3W6YA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with tt2-2-199
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with TT2-2-199
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w6yA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w6yA01
4JTFA 1F6KA 1TV7A 1P0KA 4JD4A 2XN2A 5CZ0A 2YSWA 4KFNA 1JRCA 1IXQA 2VFHA 3NZ1A 1WDWA 3HIJA 1OFDA 1PHQA 4NXKA 3G1VA 2C19A 3OEXA 5G4WA 4OV9A 3RMJA 4CNPA 5LNSA 5SWUA 3CPRA 1TPDA 3L2IA 4UFHA 2QCLA 2RDTA 4EIVA 1LDCA 2ZZ4A 4R33A 3W2KA 1PS9A 1SO4A 4L4LA 1KLZA 2Y89A 1PV8A 4YL2A 4HNNA 1IIHA 2WNNA 2O7SA 3O16A 2VEMA 3NQ8A 4M6PA 3GKFA 1C8VA 4TX9A 3U8GA 2O7QA 3F03K 3GX9A 4YXGA 1U5JA 3G24A 3LRKA 5DN1A 4N6EA 1KFCA 3W6YA 1QPNA 2WPBA 1JR1A 4IMFA 3DFOA 3W73A 3GYEA 2E5BA 5HJLA 3W1AA 2V0TA 4RXFA 3RLVA 4XUGA 3G3MA 1ICPA 4NU7A 1F74A 4AXKA 2BX7A 2WQPA 3SGZA 2WNQA 3BO9A 3EXTA 1XM3A 2Q3RA 1BKSA 3I7SA 2E6AA 1A5CA 3BLEA 1J5TA 3QPZA 4FNPA 3O6DA 3IIPA 5C54A 3W2MA 1H7PA 3O15A 3DKLA 2VOMA 2FIQA 3SJ3A 3LV5A 3C52A 1FWSA 3PBYA 5DY2A 4MFEA 3HGJA 3LCXA 3TSDA 1OJXA 3A22A 2B0MA 3W7EA 3KX6A 1M6JA 3OBKA 3M5VA 1G6CA 4DQWA 2PCQA 4OGZA 1LM1A 3LTSA 1EA0A 4JTJA 3WJXA 1ICQA 5AYXA 3GNDA 4YMZA 1AW2A 4WY0F 1YDOA 3QQ1A 5DXYA 2CFFA 3GK0A 1F5ZA 5F1UA 4O52A 1OFPA 1K3UA 5CPNA 3FEMA 1ME9A 4HIBA 5K9DA 1XBVA 4UFIA 1MEHA 2QAPA 4G1KA 5LKYA 5LHFA 3WK1A 3R89A 4JTUA 1Q3NA 1WOBA 4IPIA 1LLZA 3PR2A 4JY9A 4KWWA 1Q45A 1HO1A 1F73A 1FXQA 3M41A 4WD0A 3AO0A 2OCZA 3GIYA 4LOCA 1VJIA 1UCWA 4OU1A 5HINA 1IXPA 2QF7A 3LCHA 1QO5A 4O53A 3W1UA 3GXNA 2FLIA 2DZXA 3BVJA 3NQDA 1W31A 2W79A 4ZL1A 3GR8A 1F05A 2HS6A 5DELA 1N55A 2FJKA 1KA9F 1GVFA 5CZJA 4N02A 4DEFA 4PL2A 1R2RA 3TW7A 3R13A 2R94A 1TQJA 3M0ZA 1OFEA 5LNVA 4H4IA 3LXAA 4JX5A 4X9SA 5AHLA 1JCYA 4UTJA 3WK2A 4UTIA 4MY8A 3G18A 1S3HA 2Z6JA 4DPQA 1TREA 3FYPA 5F2GA 3W22A 3IRDA 4C1KA 3N14A 4S2CA 3TCEA 4DBDA 2PRMA 3W74A 1KFBA 3LTYA 4UFJA 4NJKA 3B05A 1W3TA 1W5NA 3S6DA 2QJGA 1IXOA 1SFLA 3KVMA 5FI8A 3CEPA 2FQIA 4OHQA 2ZZ7A 3UXAA 3RU6A 3TDFA 2GVLA 1ZJIA 2YYUA 3GXTA 1TJPA 4BI6A 1W5MA 3MI6A 1KM2A 1Z41A 1EP2A 3FJ6A 4ADUA 1KM3A 2GVJA 3DI1A 2H8ZA 4MY9A 2RHGA 1QMLA 4JIPA 4A22A 5KZDA 3EWWA 3B06A 1A5AA 1TPFA 3UYCA 2D73A 3S5ZA 3HPXA 3QW4B 2JGQA 3F4WA 3Q37A 3EWUA 3NL5A 1FBAA 1ZAJA 4K8HA 3STEA 1ZY9A 4TMCA 4NJJA 3LHTA 3HPSA 2V2DA 1KTCA 1S5WA 1M7PA 5L6UA 3BPWA 3IGSA 2DU2A 3LBMA 3W83A 3NA8A 3BG9A 2GPTA 1SQ7A 3T44A 3H55A 5KTLA 5KZMA 3JS3A 1G7UA 1YLVA 3MBDA 2V2CA 4XQ6A 1ADOA 1QO2A 3QSRA 4JTIA 3UZJA 3M16A 2NXHA 3SY5A 2YFOA 2NUWA 4YWIA 4NJHA 2CZDA 4UTLA 1TRIA 3FKRA 3LGEA 3HG5A 4RV8A 1RVGA 5FESA 5CZSA 3G1SA 4WOQA 4CQAA 3G0XA 4CQ9A 3W1NA 4UNLA 1W0MA 5G4EA 1X1ZA 1N7KA 3CT7A 1XBZA 4YCPA 4GUHA 1L6YA 5G5IA 3NL3A 2JKEA 1Q6OA 1JCMP 3TC6A 3LHWA 3KVKA 4N9BA 1DOSA 3LV6A 4JNMA 2ZA3A 3NM3A 2C3ZA 4UFMA 2WJZA 4PCFA 3QSTA 1ZCOA 2VFGA 3C6CA 2BZNA 4O54A 2Y7GA 1SO5A 4JTHA 3GB6A 4JY8A 3TIMA 4O0KA 2W6RA 3L0NA 4O15A 3S5OA 3S42A 2GQAA 3MMTA 4O0ZA 3VE7A 1TCDA 5I3HA 3W3OA 3L9CA 3W2JA 4CQ8A 4NXSA 1XFBA 3PWAA 5J5RA 1H1ZA 4NVTA 2HMCA 3ANYA 1TPUA 4QSHA 1TPH1 3IIXA 1GWJA 4K6AA 1D3HA 3VCRA 1QR7A 2P1FA 4JGDA 3NAVA 1IGSA 4ZQMA 3TQKA 1GVRA 3HQ1A 3W75A 5HWMA 4P2VA 3VKJA 1AK5A 1SO6A 3HBLA 4X3ZA 3HMJG 1DORA 2QR6A 1SW3A 4ORIA 3L0GA 4MFDA 4HNTA 3FKKA 1LORA 1QOQA 3O8AA 1OK4A 3P62A 3S8HA 1NVMA 2QCFA 1OFQA 1RZMA 5KINA 5U7SA 3N9RA 4M19A 4PTNA 1JJKA 3PUOA 3ABSA 5LGXA 1OX5A 3W88A 2C16A 1WX0A 3M7WA 2CLHA 4K39A 4LUIA 2QCNA 1VZWA 3CHVA 2QCHA 3JR2A 4O1BA 5D2WA 5CZTA 3PG8A 4MUZA 3LHZA 2OJPA 2UV8G 4POCA 3FA5A 4S1FA 5D38A 5HR7A 2VFFA 2X1TA 3SECA 1KBIA 4MLRA 3EX3A 2VELA 3HG3A 2ZBTA 1KV8A 2YXGA 1ZFJA 3STGA 2W0UA 3BV4A 2ZYFA 1P1XA 4RR4A 3C8FA 3KVJA 1B3OA 1JQXA 2FPYA 1FY6A 3UWQA 1SO3A 3PULA 3W1LA 1H62A 4WXZA 1ALDA 1XDMA 2GVGA 3P81A 4PODA 3SI9A 1LROA 5AC7A 3GZ3A 3T40A 5E0KA 1DHPA 1H51A 1FCUA 2CZEA 3PS7A 5AC6A 3GNNA 3GR7A 3NNTA 1J2WA 4ALDA 3EWYA 5E1QA 4EVZA 1NEYA 1PL9A 3FIGA 1R2SA 1NSJA 2GQ8A 3QFEA 3PY2A 3PBUA 1CW2A 4MYAA 3W9ZA 3MJYA 3WK3A 1ZNNA 3MP4A 1J4EA 2ZDRA 2ATMA 1Q6LA 2A7PA 1TB3A 2OZ0A 4WY0A 2IQTA 3W2NA 2E68A 3ZS4A 5DXXA 3IIVA 4R53A 2DZTA 4UR7A 4K38A 4GUFA 1JVNA 2GUUA 5D30A 1PVNA 3K30A 3CC1A 3RNDA 3C4UA 3MP3A 2C1HA 2QAFA 3MWAA 2C13A 3CIXA 1CI1A 2BXVA 4O14A 4AWSA 2VXNA 2V8ZA 3W7PA 1RQBA 3TAKA 1LBMA 3W7JA 1DBTA 4P61A 3HPZA 3NVTA 3QJAA 4L4MA 1TRDA 3JRKA 3TAOA 2NWRA 4UCGA 3NQ2A 5AHFA 5D09A 1XCFA 5HR6A 1A5BA 4QM1A 4DXVA 4AHOA 5LNRA 3P60A 2XN0A 3P8JA 3QYQA 4MZYA 3ZR4A 4JEQA 2NX9A 3WFAA 3L0KA 3W1TA 4LV9A 2WNZA 1FDZA 3HGRA 2G96A 5HQEA 3TW6A 2NLIA 3DFTA 3LI0A 1TYGA 3LI1A 3ABQA 4IWWA 4FEZA 3TSBA 1P5BA 3NPWA 1TV5A 2JGYA 2VFIA 3NQGA 3S5YA 2NUYA 3QMTA 1QNVA 1FXPA 2RFGA 4NX5A 4A2RA 6ALDA 2FB2A 2FTPA 3UPBA 4M5PA 4AWUA 4LVDA 3PF3A 3QMRA 4FXRA 2Y7FA 2YZRA 3B04A 4PC8A 3QH2A 4HNVA 1FDYA 4BK9A 3EKZA 3LB0A 4PFMA 1VYPX 1ZAHA 2FFCA 1NAL1 3W1RA 1D3GA 3E02A 3NPUA 4A29A 1VYRA 4QQ3A 5IBXA 3B0VC 2NUXA 5L9FA 4N2YA 4JS3A 5K9XA 3TQVA 4O10A 2X2GA 2ZRUA 3N34A 4ZQOA 3EB2A 4D2JA 1TTPA 1G4SA 1GPWA 3S1UA 2A1YA 4WXYA 2QDHA 4OV4A 1DL3A 3STCA 4LVGA 1TTQA 3P8IA 4LUJA 4OWGA 3TXZA 3W7KA 2Y7DA 1MSSA 1G4PA 4ICNA 3KAOA 1ZAIA 1XC4A 2E5CA 3D0CA 4Q33A 5HMSA 5D04C 2ZA1A 4TU1A 2A6LA 1YTEA 5G2HA 1LOQA 2YGYA 3UXDA 3HG2A 1FUYA 3VI2A 2QCDA 1KFJA 1VPXA 5LNUA 3BLFA 2C15A 2J9XA 4GE8A 1S5VA 3ABOA 4TR9A 3UZ5A 5E93A 1O94A 3GXPA 5EY5A 3NOEA 1WQ5A 1WYIA 2DP3A 5A8GA 1JCNA 1TMHA 5AOUA 1SSGA 4RZ6A 5FF7A 4NUWA 3M5YA 1TO3A 3MP5A 5I3KA 2EKCA 5C5YA 1ZALA 4FHAA 3G1HA 3LRLA 1R2TA 3G0UA 2GJLA 3SSJA 1BTMA 1G4EA 4WY0B 4E2BA 3UY8A 1IXNA 3DH7A 2A5HA 1L2UA 4Y90A 4LS0A 4XTDA 3NQVA 1P0NA 3FOKA 3QEZA 1DJQA 3R12A 3RFAA 3A5VA 2OX1A 2YDAA 5FEPA 5LSMA 4LW7A 3C2OA 1XUZA 1UBSA 3FFSA 4JIQA 2ISVA 2P10A 4GXMA 3MHFA 4LY8A 4LV4A 1SZGA 4ZQRA 1KV5A 2JKAA 4N4PA 2RKXA 4O4WA 1VLIA 3BK0A 4XTIA 3O06A 2Y63A 2QJHA 1SSDA 3QW3A 2V82A 4FNRA 4DO5A 5EPDA 1GG0A 3TR2A 2ZCGA 3MYPA 1KBJA 2DZVA 4JX4A 2H3DA 4HN4A 2AAMA 2F7FA 1V5XA 4IPJA 4WJEA 1LOLA 5D37A 4JYFA 4LRTA 1AG1O 2TPSA 2ALDA 2DZUA 1PIIA 1EPXA 3EX1A 5AHMA 5I3GA 1JUEA 2NX3A 4O17A 2RDWA 4AF0A 4I7WA 3GAKA 1THFD 1BWKA 2E1DA 3PB0A 3G1DA 1G67A 4W9TA 3THAA 2CWNA 3G3DA 4XBSA 2OMAA 2Y88A 4HPXA 3I65A 3L5AA 1H7NA 1UUOA 4LC6A 2V5LA 4BF9A 1LBFA 3TX9A 3SR7A 3EWBX 5ABTA 1W8SA 1OF8A 4EWND 1A50A 1FDJA 5CSSA 2RH9A 3CM4A 1I8JA 3A9IA 5F4WA 1OG0A 3W7GA 3BGJA 2VC6A 3P67A 1FWNA 2H6RA 3NQFA 3VE9A 2QCEA 3UPWA 1ME8A 4UNKA 2Z1BA 3TMLA 3PG9A 1L9WA 4GUGA 1GZGA 3GVGA 4N9EA 1EP3A 2Y85A 2ZRZA 3LHVA 3E9AA 1T99A 3PUEA 3G1AA 3ELFA 4OBTA 4IJBA 3O6CA 3NQMA 3TSMA 3L67A 4RCXA 3PM6A 3O1NA 1E51A 3EX6A 4WUIA 1YTKA 3P84A 3HG4A 1K02A 3I7RA 4GC4A 1M5WA 3HGOA 1S5TA 4A21A 3M5ZA 3IGXA 2OT1A 4CNNA 3C56A 4FIQA 1Q6RA 5FF0A 2LLEA 3EX4A 4OE7A 4CCEA 5C6MA 3NL6A 5U4NA 2CZFA 4JTLA 3W7DA 3NQEA 3LCIA 2XFWA 3U2OA 5FEWA 2E6YA 4OT7A 5D02A 1GQNA 4BR1A 2QUUA 4MYXA 3ZWTA 1OFOA 4NJIA 1KM1A 5FEXA 4UTMA 4PL1A 4MJMA 1B4EA 3S1XA 5G1TA 4Z0SA 4MVAA 4QIUA 2NV1A 4JYEA 5F4SA 1HG3A 2TRSA 1KLYA 1OYBA 1LRTA 1H63A 3S0CA 1BWLA 1YADA 1HFBA 3UWYA 4FB7A 2ABBA 3IV3A 5J5DA 1H7RA 2VFEA 5AC8A 2X1RA 2QUVA 2V5BA 3HB9A 4MOZA 2HSAA 4IUOA 2GJNA 2R8WA 1OX4A 2ZRYA 1HTIA 1TPB1 3NO5A 3M47A 3T4CA 1WAUA 4K8EA 3E0IA 1H50A 4FXSA 3O07A 5G2IA 2F84A 2Q3OA 1JCJA 8TIMA 4O57A 4TO8A 3KXQA 3UWWA 4IQLA 1KM6A 1UJPA 4FX7A 3AJXA 1TPEA 4IXHA 5H2ZA 1OF6A 1GVOA 3EXSA 1W3NA 1XKYA 1YXYA 2GQ9A 2QEZA 2DZPA 2H90A 3QC3A 1OX6A 3PSVA 5C2XA 3FYOA 4HPJA 4IMDA 2NV2A 3ZFHA 1IIGA 1FWWA 2QCMA 3PVFA 1D9EA 3G8EA 3P82A 3USBA 4RLIA 2E09A 3PAJA 4N9DA 3E12A 3N19B 4LT9A 2VENA 4WOZA 3EX2A 3EEGA 2BTMA 1VRDA 3TROA 3W1MA 4ZQCA 1HUVA 1PCKA 3N2MA 1GT8A 4Z1AA 5CG7A 4LS1A 3SW6A 1B57A 5BOOA 1GJPA 1XDLA 5EYWA 2ABAA 4QNWA 3TH6A 5CPLA 2V2HA 3G8RA 2J24A 4X22A 3W71A 4PEKA 4LNYA 2ATSA 5AHIA 3M43A 3NQCA 4PA8A 3DXIA 3TNOA 3C3NA 2V81A 2BWGA 1TQXA 1Z44A 2ZZ2A 3CTLA 2A7NA 4Q4KA 5AN7A 4UTWC 2QCCA 4Y96A 4Z08A 4ZQPA 1KTNA 3P61A 4N9CA 5F4XA 1YXDA 3DU0A 3A24A 2YX0A 3F1QA 3TC7A 4AMAA 4DF2A 3TFXA 1QPQA 3QM3A 1W5QA 2YYTA 4UMAA 3TQ0A 3KHJA 3L21A 2WSQA 4FNTA 3LLFA 4ZQNA 3HOJA 1TIMA 4AB4A 2ZTJA 1G4TA 5HUPA 3N9SA 2FPTA 1QAPA 1K8XA 1SR9A 1XL9A 1O5XA 3CU2A 3L65A 5EMUA 1SZFA 4FO4A 2EPHA 1TPWA 3VFLA 5K4XA 1GOXA 3TFCA 1JQVA 4PH6A 2G97A 1EB3A 3NL2A 4UIOA 3DFNA 5IM51 3LXCA 3NQ6A 3W7IA 4LRSA 3INPA 1C9DA 1VH7A 2CZ5A 2KZHA 4O1DA 1TJRA 3P80A 1QCWA 3KFTA 3GDLA 1F6PA 5DBUA 1K7XA 2B7OA 3BW4A 3HGSA 3HF3A 3B0UX 3S9YA 3GDKA 4IMCA 4UTKA 3IGUA 4GNJA 4JTTA 3Q58A 4JDYA 1W5PA 2VKZG 5D03A 1Z48A 4QJ1A 1W5OA 3NXFA 2J88A 4IGHA 4RXGA 1JULA 2GOUA 2H8XA 1R30A 2AGKA 3UWZA 2J6XA 1SU5A 4IXXA 2X16A 3TXVA 3M1ZA 2VEPA 1OYCA 3BW3A 3H53A 5FF3A 2YCEA 2Y70A 3VNDA 4FNQA 3SGUA 2DJLA 1G7VA 1OFBA 1L6SA 4IOTA 1YPIA 4I9AA 3WK0A 3NDOA 5K4ZA 5BRBA 5GVJA 1VQTA 2YFNA 2YPIA 3LCFA 1MO0A 4ML9A 1SUXA 3N2XA 3P5ZA 1KFKA 4AHPA 3KOFA 4UR8A 1IF2A 5HWJA 4OQVA 4LTSA 3LTPA 5EL1A 2QJIA 4AAJA 4ORMA 1MXSA 4Y9AA 2Y6ZA 4ZVJA 3EKLA 1TPVA 3H54A 3PC0A 1QOPA 3U6WA 4K7YA 1I2NA 3ZWSA 2C6QA 3G1XA 3L5MA 4JTKA 5DCEA 1AL7A 1W1ZA 4O1CA 3R5EA 5AYYA 5AB3A 4O13A 3GDTA 3MBFA 3S1VA 1WBHA 4KFOA 3W1QA 2J9YA 3NR0A 2CLIA 1T0OA 4UTTC 2X30A 3DFPA 2FPVA 1W56A 3W85A 2E6FA 4AEOA 4RKAA 2Y62A 5DY3A 1FQ0A 4HSNA 4UTWA 3W1XA 4M7SA 2E5DA 2A0NA 2ZRWA 1H61A 4RX0A 4XZ9A 4IMGA 1LLWA 3MHUA 1LYXA 3C2FA 3R2GA 3W72A 5AFDA 4IMEA 2B7PA 3OHIA 4JTEA 1FCBA 3BARA 4U28A 4FF7A 5TQLA 1Q6QA 2X1SA 1SZNA 4RZ5A 1EWEA 1I2QA 2JBMA 3F4NA 1H7XA 3ABRA 5FEZA 1K8YA 2J27A 4HKPA 1RD5A 2HS8A 4O18A 4O28A 4DPPA 2A6NA 4TMBA 1EP1A 3BG5A 3TK7A 4E38A 4NNAA 1O95A 3RK8A 3OVQA 2C14A 4AH7A 2JKPA 3MI2A 3BW2A 5MHBA 4UTUA 5CPMA 1JCLA 4GBUA 3MW7A 1OK6A 1VCGA 4NZFA 1AW5A 1DQWA 2TMDA 3C0JA 3TV8A 3LOTA 2ZZ3A 3HO8A 2Y7EA 3CEUA 4FNSA 3PBWA 3THQA 3NPVA 1MEWA 2E77A 2ISSA 4NNBA 3UD6A 4NQ1A 2V9DA 5TBOA 1LCOA 1KW1A 1QFEA 3EWXA 5T26A 1JUKA 1EX5A 1HO4A 1RV8A 1OX4B 4MIMA 2BSLA 4MY1A 1W37A 3C2EA 4NJGA 1X1OA 3CQ0A 4EOUA 3NQ7A 4O50A 4NX0A 3ATZA 3A5FA 4MPQA 1H1YA 2DJXA 2PRLA 4N6FA 3IVSA 3L66A 2PC4A 1JRBA 1H7OA 1GG1A 3DI0A 4HHPA 3STFA 1K7FA 5LGZA 5I3IA 1XBXA 1FCVA 5BMWA 5K9CA 3LDVA 4UFKA 1LTDA 5CPOA 3G1YA 1VHCA 3B03A 4NT0A 3LXBA 2XN1A 1FWTA 5KZEA 4RJEA 3GAYA 4M6QA 3CB8A 4UTHA 3WJYA 2PURA 3DKJA 4DF1A 3W76A 3LBCA 4LU0A 2J9ZA 1XXXA 4ZZ9A 2ISWA 1LOSA 5K3VA 3TUUA 3EXRA 1DV7A 2A21A 3I68A 1YXCA 1T96A 1GYNA 6TIMA 4Z1BA 1K8ZA 5LNWA 2QKFA 3SZ8A 3HJZA 5F2LA 5F2IA 1TTJA 3MO7A 4LVFA 2P0OA 2VEKA 5KMYA 3S1WA 3NQAA 3PUDA 3TU9A 4M7TA 4O12A 3IIZA 5K7JA 2DZWA 2QCGA 3OVPA 1V7YA 3GDMA 4GFSA 4K37A 4WX2A 1VGAA 3DHDA 1TPC1 4A3UA 4B5NA 4K7VA 2NX1A 4XKYA 1ONRA 5C55A 4CCCA 5BW6A 1OABA 2Z6IA 2QCDB 2Z2UA 2EF9A 4K36A 4WZHA 1W54A 1EIXA 3MYOA 4IX2A 2PE4A 3WJWA 1R47A 4MKNA 3DGRA 2X1UA 5CSRA 3T55A 1MEIA 3W1PA 3LRMA 3M44A 1YYAA 3NYZA 3QPYA 2G5WA 2H3BA 1I2OA 4BWLC 1OVDA 2VEIA 1H60A 1ZHAA 1X8FA 3RF9A 4U4MA 3DBPA 3W84A 4GUJA 5HWNA 4JDBA 1O60A 5EBUA 2Y61A 3PSWA 4ADTA 4FX6M 1TSIA 1T8XA 5KITA 5BMXA 4N4QA 3I7QA 1I2PA 1JCXA 1KFLA 1RQHA 2DZSA 1NF7A 1EEPA 3MI3A 2NWSA 1WBJA 2A2IA 5LHEA 3EWZA 4R34A 1A53A 4FIRA 3LHUA 2NXIA 1OFRA 5DBTA 1NF0A 3Q94A 1LRQA 3CIWA 3T7VA 1UB3A 3NEVA 4LS2A 3IEBA 5TIMA 5AHEA 1BEUA 4XBKA 2Q8LA 3NG3A 4I7VA 1H5YA 1VLWA 3LM7A 4UMBA 4CLMA 2AQWA 1AW1A 1CX9A 3W2LA 2BLEA 3QZEA 4CNOA 4GWEA 3DFQA 3A21A 1OYAA 3OVRA 1O4UA 4ADSA 4KWVA 2R14A 3L68A 3B0PA 4JN6A 1X7FA 4CCDA 2WOQA 3WJSA 3W7LA 3LERA 3MUXA 4DF0A 3IVTA 4LC8A 1X6UA 1KM0A 1WA3A 1MZHA 4X2RA 3WJZA 1LRNA 5F2MA 2I1OA 4LWWA 1R46A 1VS1A 3W70A 5D2XA 1K7EA 2Z0IA 4MZ8A 1SPQA 2WO5A 3IIOA 1K03A 1SFJA 4LVAA 4HNUA 1VCFA 1EUAA 5DCBA 1QPOA 5A5WA 1Z42A 5AHNA 1RR2A 2ZA2A 3M9YA 3O05A 1SW0A 1ML1A 3P74A 1GVSA 2V30A 2NXGA 3NZRA 3A23A 3T78A 2TYSA 5I3FA 3FJLA 4DO6A 3W07A 4C1LA 1O5KA 3W7OA 4DELA 4EF8A 2C0AA 3QRHA 3KRSA 1FX6A 2WKJA 1RQEA 4BI5A 4YLWA 1ME7A 1VR6A 1ICSA 3BGGA 4E2DA 1PE1A 1DJNA 4AWTA 3GKAA 3GLCA 1OFAA 3N73A 1XUUA 3E49A 1U83A 3PBVA 1AL8A 3YPIA 5KSWA 3Q2DA 3QQ0A 3W86A 1DQXA 5IBXC 5EA9A 3C2VA 1VCVA 3I6RA 2CLMA 2JK2A 1KM4A 4O1AA 4JTGA 3UWUA 3M5XA 4M6VA 4JXCA 3FLUA 4EF9A 3P5YA 2ZRVA 2B4GA 3QMSA 3DHFA 1LP6A 1YPFA 2E6DA 1W3IA 1Y0EA 3CWOX 2A85A 3SFKA 1AMKA 2CLLA 4YCOA 3W2UA 2PRHA 7TIMA 1WXJA 4RK8A 3LHYA 4WQ6A 3E96A 4XKYB 4MZ1A 1GTHA 1XBYA 1H7WA 3QF0A 3NPXA 1GYLA 5G2WA 3B4UA 3UY7A 5HNRA 3BG3A 4ZMGA 3W7CA 2EGZA 5D2YA 1LBLA 1P4CA 1RPXA 3OIXA 1YTDA 2YR1A 4TIMA 1I45A 2QDGA 3LCLA 3CWNA 4UFLA 4J9JA 4NNCA 4Y6GA 4AVFA 1A5SA 1DVJA 4H6KA 4DBEA 1WV2A 4UMCA 1C29A 4FNUA 4Z1DA 2YW4A 1JUBA 2C18A 4QNEA 3LLDA 1SZEA 3N3MA 4Z0JA 4Z1CA 3W7NA 2A7RA 3NM1A 1N8FA 2TSYA 5H91A 3DZ1A 4QAIA 4MLJA 4ONVA 3M6YA 1KFEA 3TE9A 3DENA 3W7QA 2HTMA 5CGQA 2WSRA 1TTIA 4MJZA 2EAWA 2Q8ZA 3KVLA 3GDRA 3W7MA 4I7UA 5D2TA 1EWDA 4O11A 4QISA 5HUOA 4RZ4A 2ZQ0A 5D32A 4NZJA 4A2SA 1B9BA 2I14A 4HT3A 3UNDA 5CKSA 2R91A 4GRSA 1I2RA 1UASA 4O19A 3LX9A 3W7RA 3KRUA 1TV8A 2ZZ6A 3G0SA 3P7YA 1VC4A 2G95A 3L5LA 1NFBA 3NGJA 4JX6A 1GVQA 1FCQA 5HULA 1G69A 1EUNA 3C2RA 5FF2A 4O16A 5LZLA 2ZTKA 3C61A 3W23A 1KTBA 4QITA 5K2ZA 3IVUA 4BFAA 1SW7A 4JR5A 2I9EA 5I3JA 2CLFA 4JYDA 1HL2A 4JTSA 5DCDA 3V1PA 1QPRA 3ATYA 3OA3A 5DLCA 1VHNA 5D33A 1FWRA 3V75A 4S2BA 4IX0A 4FX8A 4Q32A 5BNKA 5F1VA 2CW6A 3TJLA 4AHQA 1DKWA 2OT0A 4JICA 4O4VA 3LCGA 1UUMA 2A4AA 3TKFA 4DO4A 1GEQA 1ZENA 2B7QA 5EKYA 2CLEA 4KFPA 5G1YA 1GTEA 4LVBA 2FDSA 3R8RA 2ZRXA 3UQNA 3B8DA 4BWLA 3FS2A 2YW3A 2ZZ1A 4HSOA 3G22A 1LZOA 4E0CA 3W87A 5D2VA 5FF4A 5D05A 4GJ1A 2ZZ5A 3S5NA 1F7BA 4BI7A 1L6WA 2FB3A 1I4NA 1XI3A 3UWVA 3MHGA 3O6YX 1YDVA 4R7JA 4XWUA 4Y8FA 1QDSA 3TJXA 1OHLA 3KRZA 1F76A 3TA6A 4UUIA 3DFSA 2DORA 1PCWA 1KM5A 4KKXA 3BLIA 2EHHA 3PB2A 3LCWA 1M7OA 5AYZA 4AF0B 3SIZA 4UXDA 3W7HA 2CU0A 2QUTA 1YDNA 4UTTA 3RLUA 1F2JA 1QWGA 2WSYA 2CLOA 2WV8A 4H3DA 3CLMA 3G1FA 2NZLA 4O8RA 2CLKA 3TMQA 2ZFAA 2VFDA 3DAQA 2RDUA 2B7NA 1PHWA 1VYSX 3O63A 4GUIA 1WOAA 4UC5A 1B4KA 3OG3A
chains in the Genus database with same CATH superfamily
1RHCA 1F6KA 1TV7A 2YA1A 3FEQA 4LAKA 4KEZA 3AWOA 1P0KA 1HX0A 4JD4A 4C6EA 5TF0A 2YSWA 4US5A 3BL3A 3BAJA 2AQVA 2ZDSA 1EC7A 1OFDA 3RMJA 3S2MA 5SWUA 3L2IA 3SUVA 3VILA 2QCLA 1K4GA 3BJTA 4EIVA 1MUMA 4AUBA 2IPJA 2OTDA 4B4FA 1R38A 3NQ8A 1H0GA 4Q3MA 4GQQA 3PFMA 4AY7A 3AZTA 2PDCA 2A79A 1XH2A 4UOZA 1U5JA 4Q6XA 1X6LA 3F4VA 2WHKA 3NIYA 4N6EA 5A6AA 4J3SA 3W6YA 3FAXA 3KW3A 2WPBA 4IMFA 3W73A 3GYEA 5HJLA 3H4WA 4C91A 3RLVA 4CU6A 1W3LA 5CC6A 4GIAA 5M5DA 3S83A 2E8ZA 3MY9A 4H19A 2Q3RA 1BKSA 3I7SA 2A3HA 3U9IA 4S38A 2ISFA 2BODX 4MB3A 2VZOA 2VOMA 2FIQA 3IJ7A 2NW0A 3LV5A 1FWSA 1E6SM 2E25A 3R11A 3AUOA 4FSAA 3LCXA 3TSDA 2NVDA 3T2QA 1K6WA 3HPAA 3W7EA 2ISDA 3WEMA 3OBKA 3OLDA 3CYJA 3WEOA 4DQWA 3W82A 2IMRA 4OGZA 1ICQA 5DXYA 4JHOA 1PKNA 5DRCA 3W38A 2CFFA 3SFWA 1F5ZA 1XIGA 3MB9A 1K3UA 3I6TA 1DE5A 5CPNA 2OXNA 3FEMA 1EDQA 1I6NA 1YDYA 1VEPA 4UFIA 1MNZA 3R89A 4JTUA 1Q3NA 1R85A 2Z1SA 1EEXA 1MFUA 4GVGA 1LLZA 4JY9A 3H7UA 4W84A 1HO1A 1ZB5A 4J3UA 3CZEA 2I57A 1C9WA 5J8LA 3F5KA 3GH5A 4N42A 4QEEA 2PCEA 1WNOA 2QF7A 1QO5A 4O53A 3IAPA 2VGBA 3NQDA 1Z69A 3T8LA 1W31A 4ZB5A 4ZL1A 1V51A 3ARSA 2FJKA 2X41A 3AI0A 3TW7A 1TQJA 4S3FA 1A0CA 1OFEA 4H4IA 4HVXA 3D47A 5AHLA 3WK2A 3GVQA 3QFWA 4UTIA 4W93A 4ZODA 2H9AB 4MY8A 4QDPA 2Z6JA 4AIOA 4DPQA 2OWXA 3VOIA 3W22A 1KRAC 3N14A 1W9PA 1DXIA 4S2CA 1AD4A 3TCEA 4MGGA 3ONBA 2A3AA 4NZ3A 2HVNA 4AIEA 3B05A 4HGXA 2QJGA 3AOFA 1HJWA 1D7KA 3HQOA 3AROA 5CSYA 4RV3A 3S2NA 1E6RA 3VMNA 2EJ1A 3FJ6A 4ADUA 4MY9A 2H8ZA 1FP8A 3B9EA 1QMLA 1V3HA 3VZXA 4F4RA 3WF1A 3AMLA 1MW0A 4H6QA 4IIGA 3R1ZA 3AISA 2E9MA 2V5JA 3FGCA 5FL0A 3NL5A 2XSXA 1ZAJA 3RMEA 3WLOA 4NJJA 3C2YA 1V0MA 7REQB 1XLGA 3B8IA 3JZUA 3W83A 3OJGA 1SQ7A 3H55A 4CU8A 4HHLA 2V2CA 3QHOA 4JIHA 3OZMA 1QO2A 1JDCA 4BS0A 3QSRA 1JD7A 2NXHA 3SY5A 4KWOA 3AS1A 4YWIA 2FKPA 1G1YA 4XZHA 3IJ6A 2V3DA 5FESA 2Q6ZA 9CGTA 4WOQA 5G4EA 2P3EA 1B2YA 1XBZA 1RY0A 2HPIA 3VKBA 3WFZA 4MB1A 1XLKA 1Q6OA 3SCWA 3C0QA 2WVVB 4H7ZA 3TC6A 4TXEA 4N9BA 7PTDA 2RDXA 2VI0A 2XIIA 4CN4A 4R9XA 3H8AA 4JQ1A 5CC3A 2EG8A 1TV2A 1BYBA 4IFOA 2VFGA 4S3JA 3R25A 3URBA 1MNSA 4O0KA 3Q65A 2YA0A 3S5OA 2GQAA 2PSNA 2Z1WA 4HU8A 1TV4A 4W87A 1TCDA 5I3HA 4GQ0A 2XM2A 1H1ZA 3A64A 3ANYA 3MUIA 2G0WA 1U1HA 3ITLA 4JGDA 3U4AA 4P8UA 3VDAA 1GVRA 4GVFA 1JGMA 2G3MA 5HMFA 1AK5A 1QBBA 3MCMA 3EBVA 3HBLA 3HMJG 1DORA 5D4YA 2QR6A 4DIAA 1SW3A 4ORIA 3UR5A 3CMJA 3FKKA 3LN3A 3L4TA 3P62A 2PB1A 2QCFA 1OFQA 3SY8A 3WH5A 4EK7A 1TUXA 2GQ3A 1YX1A 1FHVA 5IFTA 3WL1A 4F40A 3CHVA 3OTRA 3JR2A 4O1BA 3PG8A 4H9ZA 4EX4A 3LHZA 3P93A 4OBRA 3FA5A 2B81A 5HR7A 4FXFA 5IRPA 1KBIA 4MLRA 3W25A 2PWDA 1P48A 4R7WA 2PDQA 1KV8A 3WSUA 1ZFJA 3AYSA 3RLHA 1P1XA 3NSNA 4E6MA 2FPYA 1FY6A 5A8PA 3TYEA 1H62A 5LIYX 3P81A 5AC7A 2E7FA 2ZUUA 1E6PA 5MKGA 1W1A1 4R27A 1FCUA 1XQLA 5BXPA 3PS7A 3GNNA 1J2WA 2AOSA 3EWYA 2UY3A 4EVZA 4REQB 4IZGA 3LZ3A 3FIGA 1R2SA 4JFSA 1CW2A 3W9ZA 3KOYA 2ZDRA 2F2KA 4YNGA 2OZ0A 2IQTA 3ZS4A 2E68A 4V33A 3UP8A 1XIEA 2DZTA 5CH9A 4K38A 4NG3A 3N3TA 4B9YA 3G2GA 3QZ6A 3QR0A 1CI1A 3WQEA 2DSZA 4AWSA 4ZA0A 1LBMA 1DBTA 4P61A 4D72A 3NVTA 1W91A 4LAMA 4YTSA 3OHMB 1QXLA 1B3YA 2DZAA 4UCGA 4JTCA 1C7TA 5D09A 3WQ8A 4CD5A 3WQ6A 3C0LA 4OFCA 3W37A 4AHOA 3P8JA 2EXOA 4MZYA 2FYMA 4LV9A 4WSJA 1FDZA 3ES7A 3SN0A 4WIWA 2RGMA 4NI3A 4X61A 2VHLA 3ABQA 4WK9A 2D22A 3ME3A 1XLCA 2JGYA 3U57A 3S5YA 2HEJA 1FXPA 2RFGA 4A2RA 4K1GA 1G9HA 2FTPA 4AWUA 3EEZA 3ZJ7A 3WQ4A 5H8PA 4PRRA 3QH2A 3DG3A 2X05A 1FTXA 1VYPX 1HKMA 4PZVA 1ZAHA 2FFCA 3NJ3A 3E02A 2DUAA 5E5CA 3M0MA 4BF5A 1NWRA 3ITGA 4ZR8A 1W1YA 2NUXA 1WP6A 3P14A 4QE1A 5KETA 3CXOA 2ZRUA 4UR9A 1EJVC 4D2JA 5CC5A 3IK2A 1GPWA 3TN4A 3CK5A 4C5YA 1HL8A 4OV4A 1KBLA 3STCA 4OWGA 2Y7DA 5G1MA 2E40A 4PUEA 1CXLA 4ICNA 4Q33A 2E5CA 3D0CA 5HMSA 2EPLX 4L6HA 4JCMA 4DO7A 4AD5A 3TYBA 3S5SA 4M8UA 2YGYA 2C1GA 1JCTA 4AVOA 3HG2A 3V3WA 4GJIA 5I6SA 1EO5A 1JNEA 4EAMA 2BVYA 3T9PA 3A4JA 3BLFA 2C15A 4C5ZA 4Z2GA 1P0DA 4OIFA 3UJEA 4TR9A 1S2VA 4QRNA 3V36A 3XINA 3ZMRA 4IISA 4O8AA 2YB1A 4HA0A 1WYIA 2DP3A 2P5NA 1KWKA 1DWGM 1CXFA 5FJPA 1ZALA 3G1HA 3LRLA 2PDJA 3LLXA 3UJSA 4WY0B 1IXNA 2A5HA 3HA1A 4Y90A 4LS0A 3NQVA 4M1BA 1P0NA 3QEZA 3PNZA 2CKSA 1VFMA 5FEPA 1Q66A 4LW7A 1B0IA 2HXUA 2ISVA 4GXMA 1KV5A 4R9OA 4DM2A 2Z28A 4FLSA 3QW3A 2D3LA 2P50A 3TR2A 1E55A 1TELA 2WW5A 4JX4A 3EZ4A 2WZEA 3JUGA 5AZ1A 1V5XA 4IPJA 1LOLA 3B0YA 2QGYA 1UPMB 3KDOA 2IKGA 3MZ2A 4K1WA 5E70A 5AHMA 1JUEA 4N7QA 2DW7A 2CWXA 4O17A 3SUSA 3SRDA 3OBAA 3VZYA 4AF0A 4C6DA 3EGJA 1BWKA 2WJDA 2X7WA 2CWNA 3G3DA 2OMAA 1SJAA 2D2OA 5AKQA 4A3RA 5FKYA 1LBFA 3VD5A 3EWBX 3H4GA 4B16A 1G5AA 2J7FA 1J0IA 5A2CA 2PDHA 4AYSA 3MU7A 1I8JA 3A9IA 1E9YB 4P7RA 6XIMA 1W1VA 1OG0A 4PBGA 1FWNA 1CCWB 4MJ2A 1CTNA 2Z1BA 4JIRA 3OYXA 4GUGA 3GVGA 4N9EA 1RBAA 2HNHA 3TOYA 3LHVA 2X1IA 3ELFA 2E1WA 5D8ZA 1HNYA 5I2UA 4XZMX 3K1DA 1WDRA 2D2JA 3P84A 4ZCWA 2F2HA 3HG4A 4G6CA 2PU1A 4GC4A 1CGVA 3UG3A 1S5TA 1EOKA 4KIRA 3M5ZA 3IGXA 4PUUA 4GQGA 4CNNA 4FIQA 3I10A 5FF0A 2LLEA 3EX4A 3SCOA 4ZFCA 1CLKA 1FVPA 3NL6A 3QLDA 4JTLA 3AMDA 2D2HA 2XFWA 3RX4A 3W28A 5EMJA 4OT7A 4DZAA 4YVPA 1S2WA 4R3UA 1OT1A 4BR1A 2QUUA 4HCHA 3EOEA 1PEZA 4UTMA 3PN8A 3HMCA 5G1TA 2JALA 2NV1A 2BGSA 1HG3A 1QATA 4HZ7A 1LRTA 1H63A 1JPDX 1XIDA 3CO8A 2PGRA 1BWLA 4MKVA 3UWYA 2EG6A 1XC6A 3RDKA 2FZMA 2DT3A 3WDQA 1BXCA 4ZOBA 2CITA 1HJSA 2XGZA 2V5BA 3HB9A 2HSAA 2WMHA 4IUOA 2WANA 3UZYA 2Y5SA 1KD0A 1A5MC 3M47A 3T4CA 1A5NC 5G2IA 2J4GA 8TIMA 3KXQA 2WM0A 2QJMA 1MRQA 3PZNA 1L0PA 1UJPA 4CQBA 4OOUA 4J3ZA 2PDYA 3O3RA 4NRRA 3SCPA 3EXSA 4HNLA 2ZXQA 1GJUA 1REQB 2WMKA 1XIJA 1IIGA 1WO2A 3GRIA 4W8AA 4P8XA 3USBA 5ENLA 3E74A 1V3LA 5KEZA 3PAJA 4N9DA 3VGHA 3WG6A 2BTMA 1PX3A 3E0VA 3TROA 2P53A 1D3CA 2PDPA 1PCKA 4GYJA 3THDA 1BD0A 3J7HA 3BMWA 3SW6A 2PMQA 3KLLA 2ABAA 3TCSA 4EPDC 3VGEA 4X22A 2Y8VA 5AHIA 3TTSA 3TNOA 4YYFA 1TA3A 3ARVA 1KGUA 2ZZ2A 1O6IA 2A7NA 5AN7A 4Z08A 4Y96A 3M7SA 4I5UA 1KTNA 4N9CA 4XAZA 1YXDA 2WVTA 5FJIA 2YX0A 4XAPA 1BF2A 4DF2A 3QM3A 1W5QA 4LEQA 2WQDA 3UZZA 3KHJA 1NWTA 3N4AA 2ONEA 3I6EA 4FNTA 4W7VA 2QGHA 2ZTJA 5HUPA 2GVYA 3EDJA 1JDAA 4CU7A 4GHRA 4YVXA 1O5XA 3L65A 2EPHA 4JHMA 1GOXA 1V6TA 1EB3A 2BXYA 2Z2BA 3NL2A 4FLOA 1P6CA 4DJEA 3H4XA 3AZSA 3RGTA 3W7IA 4UQBA 1X98A 2KZHA 4O1DA 4QAWA 3KFTA 3AALA 3VVGA 5JVLA 1OADA 3MDUA 3HF3A 3B0UX 3S9YA 1GNXA 2E9LA 3WX7A 5DT7A 5AC4A 4H8VA 4JKMA 2ICSA 3OB8A 1CLVA 2C71A 3FSTA 1XLFA 4P5UA 4HA3A 3Q58A 4R85A 2PLJA 1GHRA 5D03A 4JHZA 1A3WA 2P88A 4HYVA 2EPOA 2J88A 4RW3A 3VD7A 2XDFA 5KZ6A 1N82A 1NU5A 3RLGA 3TXVA 3ANUA 3OODA 4NYYA 2BHUA 5FJRA 4E8DA 2O55A 1GEHA 1BWVA 5FF3A 4J3TA 4O0QA 5T8GA 3WDPP 4V27A 1CXHA 4RDWA 4CGTA 1B3ZA 3RM8A 4C6BA 1H4PA 2YFNA 1E4NA 2YPIA 1C93A 1SUXA 2CCRA 4AHPA 3KOFA 2DIEA 4UR8A 1Q65A 3MVTA 3BQ5A 3LTPA 4H7VA 3V35A 4ORMA 2OG9A 5HPCA 4HB7A 3EKLA 1QOPA 4K7YA 1I2NA 3ZWSA 1ADSA 3G1XA 4JTKA 2D0HA 1BYCA 4XKMA 4Y9PA 2BOEX 1W6TA 4AZCB 1LL4A 1UWSA 4QE5A 3IUDA 4KFOA 3NR0A 2CLIA 1T0OA 2X30A 3OZOA 1W56A 1MZRA 2Y62A 4XZNX 4HSNA 3IWPA 1U5VA 4RX0A 1U1JA 4X9YA 3IRSA 3VNLA 3RPTA 3R2GA 3W72A 4ICMA 2OYKA 3FW6A 2PDFA 3BARA 1ENUA 4U28A 3L4YA 3B3DA 3EOUA 5TQLA 1Q6QA 2X1SA 1R3VA 3BLDA 2BFGA 1I2QA 1XLHA 2OZ3A 1FOBA 3F4NA 3WD4A 3WL0A 5FEZA 1K9DA 4HKPA 5E6ZA 1HGWA 4G2DA 2R1NA 1HP4A 1O95A 3FN9A 3MI2A 3BJSA 2ZVIA 1OK6A 1AW5A 3C0JA 2PZNA 2VT0A 4KPLA 2W5FA 4FNSA 3BLPX 3GW0A 4AZIA 3QTPA 1LCOA 2HDJA 1JD9A 4NY2A 2GK1A 3H12A 4I9TA 4GY7A 4Y2WA 1OX4B 4L5ZA 1MWOA 1W37A 4MY1A 3C2EA 1X1OA 1WKEA 3CQ0A 2W66A 3WF0A 4AIUA 3ATZA 2VVSA 4GXPA 3AWNA 2AAAA 2VL4A 2PRLA 1S2AA 3BOFA 3IVSA 4E2VA 3B9NA 2PDMA 4P7NA 3TYCA 2DW6A 5E6YA 3H22A 4I8DA 5D9MA 5I3IA 5I00A 1TE1A 1FCVA 5A6BA 1VHCA 3H2NA 1TWSA 4NT0A 4E3TA 4H2HA 5A94A 1LWJA 4UTHA 2Z00A 4DNHA 3B8VA 4D9PA 3DKJA 1BRLB 2V5DA 1RP8A 3OU8A 3CV2A 3W76A 2POZA 4YVVA 5BU6A 3LBCA 3GXDA 4H01A 2GWGA 3AJ7A 2WKLA 4F66A 2PGFA 4TV5A 6TIMA 4Z1BA 5LNWA 2QKFA 4S3AA 3BOLA 2WK2A 5F2LA 3SZ8A 4DUVA 1WDSA 2XIOA 2NQ5A 3R58A 2VEKA 2D3NA 3S1WA 1E9ZB 4ZB0A 1RY8A 2DZWA 2E3ZA 4K37A 4WX2A 1U33A 1VGAA 3UGVA 3DHDA 4MAZA 1TPC1 4A3UA 1I1WA 1ONRA 3N25A 1EPVA 5BW6A 3WNLA 2Z6IA 3C86A 2XGIA 1VFOA 2XVLA 1EC8A 4CD8A 4WZHA 1EIXA 4PCTA 2G4JA 2PE4A 3APYA 3AUJA 1R47A 3AIWA 4PMVA 1MEIA 1MW1A 3LRMA 4GXWA 1J18A 4GKTA 3M64A 1M7JA 3TC3A 2G5WA 1F9CA 5HAOA 1KXHA 1QI2A 5HWNA 3AYVA 2KAUC 4UQCA 4CNUA 2DPEA 4WVXA 4N4QA 3I7QA 3F4DA 4HBKA 3I3EA 2NWSA 4FPSA 3EWZA 3LHUA 4WDWA 1US0A 2QQ6A 4D6FA 2I7GA 1NF0A 2HROA 4RL3A 1VIZA 3RX3A 1NELA 1UB3A 3NEVA 3JZEA 3IEBA 5TIMA 3VZZA 1PZ1A 2Q8LA 4UMBA 1H5YA 2BOFX 2BLEA 1QASA 3WIJA 3MSRA 1JZ6A 1XLJA 4C6CA 3MSYA 1EYWA 4ADSA 4A3YA 4KWVA 2R14A 3B0PA 1KC7A 2YDRA 2Y8UA 4CCDA 1UIOA 3WJSA 3MUXA 1JYNA 3CL6A 7ODCA 4ZGYA 1KM0A 3VOJA 1OGSA 4FOKA 4X2RA 3WJZA 1LRNA 5F2MA 5HBFA 1VS1A 3GYCA 3FNDA 3WQFA 3ITXA 4DYJA 2WVVA 1VCFA 4H9TA 2YCLB 5A5WA 1SW0A 1C91A 1W8GA 1L8NA 1TJ0A 3AFBA 2TYSA 2XZ7A 3VYLA 3WQCA 4EF8A 2C0AA 9RUBA 3IUHA 5FAJA 1MW2A 4BI5A 1ICSA 4PB5A 3BGGA 4DHGA 3WLHA 3VMPA 4AWTA 1X6NA 2HRWA 2J8GA 4GVIA 2DDXA 1AL8A 5DMLA 1CECA 3C2VA 3BZGA 4AD1A 4M6UA 1HKIA 1X96A 2VQUA 2JK2A 3UWUA 1LQ2A 4JXCA 4JNYA 3P5YA 4IQJA 4H1ZA 1ZQ5A 1LP6A 3U2CA 3LU2A 1W3IA 4IT1A 3CWOX 3SRHA 4BQ5A 2DGAA 2Q71A 2GJXB 3PJXA 2PRHA 1R3RA 3CHCA 5BROA 1WXJA 4K2SA 3VNIA 3LHYA 1DEDA 4WQ6A 1GTHA 3FDGA 1XBYA 4YTUA 1Q2RA 3QF0A 4HYWA 1GYLA 2ZC1A 4I3GA 3UY7A 1LUCA 3WNMA 2YDSA 2FHFA 1SZRA 3BMXA 1VBGA 3GHUA 2DSVA 1DIEA 4JKLA 1I45A 2YXXA 4WJ8A 3KHDA 3P3BA 3B9AA 4NNCA 2WMIA 1IHIA 4H6KA 4DBEA 1C29A 3AICA 4D6EA 2OEMA 4HCLA 2PODA 4QNEA 3TTEA 3LLDA 1BGGA 3PTKA 3L4WA 4Z1CA 3EOOA 4UQEA 1JFHA 1N8FA 1NM9A 2ZX5A 1WKYA 1YRRA 1AH0A 3M6YA 4XV0A 2YIHA 1KFEA 1QPKA 1UWTA 2WSRA 3LA4A 3KOWA 3W0KA 2EAWA 3WH7A 2Q8ZA 3QZAA 4J2MA 5D2TA 2C79A 4EXQA 4O11A 4F0LA 4QISA 5HUOA 1LL7A 2YXOA 1XYCA 3DHUA 4NZJA 3RAOA 4PYSA 4AY8A 1O12A 1I2RA 1UASA 3LX9A 3KRUA 1S5NA 3WENA 5I3DA 3QHMA 1NFBA 4WLCA 3NGJA 1FCQA 5HULA 4L61A 5FF2A 4AD0A 2ZTKA 3CAKA 1XIBA 3TVAA 3L2MA 4PBEA 4QITA 4A8NA 4CCZA 4BFAA 1XG4A 1SW7A 3WZ0E 4RZBA 2PTYA 3RG6A 3V1PA 1QPRA 3ATYA 3SQSA 1VHNA 3W6LA 4IX0A 2ZXBA 3TJLA 3LPFA 3S46A 1EIBA 2PLCA 1UUMA 1ZU8A 4DO4A 1S1RA 1GEQA 4IP4A 2CLEA 5M2FX 2FDSA 3R8RA 3LG3A 4W85A 2ZRXA 1M1BA 2YW3A 4C6MA 1LZOA 2ALRA 3LM3A 1Q8AA 4FAMA 2ESCA 4YTQA 5I7GA 5D05A 4GJ1A 4AD4A 3S5NA 1XI3A 1O7AA 3MHGA 1X97A 1YDVA 2IUZA 3O2LA 2FZ8A 3GDBA 2C0HA 2FDMA 1HJXA 1W9VA 2WLZA 2X8RA 1F07A 1VAHA 3AIQA 3ALGA 3NYDA 2Y5JA 1PCWA 1BYAA 1V6UA 4IJCA 3BLIA 1A49A 4M1RA 3PB2A 3LCWA 1M7OA 2DT2A 2B31A 2VZSA 3BH4A 3GUGA 3H23A 3W7HA 4F8XA 1EJUC 2V3GA 3RLUA 3CZ8A 3VIPA 1QWGA 2WSYA 3DDMA 4IIDA 1QI5A 4A4AA 3SCUA 4GIYA 1UC5A 4LUSB 1J12A 2FGBA 1V7AA 2MUCA 4L9YA 3TMQA 2ZFAA 2VWSA 3DAQA 2CBIA 5BXRA 4LANA 4FLQA 2OELA 1WOAA 4UC5A 1B4KA 1XYLA 3N6JA 2BGQA 4KCWA 4G7EB 2QULA 2PWUA 3N4FA 3R0DA 1I75A 1WDWA 3HIJA 3SM0A 4DM1A 4CNPA 4UFHA 2QDEA 1UD8A 4K68A 2WMJA 3W2KA 1SO4A 4ATDA 4L4LA 1E0UA 1AQFA 4TVCA 4ZSUA 1LG1A 2FMOA 2O7QA 3F2CA 4YXGA 3G24A 3LRKA 5CG0A 3NO3A 5B7ZA 3RPMA 1JR1A 1EO7A 1UWIA 3KL5A 4D8ZA 1BLIA 1HKKA 1F74A 2BX7A 1RLCL 3QXBA 3SGZA 5HDRA 4DJFC 3WLKX 1XM3A 2R1PA 2HVMA 5E9AA 2Z29A 1A5CA 1H7PA 1RCOB 1XQKA 1W9BM 4WKHA 3C52A 3O9NA 3KWSA 2CZVA 1P6BA 3HGJA 4HU3A 3FYYA 2DY3A 2YL6A 3T2PA 4XZIA 1KCKA 2C1IA 2B0MA 2OGYA 2XTKA 5C2CA 4LAOA 2PP3A 4B5SA 1LM1A 3LTSA 4JTJA 4CVUA 3WJXA 1DWHM 3GNDA 4YMZA 4WY0F 3QQ1A 3G77A 4D6CA 3GK0A 4O52A 4H9MA 3CAVA 1ME9A 5K9DA 2DV0A 2V5CA 1MEHA 2WYSA 2QAPA 2VRQA 1FH9A 4G1KA 5LHFA 3WK1A 3MO4A 1UMLA 1WOBA 1H5VA 4B3LA 4DRSA 1FWHC 5TD4A 3VKDA 3QLLA 2R1KA 1V0LA 1XLAA 1O5RA 1Q45A 1P0BA 3VINA 1FXQA 1E3ZA 3AHYA 4F79A 1WXYA 4LOCA 4OU1A 4XD4A 3IS4A 3VXGA 3AIVA 3BAXA 1IXPA 2OWWA 1MUCA 1JNDA 5FCZA 2DZXA 1OCJA 2W79A 1F05A 2HS6A 5JH1A 2ZC8A 4PL2A 4DJDA 2GWNA 5LNVA 4D8LA 4PTVA 2ZWYA 4UTJA 2PTXA 3E0WA 5CJMA 1TCMA 3N18A 3G18A 1S3HA 4XG1A 3TYAA 3FYPA 4DXKA 4C1KA 4AWEA 2PRMA 1Q13A 1O1HA 1ITXA 4NJKA 4QLJA 4UFJA 5C9XA 4D1JA 1W5NA 1DTNA 3S2JA 1SFLA 4GACA 1AQ0A 2ZZ7A 3RU6A 1DQUA 1M68A 3GY1A 1TJPA 4QS5A 3IGHX 3IJ9A 3DI1A 4ROQA 2OKTA 4JTRA 2RHGA 5KZDA 1Q7ZA 1UZDA 1TPFA 1QHZA 2IPFA 3HPXA 5EMKA 4GKLA 3F4WA 4XVDA 3S3GA 2PTWA 2OLHA 4K8HA 1IEWA 4HK6A 3NZQA 4LB4A 1PZ3A 5CBIA 1IEXA 1UQYA 3LHTA 3W01A 1V3JA 3RO6A 3SUWA 1S5WA 1ZUAX 5L6UA 1L6GA 5JBEA 3LBMA 4P8VA 2WBKA 3B8WA 3BG9A 2GPTA 3T44A 1A5KC 4S23A 4BEQA 1MW3A 1BKHA 1E56A 4JTIA 1OT2A 3M16A 2YFOA 3RN6A 4KGLA 1V3MA 1KR0A 2YJQA 5D9NA 3FKRA 3SRFA 3G1SA 1DXFA 4CQAA 1Q6EA 2C7FA 2VZVA 1W0MA 1BHGA 5BXTA 1X1ZA 3CT7A 5C9WA 1OGBA 4GH1A 3S2LA 2XH4A 5G5IA 3OYZA 1TR1A 3LV6A 2ZA3A 4B5UA 3AU2A 1A80A 4UFMA 2WJZA 1WDPA 4BJHA 1TFVA 4B15A 1GPFA 2GUYA 2J7EA 1HIZA 3TQPA 3G6LA 3VGDA 4O15A 4MJ4A 4QBXA 1XLBA 3VE7A 3VABA 3GC5A 3QHNA 4NVTA 4KBXA 1TPUA 1TE6A 1TPH1 4Y9OA 4K6AA 1D3HA 2WSPA 1A4MA 1QR7A 3NAVA 1IT8A 4Q8WA 3HQ1A 3KBVA 5HWMA 2CLPA 5IXEA 1GOMA 4BF7A 3RR1A 3L0GA 4HNTA 1LORA 1QOQA 2YBVA 1PTGA 1NVMA 1HJVA 5U7SA 1IGWA 4JTQA 3WF2A 5LGXA 1OX5A 2ASHA 2DVXA 1WX0A 3M7WA 2QCNA 1VZWA 3T0BA 2BVDA 2FGLA 5D2WA 5CZTA 5I06A 4Y9MA 3MVIA 4HNOA 3M0YA 1HVQA 1JPKA 4S1FA 2VFFA 4L1GA 4HD5A 2DEPA 4EPEC 1KXTA 4GA8A 2WMFA 3EMQA 2J7CA 2YA2A 2W0UA 1BG4A 4KESA 4RR4A 3C8FA 1B3OA 1JQXA 3V16A 1ZS2A 4WXZA 1XDMA 1GKQA 1TVPA 2V69A 4JOMA 3SI9A 1V08A 1UD3A 1U30A 5E0KA 5EB8A 3CAWA 4MHBA 3R7MA 2CZEA 3E2QA 4W88A 1GOQA 1C7SA 4J4KA 2Y2WA 1PL9A 3PZGA 4B5TA 4DJFD 4IP7A 1EKOA 4GZEA 1VF8A 3KTSA 1NSJA 4JIEA 1RP9A 4S3KA 1VP5A 4MYAA 3FSUA 4Z2IA 3ORWA 1XW8A 1J4EA 4YIWA 3M0IA 1Q6LA 3W2NA 1R9YA 1F8MA 2UY5A 2J7DA 5DXXA 4XVEA 1CENA 3MKCA 4UR7A 3UXLA 3VCNA 2JEQA 3K30A 4KT2A 3CC1A 3RNDA 3C4UA 1V6WA 4O14A 1TWWA 4H9YA 3N1AA 2YB4A 2P76A 3AXMA 3W29A 3PZIA 3HPZA 1UZ1A 3HQPA 4L4MA 3GG8A 2J25A 1S46A 3JRKA 3ID7A 1S2TA 1KRMA 7XIMA 3OZYA 3UJRA 4QM1A 1HP5A 3QYQA 4US5D 3L0KA 1E4MM 4IL0A 4ILSA 3VTRA 4A6GA 3H7RA 2G96A 4BQ4A 1EQPA 3OW1A 1TYGA 2A3LA 3TSBA 2BOGX 1F8IA 3NPWA 4XAYA 4TX6A 2VFIA 3NQGA 3KRBA 3QMTA 2IS7A 1UR9A 4NX5A 3CIVA 4LYQA 1HQTA 3PF3A 4DX3A 4FXRA 4QDWA 4OOZA 3B04A 2BXZA 3LPPA 2HVOA 1K77A 4DVOA 4ECLA 3EKZA 5H8MA 4CEXC 4H7CA 3R8GA 3PANA 1QHPA 3NO1A 4A29A 1VYRA 3E2VA 4NHVA 2BBFA 4QQ3A 5IBXA 5F7UA 3ZYZA 2WZIA 5L9FA 3UGRA 1DPMA 3GHTA 4WJXA 4R7OA 2OSWA 3R79A 3R6IA 3TQVA 4Q8NA 4O10A 4ZQOA 3EB2A 4HP5A 1G4SA 4OECA 3S1UA 4WXYA 4XSMA 1VFLA 2QDHA 1PKLA 5LXXA 3H2MA 3ZLFA 2UWFA 5ABHA 3LUTA 3KAOA 1XC4A 1XS2A 2YOCA 2W9MA 2ZA1A 2PTDA 1EH9A 2A6LA 5HA7A 5G2HA 1LOQA 3UXDA 4AX7A 2PWEA 3SQLA 2ON3A 2QCDA 1QNPA 1KFJA 2QVNA 4JNZA 5LNUA 3KCLA 5AY7A 2X09A 3H2FA 5DT5A 1R87A 1DP0A 3B97A 1S5VA 5CSUA 3ABOA 4ZO9A 5E93A 1NOWA 2HXTA 3N04A 3QTGA 5EY5A 3NOEA 4GBDA 5LIKX 1QK0A 1E1CA 3WO8A 5A8GA 3WY1A 3ZQ9A 3NVDA 4NUWA 3M5YA 4C60A 4ZSTA 1UIPA 1F61A 4FHAA 2WXDM 3WUBA 1R2TA 1CIUA 3VFCA 1DJHA 1G4EA 3VOHA 3UY8A 1B90A 4HPGA 3FOKA 1FP9A 3GIQA 3R12A 4AX6A 2YDAA 2VX6A 5LSMA 2XSAA 4IIBA 3U0HA 2P10A 4LY8A 3MHFA 3BLLA 3ERPA 1ZJHA 4N4PA 1GVYA 1VLIA 5ECUA 2I5QA 5A8MA 2AMGA 2IPGA 4C1NA 1FA2A 1GG0A 1E6ZA 4LAZA 3AMGA 3K2GA 1Z32X 3PK7A 4MF4A 2QW5A 3LMYA 3HQNA 4HN4A 1GYMA 1XIMA 4C65A 2RUSA 1Z89A 4TOQA 4WJEA 1ZLPA 4HK5A 3KOZA 1ZGDA 3RRXA 4DXXA 3ZSSA 2ALDA 2DZUA 3R10A 1PIIA 1EPXA 2NX3A 3DCPA 1H49A 4F0RA 1IE7C 3NDZA 1KO0A 3VC6A 1TKKA 4PRTA 5REQB 1XPYA 3DG6A 3W26A 5IHSA 1RK6A 1THFD 2J79A 1G67A 3QV8A 3THAA 3ZT6A 2BVWA 2VX4A 4XBSA 4A3QA 4BF9A 1H7NA 2V5LA 3VNYA 3TX9A 3SR7A 4Z42C 1W8SA 4URIA 1CT5A 2QMJA 2PDXA 2RH9A 2QYGA 5F4WA 1V3KA 3BGJA 3MZNA 5A6JA 3CHEA 3VE9A 4D1IA 3OLEA 5DX7A 1ME8A 4CD4A 1UZHA 6XIAA 3MCNA 1EP3A 1TJ2A 1XYFA 4IQDA 3E9AA 3BGAA 3UPMA 4QR6A 4MWAB 3ALFA 3NQMA 3TSMA 5BZAA 3L67A 2XFYA 1TMLA 4KW2A 4H04A 1BVZA 1NJJA 2CXGA 4BKNA 9XIMA 4LYPA 1M5WA 1Z7AA 4GZJA 4OE7A 5C6MA 3O0FA 1DWFM 3LSCA 2CZFA 3VPLA 3W7DA 3LCIA 1V6VA 4FXJA 1XYAA 3U2OA 5LA2A 2G41A 2VRKA 1GQNA 3TOPA 2NSXA 4DJEC 1WXZA 1Q4WA 2R24A 1OFOA 2YDQA 1W1PA 1R86A 4HMNA 2D1ZA 2OODA 4Z0SA 5HNUA 3H2EA 4QIUA 2G8ZA 1OEPA 4JYEA 4GX9A 4B9ZA 1L8PA 3CB3A 3T1GA 2HNEA 3LMZA 3AYTA 4MAVA 4QDMA 1HFBA 2Z1VA 1HXJA 3W00A 1H7RA 5A6LA 3M0XA 4U5KA 5CQ1A 4ZE5A 1O5QA 1ZZMA 2H9AA 3ZJ8A 3T0AA 4HZMA 3NO5A 1J6OA 3E0IA 1H50A 3O07A 4C6JA 2F84A 1HL9A 1JCJA 3UG4A 2ODOA 2F6XA 4GH3A 1XGZA 4CKQA 3AJXA 3N11A 3UBPC 1OF6A 1YKWA 3BLKA 1XYZA 1TWDA 4TV6A 2GQ9A 1W1TA 5G4HC 3PSVA 1D8CA 4MUPA 2PWFA 2AL2A 3FYOA 5DRIA 1PAMA 1RSCA 4MNMA 1TR9A 1YNPA 2NV2A 3ZFHA 4HSHA 4HOWA 1D9EA 4AVNA 3G8EA 3ECQA 1FHUA 3QOMA 3TLQA 4WOZA 3EEGA 1VRDA 5BCAA 2YCLA 1PSCA 1E0WA 1UJQA 3VGFA 4LCQA 1GT8A 4L64A 5BOOA 4OVXA 4B3ZA 4GFIA 2OFJA 2NT1A 4QNWA 1IEIA 5A6SA 1E71M 2ADAA 2J24A 3W71A 1NOUA 4PEKA 1CNVA 2ATSA 5C9RA 1SJDA 4PA8A 1V0KA 2Q01A 1I9CB 1UP0A 1JPIA 2BWGA 2D2GA 1TQXA 3CTLA 2NQJA 1WUFA 3AS0A 4Q4KA 4UTWC 2QCCA 4ZQPA 3UT0A 2CC0A 4GOAA 2HK1A 1VFUA 2DSUA 3DU0A 4NKCA 3A24A 4MDPA 4Q4OA 2ACUA 2AGTA 3OQEA 2P0IA 2OEKA 2G3NA 4UMAA 3TQ0A 4H41A 4RE4A 4ZQNA 1TIMA 3N9SA 1K8XA 1SR9A 2F6UA 1YW1A 3CU2A 5EMUA 4YHEA 4ZE4A 3UU0A 1FWGC 1CZ1A 3GH7A 4OUIA 3TFCA 1JQVA 2DH3A 2VCAA 3QR1A 1AA1B 2G97A 4UIOA 3DFNA 3LXCA 3ARWA 4EACA 4LRSA 1C9DA 1GHSA 1ZJAA 1AQHA 1TJRA 4DN1A 3P80A 3NURA 1F6PA 4TUFA 1K7XA 2O0TA 3CUIA 4IMCA 4UTKA 3RM9A 4GNJA 1E1CB 2VDHA 4J3VA 2QV4A 5AECA 2D0GA 4I6VA 4IQEA 1DJWA 1JG9A 4I5XA 5DF0A 4Q4RA 3RM4A 3ARUA 1JAEA 1XH1A 2R6OA 3QY6A 1W3HA 3WLRA 1GKPA 1OWQA 3NXFA 4IGHA 1JULA 3A4AA 2GOUA 2H8XA 1R30A 2AGKA 2CYGA 1XGDA 1SU5A 2X16A 2VX7A 3L12A 1KQZA 1OYCA 3IV8A 4J28A 1DE6A 4Q4SA 4IGSA 4FS9A 3QPEA 5A2BA 1H41A 4B3KA 2G4FA 3TTYA 3CQKA 3VIMA 3OGRA 4ATWA 4ML9A 2OGJA 3PPCA 2CHOA 3TONA 3T07A 5EMMA 2CESA 4AIBA 3WD3A 2HBVA 3MKKA 1AZ1A 5A2AA 1MXSA 3UCDA 1BPLB 4ZVJA 2AQOA 3GFZA 4D6DA 3TR9A 4XUYA 3N2TA 1AL7A 3GR4A 1W1ZA 4O1CA 2VURA 2DH2A 3AMKA 4K8GA 5CBJA 4Q8UA 1DIOA 3GUWA 2J9YA 3SSZA 1AH3A 3W85A 2E6FA 5DY3A 1FQ0A 4UTWA 3W1XA 1YIXA 2OOFA 4PMZA 2A0NA 3E38A 4X0VA 1E6XM 3MHUA 5GNZA 5A6KA 8RUCA 4QCFA 3C2FA 3KZSA 2WHJA 2Y4SA 1WZLA 3V4BA 4IMEA 2B7PA 4JTEA 1FCBA 4FF7A 2VEGA 5CZKA 2PDNA 3L7RA 4RZ5A 1RVKA 4QX4A 1EWEA 3XIMA 4FALA 1H7XA 4QCEA 3T8QA 3ABRA 5I78A 2PGEA 3LENA 4HPHA 2WHMA 4DPPA 4TMBA 4DAIA 2NT0A 3F5LA 4NNAA 4PMOA 3RK8A 3MUZ1 1E43A 2GUBA 1WKDA 2ZOXA 3VNJA 2CHNA 3BW2A 4OUEA 3ZO9A 1UPPA 1VCGA 4NZFA 2YL5A 4DNMA 4FA3A 2ZZ3A 3HO8A 1AVAA 3EMZA 3GW3A 3RRAA 3VDCA 3N6HA 3THQA 1A5OC 3NPVA 4JIIX 1VJSA 2Y24A 4NNBA 3UD6A 1MVYA 4IICA 1UWRA 4HK7A 3UG5A 1KW1A 2WC3A 1E0TA 1QFEA 4CEUC 1EX5A 1JXJA 3RITA 1RV8A 4MIMA 1EJWC 2Z2AA 1UBPC 4L80A 3KLKA 1XLDA 3WLMA 3S6OA 3A5FA 2BHYA 3MMDA 1QU4A 3R4IA 1F6YA 1JRBA 4M80A 4LEFA 2Z25A 3CLWA 3DI0A 2WHLA 1S38A 3UERA 1RJRA 3POHA 3UR7A 5BMWA 5K9CA 3LDVA 1C92A 5CPOA 1DTUA 3B03A 3WDHA 4AZCA 2XN1A 1PYMA 1FWTA 3WH6A 5KZEA 4L56A 4RJEA 1GW9A 1ZPTA 3ITTA 4M6QA 2VGGA 3WJYA 2G3FA 2PURA 3BMVA 6REQB 1FHLA 1E5NA 3M0KA 2RJGA 4KMQA 1ZP4A 5CC7A 2NLYA 3DECA 4LU0A 3ARZA 3QV9A 2ISWA 4FR6A 1J0ZA 4ACYA 3EXRA 3WBAA 4CQDA 1T96A 1Z9AA 1UP2A 3VOGA 1I60A 3PBGA 6CGTA 1TTJA 1UWAA 3AS3A 2O9RA 1XIIA 3TEVA 1WZMA 5C9UA 3EDFA 4M7TA 1TZ9A 4DJDD 3WNKA 1YE4A 5JMUA 1W9DM 4GFSA 4WDXA 4X0NA 2QPUA 4XAFA 4B5NA 4K7VA 4XKYA 5A8NA 2J66A 3GFXA 3HM7A 5C55A 1K4HA 1Y5XA 3ICJA 1W54A 1ADDA 1XH0A 3MYOA 4IX2A 1YNQA 4YS1A 3TN6A 3WJWA 1BF6A 2XGBA 3E0LA 4MKNA 2X1UA 4L6DA 4BZYA 2W4XA 3T55A 4Z2LA 3CMGA 4H00A 4Y8EA 3NYZA 2E8YA 1W2PA 2Y0FA 1BAGA 1RK5A 1OINA 4GUJA 3W84A 3GXMA 4JDBA 5JQ9A 3BWWA 1O60A 4E4FA 3V0SA 1TSIA 3PHAA 1KFWA 1NF7A 1EEPA 3MI3A 1UR3M 4WEVX 1WBJA 1UR2A 1ZTVA 1A53A 1OFRA 4QHRA 5DBTA 5C8BB 2BY3A 1LRQA 3VX0A 4XK2A 4JKKA 4DUWA 1R7AA 4L7ZA 2DSKA 5AHEA 1UA7A 1PBGA 2AQWA 1AW1A 2YLAA 3OLGA 3KBNA 3W2LA 3IJIA 3IPWA 3LEPA 2D20A 1E4IA 4TVUA 1OCBA 4BQ2A 4S3DA 5I03A 3W7LA 4DF0A 3OIHA 4QJ4B 3VDBA 3BE7A 1K9TA 4LC8A 3LQLA 2VCBA 2VOTA 2VMFA 2J7GA 4QE4A 5M03A 4J3WA 1GOKA 1R46A 4CUCA 3W70A 1K7EA 1SPQA 1RXOB 2WO5A 3KL3A 5B80A 3LNPA 5DCBA 1ODUA 1Z42A 4E5TA 4AZBA 3TW9A 3T78A 3KS5A 5I3FA 3F2BA 3W07A 3OBEA 4M0XA 2ZUWA 3QRHA 2WKJA 2XVPA 3KDNA 3UXIA 1VR6A 1EGZA 4YTTA 3JU2A 2V38A 1RLDA 4GZIA 1Q4NX 1JXKA 5FIPA 3N73A 4AZ5A 1U83A 2GGIA 3YPIA 1GVIA 1GQJA 3Q2DA 3W86A 5IBXC 3A4XA 1VCVA 2OQHA 4XAGA 3I6RA 2CLMA 1Q7MA 1BFNA 1KM4A 3BCFA 4JTGA 4LXFA 3M5XA 2GFTA 4DBWA 2VGFA 1FKXA 1CWYA 4WGXA 1DIKA 4WR3A 3CZKA 3QMSA 4PCSA 4H9UA 3UF9A 1Y0EA 2A85A 3SFKA 1POKA 2CLLA 3W2UA 4XZBA 2GDQA 2EPMX 3KWXA 7TIMA 3VDGA 4RK8A 1H1NA 1V4YA 3CH0A 1UKTA 4AYGA 3O7UA 3GNRA 5IHRA 3EAUA 4ZO6A 1ZBCA 3AXIA 1VRXA 1MFVA 3B4UA 4Q8QA 5FL1A 3BG3A 2AKZA 3GFYA 1JZ4A 2PDWA 2VCCA 2DIJA 1RPXA 2W61A 3GE7A 5CPQA 3TJ4A 1JI2A 4TIMA 4HPNA 2BDQA 1FH8A 4HA1A 4J9JA 4RNFA 1WV2A 4Z1DA 4GX8A 1JUBA 5E0FA 1PPIA 1YPXA 1EJRC 3V5FA 4GD0A 3NM1A 3WMSA 5CLTA 3DZ1A 4QAIA 3GVRA 2GGGA 5CGQA 4MJZA 3ZM8A 2R82A 3GDRA 3W7MA 2VP8A 2I9UA 3CASA 2ZX8A 2F6KA 4IF2A 4RZ4A 1OC7A 2ZQ0A 1VJZA 4F9DA 3B8SA 4A2SA 5C71A 2AKMA 1B9BA 5CKSA 4GRSA 2IQDA 1TZ7A 3TP4A 1SGJA 1V03A 1D8WA 3L5LA 3ARTA 4CNTA 4JX6A 1GVQA 1G69A 1EUNA 3WH8A 4O16A 4PFHA 3UR8A 1OSEA 3ENLA 4MWAD 2DFAA 2AL1A 5K2ZA 4LCRA 2NVCA 4LPCA 3GNOA 5I3JA 1XPGA 3FVDA 3O6AA 5DCDA 3WMLA 4DZIA 3OA3A 2GK1B 4MB4A 1HKJA 4FX8A 3A47A 2X0YA 4Q32A 5BNKA 2CW6A 3RUBL 2VEFA 4JICA 3LCGA 2JFEX 1J93A 1O1ZA 4LVBA 3VNMA 4AEFA 4J3XA 3UQNA 3O0KA 5CXPA 2OKOA 3UA3A 3G22A 4Q8VA 4WGHA 4GINA 4KRZA 3MTWA 3WLJA 1HJQA 1L6WA 2O92A 2EPKX 2XUCA 3QGKC 1M53A 3QR3A 4Y8FA 1HN1A 1CEOA 1OHLA 5DMNA 2I17A 2Y1HA 3N2CA 3DFSA 3F2DA 1M01A 4KKXA 1HGYA 4AC1X 2EHHA 2OPJA 3GD6A 3KP0A 5AYZA 1AUSL 3SIZA 4UXDA 1FKWA 2CU0A 4UTTA 3WMBA 4GABA 4GI9A 2CLOA 3F4CA 4J35A 1FRBA 1IEVA 3G1FA 1Q6DA 4JL1A 2CLKA 4GYPC 2RDUA 4DUOA 1A47A 2B7NA 3BLOA 5IOBA 3AC0A 1F4HA 3O63A 3OG3A 3FVMA 5HJYA 4JTFA 3LBOA 4I6KA 3G1RA 8XIAA 2Y5EA 4G8TA 5CZ0A 5TAOA 4KFNA 1JRCA 1IXQA 3K4DA 2VFHA 1PHQA 3H2AA 4M29A 2C19A 3OEXA 5G4WA 5LNSA 3CPRA 1TPDA 1JPHA 1JL8A 5FA5A 2RDTA 4JEJA 1LDCA 4R33A 1PS9A 3GC4A 2Y89A 4KQNA 5A1AA 4YL2A 4HNNA 2WNNA 3O16A 3GKFA 4MADA 1RAKA 1BGAA 1KRCC 3U8GA 5I07A 5MF5A 2Z24A 1XRSA 2RJHA 3CL8A 5GJMA 2OEJA 2PZ0A 3GX9A 2DVTA 4LGXA 4KGJA 1QPNA 5HNNA 2TODA 3SN1A 5J04A 3DUGA 3DFOA 4KETA 2V0TA 5GNYA 4YWSA 1CXKA 1ICPA 3G3MA 2PBGA 2R9RA 4JN7A 1S1PA 3CL7A 4UWMA 4AXKA 2BNJA 5ABFA 2WQPA 2WNQA 3BO9A 5C0QA 1KCXA 5PTDA 2E6AA 1NFPA 1PIGA 4UQAA 3O6DA 3QPZA 1GONA 2FTWA 3IIPA 4FNPA 5C54A 3W2MA 1UH4A 3O15A 1XCXA 4C6NA 4Q8OA 2PWHA 3UFYA 4PR4A 2GSEA 5DY2A 2PDUA 5BRQA 4PMRA 3W4RA 1M6JA 3GU2A 3M5VA 4WDUA 1G6CA 1NY1A 2PCQA 4ML4A 5I77A 2PS2A 3U5UA 5AYXA 1JF6A 2FMNA 1MQPA 1YDOA 2VO5A 3EPOA 2Z7GA 3LNMA 1QT1A 1OFPA 1V79A 1XBVA 4IPNB 2HPMA 3N2OA 3I3BA 1BYDA 1PB0A 1JF5A 3PR2A 4KWWA 3E0FA 4Q4PA 3DHPA 3HFTA 1D2KA 1T5AA 3AO0A 1KXVA 4A8IA 4JTAA 4QXIA 1VJIA 4PE8A 3GXFA 1MRAA 5HINA 2YLLA 3POCA 1QUMA 3GU1A 3TTOA 3LCHA 3T09A 1SJCA 3TYZA 3GXNA 2FLIA 4JTDA 5DELA 3EYPA 3S6TA 3DYPA 3KL0A 1KA9F 4IGMA 4S3EA 4N02A 1R2RA 3S4TA 4GQRA 2R94A 2ZX7A 3M0ZA 3R8HA 4JX5A 4X9SA 2ZX9A 2ZWZA 3H24A 4UB9A 3E2SA 1TREA 3ZZ1A 2BHZA 3IRDA 1GZ1A 4DBDA 1KXQA 3F7JA 4OBSA 1ISXA 4N0RA 1W3TA 3BURA 3S6DA 2XVKA 5FI8A 2GVEA 3CEPA 2FQIA 4E3VA 2QMKA 4MNJA 4Q7IA 3S1GA 3GXTA 4GI6A 3KBWA 1W5MA 4BI6A 1KM2A 1Z41A 4PMXA 3VCCA 2GVJA 2CERA 1F3EA 2QJJA 1XD0A 1EL3A 4JIPA 4KEMA 3N2BA 1E70M 3EWWA 3B06A 1A5AA 2NV9A 1OQFA 1SFTA 1VPQA 2D73A 5T91A 3UYCA 2EPNA 3DFYA 3DG7A 4V1YA 2JGQA 3VNKA 4KRUA 2QIWA 3Q37A 3EWUA 1XP3A 3RCYA 1FBAA 1GQKA 3GTHA 3CV1A 1ZY9A 4GIRA 3VK5A 4W8LA 5HMEA 3HPSA 2V2DA 1KTCA 1VD6A 3IGSA 3B9OA 4W7UA 2DU2A 4DWSD 4HHMA 5KTLA 3TWBA 2UZ9A 3JS3A 3CUHA 1P1MA 3MBDA 4GI8A 3FA4A 3FY1A 4XQ6A 1ADOA 3UZJA 4MTVA 4PBFA 2ZKMX 3U5YA 1W3KA 1H3GA 3JW7A 4NJHA 2CZDA 4UTLA 1TRIA 5ABEA 1IT0A 4L4OA 2E4TA 5CZSA 1AODA 4UNLA 4IUGA 1WE5A 1N7KA 4E8GA 1GK8A 1L6YA 4GUHA 1E40A 3SRKA 1A4LA 3NL3A 2JKEA 1TG7A 1ZSXA 3KVKA 1DOSA 3T2OA 3WH9A 1XYMA 4NZCA 1XGEA 2C3ZA 4L65A 3H6OA 2DUXA 4PEEA 4IFRA 4PCFA 3QSTA 2BZNA 4O54A 1SO5A 3CO4A 4JTHA 4PSRA 3A3HA 4JY8A 1UMYA 3L0NA 1B30A 2BY2A 4O0ZA 4P7LA 1XSKA 1XIFA 4A8LA 4BQ3A 1ISZA 5JBDA 1XFBA 3K46A 1L6FA 5A95A 3IK4A 3IIXA 4FOUA 1GWJA 3VCRA 4QJ3B 2P1FA 1IGSA 4ZQMA 3OLIA 5H8UA 3SJNA 4P2VA 1SO6A 3FX4A 4D6IA 1CDGA 1PUDA 1QWKA 5DANA 4KCUA 3O8AA 1OK4A 4QSFA 3C5QA 1MMFA 3EMCA 5KINA 2FZDA 3N9RA 4M19A 1JJKA 4ERAA 3PUOA 3PAOA 3JVAA 1R3SA 2PUZA 2WCGA 2PDIA 1PDZA 5IDZA 4K39A 4LUIA 3CYVA 2QCHA 3K5XA 1ISWA 3VIJA 1OIMA 4JAWA 2OJPA 2UV8G 4HOXA 2REQB 3SECA 4WKAA 3C3UA 3EX3A 2VELA 2ZBTA 1E9IA 1TIWA 3URNA 1OY0A 2YXGA 2MNRA 2I16A 1K70A 4Z1YA 1JDDA 4NAEB 3KVJA 1LT8A 3UWQA 1SO3A 4PULA 3PULA 3CH9A 1ALDA 3WBXA 5EMYA 2GVGA 1UWUA 1LROA 3GZ3A 3T40A 2OQYA 3GTXA 4K3ZA 3FXGA 1DHPA 3VD9A 3NNTA 1B3WA 5BYWA 2W27A 3K4AA 1EHAA 1DWJM 2QV5A 3PBUA 4ROPA 3MJYA 3PTQA 3ZJ6A 2UY4A 3GC2A 4QG9A 3CT2A 3QY8A 2ATMA 4AFYA 4WY0A 4YTRA 2XH7A 4MB5A 3GTNA 5D8WA 4R53A 4IGNA 3QKZA 3V0TA 4GUFA 1JVNA 5D30A 3RXZA 3QN3A 4ZB2A 2XIBA 4HMEA 2BXVA 4IPPA 3UJ2A 1US3A 2VXNA 3PZQA 3W7PA 3MUY1 4Q8PA 3MSGA 5T9CE 3QJAA 2JQXA 3T0TA 4C7GA 3H21A 3TAOA 1VBUA 3VIFA 2NWRA 3XISA 5AHFA 4W4QA 6PTDA 2FH6A 4ASTA 5LNRA 2RAGA 3AXKA 3P60A 2XN0A 1BSIA 1I0BA 3ZR4A 4JEQA 2NX9A 3WFAA 3W1TA 4ZO8A 2WNZA 3HGRA 5HQEA 4ZO7A 3MUAA 3DFTA 3LI0A 1JAKA 3NSXA 3CQIA 2XWDA 1GCYA 1EGMA 4FF5A 4IWWA 4FEZA 1P5BA 3R94A 1TV5A 1J79A 2BS9A 2CBUA 2QLYA 4FOJA 6ALDA 3UPBA 3DBNA 4LVDA 3QMRA 1V0NA 3CZGA 2Y7FA 2YZRA 4PC8A 3IAQA 1EXBA 4H2CA 4BK9A 3LB0A 4PFMA 1NAL1 3W1RA 1D3GA 3NPUA 3RX2A 1QNOA 3B0VC 4X2PA 4N2YA 4JS3A 1UKOA 4NILA 4PUDA 3GVWA 3N34A 1TTPA 3BAYA 3CHDA 1DL3A 3H7VA 4LUJA 4F2BA 3ARRA 1MSSA 3B9DA 3CQJA 1T40A 4AD2A 4PUNA 5D04C 2VQTA 2XINA 4S39A 4TU1A 1JPMA 3AMCA 4D71A 1JYWA 3OVGA 3UVIA 1FUYA 1N2VA 4GNVA 4HHHA 5BRPA 4QJ5B 1JDFA 2J9XA 5HNTA 3WF3A 4GE8A 5M3WA 2CBJA 4AY1A 3FA3A 1B5TA 1WQ5A 3BAIA 2WJEA 2A3BA 1JCNA 5AOUA 4RZ6A 1P6WA 3WQGA 5HK4A 3MP5A 5C5YA 3KBMA 3MT1A 3D5HA 2VDIA 3SSJA 2OSYA 1KKOA 1BTMA 3SEPA 4E2BA 3DH7A 4H8NA 4EAYA 3RFAA 3M0JA 3A5VA 1VEMA 1PXGA 2GL5A 3RHGA 3FFSA 4Q8MA 4JIQA 1KRBC 4ZQRA 4KERA 1SZGA 4B5VA 1O66A 1V6XA 4RUBA 4O4WA 5BWAA 3VKKA 2E0PA 3CMFA 2WVSA 3BK0A 3O06A 2Y63A 2QJHA 4DZHA 5I5RA 3GWQA 1R3YA 2EG7A 1BSLA 2ZCGA 4RNHA 1BQCA 1B9ZA 2WJFA 5FD0A 3M6DA 3ZT7A 3PJUA 2F7FA 4EP8C 3REQA 4LRTA 3T81A 1GVEA 2WCAA 1E72M 5I3GA 2HCVA 5A6MA 4P8WA 5AVNA 3FJ4A 4U33A 2RDWA 1OCNA 3GAKA 3UCCA 1ECQA 3PB0A 4BCEA 3G1DA 4V15A 2CIPA 1EJ7L 1X7IA 4F2UA 4XSLA 2J75A 4HPXA 3I65A 3L5AA 1TWIA 1ECEA 2QUMA 1EC9A 1FDJA 1E4LA 3CM4A 2XYLA 3GXIA 1T6MA 1FH7A 1J8VA 4IHCA 2QUNA 2I5IA 1XSJA 3FGCB 2VR5A 2PI6A 2VC6A 3P67A 2H6RA 1EZWA 3NQFA 4LYKA 2QCEA 3UPWA 4UNKA 1L9WA 3LGDA 1GZGA 3KEHA 1IZKA 1C3FA 5E09A 3SAZA 2VNCA 3MS8A 2ZRZA 4Q4QA 5B7YA 1T99A 3PUEA 3G1AA 4OBTA 4IJBA 1ZBKA 4LX4A 3O6CA 3M0LA 4KWSA 3PM6A 3O1NA 1E51A 5HOSA 1AZ2A 4WUIA 1YTKA 1SMAA 1K02A 3I7RA 2QF8A 3HGOA 4B2DD 2FZ9A 3CUGA 2OT1A 1Q6RA 4CCEA 4M24A 1Y8BA 3U48A 1EBGA 1V77A 3NQEA 5FEWA 4AU0A 2XFFA 3BZJA 2XSBA 4RE0A 1YNYA 2E6YA 4AXNA 2NQ9A 3CWHA 1QW8A 1OD0A 1UW9A 5D02A 3VOFA 5GNXA 4F48A 3ZWTA 1FWIC 5DEZA 4EANA 4PL1A 1B4EA 3S1XA 3NZGA 1DXEA 4JL2A 4MVAA 1H2JA 2IPWA