA 2DORA 1H51A 1GYLA 4N9DA 3P84A 1PVNA 3LOTA 1UJPA 4DPQA 3NQEA 1HTIA 1H7PA 4JYDA 4DPPA 1F05A 5D03A 3P80A 3P8JA 4UNLA 3ABQA 2EPHA 4AF0B 4HPXA 3C2RA 4JEQA 4HNTA 2ZRXA 4N6EA 3W1QA 3EWWA 4JS3A 4R7JA 4UFHA 5F2GA 3S8HA 1JVNA 3G22A 1TIMA 3LHTA 2X2GA 3M43A 4AB4A 1P0NA 5K7JA 5LNUA 4JTUA 3PG8A 5H2ZA 2TYSA 2X16A 2GJLA 3P67A 4MY8A 1WX0A 3NPXA 5TBOA 1WOBA 3A23A 4MZYA 5K3VA 3FIGA 4OV9A 3SJ3A 4AH7A 1LRTA 4QNEA 3ZWSA 4GBUA 1OJXA 5EPDA 3TR2A 4A2RA 1AG1O 4KWVA 1PE1A 3FJLA 4IWWA 2J6XA 1JULA 2I1OA 3MP4A 3W85A 3WJXA 1TCDA 1EWEA 5AB3A 3TH6A 1TPWA 4ZL1A 1O4UA 4NZFA 2A7PA 1QFEA 4AMAA 2VKZG 1KM5A 3STEA 1IF2A 4O13A 2RDWA 4O4VA 1DHPA 1VLWA 5DCEA 4MKNA 5I3JA 3W22A 3O1NA 4LY8A 1GOXA 3MHGA 2QF7A 5KINA 4O52A 3I7QA 4E38A 4KFOA 3VE7A 3W2UA 3W7QA 2YSWA 5E1QA 4IPIA 3LCGA 1I4NA 3TC6A 1SSDA 3CTLA 4CNNA 3G24A 1GTEA 3STFA 4AWTA 1W0MA 1KLYA 2H3BA 4Q32A 4ADSA 6TIMA 5D2WA 2JK2A 1M7PA 1P5BA 4OWGA 3UY7A 1IIHA 3NXFA 1TRDA 4EF8A 4BWLA 3P74A 2QJHA 2V2CA 1TPB1 3SR7A 2NZLA 1ME7A 5FI8A 3S6DA 2YW4A 8TIMA 5HUPA 4RK8A 2O7SA 2F7FA 3QC3A 5AFDA 3DFTA 3IIPA 4P2VA 1FDZA 1R30A 3TAOA 3W84A 3TKFA 4FB7A 3W1AA 1OVDA 4IMFA 4RZ4A 1QWGA 1G7UA 1V5XA 1OG0A 3A24A 3BPWA 4LVGA 4M5PA 3KAOA 3T7VA 4Z1AA 4UUIA 3NDOA 3TROA 3MO7A 1Z44A 2YW3A 1WBHA 1SZNA 3DKJA 3N34A 3HG5A 2A7NA 2DZXA 3UYCA 1H7WA 2VC6A 1W54A 1SZGA 2NUXA 4UTHA 2Y7DA 2J24A 3EWUA 4NJHA 2X1RA 5J5RA 1OFPA 3W7EA 3L5AA 1UCWA 3HG3A 1SW7A 2WNNA 3F4NA 5LKYA 4IPJA 3EKLA 4HNVA 3CB8A 2JBMA 1G6CA 1YTEA 5MHBA 5AOUA 4EIVA 1OX4B 4EVZA 2WSYA 2ATMA 1FDYA 4M7SA 2E5DA 2V9DA 3S0CA 2A2IA 5KZMA 3VI2A 4AXKA 1WA3A 4WOZA 2EKCA 4WOQA 3PBVA 4JTHA 1H7OA 2E1DA 3C0JA 3CIWA 1ZAHA 5CZJA 3QF0A 1G4SA 1YPIA 3P7YA 4TU1A 1GT8A 2QDHA 4UC5A 4AEOA 5D37A 4IQLA 3UWYA 3BO9A 4OV4A 1LP6A 4LU0A 1KM1A 1TTIA 2TPSA 4WZHA 1DORA 1YDVA 5EBUA 3LCFA 4GC4A 3LHVA 4ZQPA 4QJ1A 3T4CA 1TV8A 5DLCA 1ADOA 5AHMA 4TMCA 2VFIA 1YXDA 3BK0A 1KV5A 5G4EA 3B03A 3H53A 1XBXA 3G8RA 3WJYA 4NNCA 4K7VA 3RU6A 3BLFA 3B0PA 1JJKA 2GJNA 2VFGA 1GVOA 5HWNA 2CLFA 3LERA 2QCHA 1IIGA 1CW2A 3LBMA 2R8WA 2VEKA 4CQ8A 1T8XA 2FIQA 3NQ6A 5FEXA 4HSNA 3W73A 3LHUA 1W3NA 3FKRA 1EUNA 3W74A 3CT7A 1GG1A 2YFNA 2ISVA 5AYXA 3L65A 5DBTA 4ZQCA 2VEIA 4O4WA 1QO2A 4IX2A 4O1AA 4FNRA 3JR2A 3MW7A 4O8RA 4FNSA 1SFLA 1ZHAA 5DELA 2Q3OA 1XUZA 5A5WA 3V1PA 3SGUA 3GKAA 2GQ9A 1OFRA 1MSSA 4JTGA 4MUZA 2GPTA 3CHVA 2QJIA 1TPEA 2OT0A 2C19A 3FS2A 3W72A 2OZ0A 5C54A 1I2QA 1FXQA 1LORA 1LOLA 3VE9A 4E2BA 3W7JA 1TV5A 5KZDA 2OX1A 4GWEA 4UTWA 3AJXA 2NWRA 2FJKA 4N9EA 1P0KA 2W0UA 4O1BA 1IXQA 4IXXA 4YLWA 4XBKA 4NXKA 1CI1A 4OE7A 3BARA 3BG3A 3HO8A 4IJBA 2E6AA 3EXRA 3QH2A 3SZ8A 4JD4A 1E51A 3LTYA 4JX6A 1JCXA 4K39A 4DEFA 1RPXA 4NNAA 2JGYA 3MP3A 4ADUA 2TMDA 4UFIA 4L4LA 3G3MA 3NPWA 2H8XA 3W75A 3IGSA 1CX9A 3LM7A 4B5NA 3S5ZA 1FWNA 2ZCGA 1FWRA 4RLIA 5LGZA 3HF3A 2P10A 3NM3A 3R12A 3TE9A 3KHJA 1JQVA 3MI6A 1K7XA 3PSWA 2CZEA 3W1UA 4XZ9A 3PF3A 5I3HA 3CM4A 3E49A 4UR7A 3G1DA 1DVJA 3LI0A 3FOKA 1WOAA 1NVMA 5G2WA 3I7SA 3FKKA 1DJQA 5HQEA 2NWSA 2FDSA 4NJJA 2E68A 1LLZA 1VGAA 3W07A 3QEZA 3DAQA 5AC8A 3BG5A 1VYSX 1F7BA 4MLRA 2Z0IA 4MVAA 3L66A 1R46A 4Q4KA 1C9DA 5HWMA 2DZTA 1HFBA 5IM51 2NV1A 1R2SA 3R8RA 5HNRA 2BWGA 3C2EA 3UZJA 2J88A 3IVSA 1F74A 3MHUA 3GXTA 1EP1A 3O63A 1TREA 3QSRA 2DZPA 5ABTA 1XDLA 4E0CA 5F1VA 1XI3A 3H54A 3SFKA 3O06A 1W5QA 3UWZA 5KSWA 1X7FA 2NUWA 5AHEA 4UTIA 4I9AA 3B0UX 1PL9A 5AC7A 4GFSA 1I2PA 3O07A 5HULA 3KX6A 1UUMA 2Y7EA 2ZRYA 4OU1A 1S5TA 5D02A 4UXDA 1SR9A 1R2TA 4KWWA 3HOJA 3B8DA 4ICNA 3INPA 4MJZA 1SO3A 4X2RA 2WKJA 3HIJA 1AW1A 1YPFA 3NGJA 3C61A 1EEPA 2CLMA 2WSQA 4NX5A 2R91A 1XKYA 1H1YA 1ICPA 1O95A 4K7YA 4ZZ9A 4ZQMA 5BMXA 3GR7A 5CG7A 2C3ZA 2B7PA 4A3UA 3RNDA 3T44A 4O0KA 2P0OA 1D3GA 1JUKA 2VFDA 3NR0A 2X30A 2WO5A 3L2IA 3TW6A 3O15A 1K7FA 1J2WA 3WK0A 4ZMGA 1GPWA 1P1XA 1A53A 4LVAA 2O7QA 3A21A 4C1KA 4BWLC 2QCDB 1PIIA 3L0NA 1OFBA 3C3NA 1G4PA 1XXXA 4ORIA 1L6SA 4U4MA 2R14A 1VYPX 1XBZA 2E6FA 3W2KA 3B4UA 3TK7A 3A5VA 1LCOA 4S2BA 2GQ8A 3TFCA 2VFFA 4HSOA 5FF7A 4A21A 3DENA 1HL2A 3DI0A 3L67A 3RFAA 3PS7A 2AAMA 2YFOA 2ZA3A 4NX0A 5L6UA 3FYPA 3N19B 5D09A 3N73A 3LHZA 3M1ZA 3KFTA 3IV3A 4UMCA 1ZALA 1W37A 1FWTA 1H50A 1NSJA 2HSAA 7TIMA 3M9YA 3W2NA 3BW3A 2BTMA 1AMKA 1J4EA 3W1XA 3K30A 3S5NA 2YDAA 3TQKA 3W86A 5IBXA 4GUHA 1DJNA 4RR4A 1R2RA 4TR9A 4XWUA 2ATSA 1XBVA 4LS2A 3GNNA 3MP5A 4XKYB 4A22A 5H91A 4JY9A 1TPH1 3NG3A 4AWSA 1VS1A 3N9RA 3E9AA 4FXRA 2FFCA 3G1SA 4N9BA 3TW7A 4HT3A 3BLEA 2Q3RA 1BWKA 1T99A 4JTKA 5CZTA 3G8EA 3TAKA 3TQ0A 4UFMA 3W7LA 1B57A 4DO5A 2VELA 5K9XA 3TSBA 2X1UA 2V5BA 3TQVA 4I7VA 1EWDA 5AHNA 3C2FA 4GUGA 4WD0A 3UXDA 5D2YA 3CWNA 5LHFA 1XBYA 5CZSA 1A5AA 2E6YA 4K38A 1KFKA 3M5YA 2VOMA 1KA9F 3G0XA 3LCIA 3DBPA 5FEZA 3T55A 4ALDA 3EXTA 1HO4A 4JTTA 4P61A 3EWZA 1GWJA 3T78A 3IGXA 1TTJA 2C15A 3NQAA 4JNMA 4UTTC 3IVUA 3G0SA 3W1LA 3GAKA 5BRBA 4Y8FA 1JUEA 1VC4A 1C8VA 4O11A 3V75A 1HG3A 5DY2A 4Q33A 4O0ZA 4QITA 3IEBA 4RCXA 3IIXA 2FB2A 2ZZ4A 2H6RA 3MUXA 3ELFA 1QPOA 1JCNA 3R2GA 4Y6GA 4GUJA 3TC7A 3JS3A 2JKAA 3HGRA 4JYEA 3CIXA 2QAFA 2Y62A 3E0IA 2V8ZA 5EKYA 4LVBA 4N2YA 4UTJA 2BSLA 5AN7A 3T40A 3M5ZA 1W3TA 3G1YA 4KKXA 1L6YA 1O94A 4QISA 5CPMA 1IXOA 3MYPA 4CNOA 1KFJA 4FNUA 2QDGA 3R13A 3ATZA 3MJYA 2YYUA 3MYOA 2X1TA 3HBLA 5D2VA 1G67A 1T96A 5KITA 3P5YA 1KTBA 2FB3A 3NZ1A 3KOFA 1YXCA 3KXQA 3GDMA 1B4EA 4DF2A 3G18A 1MEWA 3S5YA 1AL7A 1TQXA 3RK8A 1TJRA 1DOSA 2CLOA 4HNNA 3W7HA 3NQGA 4UTWC 4TIMA 3PUOA 4PEKA 5G2HA 2XN2A 2BLEA 3L68A 1W56A 4RKAA 2EHHA 3HQ1A 3GZ3A 2WQPA 2IQTA 3FYOA 4IX0A 4NXSA 4XBSA 3G1VA 2QCCA 2YX0A 3I7RA 2NXHA 3EWXA 2BZNA 1PHQA 3WK1A 1VCGA 4LUIA 5D04C 4IMGA 4UR8A 2ZZ1A 3NNTA 3IGUA 3KVLA 4UTUA 2YCEA 3I6RA 3M0ZA 3NQMA 5G5IA 3L5LA 2QEZA 4A29A 2V2DA 4DBEA 1TV7A 4QM1A 4OT7A 2FLIA 1UASA 3LTPA 2ZA2A 2QCMA 3W7RA 3ANYA 4QSHA 3P61A 1S3HA 3LI1A 1I2OA 2E5CA 3EWBX 3M47A 4NZJA 1NAL1 1SFJA 4Z0JA 4LVDA 4PC8A 3QQ0A 2NX9A 1XDMA 2GOUA 3WK2A 1KBJA 4K36A 4WY0A 2HS8A 2H3DA 4NT0A 3UWWA 1QPQA 3O6YX 4HIBA 1TQJA 4O19A 3GXNA 1G7VA 2VENA 2ZRUA 3STGA 4CQAA 3QPYA 3D0CA 1F6PA 2NX3A 5LSMA 2H90A 5FEWA 4UMAA 4MIMA 2ZDRA 1KTNA 4UTKA 3NL5A 1QPNA 1KFCA 3GDKA 3NVTA 1W8SA 1WBJA 3GKFA 3PWAA 5F1UA 4PODA 2ZRWA 4GRSA 3F03K 1FCBA 4CLMA 5LGXA 1XM3A 3DHFA 1PHWA 2B7NA 2PE4A 3EXSA 1I2RA 1MZHA 4XTDA 4MY9A 3W1MA 2ZZ7A 4BI7A 3WFAA 4EWND 1EP2A 3CU2A 1X1ZA 1X1OA 3W1RA 1MEHA 1ZCOA 5SWUA 2VEMA 2V81A 2D73A 5HWJA 4MFDA 2V30A 1D3HA 1K8XA 1IXPA 4R53A 1KW1A 3EWYA 2ISWA 3LBCA 1OFDA 1W5MA 5KMYA 3LLFA 3IIZA 3KVMA 2FQIA 4ZVJA 1L6WA 1GG0A 1RQHA 5AYYA 3TFXA 1RD5A 4WUIA 5D30A 1TPFA 1PV8A 4GE8A 4MZ8A 4RXGA 5LHEA 3NQ7A 3IRDA 4GUFA 5TQLA 4JIPA 2FPYA 4LRTA 4CCCA 2WJZA 3G3DA 1EX5A 1TB3A 3QFEA 4MOZA 5L9FA 1FCQA 4TO8A 2P1FA 1VCVA 4AF0A 4FXSA 1NF0A 2H8ZA 1QOPA 2I14A 5HINA 5D33A 5K2ZA 4Z0SA 1ZFJA 3MHFA 4UFJA 3M5VA 1Q6RA 2ZYFA 3HPSA 2G96A 4IGHA 2VFEA 4OHQA 4PCFA 2CLIA 2E5BA 3C6CA 3FJ6A 2YYTA 2Y85A 2GVJA 3THQA 2V0TA 4M7TA 4JYFA 3S1XA 5I3GA 1KM6A 1TSIA 3LV5A 3DKLA 5HMSA 3E02A 3TCEA 1VR6A 2V2HA 1EB3A 4DF1A 3U8GA 3UQNA 3NOEA 5DXXA 1Z41A 1K02A 3Q37A 5F4XA 3GDTA 1JR1A 1ZAIA 4O1CA 3GLCA 1N7KA 5HUOA 2EF9A 3WJSA 1ZJIA 3ZS4A 1DL3A 1OX5A 3F4WA 2AGKA 2QCGA 5D2TA 4LW7A 4FNPA 3NL2A 1W1ZA 1TYGA 4JX4A 1XUUA 1LROA 1OYAA 2AQWA 4IMEA 3QYQA 3PB2A 3LGEA 3NQDA 2RH9A 5I3IA 2CLKA 4YMZA 4NVTA 1BTMA 2ZZ5A 4FX7A 4LC6A 5I3FA 1AW2A 4PTNA 5AHLA 4O10A 2A0NA 2C1HA 3FEMA 4MLJA 5F2LA 2B4GA 1L2UA 1W5NA 5DXYA 3ABRA 2CLEA 3MWAA 3C8FA 4WXZA 3M5XA 4YXGA 4O1DA 3GR8A 3EX6A 4N02A 3TUUA 6ALDA 4O28A 1OF8A 4BI6A 1F76A 2ZQ0A 2Z6IA 1FQ0A 4Y90A 1OYBA 3G1XA 1A5BA 1KLZA 5DCBA 2E77A 1Z48A 3LB0A 4K8EA 4MZ1A 3GVGA 1I2NA 4AHQA 1H61A 5A8GA 5CSRA 3BW4A 3P81A 3USBA 3CC1A 1SO4A 1WQ5A 3TMLA 5J5DA 3W7DA 3S1UA 2B7QA 1H7RA 3HJZA 1OHLA 1HUVA 3EB2A 4Y96A 4UIOA 1FX6A 3HG2A 3LCXA 1Q6LA 3ATYA 3W3OA 2PCQA 3EX4A 1JRBA 3HPXA 3LV6A 4IXHA 5EL1A 1GZGA 4C1LA 1OFOA 1U83A 3GXPA 3OA3A 3OBKA 4CCDA 1R47A 3BGGA 3L5MA 3QRHA 2CZFA 1QMLA 2YGYA 5K9CA 4RV8A 1Q3NA 4LC8A 2PURA 2QJGA 1VCFA 4LTSA 1LRQA 4DO6A 4N9CA 1GJPA 4I7UA 1W31A 2YR1A 4JN6A 5D05A 4ML9A 1SU5A 3TMQA 3C2OA 3UWUA 2GQAA 1THFD 3MI3A 4O17A 1OABA 3TX9A 3WJWA 2GUUA 3W1PA 5K4XA 3W87A 2DZUA 1OX4A 3PY2A 3G1HA 5FESA 3UPWA 1XL9A 1UUOA 3L0GA 3LXAA 3W7NA 2QR6A 2CU0A 2RKXA 2GVGA 2QCFA 4FX6M 1F73A 3SY5A 4WXYA 2ZRVA 1LLWA 3L0KA 2Y70A 3HGJA 3MI2A 4KFNA 2LLEA 5TIMA 1D9EA 1ONRA 1BWLA 5G1YA 2ZTJA 2J27A 3U2OA 1XC4A 4LV9A 5C2XA 2VXNA 1GYNA 1H60A 2A7RA 1OK6A 3LCHA 1VJIA 3OG3A 3C2VA 1JCMP 1QPRA 2J9YA 2QUTA 2Y6ZA 3LHYA 3EKZA 1FBAA 3W2MA 5EY5A 4FEZA 2J9XA 3B05A 4JTJA 5D2XA 5HR7A 2Q8LA 2I9EA 3TIMA 2Y88A 4LRSA 4JX5A 3UXAA 4ORMA 5LZLA 4O18A 1MEIA 4E2DA 1TTPA 1PCWA 1LBLA 1LBFA 3W7PA 3QSTA 4HNUA 3TXZA 3W2JA 2DP3A 3OIXA 4MJMA 2EGZA 3GX9A 3LRLA 1VRDA 5C55A 1ZY9A 4JDBA 2CLLA 1RZMA 2NLIA 3VCRA 3NYZA 4MPQA 1SPQA 2FTPA 5CPNA 3U6WA 3S42A 3SSJA 1TMHA 1WXJA 1RQBA 3LHWA 5AHFA 3TXVA 1SZFA 4RZ6A 4O15A 3UY8A 2PRHA 3O8AA 2C6QA 1SO6A 1AK5A 3UD6A 4UCGA 4UFLA 4M6QA 1SW3A 4XTIA 3PBWA 2WOQA 3OVRA 3FFSA 3GDRA 4J9JA 3W71A 4AHOA 1QAPA 3NEVA 1H1ZA 4LS0A 1I8JA 3GNDA 3UZ5A 1TPVA 5FEPA 3N2XA 2NUYA 3N14A 2XN1A 1ICSA 1K7EA 4DXVA 5EMUA 3ZR4A 4PA8A 1ZAJA 2C14A 3OEXA 3GIYA 1VPXA 3LLDA 4S2CA 5EYWA 1ZENA 5KZEA 4LT9A 3SIZA 1EUAA 4DQWA 2V82A 3OVQA 1BEUA 3PUDA 5G2IA 4M6VA 4M6PA 2PRLA 1FXPA 3Q2DA 1MO0A 3GB6A 3DH7A 1WYIA 1KM2A 5KTLA 3LDVA 1B3OA 4MYAA 4WX2A 3RF9A 4CNPA 1GVFA 3NPUA 5AHIA 1F6KA 1C29A 2HTMA 3DFPA 5FF0A 3UPBA 3P5ZA 1LZOA 1A50A 1JCYA 3BV4A 3O05A 1W5OA 3STCA 1KBIA 3HB9A 3LRKA 2PC4A 1WAUA 1VQTA 3QW3A 1KM0A 4ZQNA 2QUUA 3H55A 4M19A 3M6YA 3NA8A 3A5FA
chains in the Genus database with same CATH superfamily
4Y9AA 1VHNA 4X0NA 3OJGA 1JD9A 3H8AA 5HJXA 4RX0A 3DXIA 3LPOA 2XU2A 1XLIA 5ECUA 1VYRA 4PH6A 3L21A 3W7MA 3RMEA 3S1GA 4JHZA 3ZFHA 2ZFAA 3QZAA 3WF4A 3ZT7A 3W7OA 3PM6A 4FR6A 3WMLA 3VFLA 5HANA 2PCEA 3E0FA 1KM4A 3A47A 4B5SA 4WY0F 1RJPA 1TR1A 3NCOA 5T8GA 1QR7A 1KGWA 2A3LA 1LOQA 4Q8UA 2XSBA 3WQEA 3U4FA 2PGEA 1OZMA 3GY1A 1J5TA 1PO9A 5FA5A 1R3SA 1E1CB 4QQ3A 3PB0A 1VBJA 2ASHA 4PRRA 5I03A 4Z08A 3S9ZA 4MAZA 2YZRA 1GVRA 3BOXA 1HJVA 2E8YA 2WNQA 3VDBA 1FP8A 3DIPA 2HS6A 4H6RA 5BU6A 6REQB 3TJLA 2W67A 2Y61A 2D0HA 4HPJA 5C9RA 5GJPA 2W91A 3E12A 2RDTA 1KCLA 2H9AB 3PFMA 2FZNA 3KS5A 5DMYA 1M5WA 2ZRZA 4LVFA 2AOSA 1PDYA 2CW6A 2IKIA 3KHDA 4JIQA 4QIUA 1SGJA 2J9ZA 3LRMA 1GQIA 2D2HA 3I3BA 4B9YA 1JNDA 2GQ3A 4N4QA 3LCWA 1OX6A 2AKZA 1V6TA 4RPQA 5E0KA 1K9EA 4IP5A 3RX2A 1W3HA 4I7WA 1UZ1A 3KOWA 4OOUA 2NQ9A 4PCSA 1A5SA 4GJ1A 4XUYA 2OCZA 3W7KA 3IJIA 3RLUA 3S5SA 2O0TA 1KCKA 1XFBA 5DN1A 4Z2HA 4LUTA 4LV4A 4ZE5A 1U5JA 4BJHA 4EACA 2C71A 1SSGA 4EXQA 3H70A 1LDCA 3CWOX 2XWEA 3LQGA 3A3HA 3TJXA 4XZHA 3VM7A 1W1VA 1XSIA 3EA2A 3C4UA 5REQB 3CHFA 1O6IA 4O14A 3SRKA 3WYZA 2VQTA 3SBFA 4EK7A 2OJPA 4NRRA 1UA7A 1DEDA 3CV2A 1TTQA 4WKHA 3UNDA 3TONA 3KL3A 4I8YA 2QCNA 2VEPA 1P6WA 4MJ4A 2R94A 4N4PA 4B16A 4IQEA 2NV2A 5IOBA 1PX4A 1Y0EA 4JPGA 4LNYA 1UIOA 3SQMA 4QLKA 1W5PA 4IIHA 3Q94A 5C9WA 4GC3A 2E67A 3WD3A 3WLMA 3QV7A 2TRSA 1V6VA 2D1ZA 1O5RA 3HMJG 1OFAA 2NSOA 2DJLA 1V0MA 4U3CA 4D1IA 3PP7A 4DJED 1VH7A 4DWSA 3QW4B 4H2HA 4B9ZA 5D32A 3BAWA 1BSIA 3T4WA 4WCJA 3BV7A 3LM3A 1CWYA 3WF2A 1UKPA 4OBRA 2F8QA 3NQ8A 1ZBWA 1EC8A 4O16A 4P7RA 3SRDA 3OVPA 1QOQA 4RNJA 5KZ6A 1O5KA 3GIPA 2YCLA 3CJPA 1TVNA 4B3KA 4K8HA 3FYYA 1Z69A 2VC7A 2Z6JA 4EF9A 1ZJHA 4PCNA 3PHAA 1EA0A 1AJZA 2PWFA 1JL8A 3VKDA 2WV8A 3M44A 1N2VA 4PBFA 2ISSA 1MXGA 4FNQA 3VILA 1EHAA 1YDOA 5FJJA 1ODUA 3CUZA 1CB2A 4NRSA 5BW6A 4A8IA 4BY3A 2FFIA 3IUHA 3O9NA 4XZMX 1JPMA 3ITVA 1HT6A 5AYZA 2X40A 2E9BA 1E6PA 3MZ2A 3ICJA 2CZDA 1BSLA 1FKXA 1R7OA 2P53A 3ALGA 1V3IA 4XD3A 3EA3A 4R7WA 3AMCA 1HP4A 1DV7A 1ME9A 1S2CA 3TNBA 3VNIA 1EKOA 2BBFA 1V02E 1QO5A 1BKHA 1RHCA 4AHPA 1K1DA 4RV3A 4R9OA 7A3HA 3VDAA 2OLSA 5DRIA 1RP8A 4Z2IA 1OB0A 1U22A 5I3KA 3MCNA 3KEHA 4IIBA 3VCCA 4UOQA 5GNZA 3QV8A 4QSFA 4GO8A 1X6UA 3EWDA 1KKOA 5LIXX 3OLGA 1I45A 3O16A 5DY3A 1SJAA 1CGXA 5A6TC 2ZE3A 2IKHA 4MADA 4MJ2A 1RCQA 3F4VA 3PVFA 2ZZ3A 4Z1CA 1UG6A 4XAFA 4F48A 2QAPA 1KM3A 4D71A 2W92A 2C13A 2HXUA 4JTIA 4KRTA 2DW7A 3C0QA 3PANA 1ZB5A 1W9DM 4LBSA 4H41A 1GOIA 4OFCA 4URIA 5CGQA 4G6CA 2EBNA 1EJRC 2ZBTA 2X41A 4C6PA 1EXBA 5CPLA 4MMWA 2UY5A 5IRPA 3LTSA 1VFUA 1AL8A 3L4TA 1ZBKA 4WY0B 5KEZA 1EIXA 4LS1A 3ABXA 1XH1A 5FJRA 1NARA 3LXBA 3K1GA 3NSNA 1JRCA 3GU2A 3GH5A 4HN8A 4JTCA 1HL8A 3CQ0A 3ARVA 4E4PA 2DQXA 3CL8A 4C5YA 2ZUSA 4DYEA 1O5XA 4X0VA 4ZQOA 2F84A 3WQ6A 1XYMA 5HPCA 3GH7A 4N6FA 4QJ5B 4ZEPA 1NWRA 2PDUA 1H7NA 3EDEA 4MUPA 1LTDA 1O12A 1EFZA 1Z3NA 1A5NC 2BG5A 1UWUA 1E3XA 5DFAA 2IUZA 2GOKA 2R1KA 3GAYA 3NQVA 1A0CA 2ZX6A 3QJAA 1B9ZA 1LOSA 1J0HA 2BXYA 3PBMA 3NQFA 4HP5A 4AX7A 1YX1A 3CZEA 1G1YA 4GISA 3KP0A 3P14A 1H51A 1YNQA 2WW5A 4N9DA 3MQTA 2Y1HA 2VD9A 3NQEA 4NZ4A 2ZXBA 2PLMA 3AWNA 4PGLA 2XPKA 2QMJA 1E73M 3P80A 5PTDA 1UMYA 3R6IA 4NZ3A 3C2RA 4JEQA 4OBSA 4HNTA 3PJWA 2ZRXA 1NIUA 3S8HA 3GW0A 3G22A 4ATDA 1XLMA 4NAEB 3IJDA 5K7JA 3T08A 4MY8A 2GJLA 3P67A 4HBKA 1ISXA 1HJXA 3NPXA 4YS1A 5TBOA 2P76A 3A23A 1UR4A 4B4FA 3UYIA 3SJ3A 5C9XA 1V3KA 4NHVA 1LRTA 4QNEA 1KXTA 4Y2WA 3ZWSA 3M0HA 2WMHA 1AG1O 4KWVA 3FJLA 4IWWA 2J6XA 5AYBA 2YIHA 3APGA 1NTHA 4Q7IA 2I1OA 2YKKA 3MP4A 4HU4A 3DX5A 1TCDA 3BAIA 3AROA 4BEUA 4JBRA 4KCTA 2VYOA 4AMAA 3VGDA 3ONBA 4KCUA 3ZVHA 1ZJBA 3VD3A 2VP8A 4O4VA 3RILA 3DGBA 1VLWA 3LGGA 1TFVA 5DCEA 4MKNA 3O1NA 4F79A 5BRPA 3MHGA 1NELA 3J7HA 3HPFA 3OGVA 1XLLA 1B1YA 1R3TA 2DUAA 2YSWA 4IPIA 1SSDA 4CNNA 3G24A 2PZNA 3Q67A 1W9VA 1SZRA 1KRBC 3AU2A 5BYWA 6TIMA 1E0UA 2DGAA 1M7PA 2OSXA 4OWGA 3E0LA 1TRDA 4BWLA 2QJHA 2V2CA 3TOPA 1TPB1 2GUBA 5GJNA 4AY7A 2NZLA 5E0CA 4DUVA 3JW7A 2VDIA 1TJ1A 2J7GA 4XD6A 4EANA 3HJEA 5HUPA 5BCAA 2EPLX 2O7SA 4PMZA 3GHUA 1QU4A 1QHPA 1XYCA 1V5XA 1OG0A 3ALFA 3ITYA 1VFMA 4UUIA 2OG9A 4Q4QA 1W9XA 1NFPA 1WBHA 1K9DA 1R85A 2Y0FA 4I6VA 4LX4A 3N34A 1FWCC 3BTNA 3HG5A 4HPHA 3UYCA 5CZKA 4WGXA 2VC6A 4IFOA 1W54A 1XC6A 1Z6KA 2W5FA 4WDXA 4KEVA 1WXZA 2X1RA 4XAZA 3DYPA 4YNGA 4HZ8A 4KF1A 3HG3A 2WHLA 4LUSB 2JBMA 2WPGA 3RJXA 3MKVA 3DECA 4EVZA 2WSYA 4M7SA 2XGZA 4ERAA 3VI2A 4AXKA 4L1WA 3E1F1 1F3WA 1RP9A 4IPLA 1XRFA 2E1DA 3A3WA 4PB5A 1YBQB 3ARZA 5A6BD 2X42A 4PUNA 5D37A 1O66A 3RRXA 2ZX5A 4OV4A 1LP6A 4LU0A 1KM1A 1DORA 2X2YA 4GCAA 3LCFA 1QNSA 2DT1A 2O9PA 4QLJA 5DLCA 3CV7A 4FLSA 3ARPA 3B03A 4U31A 2YLLA 4MB4A 1O5QA 3S2CA 2BMBA 2FGBA 4CVWA 3B0PA 2VFGA 1GVOA 4MGGA 4ZGYA 5HWNA 1S1RA 3VDGA 1QI5A 1V77A 1IIGA 2ZWZA 3LBMA 1G94A 3AWOA 4CQ8A 1T8XA 3VD4A 1A3HA 1FKWA 1IT8A 3W73A 3FKRA 3W74A 2FDMA 4KEMA 2VEIA 1V0LA 1TV2A 2GGIA 4XO6A 2WLYA 4DLFA 4FNSA 5DELA 5A5WA 3SGUA 1MSSA 1K6AA 4JTGA 2GPTA 4GA8A 4FLQA 2QYGA 2OZ0A 1MQQA 5HAOA 1WZKA 1LOLA 1E6NA 4JTRA 3W7JA 3SGGA 3K46A 4F66A 5KZDA 2OX1A 4GWEA 3QOMA 1B3YA 1ISZA 2NWRA 4N9EA 1P0KA 4O1BA 3BC9A 1VBGA 4IXXA 1M41A 4HVXA 4UWMA 3GTFA 4KIRA 1MFUA 3LNMA 1HGWA 1YE6A 4IJBA 4CQDA 3UG5A 4ZOAA 2X1IA 3EXRA 4XVDA 1E51A 4JX6A 1XIEA 5CJNA 4DN1A 3WQFA 1KCXA 2EJAA 1TKKA 1MQPA 2R1MA 3IGSA 3LM7A 3TLQA 2WC4A 4GZ7A 2IPWA 4RW5A 1E1CA 2WM1A 1LWJA 1WKEA 3NM3A 3TE9A 1C9WA 4KEZA 1KKRA 1OCQA 4F0HA 3II1A 4UR7A 3G1DA 3D46A 1WOAA 1NVMA 1LLOA 3QQWA 3HURA 4GNKB 2EPMX 3FKKA 4RDZA 1DJQA 5HQEA 3QXBA 2OXNA 6REQA 1Q85A 1LLZA 3CGTA 4RZBA 5AC8A 3BG5A 1F3EA 4IJRA 3H24A 1US0A 2Z0IA 3L66A 2H9AA 1C9DA 5HWMA 4H7ZA 5IM51 3SURA 2WMFA 1R2SA 3TEVA 1KBLA 2VR5A 4UB9A 4Y9MA 3IVSA 4DI9A 3GXTA 4WJXA 3H22A 3QSRA 3B0XA 2DZPA 1FWHC 2UY3A 5F1VA 2BY2A 4Y9OA 1W5QA 3UWZA 1P48A 1X7FA 3HFTA 5AHEA 3W37A 4I9AA 1PL9A 4D6CA 4PCPA 1TCMA 5HULA 3KX6A 4L4PA 4Q8TA 1XIDA 4ZSUA 2CIPA 2WMJA 5CAKA 4D8AA 1S5TA 5D02A 4KWWA 1XYLA 4X2RA 1D8WA 3GD6A 3MSYA 4W88A 1E1EA 1AW1A 3FJNA 2CLMA 1YKWA 2PDIA 2J78A 1B3VA 4YU1A 2PWDA 1H1YA 1IGWA 4A8RA 6ENLA 1O95A 3CUFA 1UP2A 3GR7A 5A95A 3GQYA 4KERA 4O0KA 2VFDA 3NR0A 2X30A 3TW6A 1LT8A 2V67A 1K7FA 4CNSA 4GCXA 3WK0A 4ZMGA 1GPWA 3M0KA 1GQKA 1TJ0A 1A53A 5REQA 2BY0A 4BWLC 3L0NA 3ZLFA 1DJZA 1G4PA 2Z25A 4ORIA 3VIJA 1XBZA 1WXYA 1FWJC 2QQ6A 3PTDA 3RCNA 4S2BA 4EPDC 2VFFA 2VX5A 4X61A 2DVXA 5FF7A 1W9PA 2WQDA 3ABZA 3ZLGA 4CU6A 3CB3A 3KL5A 5LIWX 4J3SA 1V7AA 3N19B 1RXOB 1DTUA 4H6QA 1ZALA 1FWTA 1DWJM 1AH3A 3TN4A 2QGYA 1GHRA 1AMKA 3K30A 4RR4A 1XBVA 4LS2A 3LZ5A 2VVNA 1JDEA 4JY9A 3ZM8A 1X38A 1ODZA 2HQAA 3N9RA 4FXRA 5A2CA 2RJHA 3NDZA 4I8DA 3U2ZA 2ONEA 4WKAA 3OQEA 1Q7QA 2XIMA 4CD5A 2HV5A 3H2EA 2PWGA 1R38A 3R11A 3TAKA 1UYQA 2PEVA 2VELA 5IFPA 2F9RA 3BLLA 2X1UA 3GUGA 4JCLA 1DPMA 3ARUA 4I7VA 1EWDA 3UXDA 2P50A 4JTQA 1XBYA 4L9ZA 3PTQA 1W9BM 2E6YA 4XO7A 3PJUA 2RAGA 2GDVA 3WX7A 2VOMA 3G0XA 3LCIA 3DBPA 4P61A 4C1NB 5A2AA 2ZIDA 1C7SA 4U2ZA 2C15A 3N6JA 4RDVA 6A3HA 4JNMA 4GYKA 3VGHA 3G0SA 3QY7A 3CUGA 3RR1A 4D6IA 3W1LA 3V75A 1J01A 4Q33A 1ZL1A 2VEFA 4RCXA 3B40A 3MSGA 4AVOA 3R2GA 4GUJA 3JS3A 1BFNA 3HV8A 2Y62A 1JAKA 3DN5A 1X1NA 4LVBA 2J7HA 4N2YA 2BSLA 3T40A 3T2OA 1TZ7A 3M5ZA 1JZ5A 3NZQA 1E9YB 1KD0A 2PD5A 3BMVA 1O94A 2HNHA 1XS2A 1G5AA 1IE7C 1PZ3A 1Q8JA 3LSBA 3FN9A 3C2YA 1KFJA 4N7QA 2A79A 1TWWA 2QUNA 1T96A 2WM0A 1KTBA 1TA3A 3UESA 3KOFA 1YXCA 1NM9A 1B4EA 2J7DA 3SO7A 1J0KA 3KDNA 3S5YA 1WUEA 3PJTA 1DOSA 4RDYA 3W7HA 1JXKA 4TIMA 3VX1A 1WAWA 4W87A 2E8ZA 1W56A 4CEXC 1GOOA 3EEZA 1NH6A 3RCYA 1AQ0A 1YHTA 4UQEA 2YX0A 3ZIZA 4FLOA 5D04C 3K13A 2PDXA 2BY1A 4UR8A 3SUTA 2ZUTA 2GGGA 2YCEA 3QHOA 1TG7A 3W25A 3FSUA 4MB3A 3L5LA 1MUCA 4OVXA 2ZVIA 4GX8A 1UASA 2CETA 5M3WA 1R8LA 2ZA2A 4P8VA 3ANYA 1C91A 1DJIA 1TIWA 3M47A 4NZJA 1T41A 4AZCB 3VGBA 2WHMA 4Z0JA 4DAFA 1JF6A 4LVDA 1Z32X 3T0AA 3K5XA 2C91A 4Q4SA 1XDMA 3WK2A 1E5JA 3E5PA 1L8PA 1RCXB 4WY0A 3R7MA 2H3DA 5HK4A 3UWWA 1QPQA 1S2VA 4HIBA 4F0SA 2ZUUA 2Z4GA 5GQBA 1G7VA 4DX3A 2RGLA 5TF0A 1H49A 2NX3A 5FEWA 3JU2A 4D1JA 2ZDRA 2VZTA 2FGZA 1H5VA 4KWOA 1QTWA 3OHMB 2VWSA 1XIFA 2QT3A 2ZRWA 3A4WA 5LA1A 4J4KA 1E6ZA 1EJ7L 1MDRA 3F4DA 3D3FA 3MUY1 1I2RA 1C8QA 4XTDA 3WLKX 5B7YA 8XIAA 3UJ2A 2QNEA 4EWND 1EP2A 1MUWA 2QUMA 3PBGA 1MEHA 1QI0A 3CIVA 3WO8A 1UP0A 2BFGA 5HWJA 3W24A 4MFDA 2QPSA 2D3NA 4IG2B 4R53A 3UVIA 1KW1A 4UOJA 3R10A 2PDGA 2XVNA 4ZVJA 2XZ7A 3ZJ7A 1EF3A 5D30A 4MZ8A 5LHEA 2YBVA 3N17A 1BQGA 5TQLA 3T0TA 1RCOB 2EQDA 4MOZA 3ITLA 4TO8A 3AIEA 2P1FA 1VCVA 2D69A 4W85A 2H8ZA 1QOPA 2I14A 1CT5A 1H41A 5D33A 3MHFA 4C6BA 4MKVA 2XVPA 5HATA 1WDQA 4NAEA 2PU0A 5IXEA 1EO5A 1CXFA 3VDHA 2G96A 3D6NA 4GVFA 2Y8KA 2JIWA 1EPVA 3ZJ6A 1OIMA 4IM4A 2Y85A 2V0TA 1FWEC 4AISA 4M7TA 5I3GA 3F5JA 4GQGA 3TCEA 3EMZA 1Q6EA 5HBFA 5JQ9A 3U8GA 3WDHA 3KS6A 1P0DA 2OVLA 2EF9A 4C90A 4UQDA 3ARXA 3WLJA 2VCBA 3M0YA 4HK5A 3SRHA 2QCGA 5D2TA 4FNPA 1W1PA 1W1ZA 4C65A 1TYGA 2J8FA 1XISA 4ZBCA 4DRSA 4WLCA 1QPKA 1RVKA 1OYAA 1BVWA 3LGEA 1P0BA 3N6HA 4JQAA 2CLKA 1BG4A 4NVTA 4FX7A 3WF0A 4B3LA 3OB8A 1AW2A 5AHLA 3FEMA 3WDJA 1W5NA 4HMNA 5HPOA 2XVLA 4IGNA 3M5XA 3W02A 4FOKA 3ENLA 3GR8A 1M04A 3AIBA 6ALDA 1OF8A 1F76A 2ZQ0A 5LXEA 2X7VA 1TWSA 1OYBA 5DCBA 3W01A 1MQRA 3LB0A 3VNJA 3AJ7A 1E71M 3CC1A 7CGTA 1WQ5A 3TMLA 5J5DA 1HN1A 3CASA 7PTDA 3POCA 2MUCA 3GNPA 3GC5A 3HG2A 3LCXA 1YE4A 3VUSA 3ATYA 2PCQA 2V38A 3HPXA 1XLJA 1U83A 1I6NA 1FWFC 1QJWA 1E6XM 2YGYA 4M29A 4BA0A 5K9CA 4JQ2A 1Q13A 3IAPA 3OZMA 1TE1A 2QJGA 1VCFA 4Z1YA 4LTSA 1HJSA 5T9BG 3CUIA 4S3FA 1U1JA 3G6MA 2I16A 1WZLA 3C2OA 1CB7B 3UWUA 3P2VA 4LUSA 2GQAA 1THFD 3MI3A 3TW9A 4AEEA 4J40A 3OW1A 4Z2JA 4DJDD 1UUOA 2RKXA 2GVGA 1EC9A 3H12A 1F73A 4IIDA 3SCUA 2ZRVA 3FHAA 2Y70A 2Y5EA 3QYSA 1TZ9A 2E40A 3MI2A 4KFNA 4DJEA 1EC7A 3GNXA 2YA0A 3R0KA 1QBBA 2ZTJA 1YBQA 3LUTA 5C2XA 1DJXA 3M0IA 1GYNA 2IXVA 3VAVA 1H60A 1VJIA 1XFCA 1RBAA 2J6VA 1U2YA 1QPRA 1S38A 2DZBA 3FJ4A 2CKRA 1JGIA 4FOUA 1JYNA 3A6OA 1FBAA 2J9XA 5I6SA 4JTJA 4GPNA 2FZDA 1GW9A 3C5QA 4JX5A 1AH0A 3UXAA 4HMEA 1EXPA 1AFSA 1LQ2A 3HQNA 1AZ1A 3EBVA 3EDKA 3QSTA 5A8QA 3W2JA 1QI3A 5D8WA 2DP3A 3P0WA 4KCWA 3NOYA 4MNLA 3KM8A 4JDBA 2NLIA 5CPNA 3U6WA 1OEPA 4D8ZA 1TMHA 3BOLA 2G50A 1RJRA 3WNKA 4XIAA 1J79A 4KPLA 1AK5A 3UD6A 4UFLA 2DUZA 3VIFA 4D6GA 1O1ZA 5AECA 1QAPA 3NEVA 1GQJA 3VIGA 3UZ5A 2J4GA 5FEPA 1X97A 2INEA 3N14A 4GX9A 1W1A1 1CPUA 3H2AA 3ZR4A 1DXEA 4ZTXA 4EPBC 2ANUA 4ILSA 1I0DA 3WFZA 3K8LA 4HSHA 1BTCA 1VPXA 3LLDA 3UZYA 1ZENA 5KETA 5KZEA 4Y9NA 4ERGA 2V82A 3CQHA 3HN3A 4C5ZA 4Q8VA 3R25A 4M6PA 1FXPA 1MW0A 3DH7A 4CNPA 1E9ZB 2ZDSA 1S46A 4FP1A 3P6LA 2DSKA 3VYLA 3DFPA 4LY4A 2V3FA 4HJFA 5FL0A 1IWBA 4YIWA 2OGYA 3PZQA 3VGGA 3NUKA 4WKFA 4UZSA 3FW6A 1VKFA 3R0UA 1XSJA 1UKOA 1REQB 3QV6A 2BS9A 1M01A 1KFWA 3KTSA 4ML4A 3ERPA 4KH2A 1EPXA 1I0BA 3CEPA 2WKLA 3F5LA 3WD4A 3CQKA 3DHUA 4Q3MA 3P8IA 3I4KA 3KRBA 5JIPA 1FOBA 5A6KA 3BH4A 1TPUA 3PULA 4JFVA 3IVTA 2DU2A 3WENA 1XP3A 5CKSA 4R33A 1DBTA 4FNTA 3VNLA 4L9YA 3QR1A 2CWNA 3L2MA 4TTUA 4U28A 2VX6A 2BOEX 4QCFA 1XIHA 1E0WA 4ZO6A 1E72M 1LM1A 4FO4A 3HG4A 3QPZA 2KZHA 1MW3A 4NU7A 1EBHA 4R9XA 3DFOA 1I75A 3RCMA 2OO6A 1FCVA 2VZSA 4QAIA 2E6DA 4AZ5A 1OF6A 2PI6A 1E5NA 2JKPA 4G1KA 5CPQA 1ME8A 1UZ4A 3TLLA 1TO3A 1R5YA 4IOTA 5AKQA 2YXXA 1UR9A 1J0YA 1JEZA 2IQ0A 1SJCA 4NJGA 2DZSA 2A3HA 4S3GA 1K77A 1SW0A 1S5NA 2PB1A 2Y7FA 4R88A 4Z2GA 3LU2A 4JY8A 4JNZA 3G1FA 1XLCA 5CC7A 5ENLA 4K37A 1P7TB 1I1XA 3TNOA 4FIQA 3DFSA 4NJKA 1A47A 3GC2A 3O0KA 1KGUA 3S6OA 2YOCA 4HZ7A 1WV2A 4YCPA 1TJPA 4AWUA 1VLIA 4ECLA 4AG0A 1LF1A 3EDJA 1V79A 4GLEA 2ZXAA 3U9IA 2CERA 4PE8A 4IT1A 3UA3A 1DHKA 2V3GA 2QCEA 5K4ZA 3UWVA 4GXMA 2OR2A 1K3UA 3UU0A 2OZ8A 2ABAA 4WDTA 1QHOA 4JDYA 4ONVA 1TUXA 2OQHA 3G0UA 5A8NA 1H63A 4JTLA 3UXIA 3EMQA 4HPGA 3V36A 3URQA 5EA9A 1CXEA 4H4IA 3QR0A 4HA1A 2NSXA 4M8UA 4LUJA 1T40A 1N55A 1C7TA 1R6WA 2VQUA 3UWQA 3ITGA 1M6JA 3BSHA 3T9PA 1R3RA 2PTDA 3CQIA 2CPUA 4PUKA 4PMQA 3W70A 5HMEA 1L0PA 3UNTA 4GH1A 4ZO7A 1JZ7A 5CPOA 4W7VA 1Y65A 4OBTA 4BEQA 3S9YA 5GVJA 3TV8A 1GJUA 4S23A 1JCLA 4GOAA 3AISA 4JR5A 1RPKA 4PRWA 4B90A 4UTTA 2HE8A 3LN3A 1HO1A 3PPHA 1Q63A 4OJYA 4RE4A 4QE4A 2VZVA 4AAJA 3BQ6A 1S5VA 3KLKA 3R43A 3E3HA 2ZTKA 3NZRA 2Q8ZA 3FX4A 4DELA 4XV0A 2JKEA 3UXKA 3M41A 3O6DA 2DVUA 5AC5A 5A94A 1AW5A 3W0KA 2XIJA 4C1NA 4MY1A 1Q65A 2B7OA 1SJDA 4X9YA 1AUSL 1NF7A 1BLIA 1Z42A 3N9KA 1E4NA 1SQ7A 2HRWA 1DE5A 3TU9A 1B4KA 1T6MA 4RNHA 3HQPA 1SO5A 1OFEA 1QCWA 2E7FA 4MWAE 1XJBA 5JH1A 2WSRA 4UBPC 2B0MA 4CGTA 1XV8A 1UR1A 2IKJA 1H3GA 2F6XA 2ZUMA 3DZ1A 2CESA 3FDKA 3GHSA 4NILA 4GQ0A 2EAWA 3W27A 1VIZA 2YXGA 1UQZA 3WNMA 1RLDA 1RQEA 4S3CA 1MXDA 2F38A 3WLTA 1QWKA 4US6A 1Q7ZA 4X63A 3GM8A 2YBUA 4DJFD 2NX1A 2DT3A 1UQYA 4ZFCA 1R9ZA 3PAOA 3O6AA 3PJXA 4GXPA 4ADTA 1R3YA 3RMJA 2YCIX 3W6YA 3CNYA 3SSZA 3U7BA 1F8IA 2CZ5A 2DY3A 1DQXA 1SJBA 3YPIA 2C18A 5E6YA 3SAZA 3L4UA 4RL3A 3HV9A 4KW2A 1A5OC 1Q5MA 1CGTA 5E5CA 5BNKA 1EZ2A 5A6BA 1S5WA 3NL3A 3B9EA 2VEGA 4LEQA 1G0CA 3AHTA 5AC6A 3QTPA 3S1WA 4S3EA 2W6RA 1FY6A 5A6SA 2VGGA 2A4AA 3UG4A 4DLMA 1AA1B 1CDGA 3AYTA 2PRMA 1BQCA 3CH9A 3S2NA 3CZJA 4D2JA 1ML1A 3C56A 3DHDA 3A64A 1RBLA 2J7CA 3WELA 1LL7A 3GE7A 3UCQA 2I5IA 2F6UA 4AZCA 2PBGA 4W86A 1CXHA 3LBOA 1Q6DA 4JXCA 1UB3A 4CUCA 2WYSA 1TV4A 1KWGA 1TX2A 1RVGA 1H7XA 3B06A 3LA4A 3H4GA 1B9BA 3DC8A 2HCVA 2W66A 4O53A 2Z1SA 1G01A 3NAVA 3QM3A 4DO4A 4HKPA 4Q7NA 1L9WA 2C16A 4OECA 3GG1A 4H9UA 2E28A 3CYJA 4ZB2A 3NL6A 1OIFA 2FPTA 5BXRA 4AEFA 1CXLA 1VBHA 4MDOA 4BK9A 1SFTA 3KCJA 1XQKA 2W62A 1TWIA 5E93A 1ZQ5A 3NDYA 3N2MA 4RZ5A 2W79A 1OG6A 2WJEA 4LPCA 3O6CA 5FF3A 3PPCA 1KFLA 5DMMA 4DBUA 4JHMA 2ZC8A 2R1NA 1PTAA 1T5AA 3E2RA 4IG2A 1EJSC 4PTMA 3PBUA 3GVWA 4EPKA 3RRAA 5H8PA 4HHPA 2Y7GA 1WDWA 3SJNA 1H5YA 3AIVA 3DBNA 5EBAA 6CGTA 4MDPA 2W27A 3KRSA 2G41A 3WLNA 2P0IA 1ZP3A 3BVJA 4PMYA 4YPJA 1V02A 3MSDA 2PWVA 1PS9A 2HPMA 4WJEA 3M0VA 5E9AA 4O54A 3CLMA 1ZNNA 4GQBA 3AAMA 1UP3A 4DHGA 1Z9AA 2AMGA 2DZVA 3MMTA 1KV8A 4GYJA 3CAVA 1TRIA 3POHA 1A5UA 3MO4A 2PLKA 1E4IA 2EPKX 1QNVA 3NQCA 3F5KA 3H26A 1D3CA 5JU6A 5IHRA 1XD0A 1UIPA 4XAYA 3VM5A 1BXCA 1DE6A 1V7YA 5MF5A 3TWAA 1JCJA 2J13A 2XH4A 1GYLA 3P84A 4R5EA 3LOTA 4Q8PA 4CCZA 4ZR8A 1HTIA 1NDYA 4JYDA 4DPPA 3G6LA 5ECVA 1UR3M 5M5DA 2CBVA 3BICA 3T81A 4P7NA 1TELA 3WQ5A 3BCJA 1JG9A 4JS3A 1V3HA 1JVNA 3TYAA 1NQ6A 1TIMA 3GVQA 3M43A 1IT7A 4EP8C 3FHQA 5LNUA 2ZADA 4XX6A 1UW9A 5H2ZA 1ISYA 3E2VA 4JL2A 4MZYA 3VU2A 5EMLA 4OV9A 1JDDA 2F6KA 2BY3A 4GBUA 5C71A 1NOFA 2YA2A 1SYTA 2E9MA 3OP2A 3KL0A 3UEQA 4PTVA 5XIMA 4Q6XA 3W85A 2Y5JA 4F9JA 5BZAA 3WJXA 1EWEA 5AB3A 3TH6A 4DUWA 1PWLA 2A7PA 1QFEA 4HGXA 1WZMA 4UTFA 1J93A 1IF2A 3NZGA 1CNVA 3WCZA 1OT1A 3OLEA 2ACQA 1DHPA 2G3NA 2O4MA 4LY8A 1ONEA 2UWFA 2RDXA 5G4HC 2QF7A 2WVSA 3OZOA 4AIOA 5KINA 4WEVX 4O52A 3NIYA 4KFOA 4Y7EA 2OWXA 1I4NA 2CLPA 4ZB0A 1HP5A 1GTEA 3RPDA 1GZJA 4C6QA 1KLYA 1RD6A 1E0VA 4REQB 1Q4WA 2XIQA 2JK2A 4JKKA 1P5BA 2YLAA 4ZB5A 4XB3A 2WXDM 3NXFA 4EF8A 3T07A 2PZ0A 2Z2BA 3F2DA 1WKYA 3S6DA 3BXWA 3WDQA 2EKGA 1XCWA 1B30A 5AFDA 4P2VA 4FB7A 1OVDA 1MW2A 4RZ4A 3UZZA 1BWVA 1G7UA 3A24A 3BPWA 1KNWA 4Z1AA 1XRVA 3KW3A 3TROA 3MO7A 4F2BA 1SZNA 1W91A 2CEQA 1J0IA 3TR9A 3V0UA 3EWUA 1GGOA 3MUAA 5HNTA 3W7EA 1Q6FA 3MVIA 4PMVA 3F4NA 3BAKA 5CSUA 4R7OA 4HNVA 2EJ1A 5AOUA 1KBKA 2E5DA 2PDYA 5D9PA 3TYEA 1RK5A 3S0CA 1EDQA 2DPEA 1WA3A 2Z00A 3CBWA 4WOQA 1O7AA 3PBVA 1DXFA 2PSNA 5D9NA 3C0JA 3CIWA 3G77A 1R3QA 5IHSA 4B91A 1YPIA 3AS0A 1GT8A 3TYBA 3MUCA 2IW0A 4DB7A 3CWHA 2PS2A 4ASTA 2ISFA 4S38A 4PRTA 5HMDA 4IFKB 4ZQPA 1Y5WA 4TVUA 4MNJA 3AIRA 4TMCA 2HVOA 4FF5A 1EJXC 4AYGA 3S9IA 3H53A 2PWUA 1V0NA 4KRZA 3AMKA 2J7BA 3WJYA 4NNCA 4XZIA 3RU6A 3BLFA 2YB1A 4J3UA 2PDJA 2CLFA 4GIYA 3QFWA 2QCHA 1VJSA 3KBSA 4MWAD 2R8WA 3GG7A 2C79A 1W1IE 3NQ6A 4HSNA 2HISA 1UUQA 3LHUA 1W3NA 4U10A 4L5ZA 1GG1A 2YFNA 2ZUVA 5AYXA 2E25A 3Q4DA 4N42A 2CZVA 1I60A 3BLDA 1MI3A 3WQCA 4PMOA 2G4JA 2GQ9A 1OFRA 1CGWA 4PBEA 3IAQA 2C19A 4ICMA 3W72A 1LORA 3U5YA 3MT1A 4CD6A 4GJJA 3GXIA 4UTWA 1ZTVA 1GQLA 4YLWA 4NXKA 4HA3A 4OE7A 4BHYA 1W9UA 3C0LA 4I9JA 3ISIX 1ONXA 2NVAA 3VIHA 4JD4A 2QDEA 3H7RA 1VFHA 3MP3A 4AUBA 1XX1A 4ADUA 2XFYA 1UOZA 3PWGA 4A3QA 2H8XA 3W75A 1EGZA 1CX9A 2PDCA 3B4YA 3QZ6A 4ACZA 2ZCGA 5LGZA 3HF3A 2P10A 1EQCA 1TX0A 2GWNA 3TJ4A 3QY8A 4H9XA 1H0GA 2OKOA 3TN5A 4XZ9A 5I3HA 4HOXA 4I90A 4FXJA 4F0LA 3B9DA 2REQB 3FOKA 2YDSA 5G2WA 5M1TA 1R9XA 3CUJA 9RUBA 4NJJA 4IZGA 4NZ5A 4CD7A 5A69A 1GYMA 4MLRA 4HU0A 5AYIA 4MVAA 1R46A 4A4AA 1HFBA 2BGQA 2NV1A 3BE7A 3R8RA 1P7TA 2BWGA 3C2EA 1NWTA 1S2TA 2J88A 4CKQA 4BQ3A 1EP1A 2D24A 1PUDA 5C8BB 2GJRA 5CGTA 4JOMA 2NUWA 3WH6A 2I7GA 2RJGA 5FSEC 5HNNA 1UUMA 1W2PA 3NSMA 3FEQA 2A3AA 3CPGA 4S3BA 5EGRA 2PGWA 3ZZ1A 3BDKA 4UXDA 1SR9A 4JKMA 1IEQA 3HOJA 1PAMA 4ICNA 1YNYA 3PTKA 3C61A 3GU1A 1EEPA 2WANA 3WQDA 1A4LA 2WSQA 4NX5A 2R91A 4FALA 2OB3A 3W53A 1ISVA 4GIAA 5BMXA 1KQYA 3WF1A 3K8MA 4E5TA 2C3ZA 4GABA 4ZTYA 4MKSA 3E2SA 4A3UA 1D7FA 3T44A 2P0OA 2WCSA 3BJSA 1GPFA 3GBDA 3L2IA 2ZXDA 4NP7A 4GJIA 4YYCA 3KE0A 3PNUA 1L8NA 2O7QA 4R3UA 4LAMA 4C1KA 1PIIA 2CC0A 1J5SA 1OFBA 1L6SA 4C6IA 1VYPX 3W2KA 1KGXA 2AGTA 3TK7A 3WKZA 4Q6JA 4W7WA 2GQ8A 4GYPC 1KCZA 1PIFA 1OQFA 4LNCA 2AAMA 1LL6A 3FA3A 1XD1A 3V1HA 2ZA3A 3B8TA 4HHLA 5D09A 4DXXA 2VCCA 4UMCA 2FVKA 3CUHA 1F4AA 1W37A 2D2GA 4TQTA 1NSJA 2HSAA 5H8UA 3FGCB 3UBPC 4DXKA 1HKWA 1J8VA 1PKMA 4XWUA 1M68A 2ATSA 4A22A 4J3WA 5H91A 3V0SA 1TPH1 4NI3A 4XZLX 4AWSA 1AD4A 4J2MA 1E3ZA 2HEJA 4GI4A 5JUVA 2FFCA 4LFYA 4GACA 3AIUA 2Q3RA 1BWKA 5CZTA 3QC0A 3CV6A 2WMIB 2O92A 4NYYA 2AQVA 2GLKA 2XSAA 3JZUA 4QCEA 3TQVA 3AXMA 4WD0A 5TNVA 5CJ5A 5LHFA 4TX6A 4F4RA 3F4CA 1SVDA 4K38A 4EAMA 2PLCA 3M5YA 1XGZA 2YL9A 1KA9F 1YDYA 1HO4A 4QBXA 3EWZA 4ZENA 4DJDA 2I5QA 3T78A 2E4TA 3IGXA 5GNXA 4P5UA 2QZRA 4H2CA 2DT0A 3TTYA 3VMNA 4P7OA 1J18A 4Y8FA 1VC4A 5DY2A 4O0ZA 4QITA 2H6RA 1XINA 1JCNA 1H2JA 3ARTA 4KWSA 3HGRA 2VR4A 3MB9A 5CC5A 2V8ZA 1VAHA 4HMDA 3N2CA 1KBBA 1WZAA 3B3DA 3LPPA 1O68A 2W3ZA 1XIMA 1JDCA 1L6YA 2CHRA 5M17A 4M0XA 4XAPA 5HDRA 1KRMA 3B97A 5DF0A 4J28A 1LL4A 1SFSA 2PFHA 3OODA 4E3TA 2POZA 3PZNA 3MJYA 2YYUA 4AZHA 1EJTC 4X60A 1G67A 5KITA 3P5YA 3NZ1A 1M9HA 3GDMA 1VENA 4WDWA 2OYLA 1A5KC 5BU9A 4Z2KA 1DJGA 4GGBA 4WF7A 4WVXA 2CLOA 4HNNA 3VD5A 3NQGA 4UTWC 2BNJA 3PUOA 5G2HA 4ATWA 1U30A 3L68A 1MNZA 2HNEA 3HTWA 1IZJA 1JNEA 1V6XA 4DYJA 4KIEA 3C3UA 2GSEA 4R27A 3FYOA 4IX0A 4XBSA 1TMLA 2QCCA 3EWXA 4IMGA 2ZZ1A 4E8GA 1V6UA 2BHYA 2AL2B 4UTUA 2CBIA 3GFXA 3B8IA 4KESA 2YXOA 3L7RA 5G5IA 2ICSA 1TV7A 3LTPA 1JZ2A 4QP0A 4GH3A 2R1PA 2OELA 2ADAA 1I9CB 1S3HA 3LI1A 1M3UA 3RPMA 2WVTA 2WZEA 3EWBX 1NAL1 1EOKA 1GONA 3N6QA 1XIBA 3CT2A 1UA3A 4B15A 1TMQA 3SUUA 2ODOA 2NV9A 3VIOA 2GOUA 1WDDA 1E4MM 4K36A 3EOSA 4MWAB 3H23A 4NT0A 3NO3A 1GVYA 3EB3A 3G5EA 4LH8A 1XG3A 2JF6A 2ZRUA 3STGA 4H9YA 5DO8A 3R0DA 3OYZA 1EGMA 1IZKA 1XPGA 4PCTA 3WD1A 1Q2SA 2YCKX 3PZUA 5LSMA 3UPMA 4UMAA 1FWDC 4MIMA 1RY8A 1KTNA 1YEYA 3DEQA 4HTBA 3NL5A 1QPNA 4UTKA 1DJWA 3NVTA 3CHDA 4GZEA 2NQJA 1WBJA 3GKFA 4IP7A 3F03K 1FCBA 3W82A 1YPXA 5LGXA 2V3EA 4EWJA 1V51A 2I5GA 1WO2A 3VOFA 1YW1A 5JMUA 1N8IA 1VBUA 2FMOA 4BI7A 2ZZ7A 4LAKA 1ZU8A 3NWRA 3PZIA 3L12A 1X1OA 1EF2A 2X05A 2VGBA 1NQKA 4E4FA 1GVEA 3APTA 4GFIA 3WZ0E 1ZCOA 3SQLA 2D73A 4CU7A 4R85A 1JF5A 1B54A 1OFDA 3FV9A 1E40A 3IK2A 4DAIA 3IANA 3IIZA 3R4IA 2FQIA 2FGLA 1GG0A 5AYYA 2WCAA 2NVDA 1PPIA 1K8CA 2DDXA 3NQ7A 2OPJA 2OODA 3SY8A 1LJYA 4LRTA 3QFEA 5L9FA 1FCQA 3AHXA 3WFLA 3MY9A 5HINA 1T7LA 4DNHA 2VHLA 3UWEA 3VGFA 2ZYFA 2YDQA 3HPSA 2O9OA 4AZ7A 1JGMA 4OHQA 1F8MA 4PCFA 4W4QA 2E5BA 4ZODA 2GVJA 3RYSA 3M0MA 4DM1A 4NL1A 3S2LA 3LNPA 4QG8A 3KBMA 1TSIA 1GKRA 2V2HA 4IICA 4H1ZA 1CGYA 2IXUA 5A1AA 3UQNA 3NOEA 5DXXA 3KUMA 4LCRA 2AMXA 5F4XA 2Z28A 5FAJA 4O1CA 3GLCA 3WJSA 3EWCA 1DL3A 2KX9A 3UXLA 3RU8X 1XICA 2J79A 4XK2A 1OX5A 3F4WA 3GNRA 3NL2A 1S2UA 5D4YA 2INZA 4AYSA 4JX4A 1XUUA 1OBAA 1JZ4A 3AU6A 2RH9A 4E3VA 1A0EA 2ZZ5A 4I5XA 1R0MA 4LC6A 4ZOBA 5I3FA 2D2JA 3A4JA 3A3XA 1M53A 2A0NA 1IEXA 4MLJA 1V6WA 1L2UA 2YJQA 4D6DA 3E74A 4REQA 4N02A 3TUUA 3RHGA 5A6LA 2VJXA 4BI6A 4Y90A 1A5BA 3RX4A 3LZ3A 1Z48A 1QT1A 3TYDA 1CIUA 5A8GA 5CSRA 1FHDA 3BW4A 1E6SM 3BWWA 4B5UA 4KMQA 2WSPA 3U0HA 4XVEA 2B7QA 4GHRA 4LBUA 1XF0A 4YVXA 4L6HA 4M81A 1HUVA 3EB2A 4Y96A 4DJDC 1FX6A 2ZWYA 3EX4A 4C1LA 1IV8A 5EL1A 1GZGA 3AUJA 3GXPA 1OGGA 1EL3A 2FZBA 3RX3A 3OBKA 3L5MA 1HQTA 3CO4A 3VIIA 2PF8A 1TWZA 4JL1A 1C8YA 2PURA 1LRQA 3BUVA 2YR1A 4HCLA 1SU5A 3TMQA 3S6TA 1UKSA 2GJXB 2CKSA 1VPQA 3GVVA 3RGTA 1QW7A 1ITUA 1OABA 3TX9A 3VMOA 4EKJA 1X6LA 4D6FA 5FESA 3UG8A 4P8UA 2QR6A 2PTXA 1N8WA 3AS3A 3MV11 3JUGA 3L0KA 3VDCA 2LLEA 3NVDA 1ONRA 2XWDA 5G1YA 1AQFA 1GEHA 4GXWA 2G4FA 3F2CA 1FH8A 4PZVA 5ABHA 2D0FA 2A7RA 2BVWA 3OLDA 3C2VA 3THDA 2DSZA 3WLSA 3CHEA 4AC1X 2RGMA 3VXGA 2Y6ZA 2WB5A 4IFKA 3EKZA 4C6EA 1QW8A 3W2MA 4FEZA 3AI0A 3WBYA 1ZCCA 5D2XA 4DJFA 2Q8LA 1WPCA 2I9EA 3EDDA 2Y88A 5LZLA 2FYMA 2FVMA 4MSSA 1PCWA 4YYFA 3KCOA 5A8OA 3TXZA 1BF2A 4J2PA 3OIXA 1XDJA 1KXQA 3MSRA 1FRBA 4GGHA 5C55A 1GOMA 1RZMA 4ZOEA 1OD0A 4MPQA 2J62A 3SSJA 1WXJA 1RQBA 3LHWA 3ANUA 5AHFA 3TXVA 4HNLA 4RZ6A 4O15A 2GZXA 2WOQA 1POKA 2FHBA 3OVRA 3GDRA 4G7FA 4AXNA 3R8GA 1H1ZA 3GNDA 3N2XA 4KS0A 4QE5A 3B8UA 3MC5A 5CEWA 1AZ2A 1XH0A 5EMUA 1ZAJA 2Z24A 1DIOA 3WBWA 3FVMA 3B8WA 2XUCA 1VIWA 5EYWA 2PGFA 1CEOA 1LT7A 2XJ7A 2VR2A 4DQWA 1W1B1 1FFRA 4QEHA 4D72A 1FP9A 3GB6A 3ME3A 4IF2A 1R7AA 2OYMA 3RF9A 4L56A 3EZ4A 1F6KA 5FACA 2HTMA 4LCSA 2VOTA 1LZOA 2YZ5A 1A50A 1JCYA 3I3DA 2G0WA 3STCA 3NZPA 1KBIA 4WIWA 3QW3A 3TTEA 4ZQNA 4V1YA 4HZ6A 2QUUA 3H55A 3CK5A 4HA0A 2GK1B 2WZMA 2HPIA 3GDBA 5EFFA 3M6YA 3NA8A 4XD4A 1NDWA 2W4XA 2ABBA 3ES8A 2CHOA 2XISA 4YWIA 3VNZA 1Q2RA 1JPHA 2REQA 3AO0A 2WC7A 2HROA 2V63A 4L4MA 2NQZA 4XBJA 1UR2A 1CYGA 1KTCA 4HQVA 4ES4A 4TOQA 4PL1A 1TUFA 3RLVA 4MPKA 3MA8A 3PAJA 2SFPA 1QOXA 2ZVRA 1W6TA 2OFJA 2VD8A 3Q58A 4C6OA 4I9MA 4UTLA 5F4SA 3VIPA 3MKKA 3SCSA 2GVEA 3I10A 5GNYA 2OQLA 3WQOA 4IMDA 4EOUA 4ICCX 2XH2A 3H21A 2QUVA 4NQ1A 3WL0A 3CXOA 4RUBA 3BGJA 2ISDA 3L4WA 3IACA 1IYXA 2JEPA 1BXBA 4KETA 3VNMA 4QJ3B 2A5HA 4R34A 3GK0A 3KWSA 3G1RA 4NKCA 1IEWA 3WK3A 4CD8A 5HJLA 3JRKA 2V5DA 1HL9A 2UV8G 1A5LC 1P1MA 2OOFA 1YTDA 3RO8A 1UD4A 3DERA 1VBRA 3H2NA 3AZSA 3QZEA 1KXHA 4UMBA 3TWBA 3VK5A 3BLOA 4XQ6A 2Z2AA 3VFCA 2RHGA 2OMAA 2C0AA 3WNLA 2FJUB 2XGBA 2OT1A 3LCLA 5I5RA 3VNKA 2RDUA 1GVSA 3AC0A 2I56A 3FXGA 1PZ1A 4KT2A 1K03A 4JCMA 4GNJA 3U48A 3I6TA 4PMNA 1HGYA 9XIMA 3W76A 3V4BA 3GBEA 1FDJA 3S1VA 3ABOA 3DHPA 1E43A 5G4WA 3AYVA 3BURA 5FJPA 1QVBA 1QASA 3OBAA 3N3MA 4OZOA 3ARSA 2BGSA 1X8FA 3FA5A 3GXFA 1B31A 4EAYA 1VHCA 1N8FA 1T0OA 3ZSTA 1SM9A 4O57A 1H62A 3W29A 3HGSA 3FGCA 1ICQA 2XFRA 2WPBA 4MFEA 4PFMA 4O1EA 2Z2UA 1RUSA 4LOCA 1F2JA 2ZX7A 2FZMA 3UGRA 3TP4A 1QNQA 4GVHA 1IR2A 4FIRA 4F3HA 4JTEA 3NO5A 4L61A 4QS5A 2JIEA 1ITXA 3PK7A 1EZWA 1V4YA 2IMRA 1JQXA 4J1OA 1XLHA 4KFPA 4L7ZA 2WMIA 2Y89A 3W88A 4ZSTA 5AZ0A 1BAGA 2A3CA 4RXFA 2Y63A 3P0XA 5LNRA 5AVHA 2G95A 3MCMA 3MUIA 5DMLA 1IGSA 1AMYA 4GQQA 1EJUC 2ZZ6A 4HMCA 2Z27A 4H3DA 2HK0A 2A21A 2OOGA 3ABSA 5LNWA 3W7GA 4WK9A 3IJQA 4AVFA 2JGQA 3LGDA 3MBDA 1OYCA 4D6EA 4POCA 4K68A 2YPIA 4XUGA 4DJFC 2UZ9A 4CCEA 2QW5A 3S46A 4IHCA 2V5LA 1KR1A 4FF7A 4W89A 1XGEA 5I00A 1F9CA 3BCFA 2GFTA 4P7LA 1FWWA 4Z42C 4NUWA 5D9MA 1YXYA 5HR6A 4YCOA 1O1HA 4K6AA 4QQUA 2CXEA 5BRQA 1L2QA 1O60A 3PBYA 1GKPA 4GVGA 5IBXC 2GSHA 1K8YA 3W1NA 2WCGA 2Y24A 3B8SA 1R3WA 1ISWA 3H7UA 3P82A 3KOYA 1HW6A 4S1FA 3GG8A 3ZWTA 2GVLA 1GQNA 2FMNA 4H19A 1FWIC 4EPEC 3COTA 1F07A 4QHRA 4FPSA 4Q22A 1K8ZA 1H11A 3U4AA 2J66A 4AZBA 3OG2A 2WHKA 1OCBA 3VMPA 3IIVA 3R89A 5C6MA 1IZCA 3PSVA 3VVGA 3IK4A 2PDPA 1UZDA 2FVLA 3W28A 4X9SA 1UBPC 2E09A 4Z2LA 2DJXA 1PKLA 4NY2A 2UY4A 4YJ5A 4TV5A 4J3XA 1Q66A 4QROA 1VP5A 2AL2A 1P4CA 2A85A 1QRQA 1W3KA 2VTFA 3S5OA 3G2GA 4W9TA 5LA2A 2AKMA 2DT2A 1V93A 3W6LA 1PCKA 4UNIA 1DKWA 4RJEA 3WDPP 1FWGC 1R87A 1FFQA 4CQ9A 4LBRA 3DFQA 1VFLA 4PSPA 1IWAA 3T2PA 3WBAA 3U7VA 3TSDA 3I68A 2WVVB 3M0JA 4MM1A 1HKMA 3ID7A 4ZFMA 2Z29A 4MWAA 3AXIA 2XFFA 4E8CA 2PDHA 4IUOA 4P8XA 2DSUA 2W63A 2QIWA 3DYOA 4NG3A 3W23A 1P43A 4QNWA 6XIAA 3SECA 1IXNA 1NFGA 1ZJAA 1MFVA 3NO1A 1HKKA 4NJIA 1PXGA 3NQ2A 3NM1A 3WEZA 3CL7A 1BHGA 3BG9A 3AYSA 4MF4A 4AD0A 1VF8A 2QMKA 4L1XA 3TZNA 4HK7A 4UQCA 3PZOA 4US5D 4H8VA 2PP0A 3LXCA 4DZAA 2BGNE 1LWHA 2J8GA 1OGSA 2J8TA 1XLFA 1RR2A 2CITA 4JICA 1QK0A 4LEFA 3WH9A 4AU0A 1B3WA 3KZSA 4HYWA 1JDAA 3EOLA 4ATLA 4ZCWA 1VZWA 4JTFA 1E15A 3VKAA 2XH7A 3W1TA 5BMWA 1EJWC 1JDFA 3VINA 1M65A 5U7SA 5E09A 1OFQA 1PB0A 1HJQA 1QDSA 4IMCA 2INFA 4HOWA 2QKFA 1XCXA 1E6RA 3WJZA 5A2BA 4BQ5A 4F0MA 1EIBA 2R82A 2GGJA 2CFFA 1RH9A 4BF5A 3VC6A 4H04A 3CPRA 3GZAA 2XN0A 3VKJA 1Q6QA 1YADA 4FHAA 3EEGA 3FCPA 3WLLA 5LNVA 3WY1A 2V68A 4IPNB 4QFUA 2QV5A 5J8LA 5ABEA 1E6QM 4DZIA 1DWFM 3W83A 5C7VA 4DF0A 3KRZA 1Q6OA 5EMYA 3NPVA 5CH9A 1E55A 3ZR5A 5ABGA 2PTZA 1EDTA 3SRFA 3MDWA 1BD0A 3KCLA 5JVLA 2WWDA 1UC5A 5K9DA 4GI8A 2A6LA 3GDLA 2PP1A 4M24A 1K9FA 5HQLA 4O50A 3IJ7A 3FY1A 5D9OA 3W7CA 2VC5A 4LALA 1GTHA 4DYKA 3B0VC 2EEXA 2DORA 4W8LA 2Q8XA 1PVNA 1F05A 1C8XA 5D03A 4H9ZA 4HPXA 3EPNA 4UFHA 5F2GA 3L4ZA 4YHGA 2X2GA 4CNUA 3UCDA 3ZOAA 4I9TA 4F0KA 3S2JA 4JTUA 2X16A 1HJUA 4IL2A 1WX0A 4MHBA 5K3VA 1N82A 3SM0A 4AH7A 4FR1A 3AXHA 4IGSA 3V5CA 5C9ZA 1UD8A 5EPDA 3TR2A 4A2RA 1PE1A 2IPJA 1GOWA 3GH4A 1ZGDA 3PZ9A 1RA5A 3VUPA 4IH3A 4ZL1A 3QGAC 4PB4A 1O4UA 3GIQA 2WBKA 4QJ4B 4KGLA 1S5MA 1KM5A 3EPOA 4O13A 2BHZA 3N13A 3IJ8A 4CD4A 1OSEA 3GFZA 5I3JA 3W22A 1ZUAX 2YCJA 4LANA 1FWAC 3I7QA 3VE7A 3W2UA 3W7QA 3LCGA 3FSTA 2D2OA 4JFTA 3STFA 1W0MA 3HPAA 1Y8BA 2GJXA 3UY7A 4NZCA 3AXXA 1GKQA 3P74A 3QOKA 2WKGA 4DVOA 1AH4A 5FI8A 4AZ6A 1CENA 3BZGA 4YTTA 1OGBA 1SMAA 3VX0A 4RK8A 4AD1A 2F7FA 4F2TA 3SFWA 1ZRQA 3QC3A 5IFTA 1FDZA 3C0SA 4S3DA 3W1AA 1XPYA 4IMFA 1B2YA 4J3VA 1XYZA 4M5PA 4LVGA 4HB7A 2PMQA 3RIKA 3KAOA 3NURA 3ANVA 3DCPA 2YW3A 4FZIA 2HDJA 4GD0A 5C2CA 2WJDA 2A7NA 4MNMA 1RA0A 2TAAA 1H7WA 1SZGA 2NUXA 4UTHA 2Y7DA 4NJHA 3R79A 5J5RA 2G37A 1OFPA 2WC3A 2XM2A 2BVYA 1QBAA 1UCWA 1SW7A 2WNNA 5CC6A 5LKYA 4IPJA 3EKLA 3CB8A 1TV3A 1EQPA 4FXFA 3BQ5A 2HBVA 5MHBA 4M1RA 3STPA 4EIVA 1OC6A 5J04A 2ATMA 1FDYA 1QI2A 2A3BA 4PBGA 2HJPA 3BCDA 3TQPA 2R6OA 2V9DA 2QF8A 3QLDA 2EKCA 2C1IA 4V1XA 3AIWA 4LCQA 1H7OA 5C9UA 3ITCA 5CZJA 2BXZA 1G4SA 5I78A 1VJZA 3UJRA 2QXWA 3H2MA 2QDHA 4LAOA 1V08A 4IQLA 4RDWA 5M2FX 5LXXA 4MWAC 1J11A 2DW6A 2PLJA 4WZHA 1BYBA 5EBUA 4GC4A 1VB9A 3LHVA 1E70M 4U5KA 4QJ1A 1TV8A 2POTA 1ADOA 5AHMA 3H4WA 2XM1A 2ACSA 3WEMA 3BK0A 3VTRA 1EX1A 3CO8A 4L80A 5G4EA 1XBXA 3REQB 1P6CA 3G8RA 4D9PA 2ACRA 3MV01 4G2DA 1KXVA 3LERA 1F6YA 2WAGA 1R9YA 1UWSA 1UR8A 2FIQA 4TXEA 3JVAA 3SIMA 4EXBA 1EUNA 5A6MA 3GXDA 3LLXA 4FSAA 4O4WA 1QO2A 5BXTA 4IX2A 3KTCA 3V0TA 4KRUA 2GK1A 3ZQ9A 3JR2A 4O8RA 3DOPA 5LA0A 1SFLA 2HBXA 1IR1A 1ZHAA 3LQLA 1RALA 2CBUA 4B3ZA 4MUZA 3GTXA 2IPGA 1PWMA 3FS2A 5C54A 2NVCA 2DIEA 3VE9A 4WR3A 4AW7A 1GCYA 4QEEA 3AJXA 2FJKA 3SCWA 2W0UA 1JYWA 4XBKA 1CI1A 3W81A 4Y9PA 3PPGA 5BOFA 1AQMA 3QH2A 2OWCA 2P88A 3MWCA 2VX7A 1B3ZA 3LTYA 4DIAA 4K39A 1RPXA