3W6YA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with tt2-2-199
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with TT2-2-199
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w6yA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w6yA01
3TSMA 2VFEA 3L65A 1EP1A 4MY1A 3TIMA 4EF8A 1SW7A 2ISWA 1VRDA 2E5DA 3C2EA 3I7SA 1I2OA 4WXZA 4JTSA 3EKZA 1WOAA 2B7QA 2RDUA 3UQNA 1BWKA 4KKXA 2CW6A 2CLOA 3GAKA 3LBCA 5F2MA 4JTFA 4DELA 1DJQA 1KFCA 2O7SA 3NQGA 3W1XA 5TQLA 3NL3A 4I7WA 2Y61A 2A0NA 5IBXC 4DPQA 5FEWA 1OFAA 1SO4A 3EWWA 3G0SA 1RPXA 4UTMA 3W72A 4MZ1A 2NX9A 3LHWA 3L67A 4UTKA 1QOQA 3Q2DA 4HIBA 4WY0A 4AHQA 1FCVA 2ZRVA 1TPH1 3FIGA 3HG2A 2CWNA 3G3DA 3T55A 3UY7A 1FCBA 1KTNA 1KV8A 2ISVA 4HPJA 1PCKA 4NJGA 1ZALA 4O4VA 1LOSA 2E5BA 1KFBA 1B4KA 1EX5A 5D37A 3NM1A 4FXRA 5LNRA 5IBXA 5EBUA 2C1HA 4H3DA 3PBYA 3LGEA 3ABQA 3V1PA 5A5WA 1K02A 3P8IA 4TMCA 3P84A 5HMSA 2P10A 3CB8A 3S42A 3L9CA 3VFLA 2VFGA 5CSRA 4UTWA 1SR9A 3CM4A 5G4WA 5KMYA 4JTJA 4MPQA 3QW3A 1GYLA 1GTHA 4UIOA 2G95A 3W1LA 3A5FA 2AAMA 1KFJA 1PL9A 2G97A 1F7BA 4MOZA 2CLEA 1ZCOA 3QFEA 5DY2A 1XBZA 4IUOA 1PCWA 1SZFA 5KZEA 1YPIA 3DH7A 3G8RA 2X16A 3BW2A 3UXDA 2BZNA 3EWXA 1ZAJA 3KRUA 1F73A 3G1AA 3EKLA 2NX3A 2TMDA 1B3OA 4O17A 1QNVA 3DFQA 2NV1A 2WSQA 5BMXA 1XL9A 3YPIA 4GXMA 4LTSA 3N2MA 3PBWA 3INPA 4UFLA 1JUKA 1LTDA 3TXVA 2CZEA 3SFKA 4Q32A 2PRMA 3LTSA 3STCA 4LW7A 2BWGA 4HNVA 3I7QA 3OA3A 4N9DA 2YXGA 1B4EA 3R8RA 4ZMGA 1A5CA 2Y63A 3L5AA 1Q6RA 1UJPA 1H1ZA 3QQ1A 1V7YA 1W5QA 4TIMA 3TAKA 2A6LA 2Y6ZA 5C6MA 5AHLA 4RK8A 3UWZA 3MYOA 3W74A 3BO9A 4UC5A 3GYEA 5D2TA 3W7CA 1F74A 4TMBA 3S5NA 5A8GA 4Z0SA 1ICQA 5FEXA 3PVFA 4FX7A 4NT0A 1WBHA 1LRQA 2Y7FA 4PL2A 1JCYA 5G2HA 2E1DA 1OX4B 3MI3A 3OVRA 4RXFA 2Y62A 4Z0JA 2V5LA 4IOTA 4KFPA 3IVTA 3B0PA 3NA8A 3NEVA 3OBKA 3C2FA 2TRSA 3TAOA 1FWRA 2OJPA 2PE4A 4HPXA 2Z2UA 3BW3A 4TX9A 3NAVA 1W3NA 2IQTA 3N9RA 3TC7A 5HR7A 4S2CA 5E1QA 2DZWA 3TCEA 3G0XA 2CLHA 1OYAA 3B8DA 4X22A 1L6YA 2A7NA 5K4ZA 1GVRA 1DKWA 1HG3A 3WJSA 2GOUA 4UFHA 1LBFA 3NQ7A 5LNSA 2YGYA 3RLVA 2QUVA 3MWAA 3TUUA 3NM3A 3NQAA 3PUDA 3MBDA 3RLUA 4Y8FA 3C56A 3OVPA 2QJGA 1EWEA 3U6WA 1B9BA 2YX0A 4LS2A 3DZ1A 1LBMA 4FNRA 1EPXA 2V0TA 4N6FA 3ZR4A 4O16A 2I14A 4NJIA 2WJZA 3QRHA 1RD5A 1TV8A 4BI5A 3NL5A 4DF0A 3LCXA 1OK4A 1LOQA 2ZRWA 1JCLA 3UYCA 1SPQA 1NEYA 1DQXA 3O1NA 4NUWA 5D33A 1GWJA 3KVJA 1W37A 3PG9A 4NNCA 4I7VA 2ISSA 2Q8LA 4IMEA 1N8FA 4O53A 1YYAA 1K7FA 1WBJA 3G0UA 1Z42A 4LC8A 1RVGA 2CZ5A 3PR2A 4JGDA 5AC7A 3A23A 2UV8G 3HPZA 4NNAA 3LOTA 4ZQPA 4RXGA 3EWYA 5HUPA 1FXQA 4NX0A 2GQ9A 4DEFA 2E6YA 2OX1A 1R2SA 3O63A 4A29A 3WJYA 2OT1A 2QUTA 3ZWSA 1QMLA 4WOQA 5T26A 4EF9A 3R89A 1OABA 4A2RA 3N19B 1DORA 3GDRA 4YL2A 3FJ6A 2FB3A 5H91A 1A53A 2YW4A 3GNDA 4FNPA 3S5ZA 5H2ZA 4CCEA 2DZTA 4NJKA 1OYCA 4BI6A 4U4MA 2ZCGA 5AOUA 1LRTA 3LLDA 3JS3A 1BKSA 4K7VA 1R2TA 4JS3A 2QCDA 3W1RA 5DCDA 4DF2A 3QPYA 3C2VA 3EEGA 3GVGA 4UR8A 2A4AA 3QYQA 4N4PA 1GOXA 2H8ZA 4K39A 1KM6A 4TR9A 3O07A 3W7KA 4Z1DA 5HJLA 3T7VA 3E9AA 3TJLA 3QC3A 3A5VA 5DY3A 5C5YA 2O7QA 3THAA 3F4NA 1HTIA 1FWNA 1GPWA 1KBJA 3DFTA 1ICSA 5F4WA 5K4XA 4LVBA 4RKAA 2PRHA 3EX1A 1JUBA 1ZHAA 1H1YA 1EA0A 3JRKA 4JR5A 3GB6A 3A9IA 3HIJA 1C29A 4YMZA 2ATSA 1R47A 2RDWA 3TQKA 3NYZA 4TU1A 3W23A 3K30A 1UCWA 2CLFA 3H53A 2QDHA 2ZTJA 1F6PA 1LLZA 1QDSA 3R13A 1VH7A 3DI0A 1SUXA 3HG3A 3W2MA 1VHCA 4XQ6A 3FS2A 3RNDA 2VFIA 4GNJA 3MHGA 3KAOA 4DO5A 1EUAA 4ZQMA 1DL3A 3B0UX 1EUNA 1I2RA 5D05A 2ABBA 4LVFA 2A7PA 1FWSA 2YW3A 1KLYA 4MJZA 5K2ZA 3QMSA 1YXCA 3IVSA 4LRSA 1FWTA 2PRLA 2WV8A 1YDVA 1OFRA 4K38A 2BLEA 3WK2A 4BWLC 4RZ5A 4GUJA 3GIYA 1Z44A 5AC6A 2QKFA 2Z6IA 2V2DA 4DO6A 4O1AA 2E6DA 1I45A 1G7UA 3UWVA 1A5BA 1XUUA 4YXGA 1Z41A 1G67A 3LX9A 4JXCA 4UMCA 4WQ6A 3L21A 2Y89A 2VEMA 3NG3A 1S5VA 2OCZA 4N2YA 4KWWA 2B7OA 2GQAA 3Q58A 4GC4A 4FX6M 5HNRA 1DJNA 4FEZA 3VNDA 1N55A 1W54A 1VGAA 2NXHA 5FI8A 2R14A 3RU6A 3BW4A 2A2IA 2A85A 2VC6A 4Y90A 4BWLA 2EAWA 3DHDA 3OEXA 5AHMA 4UFJA 3C61A 3HPSA 4A2SA 5HWNA 1YADA 4FNSA 3TU9A 4LS0A 4XBSA 3TROA 1GTEA 4IQLA 3G24A 3TC6A 1OX5A 4IX0A 3TE9A 3UY8A 2ZZ4A 3G1HA 3O06A 4IMCA 4XKYB 4QM1A 1LM1A 1W3IA 3MI6A 3C3NA 3T40A 4O0ZA 2AQWA 3DAQA 5CPNA 3F1QA 2OMAA 4JY9A 2G5WA 3W7HA 1I8JA 1VCGA 4LWWA 1WAUA 4OT7A 2JBMA 1GVQA 3IEBA 3LI1A 3VKJA 4E2BA 3N14A 2YYTA 4LS1A 3LCIA 3W2NA 2J27A 3VI2A 4OWGA 3TQVA 1KFEA 3W7RA 4GWEA 1WXJA 1NF0A 4R34A 1LOLA 1XBYA 4AAJA 2F84A 4CNPA 2GJLA 2PURA 3MW7A 1S3HA 1CW2A 3SR7A 1TPFA 3E0IA 2DJLA 3DHFA 5ABTA 3L68A 4J9JA 1W0MA 3I68A 4RCXA 4JD4A 4UNKA 4WY0B 3BG3A 3G1YA 4JTKA 1PV8A 3V75A 1UB3A 4E0CA 4LVGA 4XKYA 4POCA 2VEPA 5AHIA 5EKYA 3LCWA 3ATYA 2CU0A 2QCGA 2V9DA 1VQTA 5CZSA 3W22A 4FF7A 1HFBA 1U5JA 3P60A 5LGXA 1JVNA 4M5PA 1TTPA 1EEPA 3UXAA 1ME7A 2PCQA 2ZYFA 1LP6A 3LXBA 4YWIA 2ZDRA 3NPXA 4M7TA 2RDTA 3OHIA 4XTIA 4ZQNA 4CNOA 1QCWA 1XI3A 5FF7A 1TMHA 3P80A 5C2XA 1ZJIA 1W5PA 4RJEA 4GRSA 5DBTA 4ML9A 3W83A 1OFEA 4AHOA 3LXAA 4O4WA 5C54A 3M1ZA 1FCQA 1TB3A 3PSVA 3ZWTA 1XCFA 2W6RA 3BLEA 2VXNA 1JUEA 5MHBA 3W1QA 3P82A 3IGXA 2H90A 3W6YA 2YPIA 4UTWC 4DQWA 3WK1A 1UUOA 1NF7A 2XFWA 3M5XA 2CZFA 5I3GA 5AYYA 4O57A 5L9FA 2C13A 4NQ1A 5EA9A 3THQA 3WFAA 3CPRA 4L4LA 3SI9A 2FLIA 4HKPA 3W88A 5D2WA 3DFPA 3NQ2A 2NWRA 1Q45A 2CLLA 3W1NA 1G4SA 1IIGA 1NVMA 4Q4KA 1PVNA 5LKYA 1SFLA 2QCFA 3A24A 5KITA 3EWBX 4MJMA 1W56A 4BK9A 1F05A 2FQIA 2YYUA 4HNNA 4JX6A 2DZSA 1XBXA 2ATMA 5KZDA 3G3MA 2WO5A 3BGJA 3TXZA 3T44A 4IJBA 3ABOA 4R53A 1MEIA 3LHTA 4WZHA 2G96A 4QNEA 4XTDA 1XC4A 3QMRA 4IMFA 4DPPA 1FY6A 3O6DA 2ZZ7A 4O18A 3JR2A 4JTLA 2XN2A 3EX4A 1TCDA 2C6QA 3NPUA 4OV9A 1ZY9A 1GEQA 4TO8A 1QOPA 4MLJA 4ICNA 1YDOA 4O19A 3P8JA 3DI1A 1TJRA 3PBUA 4Y96A 1RQBA 4NJJA 3LHZA 1TIMA 3NQFA 4UTJA 3SJ3A 3W73A 3GLCA 3HB9A 8TIMA 3IIOA 1SO6A 1VLIA 4ZL1A 2BX7A 2NV2A 5K7JA 3FKRA 1M7PA 2FPTA 1VS1A 1QPOA 3D0CA 4LU0A 3W7MA 1TPUA 5F4SA 4RR4A 1W8SA 1T8XA 1OG0A 1GG0A 3W7JA 4LY8A 1TPDA 1GZGA 1AMKA 1VR6A 4FO4A 4NU7A 3QW4B 5HULA 3B4UA 2YSWA 2R91A 1Q3NA 3I65A 2QDGA 2XN0A 1J2WA 1JCMP 3M41A 2VEIA 3NR0A 4N9EA 3W1TA 3NDOA 3KRSA 2Q3OA 5L6UA 2J6XA 1SW3A 1O5XA 3QSTA 1S5TA 4ADSA 3NXFA 1GYNA 2R94A 4ORIA 3W1UA 4JTTA 3MP3A 5HR6A 4Y9AA 3SGZA 2V82A 1K8XA 1Q6LA 4LVDA 4WXYA 5F2GA 2LLEA 3HPXA 2J9ZA 3STEA 4LNYA 3W86A 4GUHA 3GDTA 2YCEA 2CZDA 3W7QA 2JKAA 1T0OA 2QJIA 4M6VA 3CWOX 3FKKA 3NQDA 1YTKA 2YR1A 1ADOA 1MO0A 5LGZA 4O12A 2C18A 2V30A 1HUVA 2BTMA 4O1CA 3M6YA 1I2NA 2GPTA 4IXXA 2JGYA 3ABRA 3WJZA 1FDJA 2TPSA 3HQ1A 4N9CA 1N7KA 1H7NA 4RZ4A 1ICPA 1JJKA 4LC6A 2ABAA 2TSYA 2QCLA 3BVJA 3E12A 3BK0A 3GAYA 4AEOA 1LCOA 3QQ0A 4R33A 5CKSA 4HNUA 1K8YA 2GQ8A 4GJ1A 4OBTA 1XBVA 1VYRA 2ZZ2A 1QR7A 3NQVA 5DLCA 4CCDA 5LZLA 3W75A 4UFIA 1P0KA 3ABSA 4WOZA 3GK0A 1J5TA 4QIUA 5BNKA 4ALDA 2A21A 3LBMA 2A7RA 3B03A 4HSOA 1R2RA 1YXYA 5D32A 1XKYA 2ZZ3A 3M47A 4C1LA 3LCLA 3EXSA 3QZEA 1G69A 3HJZA 1X1ZA 3HG4A 1TREA 2ZBTA 3QJAA 3UNDA 3Q94A 2ZA2A 4RLIA 1QAPA 2ZTKA 3W7OA 2YFOA 1G7VA 2B0MA 1ME9A 2QCDB 2C15A 4JDYA 4AB4A 3CQ0A 2P0OA 1TQJA 1FWWA 1AW5A 4CNNA 3UPWA 3I6RA 2F7FA 2V2HA 3P81A 3PM6A 4WUIA 3PUEA 3M7WA 2ZA1A 4U28A 2NUXA 3L0NA 3QH2A 4AMAA 1FBAA 5LNWA 3B06A 5AB3A 3FFSA 4N4QA 4S2BA 4CQ8A 4Q33A 3C4UA 1WA3A 5BW6A 1H62A 1UBSA 3CIWA 1F5ZA 3BG5A 4HN4A 4ZQOA 4AH7A 3PG8A 3G1SA 4IPJA 4MFDA 5AHNA 1F6KA 1H61A 1R30A 2JKEA 2EKCA 3EX3A 3S0CA 1GQNA 4EOUA 2QR6A 3DFOA 5G4EA 3F4WA 4NXSA 3DU0A 4NZJA 1KW1A 5D04C 1KM2A 1W5MA 3LRKA 3GZ3A 1IXQA 5CPMA 4BI7A 3TW7A 3W76A 3HO8A 3QEZA 3STFA 2YDAA 4KWVA 3LDVA 2NLIA 5J5DA 4N6EA 4BR1A 5AC8A 1K8ZA 1P4CA 4ZVJA 3F03K 4ORMA 3KHJA 1FDZA 3O6CA 2GVGA 2V5BA 3KVLA 1P5BA 4UFMA 1Q6QA 3P7YA 3VE9A 1YPFA 2Z6JA 3LRLA 1IXNA 2CFFA 1D3GA 2HTMA 3GNNA 3S5OA 1VPXA 2RH9A 3STGA 5F2IA 3CEUA 2E6FA 3OG3A 3C52A 3USBA 3C8FA 1AG1O 2GVJA 4RX0A 5I3IA 4HHPA 4IMDA 4XBKA 3FOKA 4LV4A 4BF9A 5FF2A 2A5HA 4FB7A 1JCJA 4CCCA 4PC8A 4H4IA 5AHEA 5CG7A 4LUJA 2EF9A 2YFNA 3SSJA 2EGZA 3G1DA 3KOFA 3NOEA 2H3DA 3B0VC 3UD6A 3IVUA 1M6JA 1JQXA 4I9AA 4UMAA 1ZAIA 2C14A 1SZGA 3W3OA 3EX2A 1TTIA 3W7GA 1H60A 4MY9A 3W9ZA 5G1YA 2XN1A 5D30A 1ZENA 3P62A 3GR8A 4MYXA 4X3ZA 1TO3A 5DELA 3TSBA 1YTDA 1QO2A 1JQVA 1WDWA 4WJEA 4CQ9A 4LRTA 1PHWA 3DBPA 3NL6A 3S1WA 2GVLA 3EWZA 1HO1A 2DZXA 5AYZA 3DGRA 4LV9A 1XM3A 5D09A 2B4GA 2I1OA 1HL2A 1QFEA 1RV8A 4A21A 3MMTA 3MHFA 4UNLA 1LBLA 4XZ9A 2PC4A 4E2DA 2WSRA 1EWDA 3FA5A 5F1VA 4O11A 1ALDA 1OFBA 2V2CA 1XFBA 4LUIA 4JIPA 3WK0A 4RV8A 2RFGA 5AYXA 1QO5A 3PULA 4PODA 2VELA 3W71A 5HWJA 4PCFA 4CQAA 4K36A 4JTGA 1A5AA 5TBOA 3W7DA 2WNQA 4FHAA 3TA6A 3CTLA 1H50A 1WOBA 4FX8A 5I3KA 3G1VA 5AN7A 4M19A 1VZWA 3MHUA 2DZVA 1KFKA 3ELFA 5BMWA 2FPVA 4UUIA 4K8HA 1OFOA 4O28A 3HGJA 2X1RA 4D2JA 4YLWA 1KM3A 1TV5A 4QISA 3FJLA 4AWSA 5K9CA 1SSGA 2QCEA 3U8GA 1AW1A 3ZFHA 3TQ0A 2FPYA 3O05A 1L6WA 4JX5A 1KM0A 4MFEA 4OHQA 1RQEA 4A3UA 4GUIA 2OZ0A 3W1AA 1K03A 1QPRA 3SECA 3W84A 1H7RA 2ZRYA 1SSDA 2J88A 3NQ6A 1DOSA 1MEHA 2ZZ6A 3UWYA 4PL1A 4P61A 1X6UA 2H3BA 5TIMA 4JICA 3T4CA 5LHEA 3NQMA 3Q37A 4FIRA 2QCCA 5F4XA 4K7YA 3L2IA 3BPWA 1O94A 3P61A 3DXIA 2J24A 1SU5A 4ONVA 5E0KA 3LB0A 5FF4A 5I3FA 5FEZA 1H7OA 4JDBA 3MP4A 1VYSX 1T96A 1R46A 1RZMA 3TNOA 2C0AA 1YTEA 1A5SA 3T78A 1DVJA 3H55A 3LM7A 3HBLA 2Z1BA 3TKFA 4EWND 3E49A 2WPBA 4OQVA 4K37A 4ADUA 3RK8A 2QUUA 5D2VA 1PIIA 1ONRA 4OU1A 2HMCA 3W7NA 1YXDA 1YDNA 1GVSA 4JYDA 1TPEA 2HS8A 5CPLA 3KFTA 1TRIA 2J9XA 1FQ0A 4C1KA 5DBUA 2BXVA 4IX2A 2X1TA 2E68A 3ZS4A 5IM51 4O0KA 4MZ8A 2NX1A 1WX0A 4ZQRA 1CI1A 5I3JA 4X9SA 2VEKA 3L66A 3TH6A 1S5WA 1X1OA 3GKAA 2NXGA 2E6AA 2A6NA 3HGSA 1KFLA 4DF1A 4GFSA 3M5VA 3UWUA 4E38A 4JN6A 3PUOA 4AVFA 4RZ6A 1LLWA 3LRMA 1SZNA 3MP5A 2NXIA 5EY5A 1O5KA 4R7JA 1G6CA 1B57A 1FCUA 5HQEA 2VENA 4IMGA 4UTIA 1MXSA 3GDLA 2RHGA 5GVJA 1I4NA 3O8AA 3DFNA 1RR2A 3ANYA 1EP3A 3W85A 1KM5A 1KM4A 4QQ3A 3DKJA 4O8RA 4NJHA 1XUZA 3I7RA 3E02A 2P1FA 4UTLA 2E5CA 5G1TA 3KXQA 1IIHA 1AL7A 3QM3A 2B7PA 3TFCA 2X1UA 5C55A 3TJXA 2CLKA 5D38A 5E93A 3RFAA 1KLZA 1L2UA 1OFDA 4NZFA 5G2WA 5CZJA 4FNTA 5LNVA 1SO5A 4NXKA 4O50A 4UTUA 5CSSA 1TSIA 4AWTA 1TJPA 2NUYA 3B05A 4Z08A 3P67A 4N9BA 3IIVA 1K3UA 3N2XA 5FESA 3QMTA 4I7UA 4O1BA 4JY8A 4UTTC 1G4PA 1FDYA 2Y7GA 3QPZA 4LT9A 1QPNA 3P74A 1IF2A 3E96A 3MBFA 4WY0F 2FTPA 4MYAA 4ADTA 2VFFA 3TMLA 3W87A 4O54A 4Y6GA 4P2VA 3R5EA 3BV4A 3NQ8A 2NUWA 3EX6A 1E51A 4HSNA 3LXCA 1VCVA 2ZFAA 4GE8A 3MYPA 3W7IA 1H7WA 3SGUA 2ZRZA 2YZRA 1SFJA 3PC0A 2W79A 4QITA 1DHPA 3LCHA 3HGOA 3NL2A 3W7LA 1K7EA 1OJXA 2EHHA 4Z1BA 4UTTA 4EVZA 4PTNA 5KINA 4FXSA 4ZZ9A 1KA9F 4O14A 1EIXA 3C0JA 1ZNNA 1TPWA 1YLVA 1KBIA 5DN1A 2CLMA 2Z0IA 3TR2A 1MSSA 4YCPA 1V5XA 2E77A 2HSAA 3FYPA 1AL8A 3EXRA 4PFMA 4GUGA 4JTUA 3PSWA 4MZYA 1DV7A 1D3HA 1IXOA 4K6AA 3H54A 4XWUA 1W5NA 5G5IA 4QJ1A 2DORA 3BGGA 3M9YA 2FFCA 1IGSA 3DENA 1WYIA 3O6YX 4CLMA 4X2RA 1W1ZA 1ZAHA 3IIPA 4A22A 3C2RA 1X7FA 1OF8A 2C19A 5EMUA 5K9DA 1KTCA 1VHNA 4NVTA 2FDSA 4O15A 4UXDA 3PB0A 2NWSA 1JCXA 1UUMA 4IWWA 4IXHA 4JTHA 3MI2A 3OVQA 3CIXA 1H63A 4HNTA 3HF3A 1XDLA 5KZMA 1Y0EA 1ZFJA 3KVMA 3EB2A 2E09A 1TQXA 2QCMA 2X2GA 4W9TA 4MLRA 1J4EA 3IV3A 2VFHA 1D9EA 3NZRA 5F1UA 1KM1A 7TIMA 2WOQA 1QWGA 2QJHA 3QF0A 1VC4A 4XUGA 6TIMA 2WSYA 1JULA 1H51A 3W7EA 3TSDA 2X1SA 3IGUA 1H5YA 4LVAA 2FIQA 3B04A 1DBTA 3SY5A 4L4MA 4Z1AA 1NAL1 1F2JA 3IRDA 1OX4A 1TPC1 4WD0A 2DZPA 1FXPA 3LHUA 3W2KA 2OT0A 5D02A 1W5OA 4JYEA 1VCFA 3TMQA 3UPBA 2H8XA 3VCRA 3W07A 3CWNA 2GJNA 3L5LA 4AHPA 3LTYA 5DCEA 2JGQA 3MUXA 1LROA 2FJKA 3M5ZA 1XDMA 1OVDA 3OIXA 3WJXA 5EYWA 1P0NA 1WQ5A 3IIXA 1W31A 3G1XA 2HS6A 3QSRA 1SO3A 1CX9A 1RQHA 3LV6A 4PEKA 3A21A 3W2UA 3L5MA 1VYPX 2V8ZA 3PB2A 1P1XA 1O60A 3NGJA 3SZ8A 5EPDA 3M44A 4JX4A 3N34A 4FNUA 5DCBA 1SW0A 1LDCA 3NNTA 3W2JA 2Y7EA 1JRBA 2JKPA 4QNWA 3S9YA 3LLFA 3PBVA 3GR7A 3NZ1A 3S6DA 2QCNA 1OK6A 2I9EA 3A22A 3R12A 4DBEA 2NZLA 5I3HA 3AO0A 1JR1A 4JNMA 5DXXA 1PHQA 4NNBA 5BOOA 3N9SA 3PS7A 3LHVA 1H7PA 5LSMA 1GT8A 3S1XA 3LTPA 3NO5A 1K7XA 1TTQA 2QF7A 1VLWA 5LHFA 1TYGA 4H6KA 1JCNA 3W1MA 1GG1A 3CEPA 2R8WA 1TPVA 4O10A 1AK5A 3P5YA 3LV5A 4O1DA 4AF0B 2VFDA 3CHVA 2WKJA 3M5YA 2FB2A 1IXPA 5SWUA 5CPOA 2WQPA 4LOCA 2QAPA 3HMJG 1W3TA 3GDKA 1NSJA 3HG5A 5D03A 1M7OA 1THFD 4ZQCA 4KFOA 3LHYA 4B5NA 2A1YA 4G1KA 1C8VA 4MIMA 3WK3A 3U2OA 1GVOA 4DXVA 2H6RA 5D2XA 4M7SA 1LRNA 3PAJA 5HINA 4M6QA 1UASA 3G18A 5LNUA 4YCOA 2RKXA 3S8HA 1TV7A 3EWUA 3SW6A 1TPB1 2WNZA 1BTMA 3PY2A 1LZOA 1T99A 3VE7A 3O15A 1LYXA 4QSHA 1VJIA 1GVFA 2Q8ZA 4OGZA 1GJPA 3O16A 5HUOA 3SIZA 4QAIA 3GX9A 4M6PA 3WJWA 2DJXA 5DXYA 1ME8A 4AF0A 3NQEA 2CLIA 4UCGA 2VKZG 4KFNA 3KRZA 1SZEA 3LCGA 1AW2A 3P5ZA 1EP2A 1FUYA 4UMBA 3TV8A 1KTBA 2QCHA 3KVKA 4UR7A 1NFBA 5FEPA 5U4NA 4JEQA 2B7NA 3M0ZA 3N3MA 2QAFA 3TX9A 2ZRXA 1XXXA 2DP3A 5EL1A 2W0UA 4OE7A 3UWQA 1BEUA 1TRDA 3PF3A 4NX5A 4N02A 2ZQ0A 3CC1A 1I2PA 2Y88A 2J9YA 4GBUA 4MVAA 3M43A 3S5YA 1M5WA 1Q6OA 1DQWA 3W7PA 3L0GA 2Q3RA 1H7XA 4BFAA 4O13A 3GXNA 1EB3A 3S1VA 2DU2A 5AFDA 4IGHA 1QPQA 4JYFA 3LI0A 4FIQA 3FYOA 3FLUA 3GDMA 3UZJA 1KV5A 3BG9A 1FX6A 5KTLA 3FEMA 3IIZA 2Y7DA 3DFSA 5CZ0A 1I2QA 1ML1A 4PA8A 1PS9A 5K9XA 4JIQA 6ALDA 1OF6A 4MKNA 1LORA 1BWLA 3BARA 3MJYA 2V81A 3TK7A 4UTHA 3C2OA 5HWMA 3EXTA 5FF3A 2C3ZA 2EPHA 3AJXA 3R2GA 3ATZA 1HO4A 2C16A 3G1FA 5G2IA 5U7SA 5FF0A 3L0KA 3LERA 1O4UA 3NPVA 5D2YA 4PH6A 2Y85A 2WNNA 1PE1A 2GUUA 3G8EA 4JTEA 2TYSA 1C9DA 3DKLA 2ALDA 3BLFA 2AGKA 1OX6A 3CU2A 4GUFA 3TW6A 2JK2A 3W70A 3CT7A 4DO4A 3W1PA 1JRCA 4MY8A 2VOMA 2KZHA 3GXTA 1G4EA 1X8FA 1TTJA 2ZRUA 3TDFA 5J5RA 3S1UA 3HGRA 1SQ7A 4EIVA 3GKFA 5KSWA 3PWAA 3GXPA 1G4TA 2ZZ1A 2BSLA 3IGSA 2DZUA 3NVTA 4MUZA 1L9WA 3KX6A 2ZA3A 1WV2A 3G22A 1A50A 2ZZ5A 4FNQA 1U83A 1OHLA 4S1FA 1MEWA 4Z1CA 3MO7A 5CGQA 1O95A 3M16A 4O52A 1OYBA 3RMJA 3NQCA 3HOJA 4AXKA 4DBDA 5CZTA 3UZ5A 4WX2A 5AHFA 1MZHA 1OFPA 4OV4A 1F76A 2D73A 5F2LA 3LCFA 2X30A 4AWUA 3W2LA 3N73A 3UWWA 5BRBA 2QEZA 1Z48A 2Y70A 4K8EA 3CLMA 1L6SA 1OFQA 3C6CA 3RF9A 3TFXA 3NPWA 4HT3A 4JTIA 4IPIA 3BLIA 4UFKA 5K3VA
chains in the Genus database with same CATH superfamily
3TSMA 1J18A 3MS8A 4EF8A 1GJUA 2F8QA 2EPNA 2CHNA 4JKLA 1I2OA 4ENLA 3N2OA 4OJYA 3VUSA 2VZOA 4XUYA 4KKXA 4LBSA 5EMLA 1RHCA 4S3BA 3A4WA 1OIMA 1JPKA 1KFCA 4XAYA 2ACUA 5D9NA 4B2DD 4MAVA 3IJ7A 3F4DA 2CBIA 5IBXC 4DPQA 4FLSA 4A05A 3F2DA 4YTRA 2W5FA 2GQ3A 2DT2A 3UA3A 4I3GA 2WSPA 3PANA 4KEMA 3LHWA 1OB0A 3RIKA 1JPMA 3TTQA 2CIPA 3HG2A 4REQB 1W8GA 3JUGA 2XIJA 3UY7A 1FCBA 5I23A 3GHUA 4XZWA 5FL1A 4GACA 2CPUA 1EX5A 3NM1A 4GZJA 4UBPC 3ZT6A 4FXRA 5LNRA 1YRRA 4PSRA 5IBXA 1SR0A 1C92A 3POHA 5EBUA 4H3DA 3L7RA 3LGEA 3RN6A 5A5WA 1K02A 3ECQA 3P84A 2P10A 1A80A 1BPLB 1IR1A 3VFLA 3H22A 1E6XM 1JPIA 1BVNP 2BV9A 2KAUC 1X6NA 4JTJA 5REQA 3H2CA 6TAAA 2NQHA 1PXGA 2YDQA 3GIPA 2NQ5A 2DVXA 2ZC1A 1J6OA 1I1WA 2G97A 1M04A 4ZR8A 2YXXA 3IUIA 3U5YA 3VGHA 1PCWA 2Z1VA 3QGAC 2JF6A 1TWDA 1V6XA 3I10A 3DH7A 2X16A 3PZTA 4I5RA 3VPLA 4R5EA 3B3DA 4X0VA 3H7RA 1F73A 1EBHA 4IFKA 3KOZA 1MDRA 3VM7A 4DI9A 2NV1A 3KBNA 2ZVRA 3INPA 1SFSA 2PDQA 4UFLA 4PBFA 1HXJA 3W26A 4Q32A 3R0KA 4R7OA 2PRMA 3LTSA 3LUTA 3STCA 1JYXA 3GVQA 3MKVA 3R0UA 2YXGA 4BZYA 4ZMGA 3T05A 1I0BA 2Y63A 4GGHA 1CXIA 4L6DA 1UJPA 3VIGA 3QQ1A 2ZUTA 3TJIA 1JDDA 5C6MA 4FALA 3UCDA 4HK5A 4Q8MA 5KEZA 4W87A 3FSUA 1RY0A 3QGKC 3AHZA 1ICQA 4GC3A 4NT0A 1WBHA 1LRQA 3AC0A 1VJZA 5E0FA 2INFA 4RXFA 2Y62A 4Y9MA 1GOWA 3NEVA 1E9YB 3C2FA 2TRSA 2OJPA 2PE4A 3FDGA 3GW0A 3ZIZA 3NAVA 1FH8A 4JFWA 3TC7A 1Q6EA 4QDPA 4S2CA 3ARQA 3B8DA 3VILA 2BG5A 4X22A 1L6YA 2A7NA 3ZJKA 3IACA 4LB3A 2PDJA 3HQOA 3L12A 3IK4A 3WJSA 2GOUA 1BRLA 5T91A 3QYSA 3IGHX 3NQ7A 4JQ1A 1PKNA 2PDWA 1SJBA 2OZTA 3NQAA 3PUDA 4E4FA 4Y8FA 4HZ7A 3N04A 3CHFA 1B9BA 4OKDA 4DYJA 1XWYA 1VEOA 3AYVA 4DBWA 3QBUA 2V0TA 3ZR4A 3WNKA 3SIMA 2CKRA 1OWQA 2WJZA 1Z32X 4WDTA 1TV3A 5CAHA 3EZ4A 3F2CA 1SPQA 1C8XA 4NUWA 1DQXA 3VNKA 3RXZA 4NNCA 2WMIB 2Q8LA 4IMEA 4NAEA 4I6KA 4LC8A 2GUYA 1PKLA 2Y5SA 3JU2A 3WD1A 5FIPA 2CZ5A 1W1PA 2W62A 3HPZA 2UV8G 1RBOB 4W89A 3LOTA 3ABXA 4RXGA 3F5JA 3EWYA 1FTXA 2Z1KA 3H70A 2E6YA 3ES7A 4NI8A 3QN3A 3N6HA 3EB3A 3GFZA 3I3EA 4H7CA 3W53A 5FSEC 4EF9A 2X42A 4H8UA 2Z28A 2Z27A 2GJRA 4KF1A 3GDRA 4YL2A 3V0UA 3FJ6A 1A53A 3P3BA 4FNPA 3S5ZA 5H2ZA 2PWUA 1GJWA 4TX6A 4Q8PA 2I7GA 4NJKA 1SJCA 2X1IA 3ANVA 1K1DA 4E3VA 1H41A 2ZCGA 3ITLA 2ISDA 3MDWA 3SJNA 4IMAA 4QXIA 4JS3A 4LUSA 1XC6A 2NT0A 2QCDA 3W1RA 3H2MA 5DCDA 3QPYA 4LGXA 3C2VA 3EEGA 3GVGA 4UR8A 2A4AA 4AY7A 7TAAA 2E9BA 1UH4A 5LXEA 1XIBA 3IPWA 1E6NA 3ITYA 4DM2A 4Z1DA 2BODX 2WHLA 3TJLA 1TIWA 2PA6A 4GOAA 3T0TA 3THAA 1FWNA 1ICSA 1KFWA 1V0LA 1ZHAA 4QE4A 2IS7A 4Q6XA 1EA0A 3JRKA 4JR5A 1ZRQA 3GB6A 2RDWA 3K30A 4F66A 1E15A 1F6PA 1VH7A 3MCOA 4AXNA 6CGTA 3RNDA 3POCA 1Z7AA 2D0HA 2VFIA 1ITCA 4AD3A 5CJMA 2XTKA 1W3LA 4L6HA 1XGZA 5A2AA 3B8WA 1JL8A 1FWSA 3T2PA 3R8GA 2YW3A 1KLYA 4MJZA 3FAWA 3IVSA 4BEQA 4O8AA 2DV0A 3NYDA 1FWTA 4MNMA 2FVLA 4D6FA 1XYMA 2DQXA 2V2DA 4DO6A 2E6DA 3UU0A 1RA5A 2ZXDA 4PFHA 4XZNX 1A5BA 1XUUA 3LG3A 4JXCA 1SJAA 2GYIA 3L21A 3MWCA 2VEMA 4JOMA 3NG3A 2OCZA 3WDIA 2FYMA 4KWWA 3TQPA 3WDHA 4DBUA 3PUGA 2IMRA 1R0MA 4FXJA 1KCKA 1UJQA 2R1KA 1XRFA 2EPMX 4OBSA 1UKPA 2R14A 4AD4A 2OEKA 5B80A 5AYBA 1JIBA 4CN4A 2EAWA 1DJIA 4UFJA 5HWNA 1X38A 1CXEA 4LS0A 1GTEA 4F2UA 1W1A1 2XGIA 1EHNA 4ZCWA 1HJVA 3G1HA 1FWBC 3O06A 3MA8A 4A35A 1TJ1A 1RA0A 3MI6A 2XU2A 3C3NA 1QUMA 1IV8A 3I6TA 3WNMA 3IEBA 3F7JA 1NWSA 3N29A 4E2BA 1AQ0A 3N14A 3FK4A 3GC5A 2J27A 2J25A 3TQVA 1KFEA 2XFRA 2Z25A 3C2YA 4GBDA 2GJLA 2PURA 1HF6A 4MNJA 1CW2A 3E0IA 1RJPA 3DHFA 1C3FA 4GH3A 4MG4A 5A6MA 3L68A 4GVGA 1W0MA 3T42A 4JD4A 3TN4A 5ABFA 4JTKA 1PV8A 3CV1A 4DUVA 1OZQA 2ZUSA 2VO5A 2WNWA 4IG2B 2D2HA 2BGSA 2PWHA 1VQTA 3W22A 3EBVA 1HFBA 3TCSA 1U5JA 3VNIA 1S38A 4XZMX 5I09A 4HQVA 5IFPA 1XGDA 1PSCA 1M53A 2ZDRA 4JQAA 3VIIA 3OHIA 2FKPA 3WD3A 1ZJIA 4PTVA 1ODUA 3NOYA 4ML9A 3W83A 1MZRA 2PU0A 5JU6A 2QV5A 3HFYA 3W1QA 1SZRA 3P82A 4E4UA 1CGVA 2H90A 1OY0A 1UQZA 2FFIA 2YLAA 5KZ6A 2YA0A 3MMUA 1UUOA 1NF7A 4IP7A 5AYYA 5LIXX 3ARPA 5EA9A 3THQA 3WFAA 3U3HA 3SI9A 3VCCA 1R3YA 3UW6A 1IIGA 2PCEA 4AG0A 2QCFA 1W56A 1UZ4A 1L8PA 2PLKA 1F05A 1EBGA 2YYUA 3TZFA 1DXIA 2PEVA 3WBEA 2DZSA 1XBXA 4C6MA 3G3MA 1XP3A 2XGZA 3TXZA 2HBXA 2IKGA 3P0XA 3ZMRA 5XIAA 4R53A 5EB8A 4WGXA 2R1NA 3ARZA 3OGVA 4ZGYA 3O6DA 1D8CA 2ZZ7A 4PMJA 1E9ZB 3PPHA 1TCDA 2C6QA 1PKMA 4LEFA 1GEQA 1MW3A 1QOPA 1E3ZA 4MLJA 1YDOA 5DMYA 4PCTA 1TJRA 1Z69A 4YIWA 4NJJA 1EEXA 4ZSTA 1DIKA 3NQFA 4HYRA 1VIWA 4UTJA 3SJ3A 1KGWA 1A4LA 8TIMA 2AL2A 3FY1A 1QJWA 1VFHA 5BXSA 3FKRA 1M7PA 8A3HA 4H9MA 2WK2A 3GE7A 4IPPA 5BYWA 3W7MA 4CU6A 4HMDA 2Y5EA 4RR4A 1T8XA 1GPFA 1GG0A 1YHTA 1A49A 4LY8A 1W9UA 3FVDA 5C0QA 3FEQA 5DRIA 3WEZA 1MMFA 2YSWA 4WVXA 2GWGA 4YTUA 4CNTA 2PTWA 1R3TA 3HZ3A 2VEIA 4KRZA 4ZTXA 4S3AA 3LZ3A 1R9YA 3NDOA 3KRSA 4C7GA 4C6BA 3CPGA 4ADSA 3MP3A 1J11A 3NQBA 2VVSA 2PZNA 1Q6LA 3VKAA 3AS0A 2WVSA 2FZNA 3GWQA 1YNQA 1V7AA 4BF7A 4GUHA 1P7TA 4KIRA 3GDTA 1UOKA 2YCEA 1KO0A 2VRKA 2QJIA 1E56A 4GPNA 1KQZA 2Q6ZA 1NJJA 3RCYA 1MO0A 4V15A 4CD5A 5LGZA 2O92A 1B3ZA 2C18A 2BTMA 3O0KA 1JZ3A 5AKQA 3QFWA 3FXGA 2AMGA 4ZB5A 1T5AA 3HQ1A 1UG6A 1N7KA 1H7NA 2D1ZA 1ICPA 4LNCA 1JJKA 1AVAA 3S83A 1E55A 2B31A 1B3XA 2ABAA 3E0LA 4ROPA 3TJ4A 3E12A 1V77A 3VIMA 5CKSA 1UKOA 4LB4A 1K8YA 2I5GA 2QMJA 2GQ8A 1EOKA 4GJ1A 2YIHA 1VYRA 4IGSA 5LZLA 3N25A 1P0KA 1WDDA 4LUTA 4WOZA 2D22A 1J5TA 4QIUA 5HNTA 3D3AA 4XZLX 3LBMA 7CGTA 2D23A 1PAMA 2PC8A 4W88A 3M6DA 4YVVA 3RMEA 1PTGA 5FJUA 3NZGA 4HYVA 3SGGA 3UG8A 1JYWA 4HA4A 3HJZA 3R6IA 2X09A 2XJ7A 3AMLA 3K4DA 4CD6A 4HCDA 3MMDA 3Q94A 3UNDA 1FWJC 2ZA2A 1QAPA 2ZTKA 3W7OA 2NT1A 2ZWYA 1DPMA 1ME9A 2QCDB 4AB4A 4AX6A 2P3ZA 2P0OA 4IT1A 3PM6A 3EKGA 3PUEA 3IJDA 2NUXA 1AZ1A 1XIMA 3L0NA 4AMAA 3UXKA 5AB3A 2VHLA 3GG1A 1DXEA 3CZKA 5I7GA 4QJ3B 4F40A 1VEPA 3C4UA 3RPDA 6XIMA 1E6SM 3RR1A 3BG5A 2HJPA 1QW9A 4HN4A 4ZQOA 4AH7A 4K2SA 2G50A 1K70A 2JKEA 1JZ8A 3TVAA 1GQNA 1UPMB 4Q4PA 1HW6A 4DJDA 4Q8WA 1IXQA 5HMFA 3TW7A 4HMCA 1MQRA 3QEZA 5ABEA 4PN2A 4KWVA 4X0NA 2BHUA 1QRQA 4J40A 2VGBA 4S38A 2NLIA 4BR1A 3K46A 2GJXB 4ZVJA 2MANA 4LJ3A 1PX4A 3DECA 2V5BA 4UFMA 2CESA 2D2OA 4PR4A 4MKVA 2Z6JA 2ZIDA 1WPCA 1D3GA 3GU2A 5F2IA 3WH5A 1FRBA 3PJTA 4DM1A 2YA2A 3C52A 2PDGA 1BQGA 2PF0A 2PDUA 3FOKA 4E8GA 4IICA 2A5HA 3GH5A 4CCCA 2OEMA 5AHEA 8RUCA 1QASA 2VMFA 3G1DA 3KOFA 2IPJA 2VZSA 2HVOA 4PRRA 4UMAA 4BKNA 5FJTA 3QLDA 4CN1A 4HZ6A 5BXPA 3OVGA 5G1YA 2XINA 3FAXA 2I17A 5A6KA 2WYSA 1H49A 4GNVA 4PB4A 2R1MA 1JQVA 2A79A 1WDWA 5DFAA 3MKCA 1LT8A 1I9CB 3AXXA 1C7SA 4LV9A 4TXEA 4QEHA 1MUMA 1R7AA 2I1OA 1HL2A 1MW1A 2XSBA 3MHFA 4H01A 1R3WA 4DJEA 4LYKA 1M3UA 4YJ5A 3VMOA 3WK0A 4RV8A 4H9ZA 1E3XA 4WR3A 4DVOA 2WVVA 3ZOAA 4PODA 1RK5A 2VELA 4Z1YA 3W7DA 1EQPA 1TFVA 3OPSA 2Y2WA 3S6TA 2IKIA 2WM1A 1ONXA 4FHAA 5CC3A 2HWGA 5I3KA 4HA1A 4TTUA 2WVTA 3MHUA 2DZVA 3GC4A 3KBVA 3T2OA 1EDQA 5ABFB 4QLLA 1V79A 1W1VA 5CPQA 4H6QA 3GM8A 4U2ZA 3S2MA 3DHPA 4LAKA 3QR0A 2QCEA 3U8GA 4RV3A 3PTMA 1AW1A 1HGWA 4JX5A 4MFEA 1RQEA 2YLLA 4F0HA 3W1AA 3LS9A 3SECA 2XG9A 3XISA 1GVYA 3RPTA 4Q8TA 1DOSA 1EX1A 2AL1A 3UWYA 1XIFA 4H2HA 2Z1SA 1US3A 5A94A 2D0GA 3ZSSA 3T4CA 5LHEA 3A9BA 4FIRA 2YDRA 3OBAA 2O9OA 4NIRA 1C8YA 1O94A 2J24A 1SU5A 1H3GA 3BZGA 4OBRA 5FEZA 1PWMA 2WMGA 1H7OA 1VYSX 1A0EA 3LK6A 4PUDA 1RZMA 2C0AA 3H55A 3K8KA 3TKFA 4GI9A 3DDMA 3QVQA 4ADUA 1Q2RA 3RK8A 1CXLA 2WLZA 3NDZA 4ZOCA 3W7NA 1YXDA 2PZ0A 2HS8A 3SBFA 3H2NA 1DIEA 5IM51 4ZFMA 3CO8A 5I3JA 3L66A 4Z2LA 3TH6A 3QV6A 5B7ZA 3GBEA 2QVHA 2MNRA 1KFLA 2DIEA 1UWRA 4GFSA 3UWUA 4DUXA 5HJYA 1W1YA 4RDWA 1LLWA 3LRMA 1SZNA 4AYSA 3BUVA 1CGWA 1VEMA 3UETA 1T41A 1FCUA 2VENA 5HPCA 1LF1A 2RHGA 1K77A 1I4NA 3DFNA 4GHRA 1E43A 4H9TA 2XZ9A 4Z42C 5A6LA 1B9ZA 3GO2A 1NDYA 3E02A 2E5CA 1U30A 1XLFA 3QM3A 5I00A 2X1UA 5C55A 3ARSA 3RFAA 4S3KA 3B9AA 5CZJA 3AYTA 3ZSTA 4BQ2A 1A5UA 1TSIA 3W29A 3P67A 3USZA 4Q4OA 4R7WA 5FESA 3QMTA 4AIBA 2DUXA 1G4PA 2Y7GA 5DQPA 1QPNA 1Y8BA 3E96A 3IARA 3UVIA 2J7DA 3MBFA 4QROA 3KE0A 3W87A 4UWMA 3HM7A 3SRDA 3MSGA 1E51A 4J3TA 3QQWA 3SRFA 1B5TA 4Q3MA 2ZFAA 3W7IA 1P7TB 4QITA 3HGOA 1K7EA 1OJXA 1B3YA 2FZ8A 1JF6A 3CTTA 4UOZA 4GJJA 4K1GA 3UG5A 4FXSA 4W5UA 2ZOXA 1A5NC 1REQA 3VX1A 1YDYA 3PJUA 3IJ8A 2Z2AA 3GNXA 3OQ8A 1I6NA 4RNFA 4LALA 4TOQA 3TYUA 1YPXA 1FWCC 3MUAA 2FZMA 3BXWA 3PSWA 2Z26A 3CAQA 3HURA 1ZCCA 1TJ0A 3BGGA 3OLEA 2E40A 2FFCA 3KZPA 3FYYA 3RG6A 1VAHA 1VRXA 3L4UA 4CLMA 4DJDD 3ZVHA 4ACZA 3IIPA 4QG9A 3C2RA 3RLGA 1E5JA 1X7FA 1XYCA 2OXNA 1VJSA 4NVTA 2FDSA 4M81A 5A1AA 4UQ9A 5FCZA 3H4WA 4IXHA 3MI2A 3CIXA 4WJ8A 3ITXA 1G0CA 3HF3A 2ZDSA 3SN0A 3CL6A 1WCGA 1Y0EA 1ZFJA 4P7OA 1J2BA 3EB2A 2E09A 1EGMA 1TQXA 1CXFA 2YBUA 1D9EA 2DH2A 3NZRA 1KM1A 3W6LA 2WOQA 3ZR5A 1HKMA 4DAIA 1JULA 1H51A 4DY1A 1ZPTA 3TSDA 2YL8A 3IGUA 4LVAA 2ISFA 5JXQA 2FIQA 4GCXA 3PTDA 5GNYA 3KCLA 1DBTA 4N0RA 5G1MA 3PTKA 1JGMA 1ZBWA 2PBGA 1W5OA 1JG9A 4JYEA 4EAYA 3WO8A 1UR2A 2WXDM 4GJIA 2GJNA 4AHPA 2JGQA 1TWSA 3VNYA 1BF6A 5T9CE 2ZUVA 3CO4A 3DGBA 1NWTA 1GORA 1CX9A 3E5PA 4F0SA 4WHBA 2YOCA 4JTCA 4US6A 1O60A 1NDWA 1EA9C 2FZBA 5FJPA 4DJED 4FNUA 2J79A 1SW0A 1LDCA 3NNTA 4XVDA 3W2JA 2A3LA 1UP3A 3LLFA 4ZENA 4E6MA 4Z2JA 3PBVA 3NZ1A 1XCXA 2H9AA 1OK6A 1DWAM 3UR7A 3SSZA 3R12A 4NF7A 3VGBA 2NZLA 2DIJA 3AO0A 5M17A 1FHLA 4B4FA 1JR1A 4JNMA 4CD4A 3R7MA 3OZOA 5BOOA 3N9SA 3PS7A 5LSMA 1PO9A 3S1XA 1ZP4A 5EMMA 3I4EA 5C7VA 3WQEA 4E5TA 1JCNA 2ZC8A 2HRWA 2A3CA 2P5NA 2J78A 1AK5A 3P5YA 1OINA 2QPUA 5AVHA 3LNPA 3OJGA 1KCZA 5CPOA 1CXHA 4I9TA 1WNOA 3HG5A 5D03A 2DQWA 3ZJ7A 4ZQCA 1GHSA 3LEPA 4KFOA 2BVWA 2CHOA 3LHYA 4MIMA 1GQJA 3U2OA 3OU8A 3WF1A 5MKGA 4LFYA 4JNZA 1S5NA 1LRNA 3C3UA 3PAJA 5HINA 1EF3A 3EGJA 3H6OA 3W02A 2QIWA 3S8HA 2PDHA 2OQLA 1H0GA 3SW6A 4GNKB 2XSXA 3E6EA 4X60A 3O15A 1VJIA 2JFEX 3QY7A 4OGZA 5HUOA 4QAIA 3GX9A 2XGBA 4QDWA 1WZMA 1DE5A 2DJXA 3V5FA 1PPIA 4KFNA 1LG2A 2VR5A 2ZICA 3F2BA 1KTBA 1Z3NA 3BLOA 4KW2A 1NFBA 5FEPA 2DUZA 4CU8A 2BY0A 3RITA 4JEQA 2CBVA 3UJEA 3M0ZA 1TX0A 2DP3A 5EL1A 2W0UA 4OE7A 1ESWA 3APYA 3CMGA 5DEZA 5A6JA 2GWNA 5J04A 4IFOA 3CC1A 1A5KC 4C5ZA 3MUY1 3PZGA 4NAFB 3GHSA 3S5YA 1A5OC 5BOFA 2QDDA 3W25A 3BAJA 3MSYA 1PBGA 1H7XA 4KBXA 3GXNA 1U1JA 1XLDA 2DU2A 3HU7A 1O6IA 2YL5A 1KV5A 2HISA 3KBSA 2YB1A 1KRAC 5K9XA 4ES4A 1I2QA 4MKNA 1LORA 2X40A 4I8DA 2DUAA 4NZCA 1TWZA 1OCJA 3JZUA 3AIWA 2J7CA 2OELA 4K3ZA 3R2GA 2O56A 2BHZA 1OT2A 1YE4A 1AJ2A 4TV6A 1HN1A 2Y85A 1PE1A 2BY1A 1QW7A 4EX4A 2J62A 2XISA 1XIEA 1JZ2A 1E1CB 2AGKA 1QNQA 1OX6A 3TYCA 3SCRA 3TW6A 3I6EA 5FAGA 1DJHA 1HJQA 3W70A 5I78A 5I0DA 1UMLA 2VOMA 1G4EA 3VKDA 3TYZA 3BC9A 1E6RA 3VNZA 2GGIA 5I6SA 3P6LA 3W0KA 1A5LC 5FJJA 1UZDA 4JFUA 2DZUA 3IWPA 3PAOA 3UZXA 4S1FA 3VMNA 1SFTA 4HPNA 1O95A 2YL6A 4AXKA 4QJ5B 1OM0A 4Z2IA 1MZHA 2DSVA 7ENLA 3LCFA 4QR6A 2VQUA 2DSKA 1ZJHA 2E9LA 5BRBA 2QEZA 1KGXA 1EL3A 1JZ4A 1RALA 4NZ5A 1UYQA 3NPWA 4HT3A 1P1MA 4IPIA 4PB5A 5I07A 2JQXA 2YCJA 4ZXLA 4W86A 4Y8EA 3TIMA 5D8ZA 1SW7A 2ISWA 5A6AA 3I7SA 4FP1A 1NQ6A 4JTSA 4P7NA 3EKZA 1WOAA 1TV4A 2RDUA 1BWKA 2CLOA 3GAKA 1D3CA 3SCWA 4D9PA 1DJQA 1BQCA 1QK2A 5FEWA 3FGCA 3EWWA 4UTMA 4MZ1A 1IEXA 3FJNA 5HPOA 4WY0A 2VT0A 4AHQA 2ZRVA 1E4LA 2CWNA 5C8BB 3WUFA 1TJ2A 2PTZA 2BP1A 1PCKA 4NJGA 3V18A 4O4VA 4ZO6A 1JXKA 2UZ9A 1KFBA 1M7JA 1KXQA 4LCQA 4Y9PA 1GKQA 4AZIA 3PBYA 3EWDA 1ENUA 3V1PA 4TMCA 4PUNA 4DBSA 3S42A 3U7BA 2VFGA 2JF7A 5G4WA 5KMYA 3SB0A 1XD0A 1DEDA 2BXYA 2EEXA 4KWUA 3B8VA 3ID7A 2AAMA 1KFJA 1W9PA 1F7BA 4MOZA 3CH9A 4D8AA 3TYAA 1E6ZA 1XH1A 5KZEA 4B5SA 4P7LA 3AFBA 4GLEA 4F79A 1IGWA 3QY6A 1CB2A 4Y9OA 2BZNA 1IZJA 3EWXA 2WWCA 3EKLA 3VVGA 4GK8A 1XF0A 3NGFA 1S46A 1B3OA 1OADA 3DFQA 2WSQA 5BMXA 1XL9A 3ZVHB 2ZX6A 4ACZB 4GXMA 3N2MA 3PBWA 3W82A 4JN7A 3ALFA 3GFYA 1J0KA 4PTXA 3OA3A 1MQPA 4N9DA 1EO5A 3R8RA 2WHJA 1A5CA 1NFGA 3BL3A 1YBQA 3IS4A 4IH3A 4A8RA 1H1ZA 1W5QA 3CHDA 3RM9A 2O55A 5LA2A 4I9MA 2Y6ZA 1EZ2A 1W2PA 3MZNA 1PX3A 2VL4A 3UWZA 5I24A 3S2LA 2JE8A 3S46A 4UC5A 1H0IA 3S5NA 5CJ5A 1KNWA 3SQLA 3NJ3A 3PBGA 3PP7A 3D6NA 4PL2A 1EPVA 1JCYA 5G2HA 1EYWA 3CHCA 3NURA 3MI3A 3OVRA 4IQJA 4JFTA 3V35A 4QE5A 4S3GA 2QPSA 4IOTA 4XAZA 4KFPA 1KRBC 4EANA 3NA8A 1VFSA 4EAMA 3TAOA 4PTWA 3A4JA 4XVEA 2Z2UA 3ARUA 2BMBA 1IEVA 4MF4A 2VDIA 2CBUA 1VBHA 4LANA 4CNSA 3KZSA 4WEVX 2O9PA 5E1QA 1YE6A 5E09A 1OYAA 3SAZA 3W38A 1DKWA 4M3PA 1R9XA 4AFYA 4AZ6A 1LBFA 1WKDA 1CEOA 1KKRA 2PODA 2YGYA 2QUVA 3MWAA 4E2VA 2PB1A 3TUUA 3TLLA 1RBAA 4IGNA 4C6CA 3RLUA 3PFMA 1X97A 3C56A 3OVPA 3HPFA 1X6LA 1DJXA 1J0IA 3II1A 4FNRA 1PDZA 1R85A 2H9AB 4O16A 3CZEA 3QRHA 3KTCA 4HMNA 1TV8A 4MTVA 4BI5A 4PBGA 3EA2A 1LQ0A 2ZRWA 5JBDA 1JCLA 5D33A 1JCTA 2WQDA 3BSGA 1N8FA 1YYAA 1K7FA 3UG4A 4JQ4A 1RVGA 5HQMA 2J75A 3PR2A 3AIBA 2NVCA 1TMLA 3FXYA 3A23A 3TW9A 4GMEA 1NWUA 5E5CA 4ZQPA 3WD2A 1ZQ5A 4DXXA 2PBOA 1PYMA 2V5DA 4QGCA 1FXQA 2OX1A 2G8ZA 3T0BA 2OT1A 3ZWSA 3QV9A 1NP2A 1Q6FA 4MSSA 5IXEA 3R89A 5MKGB 4XISA 1VB9A 4A2RA 2WANA 3IANA 1SM9A 3NIYA 2EXOA 1J6PA 2IXVA 2A3EA 1EJVC 1ODZA 4Q7IA 1OYCA 4U4MA 4M1BA 1UD3A 1LRTA 3LLDA 1J8VA 1XQLA 3JS3A 4K7VA 2IQDA 5I79A 1XLCA 4CQBA 3P14A 4DIAA 3QYQA 5A6TC 1E40A 2VX6A 1LQ2A 5E9XA 4M56A 1IEWA 1M7XA 2V68A 3DYPA 3O07A 3W7KA 3GUWA 5HJLA 3A4AA 4FOUA 3E9AA 3NEHA 3KHDA 5DY3A 1FWEC 5C5YA 2O7QA 2Y8VA 4GIAA 4MGGA 2BOEX 2RGMA 1GW1A 3DFTA 1KBJA 4ZFCA 2SFPA 1V03A 2OZ3A 4RKAA 3EX1A 1JUBA 3BSHA 4PZVA 2YKKA 5DT7A 3KW3A 3HIJA 2ATSA 5TNVA 3TQKA 3W23A 1UCWA 2CLFA 1W1IE 2ZTJA 1LLZA 3GDBA 1QDSA 2DEPA 3R13A 2GL5A 3KP0A 4XQ6A 3QPEA 1HKVA 4GNJA 4U5KA 3B9OA 4DO5A 1EUAA 1J0YA 4JFSA 1JZ7A 1EUNA 3M64A 4MDPA 5D05A 1ZBCA 2CBJA 3OB8A 3THDA 3LYEA 2ABBA 2DW6A 4YHEA 4AEEA 3XIMA 4W7VA 4DLMA 4RDZA 2FZDA 5K2ZA 3GG7A 3M0MA 3QMSA 2PRLA 4EXQA 1YDVA 5IOBA 1OFRA 4BWLC 4RZ5A 4GUJA 3WBXA 5AC6A 4B5XA 3HQPA 5CBIA 1J5SA 2EQDA 3KL0A 1I45A 1G7UA 4Q8VA 2CYGA 1Z41A 4GG9A 4S3FA 3LX9A 4UMCA 2WC4A 4L4OA 2Y89A 1HKJA 1EIBA 4R88A 1HJXA 2E8ZA 3WF4A 1N55A 1W54A 1CLXA 4EXBA 3RU6A 3BW4A 2VNCA 3KS5A 2A85A 4JTRA 4BWLA 2Z7KA 3VINA 3SCPA 3OEXA 1E9IA 3LM3A 3H24A 3RCNA 4HTYA 3GVVA 4A2SA 1E6PA 1YADA 1C93A 3CBWA 3TROA 3OA5A 2IKHA 1F3TA 2ZZ4A 3MUCA 1A47A 4XKYB 1S1RA 1LM1A 1W3IA 1XRSA 5CC7A 3WQPA 4HU3A 1U22A 3DAQA 5M1TA 3F1QA 4JY9A 4Q7NA 2G5WA 3W7HA 1I8JA 3MSDA 1WAUA 1V0NA 4WRHA 4OT7A 1OD0A 2D3LA 3D46A 4LS1A 3LCIA 3W2NA 3UFYA 2WSKA 3SADA 1AD1A 1XBYA 4AAJA 4H6EA 2J66A 1HP4A 2D20A 1V93A 4C1NB 3SR7A 3FGCB 1TPFA 4FSAA 2FTYA 2V69A 2G37A 1IWBA 4WY0B 3TLQA 4CQDA 1X7IA 3V75A 1GVEA 1G5AA 1QHOA 4E0CA 1W9BM 2VEPA 4C6JA 1ZBKA 1WDRA 3GG8A 4GIRA 4QEEA 3REQA 1GZ1A 4ECLA 5EKYA 3WCZA 2C1IA 2V9DA 5CZSA 1VFOA 4FF7A 2GSJA 4P8XA 3HA1A 5D4YA 5LGXA 4RE3A 2UY5A 1JVNA 3STPA 2FVKA 4MPKA 3T0DA 4XV0A 3WNOA 4W5ZA 4YNGA 4H7ZA 4M7TA 4W7WA 4XTIA 4ZQNA 2HBVA 3AUJA 4CNOA 2BXZA 5FF7A 4B15A 3P80A 5C2XA 4LF1A 4RJEA 1NARA 3DHUA 4NRSA 4AHOA 3M1ZA 3ZWTA 1TB3A 3TC3A 3BICA 3MTWA 3IGXA 4UTWC 4UQEA 5CG0A 3MY9A 3NXLA 1XLGA 2XFWA 2CZFA 5I3GA 1EC9A 2OWWA 4O57A 5L9FA 5HQLA 2C13A 1HJSA 3ZVIA 4F9DA 5LA1A 3IUHA 4HKPA 4EPEC 3DFPA 1Q45A 2OFJA 4CUCA 1ZP3A 4C6LA 3M0HA 4Q4KA 1PVNA 5LKYA 1SFLA 4ZO7A 4KS0A 4BF5A 5C9XA 3SO7A 1P0DA 4ASTA 1US0A 3BGJA 4MWAE 1DHKA 1NFPA 2WZTA 4QG8A 2YCKX 2FDMA 3LHTA 4WZHA 4WJXA 4CVWA 4IMFA 1FY6A 1YBQB 2XN2A 1VBUA 4DZ5A 3NPUA 4OV9A 2C79A 4TO8A 3DI1A 3TOYA 1V6YA 2G0WA 2P3EA 3PBUA 4Y96A 2X2YA 2XYLA 3SRKA 1C90A 2UBPC 3M7SA 3W4RA 4J3WA 1SO6A 3EOLA 3WQDA 3T9PA 2NV2A 2ZUMA 2FPTA 1FH9A 4PBEA 2HROA 1UD2A 3WYZA 4UCFA 1RBLA 4LU0A 3E5BA 1TPUA 2AOSA 1HL9A 1OG0A 1QBAA 2F9RA 1TPDA 1Q66A 3QW4B 3VK5A 1JCMP 1LL6A 2B81A 1ITUA 1N2VA 2FGZA 3W1TA 2Q3OA 5L6UA 3TR9A 4C60A 1HT6A 4FAMA 3MZ2A 3N6QA 4AC1X 1O5XA 3L4XA 3GHRA 3OO2A 5AYIA 3QSTA 5BOEA 4H6RA 4AEFA 3T8LA 1GYNA 3W1UA 4Y9AA 3H2FA 4GISA 1K8XA 4LVDA 3VNMA 4WXYA 4FI4A 2DT1A 5F2GA 2LLEA 4ZTYA 2J9ZA 2PD9A 5CJNA 4H9YA 3W86A 1UW9A 4NY2A 4D6CA 4DRSA 3PBMA 1JFHA 2WM0A 4M6VA 3CWOX 3PZVA 3NQDA 3V5OA 1YTKA 2YR1A 3ES8A 1ADOA 2GZXA 1WE5A 4PMRA 2C0HA 4H83A 4F9JA 1HUVA 4O1CA 2DVUA 4WKHA 3ABRA 2JEQA 1FDJA 3S2CA 2HVNA 5BCAA 3R1ZA 4RZ4A 1UD8A 5LA0A 4TX8A 3P2VA 2TSYA 2INZA 3UR8A 2QCLA 1T6MA 3GAYA 1S2TA 2QF8A 3QQ0A 4R33A 1ZJBA 4ATDA 2P8CA 4YHGA 2BVTA 1Z6KA 3G2GA 3UT0A 5LIUX 2VGIA 1XBVA 4HK7A 3VFCA 3NFUA 3BWWA 3ABSA 2IXUA 4PCNA 3N15A 4C6OA 5H6HA 1CWYA 4HNCA 5BNKA 2VC7A 1E0XA 2OO6A 2JIWA 2GUBA 5C71A 1H11A 3B03A 3VCNA 3WDPP 5ECUA 4K8GA 1UR9A 3N4FA 2C7FA 2ZZ3A 3FX4A 5IDIA 3LCLA 3EXSA 4L56A 1G69A 4S3DA 3VIOA 1ECEA 1TREA 4URIA 1UH3A 1QI5A 4RLIA 4UR9A 2ACQA 2YFOA 1SVDA 1TUFA 2J4GA 1D7KA 1W9DM 1UUQA 4HSHA 3CQ0A 4CNNA 3UPWA 1ISYA 3XINA 3I6RA 2F7FA 2V2HA 1JF5A 3WLIA 2VEFA 3M7WA 4CVUA 3QH2A 1POKA 3FHAA 1VBRA 3WF0A 2G4JA 3GTXA 4JEJA 3SURA 1VFMA 3THCA 1EJSC 3WFZA 2FHFA 1H62A 4MHBA 1WXZA 1F5ZA 3WLPA 3PG8A 3G1SA 3CQHA 1MFUA 3EX3A 3E3HA 4CNUA 3DFOA 1EJUC 1WXYA 5G4EA 4JIRA 3DFHA 3DU0A 5D04C 1KM2A 1W5MA 1WZAA 4W8LA 5CPMA 4BI7A 4GQBA 4IL2A 4C6DA 4YYFA 1KCLA 2NLYA 4YWSA 2NSOA 2HXTA 5IHRA 1UD4A 4A8NA 4J4KA 1EJ7L 3UBPC 1P4CA 3F03K 3CYJA 4LUYA 3N13A 3MV11 2FMOA 3O6CA 4ICCX 1P5BA 4WK9A 1JDFA 4HN8A 3LRLA 1Y5WA 4D1IA 3OLIA 2VD8A 1LQAA 3STGA 1AMYA 1J0ZA 3AICA 1UWSA 1AG1O 1XW8A 3TYEA 2GVJA 4XBKA 4LV4A 2WJFA 4H8HA 3EDEA 2EF9A 1OSEA 3NOEA 3AXKA 3VKBA 1EZWA 3B0VC 1WB0A 1V3KA 3UD6A 4U3AA 3ZLGA 5A6SA 5LYRA 4D6DA 1ZLPA 3NSNA 2C14A 3V16A 5CXPA 3EX2A 2OLSA 3CL8A 3W9ZA 5D30A 1ZENA 2X8RA 1SJDA 1DIDA 3NCOA 3FHQA 5T8GA 1TO3A 4NASA 3QZ6A 4H19A 2GGJA 2Z29A 2XH4A 4HK6A 4WJEA 3DBPA 3NL6A 5J8LA 2GVLA 3DEQA 1HO1A 3EWZA 2DZXA 2X7VA 4MWAA 3GNRA 3GTHA 3R11A 4NZ4A 1JXJA 1XM3A 5D09A 3OZPA 2WMHA 2PWFA 1QFEA 1RV8A 4A21A 3MMTA 2QXWA 4PMZA 4UNLA 3HN3A 1LBLA 4LXFA 4XZ9A 4E2DA 2WSRA 3DERA 4E2OA 1ALDA 2ZXQA 4A3YA 2Q09A 2G3FA 4G2DA 4GCAA 1NU5A 2QW5A 3CAKA 4F48A 4K36A 2REQA 1QK0A 4JTGA 1A5AA 5TBOA 3MUZ1 3QY8A 3OLDA 4G7FA 6A3HA 1W3KA 5H8UA 1RUSA 1PZ0A 1V0KA 1X96A 4XD5A 1WOBA 2YCLA 3RLHA 4M19A 1VZWA 5D9MA 3PNZA 1C9WA 1KFKA 2YL9A 2NW0A 3ELFA 3G5EA 4UUIA 3BCJA 1TVLA 4MB1A 1G94A 4AWSA 1J79A 3B9NA 1Q2SA 1H1NA 1XSIA 3O05A 4OHQA 3BLKA 4HU8A 2OZ0A 1WDSA 1QPRA 1NY1A 5E70A 3UJRA 1SSDA 3GH7A 4PL1A 4H1ZA 1EDGA 1XFCA 3WDJA 1UWTA 4JKMA 4EK7A 4DZHA 1VBJA 3N1AA 3NQMA 2QCCA 2AKZA 4K7YA 1TCMA 3P61A 4IIGA 5I3FA 5FF4A 4DWSD 4AIOA 4F4RA 3GFXA 1R46A 3AMCA 5E9AA 2HNEA 4ZA0A 3T78A 4BY3A 3PZQA 2X41A 2PDLA 2WPBA 4OQVA 3WQCA 1EXPA 2QMKA 1XRVA 4K37A 3CPUA 5D2VA 5JIWA 4RUBA 2WVUA 2OSYA 5CPLA 2W67A 1TRIA 2J9XA 3KDNA 5CLTA 3UWEA 4ERIA 1T8QA 4O0KA 4P8UA 1E71M 4X9SA 2VEKA 4FLOA 3PZUA 3EA3A 4J35A 3W24A 3UJ2A 2Y1HA 2Y5JA 2A6NA 1MW0A 4DF1A 3M5VA 4IHCA 3KP1A 2WPGA 3MP5A 2NXIA 4GQGA 4JIHA 1O5KA 2VX5A 1G6CA 1UPPA 1XJBA 3GDLA 4DWSB 1DXFA 3O8AA 3ANYA 2GJPA 1W1TA 5ABHA 1FWAC 3WMSA 1F3XA 1XYFA 4QQ3A 1KM4A 1W2VA 3CUFA 3DKJA 3VC6A 2VCAA 3I7RA 1BGGA 1XQKA 5G1TA 3VIKA 1ZTVA 4I5XA 3TJXA 2CLKA 4JIIX 1KLZA 1L2UA 4NZFA 2R82A 4FNTA 1SO5A 3BOLA 5HMEA 3AWOA 3B05A 4Z08A 1K3UA 4ZXOA 4JHMA 1EQCA 1P0BA 4JY8A 1AODA 2F6XA 9RUBA 4AZGA 1IF2A 2XIQA 4HHMA 3UCQA 4WY0F 3CZLA 2I16A 4MYAA 3M0YA 2HZGA 4HP5A 4LYRA 1C8QA 3T6CA 1VFTA 4QLJA 3EX6A 4HSNA 3R94A 3LXCA 4ZSUA 1H7WA 3SGUA 1XLLA 3PC0A 1SFJA 4CKQA 4UQAA 1DHPA 3Q4DA 2DZBA 3LCHA 3NL2A 3WH6A 5LIYX 2EHHA 2V3GA 5A8PA 2E9MA 5KINA 1LT7A 3VOFA 2CZVA 3VNLA 2QGHA 4O14A 1EIXA 4GYKA 1UD6A 1TPWA 1YLVA 1UWIA 1TE1A 1MSSA 4GABA 3VDBA 4YCPA 1O68A 2E77A 1BXBA 2HSAA 1DJYA 5HA7A 1AL8A 1PZ3A 3EXRA 4KH2A 1F07A 1WZKA 4JTUA 3GNOA 4AD1A 4MZYA 1IR2A 3EDJA 3H54A 1W5NA 4MDOA 3VO0A 5DMNA 3DC0A 2XFYA 3BE7A 3DENA 2XIOA 1WYIA 4A22A 4MJ4A 2FHCA 4L5ZA 5A8QA 2C19A 5EMUA 5K9DA 4UXDA 3PTQA 4IWWA 1Q4WA 3QC0A 3UG3A 3WBWA 4TQTA 4GYPC 3CMFA 3SCNA 4QJ4B 1O12A 5KZMA 1QBBA 1OZMA 3BMWA 3GYCA 2FTWA 3AYRA 4ZE4A 5I02A 2QCMA 4W9TA 3WQ8A 3L4TA 2VFHA 1JZ6A 5CAKA 4AU0A 4Q4QA 4GI4A 2V3DA 7TIMA 5E0CA 1UP0A 4PMOA 1QWGA 2QJHA 2VTFA 2VUNA 3SY1A 1BGAA 4GYPA 2VZTA 4L4MA 1ZGDA 4Z1AA 3IRDA 3E74A 4GQRA 1OX4A 1TPC1 2DZPA 3LHUA 3VIHA 3VM5A 4FOKA 3W2KA 2D24A 1AQFA 1EDTA 2YB4A 4OFCA 1DWJM 1LL7A 3MT1A 1QOXA 4HHLA 2G3NA 3LSCA 3VCRA 2G3IA 4B4HA 3CWNA 2ACSA 2YBVA 1V3IA 5C9UA 3RU8X 3N2TA 5JIPA 1XDMA 1OVDA 3WJXA 5EYWA 3C0SA 3AMDA 3GU1A 3VZZA 1RQHA 1GONA 2Z1WA 2QJJA 4MWAD 4C7FA 2WCAA 3LV6A 4PEKA 3BANA 3WH9A 1M68A 3PB2A 2PGEA 3SZ8A 1X1NA 1V6VA 5DCBA 2Y24A 5A3HA 2Y0FA 2F6UA 2Y7EA 1NIUA 2I9EA 3WLRA 5I3HA 2OOFA 2GK1B 4DAFA 2QDEA 4U33A 3LZ5A 5CZKA 1H5VA 8XIMA 5DXXA 1E9LA 3NTYA 3UVAA 2VC5A 3WQVA 1HKIA 2XIIA 4GZEA 4GY7A 1JEZA 3R8HA 2YZ5A 2QQ6A 1HIZA 1VLWA 3RDKA 3W1MA 1UZ1A 2R8WA 2Y8UA 4O10A 1GK8A 4AF0B 2VFDA 4B90A 1K8CA 2WKJA 3T0CA 2BVYA 2PWEA 2FB2A 1S2AA 3BGAA 5CPTA 2WQPA 3HMJG 3N4EA 1M7OA 5BXRA 4MWAB 3G77A 4AZCA 1D8WA 1UH2A 4B5NA 4ML4A 5C2GA 1YMYA 3WK3A 2H6RA 4INFA 5D2XA 4M7SA 1OG6A 4L9XA 3VC5A 3G18A 5LNUA 2O9TA 4LAOA 1LUCA 4YCOA 2RKXA 1TV7A 3EWUA 2WNZA 3ICJA 1R3SA 5M5DA 3OYXA 1LYXA 4QSHA 2REQB 1KXHA 3L2LA 1S3TC 4H9VA 4IJRA 5XINA 3ONCA 4YTTA 1ME8A 1TR1A 3NQEA 2CLIA 1PB0A 3ZYZA 1OQFA 1Q8AA 1EP2A 1FUYA 3OZYA 2YCLB 3TV8A 1OGBA 4UR7A 4D6JA 4GX8A 4J3VA 4X63A 3N3MA 2QAFA 2ZRXA 1UR0A 1BEUA 1TRDA 4LPCA 4L9YA 4PCPA 2ZQ0A 1I2PA 1FHUA 2Y88A 3U7VA 3A12A 4GINA 2BOGX 1RXOB 4GBUA 3D3FA 4L1XA 3M43A 3BAIA 7REQA 1M5WA 1Q6OA 2QPXA 1K6WA 2Q3RA 1EB3A 3WF3A 2O0TA 1GEHA 3ONBA 4IGHA 1O7AA 4JYFA 4FIQA 1A0CA 2XFFA 1M41A 3GDMA 3HPAA 3BG9A 1FX6A 3FEMA 3IIZA 5CZ0A 1TV2A 3KM8A 4H04A 2VX4A 4F0RA 4UTHA 1HVQA 3EXTA 5FF3A 2C3ZA 4HGXA 5IDZA 1ADDA 3AJXA 3DX5A 5TF0A 3ATZA 1JPDX 2C16A 3LERA 1O4UA 2YJQA 3V0TA 1XLIA 2EBNA 4G6CA 3K2GA 4UOJA 1S39A 3G8EA 4JTEA 5HXMA 4ATWA 1L6GA 3BLFA 1XGEA 4XX6A 3CU2A 4GUFA 2OVLA 2PDIA 3I3DA 3QV7A 4JCMA 3CT7A 3HFTA 3W1PA 4DO4A 1JRCA 3WUBA 3WMLA 3WQ6A 1Y65A 1X8FA 1TTJA 3U4FA 3TDFA 1N8WA 3GKFA 5KSWA 4YVPA 2BSLA 4MUZA 3KX6A 1V3JA 1U83A 3B8TA 1MEWA 4GO9A 4X61A 5CGQA 2QYGA 1HNYA 3AHYA 1JDAA 3N2CA 1OYBA 3RMJA 3VU2A 3NQCA 2WJDA 1JI2A 3UEQA 4DBDA 5CZTA 4WX2A 1LWJA 5AHFA 1OFPA 2JALA 4P7QA 1F76A 3VDCA 3SCVA 1UIPA 5BU9A 2BOFX 3OLGA 4F2TA 4K8EA 1L2QA 2GOKA 1XLAA 3ITCA 1L6SA 1OFQA 3RF9A 3TFXA 4JTIA 3BLIA 3VIJA 1XIHA 4UFKA 4OUEA 5DANA 1HP5A 5K3VA 3C8NA 3VOIA 4M24A 1BAGA 4IGMA 4RDYA 1NELA 3L65A 3AIVA 1VRDA 2E5DA 1WP6A 3C2EA 1F3WA 2B7QA 3K1DA 4QE1A 1X39A 3UQNA 1ISVA 2OGYA 2TODA 1G9HA 4JTFA 4XAFA 4DELA 1UROA 2ZVIA 2O7SA 5REQB 5TQLA 4I7WA 3GVRA 1OFAA 3LSBA 2ZXBA 3W72A 4B5WA 5A8OA 4TVUA 3L67A 4UTKA 4HIBA 4JTQA 1TPH1 8CGTA 3MB9A 2PTDA 3G3DA 2ODOA 3EPMA 3A3WA 1KV8A 5H8MA 4HPJA 3W6MA 4MB5A 3V3WA 1V51A 2C71A 3AXIA 3EOOA 4IFKB 1UKTA 1XICA 3V5CA 1EKOA 2WMKA 4OOUA 3ABQA 1C91A 3CB8A 2ZX8A 1MW2A 3L9CA 4EXAA 3BLDA 3CM4A 3URQA 4MPQA 1GYLA 1I60A 1GTHA 3L4YA 3MV01 4YYCA 4DJFC 4HNLA 4AZ5A 3H4XA 3W1LA 1JNEA 1PL9A 2P8BA 3T2QA 3AJ7A 3A47A 4WLCA 2CLEA 3QFEA 1NOWA 1G1YA 2E0PA 2PDPA 4REQA 2PDCA 2HPIA 5HATA 4H41A 4R27A 1I1XA 3G8RA 3BW2A 3UXDA 3KRUA 1R3VA 1QW8A 1PZ1A 1XISA 1RVKA 2TMDA 1AH4A 1ZB5A 4O17A 3YPIA 4LTSA 4MMWA 3QOKA 3QR3A 4R9XA 2HDJA 1MI3A 3EA1A 1EOMA 3TXVA 1R8LA 3QXBA 4U5IA 4AMCA 4LW7A 2BWGA 3CB3A 1GW9A 3VUPA 3VKCA 2OQYA 1LJYA 4KIEA 3K8MA 2XM2A 1UKQA 5JH2A 4Q7BA 1V7YA 4TIMA 3UR2A 1G01A 3ISIX 1MXDA 3W74A 4Z2HA 4PYSA 4TMBA 1BRLB 5A8GA 4Z0SA 5FEXA 1MNSA 2P88A 3B8SA 5EFDA 4AD0A 2DY3A 3WSUA 2E1DA 9XIMA 3VD4A 3SQSA 1E72M 1OX4B 4Z0JA 2VDGA 1NOUA 4PSPA 2P0IA 3CNYA 4G5DA 3B0PA 3QZAA 4PRTA 3OBKA 2Z7GA 3BW3A 3KBWA 5H1WA 1UA3A 4TX9A 3RM8A 1W3NA 3N9RA 5HR7A 2DZWA 2PGRA 5GNZA 3G0XA 1B31A 2CLHA 3M0KA 1P6CA 5K4ZA 1GVRA 2BY3A 1ONEA 4ATLA 1HG3A 4NAEB 1J10A 1NDZA 1ZSXA 4UFHA 1XRTA 5LNSA 1JGIA 1QT1A 3NM3A 5JMUA 3OQEA 2QJGA 1EWEA 3U6WA 2Y4SA 5BWFA 3AALA 4LS2A 4PMDA 3DZ1A 1LBMA 1AUSL 3BQ6A 1CBGA 2I14A 4CD7A 4J2MA 4RPQA 3E2QA 1RD5A 4NKCA 3NL5A 4DF0A 3LCXA 4F3HA 4ZOBA 1TELA 3H12A 1FFRA 3WLHA 1NEYA 2WZMA 1GWJA 3KVJA 3F5KA 3PG9A 3ZJ6A 2GSEA 2GDVA 4GIYA 1WBJA 3JW7A 1SGJA 3G0UA 1Z42A 4LUSB 4HU4A 4KETA 2BGNE 4XG1A 3ARVA 4J3UA 4MB3A 4BCEA 4S23A 5HUPA 2BNJA 1MVYA 3QKEA 4DEFA 1R2SA 3DYMA 3O63A 4AD5A 4AZCB 4A29A 3BAWA 4LBRA 3CUXA 4WOQA 2BASA 3QHNA 1U5HA 5T26A 2ZKMX 1V3LA 1I75A 3N19B 5CBJA 4FR6A 1XG3A 1XX1A 1LUCB 2R9RA 2J7BA 2YW4A 2BFGA 3SUVA 3KUMA 2J8TA 3GS6A 3IUDA 2DZTA 4NZ1A 4BI6A 5AOUA 3ANUA 4EPDC 2DH3A 4PUKA 2GLKA 1CT5A 1ITQA 3ZT5A 3KLLA 3ARRA 1XLEA 3CGTA 4DF2A 3NSXA 4LCSA 1AZ2A 3OW1A 4N4PA 5C7HA 2HE5A 1GOXA 3R4IA 2H8ZA 4K39A 1KM6A 4LAMA 4TR9A 1WUEA 1EFZA 3R79A 1KBKA 2ZADA 3WY1A 2W61A 3QC3A 4GVFA 3A5VA 1V6WA 4OTKA 4K1WA 4L7ZA 2J77A 1YIXA 3F4NA 1HTIA 2JIEA 1GPWA 3Q67A 4HTBA 1UHVA 4KWSA 7REQB 1MUCA 3RYSA 1H1YA 4YMZA 3NYZA 4TU1A 3FJ4A 4HA3A 3WLQA 4IP5A 4AW7A 4QCEA 1W6TA 2GDUA 2P53A 3W2MA 3UZWA 3FS2A 2PLMA 3MHGA 4GH1A 1CPUA 3K5XA 3B0UX 2C91A 4ZBCA 2V6AA 1ZZMA 4JZ5A 5G4HC 3VDHA 3KTXA 2R6OA 1A3HA 4FK9A 4NL1A 3PZIA 2WV8A 3OYZA 1P0EA 4K38A 2BLEA 3WK2A 2YBTA 1K4GA 1Z44A 3LQGA 1YNYA 4O1AA 4M6UA 1U1UA 3WBAA 4CQCA 2QJMA 3UWVA 3SQMA 4YXGA 1G67A 2O9RA 4WQ6A 3E2VA 1UP2A 3URAA 4KESA 3WLOA 1S5VA 2C8NA 4N2YA 2B7OA 2GQAA 3Q58A 4GC4A 1UA7A 4HYWA 5HNRA 4FEZA 3P0WA 2OYLA 1PYFA 2FGBA 3VNDA 2NXHA 2G3MA 2VC6A 4Y2WA 5CGMA 4Y90A 3T0AA 2HE8A 4C91A 3J7HA 5AHMA 3GR4A 3HPSA 4QFUA 2FH6A 3FVMA 4FNSA 3TU9A 2PF8A 3G24A 3H23A 3TC6A 3O3RA 3TE9A 4IUGA 2G3JA 2OO0A 4QDMA 3AU6A 1EGZA 4V1YA 2Z24A 2ZXAA 2Z4GA 3URNA 4O0ZA 2AQWA 5CPNA 2OMAA 4EPBC 1VCGA 4LWWA 2A3BA 4PMYA 1TWIA 3LI1A 3CLWA 3VKJA 1MXGA 1PDYA 1KXTA 2HK0A 1S5MA 3M0JA 3S4TA 3VI2A 1DYSA 4GWEA 1TWWA 1GOMA 1NF0A 1CDGA 3OBEA 1LOLA 5DRCA 3EPNA 2PGWA 2FVMA 3M0LA 5ABTA 1XKJA 4J9JA 2XVLA 3BSMA 3I68A 4RCXA 4UNKA 3GC2A 1AJ0A 1UB3A 2CCRA 2VM8A 2OYKA 3EYPA 3E1F1 2PTYA 3VIPA 1A3WA 2CU0A 2QCGA 3BCFA 1U33A 4C6NA 3P60A 5FAJA 3GD6A 2G41A 3FN9A 3ARTA 1EEPA 1ME7A 3UJFA 3F4CA 2PCQA 2ZYFA 4B5VA 2WJEA 5DT5A 4KEZA 3NPXA 2RDTA 1TMHA 1JYVA 3SEPA 3BMXA 4C6QA 2ZX7A 2TAAA 3U5UA 3LN3A 4L65A 1GHRA 5DBTA 1E0WA 3Q65A 4O4WA 5C54A 3PSVA 1FCQA 2CLPA 1E0TA 3BLEA 5MHBA 4H8VA 1XS2A 2YPIA 3DOPA 4DQWA 3WK1A 5I03A 4I8YA 2VRQA 4S3CA 3QLLA 4WF7A 4IG2A 3ZJ8A 3TWAA 3COTA 3PFRA 1GQLA 3W88A 1GOOA 2PPGA 5D2WA 3NQ2A 3EPOA 3C86A 2NWRA 3VIFA 3ZQ9A 1WUFA 3WX7A 2CLLA 1G4SA 1W17A 2EJAA 1QNSA 3A24A 3EWBX 2AL2B 4XB3A 4BK9A 4D71A 3KS6A 4F0LA 3UPMA 1F4HA 3BAKA 2ATMA 5KZDA 2D69A 3MO4A 5FJIA 1AH0A 2OKTA 3ZZ1A 2G96A 3IJQA 4QNEA 1EC8A 5CC6A 1HQTA 3VKKA 4KEUA 4DPPA 4UTFA 4O18A 3JR2A 4JTLA 4HNOA 1PKYA 3S2NA 3EX4A 2DT3A 3PJWA 1F9CA 1YW1A 1ZY9A 3AI0A 4JPGA 1ZU8A 2FGLA 3UGVA 1GVIA 4B3ZA 4O19A 3WN6A 1Q4NX 1Y5VA 1RQBA 3LHZA 3K1GA 1IT7A 1TIMA 4ZE5A 6ENLA 1JZ5A 1UR8A 3VZYA 3GLCA 3IIOA 2MUCA 4F0MA 4WDXA 1VLIA 1M1BA 4ZL1A 4UOQA 1JAEA 4GQQA 3WLSA 4HVXA 4HOZA 1Q6GA 3GXIA 4TUFA 4GZIA 1QPOA 1V3HA 4O1FA 3D0CA 3SN1A 2XIBA 4LEQA 1IEIA 4TV5A 1W8SA 1EGVA 3W7JA 3AS1A 4F2BA 4GYFA 1XHGA 1V6UA 3ZM8A 1Q63A 2DZAA 4W85A 2ZX9A 4AD2A 1FVPA 6XIAA 3M41A 4DYEA 2WHMA 4B92A 2QZRA 2VD9A 1PX8A 3UERA 1IT8A 1JNDA 4V28A 3NXFA 3PZNA 4WKAA 4ORIA 4JTDA 1WAWA 3G6LA 4JTTA 5HR6A 3SGZA 4JN8A 2XWDA 4LUTB 3MVIA 2RAGA 2W3ZA 4QS6A 5JVLA 4LNYA 3L4WA 4KCTA 1UC5A 2CZDA 2JKAA 5AC4A 2AKMA 2V30A 4XIAA 4GZ7A 3M6YA 1I2NA 2XUCA 4IXXA 2JGYA 2TPSA 1XR2A 2PDFA 4N9CA 1HGYA 4JHZA 4LC6A 4US5A 1TVNA 1EJWC 3BVJA 4GXWA 3D47A 3BK0A 3LMZA 4AEOA 2ZZ2A 1QR7A