3W76A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-4-189
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-4-189
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 103
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w76A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w76A01
3G1VA 1XUZA 4RCXA 1AK5A 3TU9A 1PHWA 2A85A 2C13A 2VENA 3HF3A 3BW3A 1ICPA 3G1YA 2X2GA 3BW4A 3FKKA 1L6WA 4N4QA 4GNJA 4Y90A 3W2KA 1H61A 3TC6A 3NZ1A 1OFOA 3G1XA 1ICSA 1FX6A 3EX2A 1EUAA 3CT7A 1JRBA 1W3IA 4LOCA 1N7KA 1QO5A 3GAYA 2E77A 2R91A 4M5PA 1CW2A 1D3HA 4DO6A 4TR9A 4O1DA 1XUUA 4DF0A 2NUWA 3UPWA 1JRCA 3M5YA 5F2GA 4YLWA 4A3UA 3LRLA 4LUJA 5KZMA 1A5CA 3B0PA 4ICNA 3PR2A 1VYSX 3HPZA 4UTJA 3L0NA 1WQ5A 3DHDA 3LCIA 1G7VA 2DZWA 4Z08A 4XUGA 2QCEA 1A5AA 1QDSA 3STFA 3LOTA 1LBFA 1M7PA 4HNTA 2TMDA 1QPQA 3EXSA 2RDTA 2J88A 2UV8G 1FCQA 3KVMA 2FB2A 1KV8A 2H8ZA 4O57A 4IOTA 2F7FA 4JX6A 1T99A 4XKYB 1DVJA 5C5YA 2CFFA 1H51A 2NV2A 5U7SA 4MY1A 3N19B 1ALDA 2V8ZA 2Y88A 1ZCOA 1FQ0A 1Q6RA 1SQ7A 1XBYA 2C18A 1VCVA 4MOZA 1GVSA 3LBMA 2VELA 1Q45A 3A5VA 3L5MA 3UXAA 4W9TA 2A7NA 5HNRA 3TE9A 2JK2A 1TYGA 2J24A 1MEHA 4UMCA 4NNBA 4UIOA 2ISSA 1FXPA 3OA3A 4R34A 3LCFA 5DELA 1YDVA 3IVUA 1KFEA 3VI2A 1TJRA 3HB9A 1IIHA 3W7LA 2FJKA 4HPXA 3O8AA 3UWYA 5HR6A 3MMTA 5E93A 5CGQA 4NJKA 3S5OA 3QW3A 4EF8A 2A6LA 1M7OA 2EHHA 2NLIA 3DFOA 3S42A 1BWKA 3EX4A 3NA8A 2Q3OA 1SO3A 1XKYA 4UTLA 1BTMA 3NYZA 1XBZA 3M43A 4N6EA 4LRSA 5FEPA 1WXJA 3NXFA 3S1UA 3TXZA 5CPOA 3V1PA 2NXGA 4CCCA 3TFCA 4TMCA 3HOJA 1AW5A 3NVTA 2WSQA 3FYOA 4XBKA 3ZR4A 1IIGA 5DCEA 2QDHA 2A5HA 4UTTC 3W2LA 3LM7A 3AJXA 2Y7GA 4M7SA 4WY0A 2E6FA 4XTDA 2QDGA 5MHBA 3EKZA 1Y0EA 1SUXA 3L68A 3W9ZA 1N8FA 4JTIA 4RK8A 2OJPA 3W87A 1OYAA 4E2DA 3LGEA 1JR1A 3G24A 1PV8A 3DU0A 1VQTA 5D33A 1WDWA 3GKAA 3N3MA 3GXPA 4Z1AA 3P81A 4ADSA 2P0OA 2EAWA 1FY6A 2JGQA 3VCRA 4XQ6A 4LY8A 5CZ0A 3GYEA 1Q6OA 1X7FA 2BTMA 4A22A 3EWZA 1TV8A 2QKFA 3T55A 4LT9A 4CLMA 1C29A 1WOAA 4RXGA 2ZA1A 5IBXA 2ZA2A 3W88A 1M5WA 5DCDA 1IXPA 4TMBA 2VFDA 3N2MA 5AHNA 4S2BA 1DQXA 3SW6A 1ZY9A 5AHMA 3PUDA 1LYXA 1T8XA 3LDVA 4UTHA 3CM4A 3L2IA 2A0NA 1S5VA 5LNRA 2TPSA 4ZQPA 3G0XA 2E68A 2Y89A 3S9YA 5BMXA 4MY8A 2WSYA 3ABOA 2RDWA 5D02A 2GOUA 4LRTA 4I7WA 1FWNA 1OX4A 3OVRA 1H7XA 4O0KA 7TIMA 3TMQA 4NX5A 4EVZA 3QEZA 3W76A 3TA6A 1CI1A 2YZRA 1VZWA 3LBCA 1HTIA 2W0UA 4LS1A 2RH9A 2C3ZA 3G3DA 1G4TA 4J9JA 2YYUA 1B4KA 2V30A 4S2CA 3QMSA 3ZWTA 3TSMA 2XN0A 3HQ1A 1O60A 3UWQA 5F4WA 1D9EA 1GVQA 5LNWA 5KMYA 4MLJA 3G1HA 4JY9A 3WJWA 2NWRA 1JULA 1OFBA 4IJBA 3CEUA 5T26A 2VEIA 1OABA 4GRSA 3W7QA 5D2WA 4WXZA 5I3KA 3SGZA 2CLKA 4JTUA 4GE8A 4BI6A 2QAPA 5SWUA 3C8FA 2W79A 4BI5A 4NJGA 1GG1A 1E51A 4AVFA 3QQ1A 3M16A 2QEZA 1Z42A 4NU7A 3S1VA 1XC4A 2DU2A 4Q4KA 3TAKA 3LRMA 4CNPA 4O16A 4LVAA 1LOSA 3E02A 3B8DA 2QJHA 3NG3A 3TV8A 3BLIA 3O6DA 3W1XA 3W2MA 3W7DA 1GZGA 1Q3NA 2PE4A 4JX5A 3S1WA 1KV5A 2I9EA 5EYWA 2IQTA 1FCBA 2QCDA 3BLEA 3LLDA 1ADOA 5EY5A 3UQNA 4UFKA 2ZTJA 5D2YA 5KZDA 4EIVA 2JKPA 1IXNA 3W07A 4LVDA 4WQ6A 5EMUA 4QSHA 2BXVA 1C8VA 3NQ8A 2OT1A 1V7YA 3NR0A 5D05A 4AEOA 3S5ZA 1KFKA 5IM51 4GUHA 5HR7A 4K39A 1R30A 4IUOA 4IX2A 3LCGA 1SSGA 2V82A 1EIXA 4FNUA 1W1ZA 1L9WA 3B04A 3PC0A 4O1AA 2J27A 1QO2A 3HG5A 4QQ3A 4Y96A 3BLFA 1G4SA 4JN6A 4LNYA 1FUYA 4EF9A 3N14A 2ZCGA 4FXRA 3O16A 1MXSA 3W72A 3TH6A 4KFNA 1VR6A 3LHZA 2WO5A 4OT7A 1XDLA 3CEPA 3KVKA 1W3TA 4HNNA 4BR1A 1QCWA 2NUXA 4PTNA 4UTWA 3NZRA 4K8EA 3KVLA 3NPXA 2Y63A 4OGZA 1GT8A 4BWLA 3LTPA 4UTKA 5BMWA 1UCWA 4NX0A 5HULA 1EPXA 3PUEA 5FEWA 3I7RA 1BKSA 3TCEA 4JEQA 4JTEA 1MEIA 3NL5A 2FTPA 3I65A 2HTMA 1H63A 3G0UA 2QUUA 4X2RA 4AF0A 4UFIA 2Y61A 3DKLA 2BX7A 2CLOA 5G4WA 3GK0A 4JDYA 1QOQA 1DORA 1ICQA 3L9CA 4GBUA 1DL3A 1J4EA 5AOUA 1KBJA 1OG0A 4FNPA 1W0MA 4UUIA 4IWWA 2VFIA 1TV7A 2QR6A 2Z2UA 4CQAA 3W2NA 4CCEA 3CPRA 3MW7A 4QITA 2NUYA 1YPFA 3EXRA 1A5BA 3VE9A 1OFQA 3W7CA 5I3FA 3W84A 4LV4A 3W7JA 3GKFA 3C2OA 3P5YA 3TIMA 3LCHA 2VFEA 1HUVA 1OF6A 1QOPA 1YADA 4G1KA 4JTKA 1GVRA 1GYLA 3TQ0A 3PBVA 1OYCA 5L6UA 1GPWA 1K7EA 2C14A 3CIWA 4QM1A 4BFAA 3FJLA 1PE1A 3HMJG 2NXHA 4O53A 2QF7A 3NQAA 3M9YA 1KM0A 3FLUA 3C56A 2YCEA 3S5NA 3W1LA 6TIMA 2X1RA 1VLIA 1LDCA 1DHPA 4IMGA 2OT0A 1MEWA 3B06A 3GB6A 1DKWA 3T40A 1K7FA 5LKYA 3W7NA 2A6NA 3JS3A 1JVNA 4MYAA 4ZQMA 1X1OA 3SFKA 1D3GA 3SJ3A 3HG4A 4A21A 2C16A 1H62A 1OVDA 4N6FA 4S1FA 3INPA 4PC8A 1B4EA 2ALDA 4YCOA 3SGUA 3DFPA 4WXYA 3A5FA 3UXDA 1O5KA 2GJNA 4AH7A 5DY3A 5DXXA 1JQVA 4AWTA 3MO7A 5HQEA 3G1FA 4QJ1A 3WK2A 2QCNA 4UNKA 4LVFA 1OK6A 2PURA 1W31A 2AGKA 1ZAHA 3NPWA 4UTMA 3M5VA 5FI8A 2QCHA 3PUOA 2ZYFA 1ONRA 5KSWA 1DQWA 3RNDA 1RR2A 3T7VA 1JCYA 5CZJA 4QAIA 1I2QA 3BW2A 4M19A 1LLWA 3EWBX 3KXQA 1VCFA 3BG9A 3N9RA 4FX7A 1W5OA 4P2VA 5EPDA 4GFSA 1H60A 3E12A 4OBTA 4DXVA 3PG8A 1QMLA 3HPSA 2Q3RA 4DPQA 4JX4A 1VRDA 4O14A 3TSDA 4K7VA 4FIQA 5I3JA 1MO0A 4FX6M 5HMSA 3THAA 4FO4A 2PCQA 1KFCA 2D73A 1G4EA 4E0CA 3DENA 1GTEA 3C52A 2CLEA 3QYQA 3WJYA 5C6MA 4LS0A 5A8GA 4GWEA 1JCXA 3QSRA 3EWUA 3NQGA 1UASA 3PSWA 3H54A 2WKJA 4RKAA 1SPQA 3DGRA 3DI1A 5EA9A 3GDLA 3O05A 3OEXA 2J6XA 4JIPA 3V75A 1VC4A 1NSJA 5EBUA 3KRZA 3W1AA 3W1QA 2VKZG 1EA0A 3PVFA 2FFCA 2GQ9A 3MHGA 5HWJA 2WPBA 3MP5A 3W7MA 1W37A 5D2XA 3RLUA 3C3NA 3TAOA 4E38A 2VEPA 1RVGA 5LNVA 4H6KA 4Q32A 3QZEA 3UPBA 1UJPA 3UZJA 3GIYA 4Z1DA 2CLHA 4NVTA 2GVJA 2YW3A 1TQJA 5CPNA 1B57A 2E6DA 4JTLA 2QCCA 4LUIA 4DO4A 1LROA 2R94A 3G1AA 5FF2A 4NNCA 2GPTA 4ZQNA 3RFAA 2ZQ0A 1H7RA 1G67A 2JKAA 4CNNA 2B7PA 1TTPA 3KOFA 5KTLA 3W1TA 2NXIA 4ML9A 3BG5A 3EX6A 4IMDA 4YWIA 1SW0A 4JTJA 1RV8A 3W1UA 1FWWA 3EWWA 3I7QA 4NQ1A 1P0KA 4K37A 2AQWA 1YDOA 4MVAA 4XKYA 1ZJIA 1K8XA 1MZHA 2QCGA 3P8JA 1B3OA 1TTJA 2DJLA 3OG3A 3GDMA 1YTEA 2Z0IA 3U6WA 4QNWA 4AXKA 2RHGA 1ZNNA 1VGAA 3MHUA 4UMBA 1SR9A 1WA3A 4UFHA 3S6DA 1OFDA 5GVJA 1OX6A 3CTLA 1GEQA 2X1SA 2V2CA 3TFXA 3P80A 1VPXA 1DJNA 4PL2A 3W1NA 3PBWA 2YPIA 5E1QA 3N34A 2V9DA 4LVBA 4AHOA 1TQXA 1LP6A 1GVFA 3NAVA 4MZ1A 5LZLA 1SO5A 4FHAA 3BGJA 4X22A 4O50A 1T96A 5CSRA 2ATMA 1GVOA 3H55A 3M0ZA 4C1KA 5D30A 4L4LA 4PL1A 3W75A 3C4UA 5AC6A 4GUFA 4POCA 3P84A 3QRHA 3CQ0A 2YSWA 2E6AA 1PIIA 1YDNA 4PFMA 2NV1A 5AYYA 1C9DA 4WD0A 5EL1A 3R89A 2DZXA 1K3UA 3HBLA 1TPWA 5TIMA 1KFBA 1LM1A 4WY0F 1UB3A 3N9SA 5DLCA 4FF7A 3UZ5A 3FYPA 1CX9A 4WX2A 4GUJA 4RZ4A 4YL2A 4D2JA 5K9DA 4HPJA 3W22A 1KFJA 1RZMA 3LXBA 3L65A 3TXVA 5K7JA 3EEGA 1YTKA 3CIXA 2HSAA 3PAJA 1PHQA 4WOQA 2WSRA 3DFTA 2GVGA 1FCVA 1YXCA 5K9XA 2R8WA 3SIZA 1YXDA 3K30A 4UC5A 5F2LA 4KFOA 4Z0JA 2HS6A 5H91A 1IXQA 1UUMA 4O28A 2YDAA 4X9SA 1VLWA 5L9FA 2QCLA 3W3OA 2Z1BA 1OJXA 1SW3A 3W23A 2Q8LA 3W74A 2B7QA 4AWSA 4NJJA 3N73A 1GG0A 3ABSA 2NX1A 4N9CA 1VHNA 2ZRYA 3ANYA 2ZZ4A 5BOOA 1FCUA 3ZWSA 1W8SA 3IIOA 4IQLA 2CLFA 2ATSA 1QPRA 4A2SA 2OZ0A 3W7KA 1NAL1 1AG1O 2A4AA 1V5XA 4AB4A 4A29A 3GLCA 3EX1A 1TPH1 2CW6A 2C6QA 3W1RA 4BF9A 1OX5A 1IXOA 1TRDA 1W3NA 3BPWA 2H8XA 1H50A 2XFWA 1Q6QA 1QPOA 1VS1A 4M7TA 3M41A 4FEZA 3EKLA 5U4NA 3ZS4A 3F4NA 4DBEA 3LV5A 3KAOA 3UNDA 5G1TA 2VOMA 1LBMA 4LV9A 3W7GA 3MI3A 1XL9A 4MYXA 1XXXA 3L21A 2HMCA 4TIMA 5AHIA 1WOBA 1OF8A 3LB0A 3UWUA 3EWYA 2AAMA 3M5ZA 2B7NA 2GQAA 3FKRA 3IIVA 1KM6A 5CSSA 1W5NA 4I7VA 2VEMA 3HO8A 1KTNA 5D38A 3LERA 4JGDA 3HG2A 4UCGA 4PODA 4FNRA 2ZRXA 4AWUA 3STGA 2ZZ2A 3QW4B 4Y6GA 4HT3A 5D03A 2ZA3A 3P61A 2DZVA 1Z41A 1K8YA 2CWNA 3A21A 3L5LA 4TX9A 4R7JA 4O1BA 4YCPA 4R53A 2QCMA 2V2HA 5LGZA 4MUZA 1A50A 1TIMA 1XI3A 4HIBA 3QPYA 3O15A 2PC4A 1TPB1 3BVJA 2YFOA 4N4PA 2TRSA 4PH6A 5BW6A 3MP4A 4L4MA 4O4WA 5LSMA 2B0MA 2C1HA 2E5DA 2ZZ1A 3STEA 3PB0A 2WJZA 1THFD 5F4XA 3LV6A 5DN1A 4QIUA 3W73A 3C2FA 4HSNA 4MJZA 4JR5A 1PS9A 3NPUA 3F03K 3D0CA 4QNEA 4CCDA 1NEYA 1SW7A 2OX1A 3EWXA 3T78A 4JYFA 3DKJA 1JCMP 2G96A 1ZENA 4FNQA 1JCJA 1ZAJA 4JYDA 3PM6A 5DCBA 1KM1A 3IIZA 1KTBA 3LHWA 2V5BA 2YYTA 5AC7A 3BK0A 3QC3A 3TX9A 3Q2DA 4NXSA 1QPNA 1YLVA 4UFJA 3TKFA 1LRNA 4LTSA 1I2NA 2ZRWA 2CU0A 1JCLA 4LC6A 1ZALA 2ABBA 1KLYA 1QR7A 4JYEA 2Y7FA 5D2TA 1L6SA 1UUOA 2WNQA 4GXMA 2ZRZA 1KA9F 1TB3A 4P61A 4OU1A 4HKPA 4IPIA 3IGXA 3UY8A 3SY5A 4RV8A 4EWND 2WV8A 3S5YA 3DAQA 1Q6LA 3W86A 3U8GA 4PEKA 3GNDA 1F73A 4R33A 3ZFHA 3LTYA 3TQKA 3EXTA 4MY9A 2E5BA 4OV9A 1XBXA 4ONVA 5KITA 1KBIA 5E0KA 4N02A 2F84A 1I4NA 4E2BA 3O06A 3PF3A 5D32A 5D09A 3NO5A 3PG9A 4N9DA 1FDJA 1I2OA 1G4PA 2GUUA 2EPHA 4JTHA 4UTTA 4WZHA 4M6VA 4MLRA 3S1XA 8TIMA 2X30A 2CZFA 1ME8A 3E0IA 3S0CA 3IVSA 2QUVA 5KINA 1JUEA 4RZ5A 5F2IA 4X3ZA 5LGXA 3GXTA 4ZQOA 3L67A 1X8FA 1W5MA 2ZZ7A 1TPVA 1T0OA 4RZ6A 2Y7EA 3FEMA 4UR8A 2YR1A 1M6JA 2E09A 1XM3A 3F1QA 5F2MA 4JD4A 1R46A 2OMAA 3MI6A 2PRMA 3PWAA 4HSOA 1U83A 3LTSA 2EKCA 2VEKA 4MFDA 4WUIA 3LI0A 3RLVA 1EWDA 4MKNA 2VFHA 1H5YA 1SZFA 1WX0A 3C2RA 5D2VA 3VFLA 4KFPA 2B4GA 3QFEA 4C1LA 3DHFA 5HWNA 3WK1A 2NZLA 4KKXA 2ISWA 5IBXC 1P1XA 4HNUA 1YXYA 3W7EA 1YTDA 3QJAA 1VCGA 2W6RA 3IEBA 2CLMA 2ZZ5A 5EKYA 3I68A 1LTDA 5H2ZA 2ZFAA 3W7HA 4YXGA 4N9BA 2ZDRA 4B5NA 3DH7A 5LHFA 3H53A 1JUBA 1TPEA 1H7PA 4HNVA 2X1TA 3HJZA 5G5IA 1FDYA 1KLZA 1L2UA 1HO1A 1AW2A 1RQHA 2EF9A 3O1NA 4DELA 1P0NA 3W7PA 4NZJA 3NM1A 3TROA 3R2GA 3MP3A 3KVJA 3JR2A 3VKJA 1X1ZA 2YGYA 3SSJA 4ZL1A 1IGSA 1ZHAA 5DBTA 4M6QA 3BG3A 2FQIA 4MZ8A 1F7BA 1SSDA 3TQVA 5DY2A 5CZTA 1LRQA 1TPC1 3LCWA 3NEVA 3NDOA 1KM2A 3TDFA 2V0TA 3FOKA 4ZVJA 3GR8A 3GDRA 5AHLA 4U4MA 3HGRA 3T4CA 3L0GA 3A23A 3NQCA 2GVLA 1G69A 1RQBA 3NQVA 1H7OA 4ZZ9A 3C2VA 5AYXA 4GJ1A 5J5DA 3NQ2A 1F05A 3A22A 3RF9A 4FX8A 5K3VA 3A9IA 4GUIA 1FBAA 3VE7A 4UFMA 3TW6A 4EOUA 3B0VC 5DBUA 1XCFA 2Y6ZA 2E1DA 3NL3A 4WJEA 3WJSA 2G5WA 4CQ8A 4IMFA 3O07A 4MZYA 1VYPX 3P62A 3GXNA 1GYNA 2FPYA 3C6CA 3BGGA 4N2YA 5CPMA 5HUPA 2Q8ZA 4UTIA 5G1YA 4IMEA 5LNUA 3C2EA 1R2SA 5J5RA 3IVTA 2BSLA 3DI0A 2JGYA 1HO4A 3R5EA 3IGSA 2DZTA 1WBJA 2ABAA 3QMTA 3VNDA 1WV2A 4LS2A 3NQMA 3MYOA 1K8ZA 3DZ1A 4LWWA 5FEXA 3Q37A 3SZ8A 1VHCA 1KW1A 1DOSA 1I2PA 4HN4A 3R13A 4IGHA 3QPZA 3HG3A 3KX6A 4OE7A 3GNNA 1B9BA 2Z6IA 1JQXA 3OBKA 1AL7A 1TPDA 3B0UX 2X1UA 1H1YA 1SZNA 3PULA 3OIXA 4O0ZA 4MIMA 3P8IA 1SU5A 3N2XA 1EWEA 4UR7A 1GWJA 4ZQCA 3G8RA 4UNLA 1GQNA 2V81A 1SZEA 4MFEA 2GQ8A 4GC4A 1HG3A 3CU2A 3QQ0A 4NZFA 5AHEA 2P1FA 4LW7A 3GX9A 4RLIA 4A2RA 5I3GA 2YXGA 5I3HA 4QISA 5HWMA 2Y70A 4I7UA 4GUGA 3TMLA 3M47A 3OVPA 2CZ5A 1PCKA 4OQVA 1LLZA 3TSBA 2C0AA 3ELFA 3NQ7A 5BNKA 1DBTA 3WJXA 3QF0A 3PSVA 3IIXA 1OHLA 3NM3A 2NX9A 3JRKA 3KRUA 2C19A 1TJPA 3O63A 2V5LA 5G2HA 3Q94A 1BEUA 2I14A 2VFFA 3G8EA 4WY0B 4RX0A 1TREA 1OFEA 3CHVA 1BWLA 1W56A 5HJLA 3HPXA 1QWGA 1LBLA 3RMJA 4NUWA 4UTWC 5ABTA 2RDUA 3NQDA 4DQWA 4IXXA 3C0JA 4BWLC 3MYPA 1JJKA 4O4VA 3LCLA 3QM3A 3UWVA 2KZHA 1AW1A 2G97A 1F6KA 1TPUA 3BO9A 2ZBTA 4IMCA 5F1UA 2ZZ3A 1ME7A 4AAJA 3NNTA 1W5QA 4O8RA 4KWVA 2DJXA 4Q33A 5AB3A 2I1OA 3HGJA 3LHUA 1L6YA 3WK3A 1KFLA 4O52A 5K9CA 1TRIA 3FJ6A 3O6CA 1LOQA 2ZTKA 1EP1A 1EP2A 2H6RA 3FFSA 3P60A 2P10A 5FF7A 1P4CA 1DV7A 1F74A 4WOZA 4BK9A 3DBPA 5F4SA 1SZGA 4LC8A 4DF1A 1TO3A 2QAFA 4JDBA 5D37A 4HHPA 4ORIA 2QJGA 3W71A 3LRKA 1A53A 4LVGA 1OX4B 3TUUA 1DJQA 2YX0A 1K03A 2ZRUA 1QFEA 2ZRVA 1ME9A 1PVNA 2CZDA 2JKEA 4ADUA 2R14A 5KZEA 2EGZA 3B03A 2DP3A 3NQ6A 3SECA 3PBUA 3P7YA 3GDTA 3ATYA 1S3HA 4TO8A 4IPJA 2Y85A 1K7XA 2NWSA 2VFGA 4O10A 3LLFA 4Z1CA 3W2JA 4RJEA 1LOLA 3SR7A 4O1CA 1WYIA 2PRLA 4Y8FA 1EEPA 3TR2A 3LHVA 2Z6JA 1O94A 4DF2A 4K7YA 1W5PA 1VYRA 1I2RA 1R2RA 4RXFA 1ZAIA 1GOXA 3KHJA 1RD5A 2J9ZA 3LCXA 3R8RA 1OFRA 1UBSA 1J5TA 5I3IA 1RQEA 1EB3A 3LXCA 3QMRA 4ADTA 4PCFA 2XN1A 4CQ9A 3GR7A 3I7SA 2DZPA 3RK8A 2X16A 4K36A 5AFDA 4O54A 5FF0A 3W7OA 3QH2A 4JNMA 4ORMA 3MI2A 3RU6A 3CC1A 3HIJA 4O15A 4H4IA 5AN7A 2HS8A 1VH7A 1OFPA 4KWWA 5FESA 1JCNA 3W1MA 1EX5A 3EX3A 2A7PA 4O17A 3TW7A 3WJZA 1FWTA 3NOEA 3IGUA 3UD6A 4JY8A 4DO5A 1AL8A 1OYBA 4AMAA 2FPTA 3TC7A 4XZ9A 3L5AA 2QCDB 1PCWA 3TNOA 3NGJA 5G4EA 3SI9A 1SFLA 3LXAA 5FF4A 1SO6A 3W70A 3MWAA 1H1ZA 1YYAA 4OWGA 4JXCA 4NNAA 3UYCA 3G1DA 4ZQRA 1LZOA 4JTTA 5K2ZA 2CZEA 3G18A 1TTQA 4RR4A 1MSSA 4AHQA 1W54A 3G3MA 3MBFA 3GVGA 3Q58A 5A5WA 3USBA 1EUNA 3W83A 4Z0SA 3MHFA 1ML1A 4FNTA 2WQPA 3KFTA 4OHQA 5LNSA 4FIRA 1OFAA 5AC8A 2BWGA 4FXSA 5HUOA 1QNVA 3G1SA 2QCFA 3FA5A 3WFAA 4JTGA 3OVQA 2O7QA 1G6CA 4LU0A 5C2XA 1NFBA 1N55A 4AHPA 4CNOA 1I45A 4K8HA 5LHEA 2FPVA 4JICA 5AYZA 1Z48A 2XN2A 4NT0A 4OV4A 4XTIA 5CKSA 1S5TA 3AO0A 3CB8A 3O6YX 3GDKA 4FB7A 2FDSA 1NVMA 3W1PA 3HGOA 4O18A 3UWWA 5K4XA 1WAUA 3L66A 3M6YA 2YFNA 3PB2A 4JTFA 3DFNA 1TCDA 1P5BA 3L0KA 2YW4A 5HINA 4N9EA 1QAPA 4AF0B 1HFBA 5D04C 4UTUA 3C61A 3LHTA 3FIGA 3DFSA 5TQLA 5K4ZA 3P5ZA 6ALDA 4NXKA 1KM4A 3F4WA 5F1VA 3NPVA 3PY2A 2FIQA 1NF7A 1I8JA 3ABRA 3IV3A 3E49A 4IX0A 2FB3A 2DZUA 1FXQA 1YPIA 2BZNA 3E96A 5CZSA 4IXHA 3M44A 3ATZA 2A7RA 1EP3A 2WOQA 4O11A 2QUTA 1WBHA 3CLMA 2VXNA 3BARA 4YMZA 3QSTA 3KRSA 2RKXA 4NJIA 3NQFA 1S5WA 3UWZA 4MPQA 4DEFA 3GAKA 4NJHA 3LX9A 3TK7A 3W85A 1H7WA 4UXDA 3G22A 4MJMA 3U2OA 5DXYA 1FWSA 2DZSA 1KM3A 5CG7A 1KM5A 4U28A 1X6UA 1K02A 1SFJA 2PRHA 2WNNA 3NL2A 4JIQA 4K6AA 3P67A 1RPXA 2G95A 2WNZA 4Z1BA 3B4UA 1XBVA 4XBSA 4TU1A 2V2DA 1TPFA 3NQEA 1HL2A 2LLEA 4BI7A 2TYSA 4O12A 3PBYA 3W7IA 1F2JA 4Y9AA 5TBOA 1O95A 2TSYA 5C54A 2OCZA 3CWNA 2A2IA 3FS2A 4UFLA 2J9XA 3DXIA 3HGSA 3STCA 1TSIA 3WK0A 1FDZA 2O7SA 2C15A 2JBMA 1OK4A 5BRBA 1LCOA 1GTHA 2GJLA 1LORA 3LHYA 1F6PA 1SO4A 2Y62A 3DFQA 3MUXA 3EB2A 1TTIA 4DPPA 1J2WA 3TJLA 4I9AA 2E5CA 3NL6A 2VC6A 3W6YA 4JTSA 4DBDA 4O13A 2H3BA 5FEZA 2BLEA 1IF2A 1R2TA 4M6PA 5G2WA 1KTCA 1F76A 4XWUA 3LI1A 4K38A 2CLIA 3YPIA 3B05A 2J9YA 3P74A 1U5JA 1PL9A 1Z44A 2E6YA 1A5SA 3P82A 1VJIA 3I6RA 4ZMGA 3G0SA 3T44A 3THQA 1TMHA 1TV5A 1XDMA 1NF0A 3UY7A 3W7RA 3IRDA 3M5XA 3S8HA 2CLLA 2NX3A 2A21A 2ZZ6A 4UMAA 1ZFJA 5AHFA 2RFGA 1LRTA 3E9AA 3TJXA 3ABQA 1O5XA 1XFBA 4ALDA 5CPLA 2QJIA 4FNSA 1R47A 4H3DA 3A24A 3MJYA 1GJPA 2FLIA 4PA8A 3W2UA 1O4UA 3CWOX 1G7UA 1H7NA 1FWRA 5G2IA 3R12A 3OHIA 2H3DA 2A1YA 4O19A 1F5ZA 2H90A 5FF3A 2B7OA 1JUKA 2DORA 1AMKA 2ISVA 3M7WA 5C55A 3M1ZA 3PS7A 3IIPA 3BV4A 3MBDA 3GZ3A 2Y7DA 4JS3A
chains in the Genus database with same CATH superfamily
3G1VA 4RNIA 2YCKX 2A85A 2PF8A 3WQDA 4EXQA 4PR4A 3CPGA 4WHBA 3S2JA 3BW4A 1M01A 1M65A 1H61A 4UR9A 3H8AA 3GG7A 5HANA 3G1XA 4ZXOA 4B9ZA 4AXNA 2P50A 3CT7A 4O8AA 1JRBA 4UBPC 1QO5A 2R91A 2C7FA 1CW2A 1NFGA 4DO6A 4X0VA 1V93A 1EL3A 4DF0A 3V1HA 3UG3A 3CMJA 3H7RA 1H09A 1OGGA 1Q2RA 5KETA 3B0PA 4ICNA 4EAMA 3CAVA 1P0EA 4UTJA 4CN4A 3L0NA 3L4XA 3DHDA 3EA2A 2P88A 4Z08A 1ZU8A 3RRXA 4CQBA 1A5AA 1QDSA 1LBFA 1M7PA 2AKZA 4M56A 1I0DA 2UV8G 2QJNA 1FCQA 4HOWA 3WSUA 3B3DA 1UKOA 3B9NA 1Q63A 4IOTA 4IZGA 3KOYA 1W8GA 1XLKA 2E0PA 4B5VA 1QHZA 3AZRA 4Q3MA 2XZ9A 5CAKA 1ALDA 2VD9A 4KGLA 5AY7A 2Y1HA 4AY8A 1Q6RA 1FP9A 4MOZA 1GVSA 2PAJA 3LBMA 3OBAA 3A5VA 3L5MA 3UR5A 4GO9A 4AZHA 3TZFA 2G8ZA 4J3WA 2VURA 3PFMA 3DYPA 1CXFA 4YPJA 4NNBA 1FXPA 3TYAA 3UJRA 5JU6A 3VMNA 1RSCA 2EXOA 3IVUA 3M0JA 4PRWA 1WNOA 3W7LA 2FJKA 2KAUC 3E5PA 3O8AA 1C9WA 4AD5A 3MMTA 5E93A 4NJKA 3VTRA 3WH6A 5DEZA 3LQLA 2A6LA 4FS9A 2NLIA 3S42A 4GVGA 1ZBVA 4TVCA 4G56A 1KKRA 3CZGA 1BWKA 4P7LA 5CPSA 2Q3OA 2GJRA 1XKYA 2NQZA 3VINA 1VFTA 1QW9A 3M43A 1NDVA 4LRSA 5FEPA 1WXJA 3S1UA 3V0SA 3TQPA 5EMLA 3DHPA 3PTKA 5GNZA 3V1PA 3ARQA 4WKHA 3AMDA 4YVXA 3NVTA 3FYOA 4DBWA 1IIGA 2A5HA 4UTTC 4FF5A 1P43A 2YBVA 4CNTA 2E6FA 1IQ8A 2QDGA 2RGLA 2ZUUA 4JTIA 4IP5A 1J8VA 3U57A 4AZIA 1RPKA 1OT2A 4E2DA 2YCLB 1JR1A 4AZGA 1PV8A 3KHDA 1XJBA 3W25A 2E4TA 1B3XA 3P81A 4H8NA 2P0OA 1FY6A 1QU4A 4XQ6A 4LY8A 3GYEA 1KRBC 3RCNA 2BTMA 4A22A 5E9AA 3EWZA 1IZCA 3APTA 2QKFA 3ME3A 4JFTA 4PZVA 3OB8A 3AISA 4HHMA 1IXPA 3WBWA 4TMBA 5HNUA 3N2MA 1ZY9A 3A3HA 2QQ6A 4WJXA 1PO9A 3L2IA 2A0NA 4HYWA 1V79A 1S5VA 3O3RA 3S9YA 1WDDA 1MQPA 2WSYA 2W91A 3AMCA 1QVBA 1EDGA 4OBRA 1VFSA 4I7WA 1FWNA 1OX4A 3GHSA 1J2BA 3TMQA 2G37A 4NX5A 4MKSA 1BGAA 4U33A 3FSTA 1OM0A 2C3ZA 4DLMA 2PDUA 1ELSA 2PLJA 3VGBA 1AFSA 1UR3M 2XN0A 3WLQA 3KZPA 5F4WA 4PSRA 3ITXA 4MLJA 3G1HA 3IJ7A 2V5KA 2NWRA 3REQA 1JULA 1OFBA 2VEIA 5DQPA 4FPSA 2XGIA 5HOSA 5I3KA 3XISA 3GVWA 2ZADA 3IGHX 4NJGA 4AVFA 4GLEA 1E6XM 1Z42A 4MDOA 1BGGA 3S1VA 1XC4A 3AFBA 2DU2A 3TAKA 3A13A 3CH9A 1LOSA 3E02A 4W88A 1GONA 5C9RA 1WKFA 1GQIA 4TTUA 1RCXB 1Q3NA 3VD7A 5A8QA 2I9EA 3A4JA 2R82A 3L2MA 4B2DA 1K8CA 5C9ZA 4EKJA 4UFKA 5D2YA 3LA4A 4W89A 5IHRA 2HEJA 2JKPA 2DT0A 5JUVA 1AQHA 2XTKA 4LVDA 3N13A 1H49A 4QSHA 2WVTA 3MZNA 3NQ8A 4F0SA 1V7YA 3NR0A 2JE8A 1KFKA 2CNCA 3HV8A 1X1NA 4WRHA 4K39A 5HR7A 1R30A 5LIXX 4JCMA 1A4LA 6XIAA 3KLKA 4FNUA 3U7BA 3PC0A 4NZCA 3T81A 4EE9A 4Y96A 3BLFA 3JZEA 4JN6A 1FWAC 3N14A 4FXRA 2QMKA 3SJNA 3MA8A 1P6WA 4QQUA 2OX4A 5FA5A 3J7HA 3WMLA 4NAFB 4N7QA 3GHUA 3H4GA 1GVYA 1S5MA 3WUBA 4BF7A 1CXHA 2INFA 1HJVA 2PGEA 4HNNA 2Y63A 4KRTA 3BQ6A 3LTPA 4UTKA 4IIGA 4S3BA 3CTTA 3PUEA 1GOOA 3TCEA 2VL4A 2XIOA 3KS5A 3ARRA 3VM5A 6REQA 2YCJA 4B91A 2FTPA 3I65A 2QUUA 1R3WA 4X2RA 2Y61A 4ZFCA 1YMYA 1Q66A 4NILA 2WZEA 2BX7A 2DZAA 3ONCA 1QOQA 2V68A 1Q7MA 3VGDA 1B2YA 1ICQA 1OIMA 2FZBA 5AOUA 1KBJA 1W0MA 3RX4A 4LUYA 4UUIA 4D8ZA 2Z2UA 4NKCA 2ZUTA 3W2NA 1GNXA 2OEKA 3SSZA 4QITA 2ADAA 1M03A 1S2AA 2OZTA 5EMMA 2ZUMA 3A12A 2GSEA 3V0UA 3W84A 1E71M 5A2BA 3LCHA 2VFEA 1UH4A 1V51A 5DRCA 1HIZA 3TQ0A 4ILSA 3AXIA 3R25A 1PPIA 4JBRA 5I24A 3C56A 3H4WA 3QY6A 3ZR5A 1PKLA 3N4FA 1XLAA 3B06A 3QKZA 1JAEA 3W7NA 1CLXA 2A6NA 2BBFA 3GQYA 1X1OA 5GPRA 3SJ3A 1VBUA 2QVNA 2C16A 3SCOA 1H62A 5TD4A 4YCOA 1UZ1A 4F0RA 3LPFA 3DFPA 1FHUA 2Y5EA 3A5FA 3ITTA 2OQLA 3W24A 2XG9A 2PA6A 1R3YA 4DUXA 1HKMA 1OCNA 3CGTA 4AX7A 1EXBA 5HXMA 2ZUNA 3PWGA 4K2SA 2I56A 1PB0A 4CD4A 4ICMA 5KSWA 1DQWA 7ODCA 4FA3A 1UOKA 4MWAC 3BOFA 5I5RA 4QAIA 1YPXA 3ZLHA 1YDYA 3QPEA 1H11A 1W5OA 2GWNA 3MO4A 3MC5A 4X9YA 1I75A 4JFVA 3I3DA 2VRQA 1JI1A 3E12A 2GJXB 4PUWA 2Q3RA 1E0UA 4DPQA 2OWWA 3RILA 4EANA 4AIUA 3VFCA 4MF4A 4PMNA 4QLJA 3ZJ6A 2F6UA 5H8MA 3CZ8A 3THAA 2KX9A 1UR4A 1UMLA 4LS0A 4L6HA 4AIBA 4GIAA 1JCXA 5EFDA 3SCNA 3MS8A 2PS2A 3V36A 4D6CA 1XLFA 3VZYA 4RKAA 1SPQA 4H8VA 4R7OA 2F38A 3WLNA 1E5NA 1UIPA 3VD5A 3KRZA 3PJTA 2NSXA 1FHLA 1K9TA 2FFCA 4ACZB 3W7MA 1BVWA 4YHEA 3QZEA 1E1CB 4JKMA 3GIYA 4DY1A 4C6QA 2GVJA 5BCAA 5CPNA 1B57A 4GD0A 2E6DA 2QCCA 1BF6A 2R94A 3I3BA 1FKWA 3Q45A 1VB9A 4EAYA 4QBXA 4DJEC 3BJFA 3DBNA 1H7RA 2JKAA 4CNNA 2B7PA 4GBDA 2PEVA 2YA2A 4DJDC 1QOXA 2NXIA 4R3UA 3BG5A 3EX6A 4YNGA 4YWIA 1UH3A 1D8WA 4PB4A 3GY1A 4A35A 3W1UA 2EJ1A 4NQ1A 2A3BA 2PDJA 2AQWA 3CL8A 1P6BA 4XKYA 5M17A 3WBXA 3E2RA 1NDWA 2OR2A 3P8JA 5ECVA 2DJLA 3GDMA 3PZUA 3AS2A 2BS9A 4QNWA 5I7GA 1ZNNA 3KL0A 1ZJAA 4L5ZA 2PGFA 2YL9A 5GVJA 3KZSA 1OX6A 2D22A 1GEQA 2V2CA 3K8LA 3TCSA 5JVLA 3W1NA 3NDZA 2VNCA 5E1QA 3N34A 1CGWA 1BPLB 4LVBA 1F07A 3S3GA 4W93A 4FHAA 4H41A 4GIYA 4GG9A 2NSOA 3DOPA 5D30A 4L4LA 2CEQA 4LBRA 3A4XA 1E6SM 5AC6A 5PTDA 3QRHA 4LBUA 3BC9A 3ANVA 2YSWA 7REQB 1HP5A 4I5XA 5AYYA 1C9DA 2NLYA 1W32A 5EL1A 3D6NA 2DZXA 1TPWA 4UWMA 1LM1A 2OO6A 1UB3A 3QR0A 1OC5A 5DLCA 3R6IA 3FHAA 4WX2A 4RZ4A 4HYRA 2YZ5A 4J3SA 3DC0A 3L65A 2OOFA 3QOMA 4JTQA 2HSAA 4DYJA 2WSRA 1WB0A 1FCVA 3LLXA 4WSHA 2R9RA 2UY5A 3BJTA 5H91A 4XVDA 4HA0A 3CL6A 1VF8A 5L9FA 2QCLA 3W3OA 2XIQA 1KWKA 1ISVA 3CXOA 2CITA 4LX4A 3W23A 4GPNA 4KEVA 3WLKX 2HPMA 3TWAA 2B7QA 3WDRA 4AWSA 4FR1A 3N73A 3N4EA 2NX1A 4FLQA 2ODOA 4CVUA 1WAWA 3ANYA 1DIOA 3ZWSA 3WH9A 3NIYA 4IQLA 3ARTA 2OZ0A 3N17A 1AG1O 2PWEA 4BHYA 4DVOA 1TPH1 4R9XA 3CV1A 3RAOA 2H8XA 4XAYA 3DESA 1H50A 2PGRA 1ZSXA 3EB3A 3EKLA 4ASTA 3P14A 3ZS4A 3CUFA 3OP2A 4DBEA 4JTAA 1W1VA 4FR6A 5FIPA 2DW7A 2PODA 4MYXA 3P93A 4GFIA 2ISDA 1EDQA 1XXXA 1XCXA 2F6XA 3RX3A 4TIMA 3TR9A 1UC4A 3EWYA 2QV4A 1K1DA 1KXHA 1M7JA 2B7NA 2DSKA 1KM6A 3ZXWA 4I7VA 3GNOA 4K3ZA 1OZMA 1HN1A 1R8LA 3HG2A 2ZWZA 4UCGA 4PODA 4A8RA 5GNYA 3D3AA 4AWUA 3STGA 5LIWX 2OSWA 1J0JA 3P61A 1Z41A 4YWSA 3WD1A 2XFYA 3AICA 2AGTA 4O1BA 3GR4A 4LNCA 3WO8A 4YCPA 3BLOA 2QCMA 1TIMA 3H2EA 3O15A 1XYZA 3A64A 3BVJA 4N4PA 4Q22A 3I6EA 2ZZ1A 3STEA 4OVXA 2B81A 1THFD 3NEHA 4E8DA 1A5NC 3N4AA 2D2OA 3D0CA 3GDBA 2P53A 1TVPA 1BF2A 3ARPA 4NZ3A 1JDCA 4C6JA 1ZENA 2VMFA 1M53A 2AL2A 3PM6A 3IIZA 2J7BA 2BP1A 2V5BA 1OG6A 1F3WA 2YYTA 3BK0A 3M0LA 3Q2DA 1QPNA 2D0HA 1ZALA 4W7WA 4MB3A 2BNJA 1FA2A 4L65A 1JDEA 5C0QA 1L6SA 1JZ3A 1FH9A 1E5JA 4S3KA 1UUOA 2WNQA 4P61A 3UY8A 2WZMA 3ITOA 3B9OA 1BQGA 4RV8A 3N2TA 3VA8A 1UWTA 3S5YA 3DAQA 3WH7A 1F73A 2YA1A 3RDKA 3VDCA 3EXTA 3GTIA 4OV9A 4ONVA 4M24A 4N02A 4AVOA 4GYKA 5A6SA 2J75A 3PPFA 4N9DA 1FDJA 1I2OA 2ASHA 4RNJA 4UTTA 4WZHA 4MLRA 2X40A 1NJJA 1E1EA 2X30A 1F61A 2CZFA 3W6LA 1AQFA 1ME8A 3D47A 3B9AA 3PZOA 3S0CA 3DERA 1UKQA 4GNKB 1H3GA 1R3QA 3AIVA 4OIFA 4G1NA 1IWBA 4JCLA 1R0MA 4ZB5A 2ZZ7A 4QDMA 4PN2A 1PKMA 1G9HA 1XM3A 1N82A 2OMAA 4BQ2A 1J11A 2EKCA 2VEKA 1EGZA 4L1GA 1Y7VA 3LI0A 3RLVA 3UW6A 3WUGA 3R10A 1V3MA 4BEQA 3EA3A 3RUBL 2DW6A 2ZX6A 4MDPA 3WBYA 3WL0A 3QFEA 4C1LA 4LAUA 3MZ2A 3MUY1 5FAJA 1YXYA 2ZUVA 5H2ZA 1Z3NA 1JDFA 2PDYA 4N9BA 5A8MA 2ZDRA 4HBKA 4J28A 4JHOA 1Q6GA 3RIKA 3HJZA 3S83A 5G5IA 3UJSA 3B9EA 3O1NA 2DV0A 4RE3A 3WF0A 2POTA 3NM1A 4TV5A 4ROPA 4L6DA 1JYVA 3MP3A 4QJ5B 1GORA 3R4IA 3KVJA 2WB5A 1P0DA 4JTRA 3L7RA 2PP1A 5AKQA 3UVAA 3B8TA 5DY2A 5CZTA 4DWDA 2WZIA 5LIYX 3TDFA 3EB4A 2V0TA 1B54A 4ZVJA 4DRSA 1S38A 5AHLA 3HGRA 1FWJC 3L0GA 2CBVA 3D5HA 4LUTA 3NQCA 7A3HA 1U2YA 2XJ7A 3GNXA 3TNBA 1SMDA 1RQBA 3NQVA 3DN5A 1H7OA 3MKVA 4ZZ9A 3C2VA 5AYXA 3UZYA 3K4DA 4GJ1A 3NQ2A 3RF9A 3CHFA 5K3VA 2DSVA 3A9IA 3SQMA 4UOJA 4AEFA 1Z7AA 4EOUA 2Y6ZA 1IWPA 4W7VA 4ICCX 5CG0A 2G5WA 3B8IA 4CQ8A 3O07A 1VYPX 3P62A 5A69A 1AODA 3BGGA 2VZVA 1QNOA 4UTIA 4IMEA 5B7YA 3WD2A 3IVTA 4JFUA 4KH2A 3UXLA 2JGYA 4IP7A 4GY7A 3IGSA 3THUA 3S2MA 4LS2A 3WQPA 3MYOA 4GXPA 1VHCA 5HMDA 1C7SA 1DOSA 1O7AA 3KTCA 1Q4NX 4HN4A 1EX1A 2XH2A 3HG3A 4OE7A 3A6OA 3UJ2A 4G8TA 1B9BA 4PMQA 1C93A 3N25A 4V2XA 1YE4A 1JQXA 3EYPA 1AL7A 1SJAA 4LH8A 1SZNA 1CDGA 1BVNP 4C90A 4IUGA 3H70A 2ZXQA 4UR7A 1GWJA 4ZQCA 3G8RA 8RUCA 1UYQA 2GWGA 2V81A 1SZEA 4MFEA 4UB9A 1HG3A 3QC0A 4URIA 3GX9A 5I3HA 2Y70A 2PTXA 4Y7EA 1XV8A 1U5HA 3TJIA 1PCKA 4OQVA 1LLZA 4J3VA 3BLKA 2VP8A 4MM1A 4HK6A 5BNKA 3WJXA 3QF0A 3PSVA 2QNEA 1CGUA 3NM3A 2NX9A 1J9YA 2VFFA 4REQB 1TV4A 2VRJA 1TREA 1OFEA 1PYMA 3QTGA 3UJFA 1QWGA 1Q6FA 4NUWA 2Y4SA 1Q65A 3VNIA 3ZQ9A 3DEQA 3C0JA 2XHYA 4CVWA 1JJKA 4IT1A 3LCLA 2NT0A 1WPCA 3WQGA 2OGYA 1TR9A 1AW1A 2VQTA 2G97A 5AC4A 5F1UA 4IIBA 3POCA 1W5QA 4KWVA 5JH1A 4JIHA 4XZMX 1XX1A 1HP4A 3F4VA 3GC5A 1NELA 1KFLA 1MFVA 3U3HA 3SFWA 2FZMA 3R0DA 4QLKA 3VXGA 3CMFA 1MNZA 1S2WA 5EFFA 1P4CA 5CZKA 1DV7A 1HKJA 3QY8A 5E0FA 4BK9A 4HHPA 4LEQA 4Z2HA 1P7TB 2QJGA 1LG2A 1A53A 4LCRA 3WLMA 3G77A 3TUUA 2Y8KA 1E4IA 3GYCA 1ME9A 1PVNA 2CZDA 3TVAA 5BXRA 2DP3A 4DZ5A 3FVDA 1W9DM 3ZVHA 3SECA 3PTDA 3WYZA 5ABHA 4J2PA 4ZSUA 3VOHA 3U5YA 4O10A 3LLFA 3W2JA 1S1PA 3CT2A 1WYIA 2Z2BA 1KXTA 1XYCA 4HHLA 3CQIA 2Z6JA 2UY3A 2I17A 4S3DA 1R2RA 4JQAA 3GBEA 1GOXA 2GOKA 4JQ1A 4S3GA 3R8RA 1RP9A 3TC3A 1OFRA 4HK7A 1W1B1 1W6TA 3OO2A 5I3IA 2R6OA 3KRBA 3QMRA 3QZAA 2PMQA 2RDXA 2CHOA 4CQ9A 1ZP4A 5CAHA 3GIPA 1TZ7A 4AY7A 3I7SA 3MB9A 2DZPA 4D9PA 3RK8A 2ZX5A 3IPWA 4ZO9A 4K36A 4GMEA 3S47A 1ITQA 4GI4A 2G3JA 3CC1A 3TP4A 3WNKA 3GD6A 1TKKA 3AU6A 1E6QM 1VH7A 4LF2A 4D8LA 2ZE3A 1JCNA 7CGTA 5FESA 1FWFC 2V69A 4MWAA 2X7VA 1YIXA 3WJZA 1FWTA 3GU1A 4JFWA 3RU8X 4C6EA 3LNMA 4US6A 4JY8A 1OYBA 3NXLA 2FPTA 3GW3A 4XZ9A 4D1IA 1GEHA 1PCWA 3KBVA 1SFLA 3E1F1 5FF4A 1TA3B 3L2LA 2VZSA 1TWZA 4YHGA 4IIHA 1PKNA 3MY9A 1LQAA 3ZYZA 4H6RA 3SRFA 3B40A 3DHUA 1KRCC 2RJGA 1OADA 4DWSC 4JTTA 4MB5A 2I5QA 3GVGA 1CGVA 3UCCA 1JFHA 1FRBA 3W83A 1RJPA 1ML1A 3WNNA 5LNSA 1EF2A 2BWGA 2W61A 1XIDA 5HUOA 3TOYA 1ZL1A 1QK2A 2O7QA 5CSUA 1UR2A 4GINA 1N55A 1XCWA 1WKYA 2J7FA 2QLYA 3OA5A 4QG6A 1V03A 3AAMA 3U0HA 1A49A 4AUBA 2O9PA 1Z48A 2XN2A 4GISA 4KERA 3GWQA 1S5TA 3AO0A 3O6YX 3KBWA 2P8BA 2FDSA 1A3XA 1NVMA 3W1PA 3AMKA 1NDYA 1GVEA 5K4XA 3K2GA 2YFNA 3PB2A 1TVLA 4JTFA 3EDFA 3DFNA 3RG6A 1TCDA 3AUJA 2O55A 3L0KA 4N9EA 4AF0B 4FXJA 1TX0A 2GDUA 1LJYA 2RJHA 3O2LA 4XX6A 3FIGA 1D7FA 3A9BA 5LXXA 3P5ZA 2E67A 4R85A 1KM4A 3F4WA 3O7UA 2X0HA 3FCPA 1PJ9A 4C1NA 4DJEA 2FIQA 3ABRA 4Q4SA 2YJQA 1D7KA 3KWSA 3JZUA 3OLEA 2DZUA 4DJDA 1QPKA 1KGUA 2PP0A 4IXHA 1V6WA 2ALRA 1EP3A 3MVIA 2WOQA 3LK6A 2RKXA 5BXSA 3FAWA 1S5WA 3RM4A 3UWZA 3TK7A 1JFXA 1ZBWA 4PMOA 1H7WA 4UXDA 4C6KA 3L4TA 2DZSA 1KM3A 4H9ZA 1XYFA 5CG7A 4UQ9A 1WCGA 2PRHA 3GUWA 3N1AA 3WFLA 4JIQA 3NL2A 3P67A 1KC7A 2XGBA 2WNZA 2MNRA 1VEMA 1NIUA 4ZE5A 1U1JA 1TPFA 4GQGA 3NQEA 1XYAA 1HL2A 4EX4A 5EMJA 5E6ZA 4Y8EA 2OWXA 5C54A 3CWNA 1UD6A 1C90A 4IIFA 4XIMA 4KCVA 4J3TA 2OSXA 1EJXC 1WKEA 3LM3A 3DFHA 2PDCA 1OK4A 2ONEA 1HKWA 1GTHA 3WBAA 1LORA 4UOQA 3S4TA 2OO0A 4Q8TA 3DFQA 2G3MA 4F0KA 3EB2A 3QHMA 4DPPA 3TJLA 4HNOA 4XD4A 2H3BA 4FZIA 4PTVA 3AI0A 1F76A 4XWUA 3EWDA 3LI1A 4K38A 2CLIA 2E9BA 1XPYA 2J8FA 1A5KC 3P74A 4S23A 1PL9A 4NASA 4PRRA 3UCDA 4ZMGA 3G0SA 3AIEA 4IPPA 3UY7A 5BROA 4HZ6A 1SJDA 2CLLA 2NX3A 3Q65A 2A21A 5CXPA 2ZZ6A 1S1RA 4UMAA 1ZFJA 4BS0A 4A3YA 4XZHA 1LRTA 1DJYA 4H04A 1W1A1 4IQJA 4FNSA 1UPPA 3MUAA 5D9PA 3AMGA 1B1YA 3V4BA 3SQLA 1G7UA 3CWHA 5G2IA 1XGZA 3Q67A 3K8MA 4WK9A 1S46A 4PB5A 5FF3A 3SRHA 5CBJA 3SEPA 2DORA 3SO7A 3VKKA 4JTCA 3DX5A 2I5GA 1NWUA 1Q7ZA 3IIPA 1DHKA 3T9PA 1XH1A 2IMRA 4PBFA 3RLHA 3WFZA 4JS3A 1XUZA 3TU9A 1PHWA 2D3LA 1KCXA 2X7WA 1ICPA 4KCUA 1UR0A 5AYBA 3BAJA 3IWPA 3TC6A 4DXXA 1OFOA 1QHPA 3L4VA 4GABA 1FX6A 1PWLA 1EUAA 3GU9A 3R79A 4LOCA 3T2OA 4HMEA 1R3VA 2INEA 4HNCA 2NUWA 1JRCA 3PJXA 2D20A 4ZTYA 1JEZA 3PR2A 3HPZA 3AHXA 1WQ5A 3LCIA 5F7UA 2J47A 3DDMA 3S46A 1YNQA 3OLIA 4XUGA 1C8YA 2EJAA 3EXSA 4HZMA 2RDTA 4C6MA 2IPJA 1BRLA 2XZ7A 3FGCB 5HJYA 4M0XA 5GJMA 4GQBA 4O57A 4IICA 2D2HA 4UCFA 5G1MA 1I9CB 4GC3A 4JX6A 5HMFA 3PZIA 2XFRA 1DVJA 3URNA 5C5YA 2OSYA 1N2VA 4WKAA 3M0IA 4QJ4B 1J0YA 2E25A 4MY1A 3II1A 2V8ZA 3KP1A 5BXPA 4F66A 3C8NA 3VIPA 4FK9A 1OEPA 1JPMA 1QI4A 4HNLA 2EPKX 2DZBA 2X2YA 1GOMA 4AD3A 3TE9A 3C0LA 1U5VA 2JK2A 2J24A 4HCDA 5M5DA 4UMCA 4PTWA 2ISSA 1SMAA 4R34A 2E3ZA 2ESCA 2GGIA 1YDVA 3UZWA 2WHMA 3CO4A 2MANA 3K8KA 1HVQA 2QPUA 4DAFA 4AD1A 4YYCA 5CGQA 4D72A 3QW3A 3T0AA 2NW0A 2EHHA 4UNIA 4FOKA 3CUGA 1ZQ5A 2J13A 4UTLA 3S2NA 4HTBA 3IRSA 5FD0A 2BY0A 3TXZA 3EOUA 4GI9A 3WBEA 3PTQA 4GYJA 4X0NA 5CPOA 3B9DA 1XLHA 2FFIA 4CCCA 3TFCA 1AW5A 2DT3A 3WLJA 1RHCA 1GKPA 4XBKA 4XO6A 4GYPC 3LM7A 4PBEA 2FKPA 2BY3A 2Y7GA 1L0PA 4JN8A 4ZO8A 3USZA 2FJUB 4HHHA 4HQVA 5MHBA 3VILA 1Y0EA 3B8SA 3L68A 3AWOA 3W87A 4GH3A 4HMDA 2PZNA 4WLCA 3G24A 3OW1A 1KXVA 3DU0A 1IR2A 1VQTA 3N3MA 3GXPA 1KKOA 4Z1AA 2RGMA 4ADSA 2EAWA 3WD4A 3CZEA 3VCRA 1TIWA 1GOIA 5CZ0A 1DJZA 1Q6OA 4Y2WA 3VUPA 1BXBA 1REQB 1X7FA 2PSNA 3T55A 4CLMA 3EKGA 1WOAA 4RXGA 4AYSA 2INZA 1EA9C 1F3XA 1XIEA 2ZA1A 2ZA2A 4CD6A 3VIMA 3BLDA 2GGGA 4LUSB 1DQXA 1E4LA 4S3EA 1T40A 1U33A 1W3LA 1ONXA 5CQ1A 1PXGA 4NP7A 1MZRA 2BG5A 4C5YA 1E56A 2E68A 1UZHA 4A6GA 4MY8A 3ARUA 3HN3A 4PRTA 2BVWA 3SM0A 2RDWA 5D02A 4QJ3B 3O0FA 1DYSA 2WZHA 1MQRA 4V33A 1L8PA 4XKMA 1CI1A 3NO3A 2YZRA 4LAKA 4ML4A 2W0UA 4CN1A 3CQJA 3G3DA 4J9JA 1JNEA 3ARZA 1MRQA 3WELA 3U2CA 3HQ1A 3UWQA 1VFFA 1UWAA 1EJTC 2XWDA 2F2KA 1OY0A 5KMYA 2V63A 3T4WA 3AS1A 3KCJA 1E6PA 1X8CA 1OWQA 3CEUA 4H9TA 4AC1X 1EJRC 3I3EA 4GRSA 3VKDA 4AW7A 4CN6A 1OINA 3SGZA 4LB3A 4HA1A 4JTUA 3W0KA 2D2JA 1GG1A 2ZVRA 1E51A 1T8QA 3T05A 3M16A 2QEZA 3N29A 1VFMA 4PB3A 3BL3A 3UZZA 4NU7A 1E9ZB 4ZR8A 4YTRA 4B9YA 1V02E 3IJIA 3SCTA 4PUNA 4I6KA 2QJHA 4LB4A 3BLIA 3O6DA 2ICSA 3W7DA 3HFYA 4YVVA 1Q6DA 1GUVA 3RGTA 5EMYA 1JDDA 5RUBA 5T9CE 5EYWA 2IQTA 2QCDA 3LLDA 1ADOA 5EY5A 2FDMA 3NVDA 2ZTJA 5KZDA 4B5WA 1E6ZA 2QW5A 4GVFA 4XO7A 4F79A 4WQ6A 1NWTA 1C8VA 2OT1A 4AEOA 5IM51 4GUHA 4KRZA 3GH5A 5FJUA 4F0HA 3F4CA 2ZX9A 2V82A 3C86A 1VJZA 1QW7A 1L9WA 1IEXA 4D8AA 3HG5A 4QQ3A 2P8CA 4A3HA 1L2QA 1FUYA 3PZVA 4XD6A 3ORWA 4YTSA 3TH6A 4KFNA 1VR6A 4OT7A 1TX2A 5M03A 3SGGA 1BVZA 4ZB0A 1XDLA 4OTKA 5AZ0A 1VFOA 3KTXA 2OQYA 1X7IA 2QIIA 4Q8MA 1W3TA 1JI2A 2C79A 4BR1A 4PTNA 2VGBA 3G5EA 3NZRA 3KVLA 4DUVA 3QR1A 4OGZA 3N15A 5BMWA 1UCWA 2O4QA 5HULA 3AIRA 4GVIA 5FEWA 2ZUSA 4Q6JA 4WIWA 2WC4A 4JEQA 4S38A 2FVLA 5AC5A 3AU2A 2HTMA 3WUEA 1GHSA 4XAGA 4GJIA 3H2OA 1SYTA 2HZGA 4LGXA 1N8IA 2BXYA 2J4GA 2BGSA 4YTQA 4JDYA 4C60A 3JU2A 1DORA 1YBQA 5ENLA 4B4FA 3URQA 4GBUA 1J4EA 2F6KA 2F8QA 1OG0A 3M7SA 3OBEA 2QYGA 3LSBA 2VFIA 4F4RA 1TV7A 1ONEA 3WLSA 2NUYA 3D3FA 1A5BA 3VE9A 3U7VA 3KOWA 1FVPA 1YRRA 4LV4A 3W7JA 5CH9A 3TIMA 5A6KA 2AAAA 3FAXA 1HUVA 4GOAA 1OF6A 2H9AB 4G1KA 2YL5A 1GVRA 5REQA 2CBUA 3S9IA 3R0UA 3PBVA 1GPWA 5HJXA 3VIJA 3V5OA 1PE1A 2NXHA 4NSBA 4O53A 3NQAA 3M9YA 1KFWA 6TIMA 1OB0A 1EYEA 5ABFB 4IMGA 4ZFMA 4E4PA 3T40A 5LKYA 3Q4DA 4Q4RA 3JS3A 4CCZA 3QHOA 4Y9OA 4MYAA 4W8LA 4RDWA 1X39A 3HG4A 2GLKA 4GQRA 2R1MA 2WCSA 4B3ZA 1RK5A 1O66A 3DGBA 3MV01 3B8VA 5C7HA 3LQGA 3ZT7A 3AOFA 3G1FA 1QNQA 1DPMA 1Y65A 1HJQA 3MT1A 1LUCA 2AQOA 2AGKA 1ZAHA 3H22A 2OODA 4UTMA 2B31A 5FI8A 2QCHA 5LIKX 2WNWA 4QRNA 4J27A 3T7VA 2UZ9A 1CWYA 1PTDA 3BG9A 1O5RA 1HL9A 4GFSA 1H60A 1KBLA 3UR8A 4KEUA 2VDHA 3VCCA 4GIEA 4O14A 2EO7A 3E0WA 1A5MC 4DWSA 1BFNA 2WW5A 1S2UA 3OJGA 1FOBA 4HA3A 2QGHA 1P6CA 3GW0A 1FWHC 4WSJA 1RCQA 1MO0A 5C8BB 4IFOA 3IAQA 5HMSA 3RHGA 1KFCA 4V15A 1G4EA 4E0CA 4GI6A 1GTEA 5A2AA 1BYCA 3ENLA 1UWUA 2CLEA 3QYQA 2WLZA 3WJYA 5C6MA 1J0HA 3IANA 1RCOB 3NQGA 4KBXA 4AYGA 3S2CA 2FHFA 4ES4A 2ON3A 4JZ5A 3WF2A 1IZKA 3GDLA 4HJFA 4OOZA 3ZLGA 2J74A 5EBUA 1XYMA 3W1AA 3BMWA 4PTXA 5MKGB 3WH8A 1MW1A 3MP5A 3RLUA 2G4JA 1D2KA 1QHOA 1RVGA 1DTUA 4Q32A 4F48A 3C5QA 1Y5WA 4Z1DA 3VU2A 4RDYA 2V3EA 3VNZA 4JTLA 1R9YA 4DO4A 4M3PA 4YJ5A 4NNCA 1V0LA 3HPAA 2HE5A 3QLDA 3AYTA 2A3CA 1G67A 5B7ZA 3KOFA 3ONBA 4P7QA 1F8IA 2OFJA 4WKFA 2OYLA 4IMDA 1SW0A 4JTJA 1RV8A 1GPFA 4XG1A 1P0KA 3L4WA 3OYXA 1YDOA 4MVAA 5FJTA 3VK5A 4NG3A 4OUIA 1MZHA 1NP2A 4GYFA 1B3OA 4TVDA 3BAYA 3R94A 4AXKA 1M3UA 4ZODA 2RHGA 1JYWA 3MHUA 2W9MA 1CIUA 3W37A 1XSIA 3LGDA 4L56A 4PEEA 3CPUA 5DMMA 4C7FA 5JXQA 3MMUA 2V9DA 2XVLA 2HCVA 4Z2GA 1XGDA 3NAVA 4MZ1A 1E0TA 4R88A 2XPKA 4IQDA 4C6DA 4X22A 4H83A 3VUSA 1HXJA 1T96A 5XINA 3QGVA 3H55A 1MNSA 4C1KA 2NVAA 3W28A 1TJ2A 3C4UA 4QX4A 1E9YB 4GUFA 3E6EA 1XIHA 3CQ0A 4KCTA 2E6AA 1EBGA 3B97A 1HX0A 3DUGA 4B5TA 5CC7A 1US3A 1T5AA 2F61A 4PUKA 4WD0A 1MXGA 1DWJM 4BCEA 5TIMA 1KFBA 3WEMA 1KO0A 4K1GA 3UZ5A 3VIFA 1BSLA 4WEVX 3T6CA 1CNVA 4YL2A 4HPJA 1KFJA 1XSKA 3LXBA 1MVYA 4ZA0A 1QWKA 3K1GA 3TXVA 1ZUAX 4BZYA 4WOQA 2IQ0A 4LFYA 3CL7A 1E4MM 4QE1A 1YXCA 3SIZA 4GY1A 2GUYA 3K30A 3AIUA 3T09A 1PAMA 5GNXA 4O28A 2CERA 4XZNX 5B80A 5HATA 3GE7A 3UNTA 3S6OA 3FV9A 1KD0A 3LGGA 2YCLA 3ABZA 1TMQA 4RDVA 3CZKA 2BVTA 3O0KA 1CEOA 4OUEA 4ZCWA 1VHNA 2ZRYA 2OEMA 1PUDA 7TAAA 3EDEA 2REQB 3IIOA 2ATSA 3VAVA 1NAL1 2DT1A 3RJYA 1A4MA 2WM1A 3ABXA 2A4AA 4A4AA 2WLYA 3BAKA 4H6EA 3ZIZA 3BAIA 2CW6A 4BF9A 5D8ZA 3B4YA 4M7TA 1QI3A 3C0SA 2QDEA 3APYA 1RH9A 4QEHA 1OCBA 1JZ7A 3KAOA 1UD8A 2VOMA 3H2MA 2JQXA 1XL9A 4B5XA 2ACUA 1KBKA 3LB0A 4X2PA 5I3DA 3T8LA 1TVNA 4E8CA 3VZZA 3IIVA 3FKRA 5CSSA 3HO8A 3WMBA 1US2A 3LERA 4JGDA 5D38A 3SN0A 1J96A 1O1HA 2TAAA 4I90A 3AWNA 4C6BA 1BYDA 3HQOA 4DAIA 3SUTA 2CC0A 3A21A 4TX9A 3VOIA 2XUCA 4JIEA 5LGZA 1FTXA 1A50A 1V6UA 4QHRA 4P8XA 3WY1A 1GZJA 3EOSA 3HMCA 2TRSA 4TX6A 3UYIA 4L4MA 4M1RA 1MW3A 3WLHA 2C1HA 4KW2A 4UTFA 3PB0A 2WJZA 3BSHA 1MMFA 3TLLA 3W73A 1UOZA 4Q4QA 1GKQA 3ERPA 1WUEA 3UERA 1VEPA 2JIWA 3T78A 4AZ5A 3KBNA 4H7ZA 1R7AA 2BHZA 5BOEA 1HL8A 1ECQA 2XGZA 1ZAJA 4JYDA 1PZ2A 4Z42C 3A3XA 2CBIA 1KTBA 3LHWA 7XIMA 1O12A 4NZ1A 2X41A 5HNNA 4J2MA 2RUSA 1I2NA 1NARA 2ZRWA 3VIIA 1QR7A 2IKHA 4JYEA 1XRFA 3ZJ7A 5D2TA 3T1GA 1R3SA 5C9WA 2JF6A 2VD8A 5EB8A 1WXZA 1E72M 1ZJBA 3IGXA 3KEHA 4AQLA 1BSIA 2WV8A 5BOFA 4F40A 1YQ2A 3W86A 2JEQA 3ISIX 3PNZA 3LTYA 3R7MA 3IJ8A 4MY9A 3ZMRA 5KITA 3OIHA 1DWAM 1XS2A 3O06A 3PF3A 3LD5A 5DT7A 3NO5A 3RR1A 3MU7A 4A05A 3PG9A 3H7UA 1G4PA 4PMDA 3WQ4A 1RBAA 4GYPA 3CO8A 5LYRA 1X38A 4UQAA 4UOZA 4NAFA 4MADA 2ZUWA 1GK8A 3E0IA 4QAWA 4G5DA 3TONA 3IUIA 1PZ3A 4RZ5A 4DJED 4WDUA 1X8FA 4DJDD 1W5MA 3LPGA 1T0OA 3RX2A 3EEZA 2Y7EA 4HYVA 5T8GA 3F1QA 4MNJA 3PWAA 4EXAA 1H2JA 3LTSA 3WQOA 1RA0A 3VGFA 3VKBA 1LL7A 4FP1A 4WUIA 1TELA 3SBFA 4MKNA 3U5UA 1H5YA 4CD5A 1JYXA 3MCOA 1WX0A 3FA3A 3HQNA 4IGSA 5D2VA 4MPKA 2OZ3A 3DHFA 2NZLA 2XVNA 5IBXC 4HD5A 4HNUA 1EF3A 3IEBA 5EKYA 4GZEA 1LTDA 2ZFAA 4B5NA 5LHFA 1H7PA 2C91A 2X1TA 2PLKA 1NY1A 1NWSA 3GXFA 1L2UA 1RQHA 2EF9A 2ZXBA 1P0NA 3BCFA 3MCNA 4WSKA 3R0KA 3R2GA 1VPYA 4I9JA 4GX9A 3U9IA 1V0KA 3JR2A 3WG6A 1XPGA 1ZHAA 5DBTA 2FQIA 4MSSA 4LSBA 1OQFA 3T2PA 3NURA 4IPLA 3FOKA 2PU0A 3GR8A 2QS8A 4QDPA 4U4MA 3T4CA 1S2VA 2GVLA 1G69A 3VABA 3G6MA 1GHRA 3ZO9A 4M51A 2QGYA 3LU2A 1A5LC 4FX8A 3P3BA 3TTEA 5HPCA 2W67A 3PZGA 3B0VC 1AA1B 2O4MA 3MMDA 4LYPA 3NYDA 5IDZA 3BICA 5A6JA 1B3ZA 1HJSA 4IMFA 1GJWA 1F8MA 4LANA 2V3GA 4LEFA 1XISA 1R2SA 3DI0A 3SUUA 4TX8A 1OC7A 3CLWA 2DZTA 1WBJA 1JNDA 2XVGA 5A94A 4M82A 3Q37A 3SCUA 2OU4A 5ABGA 1GQJA 1KW1A 4CGTA 1MRAA 1I2PA 4TXEA 4IGHA 3R13A 3QPZA 3KX6A 1ZTVA 2GJXA 3AUOA 4EPDC 1GVIA 1GGOA 3B0UX 3WEZA 2WHLA 3GZAA 4MB1A 2J25A 2OB3A 4O0ZA 4MIMA 2DDXA 1W9UA 3P8IA 4L9XA 1SU5A 3N2XA 1ZRQA 1EWEA 5I06A 3EPMA 1HGWA 1GQNA 3KL3A 3ZSTA 3CU2A 3QQ0A 5LNWA 5AHEA 4LW7A 2G3NA 5HWMA 2D23A 4QTGA 4GUGA 3TMLA 3GFYA 2PB1A 2C0AA 3NQ7A 1DBTA 3IIXA 2Q02A 1OHLA 5A95A 1IHIA 2C19A 3QVQA 1VAHA 2V5LA 2I14A 4WY0B 1K77A 3WH5A 1BWLA 5HJLA 4ACZA 1JPIA 1LBLA 3WF3A 5ABTA 4UTWC 2IPGA 3SCSA 4IG2B 3CBWA 1PX3A 1E1CA 3QM3A 3UWVA 4JKKA 1XC6A 1F6KA 1TPUA 3BO9A 3KWXA 4IMCA 3UP8A 2W27A 2XIIA 2ZZ3A 1ME7A 1QNPA 4O8RA 4RPQA 2VZUA 2WSKA 4Q33A 1RAKA 2GVEA 1GOKA 4NRSA 4QG9A 4O52A 4Q8NA 4UZUA 5K9CA 1TRIA 1LQ2A 1RXOB 4V1XA 1LOQA 3APGA 3AHZA 1EP1A 4AY1A 3DG6A 1EO7A 2CKRA 1EZWA 5FF7A 4Q6XA 3MSRA 2VZTA 3CUXA 4WOZA 5F4SA 1G94A 2CXGA 4LC8A 4AIOA 3L4YA 1UA3A 2WVVB 4JDBA 5D37A 2O0TA 1XDJA 4Y9PA 1NOFA 3KL5A 4PCNA 3N18A 2XINA 2ZRVA 4DUOA 2JKEA 5KZEA 3B03A 3V35A 1I1XA 4IP4A 3R8GA 4F2BA 1F3TA 1UUQA 3NQ6A 1CTNA 4AZCB 5I77A 3RXZA 1HZYA 3P7YA 3GDTA 2OLSA 5D8WA 4JAWA 1K7XA 2WVUA 2NWSA 4NAEB 4RJEA 2PWFA 2PTDA 3FX4A 1EEPA 3TR2A 1O94A 4M80A 2YBUA 4D6IA 1I2RA 2E9LA 2J9ZA 3LCXA 1DP0A 1RQEA 3PPGA 1A5UA 3LXCA 3GR7A 4D6EA 1YKWA 1R38A 7REQA 1A47A 3AIQA 1LT7A 3SADA 1ZZMA 2QMJA 2P3EA 4MAVA 3W7OA 4JNMA 4AC7C 4RPPA 3MI2A 3CIVA 4CQCA 2BASA 1VBGA 5AN7A 1XG4A 2G41A 5A6BA 2QPSA 1OFPA 3BSMA 5AECA 4PBGA 1EX5A 3W1MA 3EX3A 2A7PA 4NZ5A 2ZIDA 4P8UA 3B0XA 2HXTA 4H00A 4AMAA 2GGHA 1QW8A 3L5AA 3MANA 1EFZA 3NGJA 2CBJA 1UD5A 3SI9A 4D6DA 1SO6A 3W70A 1YYAA 3UZXA 2DSUA 3E0VA 3FYYA 1GOQA 3G1DA 4ZQRA 4LYQA 1O68A 5K2ZA 2CZEA 4RR4A 1MSSA 4AHQA 1W54A 4C6IA 4L6OA 1BYAA 4Z0SA 3EDJA 4FNTA 1VBJA 4FIRA 3TN3A 1OFAA 5DANA 1B5TA 2BHYA 2PP3A 1QNVA 1BG9A 2QCFA 2Z24A 3FA5A 1RA5A 3OU8A 4JTGA 1G6CA 5AYIA 4LU0A 2A79A 4LCSA 1YE6A 3LEPA 3TWBA 4AHPA 2WMIB 1FH7A 4AZBA 4NT0A 5CKSA 4YVPA 3CB8A 1SM9A 3MSDA 1EHAA 3GH4A 2OQHA 3L66A 3M6YA 4Q8PA 1UMYA 1MDRA 2AQVA 3CV7A 4KEMA 1QAPA 3F2CA 1HFBA 4LJ3A 5CGTA 4GA8A 5TQLA 4IFKB 2EPLX 4NXKA 5F1VA 3WDIA 3PZ9A 1PX4A 2FTWA 4IX0A 2XU2A 1FXQA 3GXDA 1A3WA 3ATZA 3KBSA 2WPGA 3PNUA 4XBJA 2BDQA 1A80A 1UKTA 4NF7A 4NJIA 2WK2A 3NQFA 2WYSA 1SFTA 4ZEPA 4LXFA 4G7EB 3LX9A 4W5ZA 1E55A 2IKJA 1K02A 4HB7A 4K6AA 1UQZA 3AXXA 3GXMA 4XVEA 4Z1BA 3PJUA 3PAOA 1UP0A 1XBVA 3IS4A 4C6OA 3EAUA 1EC9A 2Y24A 1DJIA 3T0BA 4OECA 1XINA 3AHYA 2QPXA 4Y9MA 4O12A 4Y9AA 5TBOA 2OELA 1F3EA 1IEIA 2OCZA 1JZ5A 1FWGC 4P5UA 3DXIA 2FH8A 3ARVA 3KS6A 3U4AA 1M68A 2R1NA 2JBMA 9CGTA 2Z00A 1E73M 2G3FA 5JBDA 2OG9A 2UWFA 2Y62A 1J2WA 3DG7A 4I9AA 1WZKA 4JTSA 1KCLA 4DZIA 5G2WA 1KTCA 1MDLA 2C8NA 1OC6A 1YX1A 1JGIA 3QYSA 2J9YA 2EPNA 3P82A 3EOEA 5EU9A 5HQLA 1TMHA 3W7RA 3NCOA 4J3ZA 5AZ1A 3M5XA 3S8HA 1HJWA 4PE8A 3LNPA 1IE7C 2AMGA 1B3WA 3TJXA 1OBAA 1R9ZA 4A8NA 1XFBA 3ZM8A 1DE6A 1H5VA 2QJIA 1VIWA 5A8PA 1R47A 2PDXA 3M0XA 2DUXA 2HK1A 3KUMA 3W2UA 1O4UA 1SFSA 1XD1A 4JIRA 1UA7A 4XB3A 1IT7A 3OHIA 1R6WA 3R12A 3NWRA 2A1YA 1XIGA 2FMNA 2H90A 4XZBA 1XLEA 1AMKA 2ISVA 3E2QA 2VX6A 3AALA 3FDKA 4LYKA 4YTUA 3AHVA 3BV4A 3MBDA 2Y7DA 4Q4PA 4NIRA 4IGMA 4RCXA 3CS2A 2HRWA 3F2DA 2VENA 3HF3A 1Z8AA 1Q85A 4J3XA 2D1ZA 3BW3A 3G1YA 3FKKA 1QRQA 3BCJA 1L6WA 2IPFA 3E2SA 4N4QA 4GNJA 4BEUA 2GJPA 4CKQA 3ZVIA 2HE8A 4KEZA 1K9DA 1JG9A 2V5JA 1ICSA 3EX2A 2FVMA 4EPKA 4GX8A 2BOFX 1V3LA 3GAYA 2E77A 3W82A 2PDBA 2D2GA 1D3HA 4O1DA 1XUUA 2WC3A 3VIKA 3M5YA 5F2GA 4YLWA 4A3UA 3LRLA 5KZMA 3ZT5A 3U48A 4NYYA 1UD2A 2DZWA 1E40A 3GNRA 4OBSA 1K6AA 4ECLA 1C8XA 3UVIA 5LA1A 2QCEA 4UQDA 1E70M 5LXEA 3STFA 3LOTA 3G2GA 3IK2A 1QPQA 4XUYA 3OZMA 1V3JA 2FB2A 5E70A 1KV8A 2J77A 2H8ZA 3KLLA 3EBVA 5HDRA 2CFFA 3BSGA 1H51A 5A8NA 2NV2A 3IJ9A 4CU7A 5U7SA 4GZJA 3N19B 4HPNA 2CLPA 4Z2JA 1ZCOA 1W2VA 2CESA 4H8HA 1V6XA 1SQ7A 1XBYA 2C18A 3IACA 3HFTA 4MNLA 3FN9A 3FVMA 5ECUA 1Q45A 4H2HA 3AIWA 3UXAA 4DWSD 4HPGA 3S6TA 3T8QA 1AVAA 4LAMA 3STPA 3MWCA 4A3RA 3VGHA 4UIOA 2OLHA 5DELA 3VI2A 1TJRA 3NZPA 1IIHA 4U10A 3UWYA 2D69A 1EQPA 4LAZA 3S5OA 4EF8A 1US0A 2DQWA 1XYBA 1KCKA 4CEUC 2W63A 3IV8A 3MDUA 1ZP3A 4K68A 5CSYA 3E74A 2BB0A 4PUDA 1KGXA 3NYZA 1XBZA 4N6EA 4QCFA 3DYMA 4OZOA 3NXFA 4I9TA 3E0LA 2EBNA 3H2NA 2NXGA 3CHEA 2WSQA 4MB4A 1ZCCA 3ZR4A 2HBVA 1X97A 5DCEA 2QDHA 3SCVA 4B5SA 1V8EA 3AJXA 3ITCA 2QULA 5FJRA 4REQA 4XTDA 8XIMA 1ISXA 2OJPA 1OYAA 4DJFC 3IAPA 1UP3A 3EOLA 3LGEA 5E6YA 1Q8AA 3GKAA 1ZB5A 2YBTA 3WLIA 1TUFA 4C6FA 2VGIA 1TR1A 1SJBA 1TV8A 5AVHA 3K13A 3M4HA 1EOKA 3VD4A 1C29A 1RBOB 2HJPA 2DH3A 4HU3A 5IBXA 1RLDA 4E5TA 1R5YA 3W88A 1M5WA 5DCDA 4X61A 3MV11 4S2BA 5AHNA 3SW6A 1GCYA 5AHMA 1BQCA 3PUDA 5FAGA 2QVHA 1JPKA 1E4NA 3LDVA 3TYDA 4UTHA 3ES7A 3CM4A 3U2ZA 2TPSA 3WN6A 3T08A 4ZQPA 1VP5A 3G0XA 2Y89A 5BMXA 1XRVA 3BMVA 2P5NA 1P7TA 1CXIA 3ABOA 1M41A 2GOUA 3GO2A 2WJEA 1O5QA 3QEZA 2Q6ZA 3CK5A 4LS1A 3AS0A 4W86A 5FL1A 4H9YA 3ZWTA 3TSMA 4IPNB 1WZLA 1O60A 4L9YA 3TZNA 2Z27A 1V4YA 3TJ4A 4Z2LA 1D9EA 1GVQA 3VC6A 1O1ZA 1UIOA 1MWOA 2VUYA 1IEVA 2XM1A 3WJWA 4H19A 3VD3A 3BZGA 1DWFM 3VD9A 5T26A 2Z1XA 1DIDA 3GVRA 5D2WA 4WXZA 4K8GA 4GE8A 2QAPA 1FWCC 5SWUA 1JZ2A 1OT1A 5CJNA 1R85A 4BI5A 1W91A 4N42A 3MQTA 3OLDA 1UW9A 1XHGA 4QP0A 1IR1A 1ECEA 5A2CA 4M29A 1J0KA 2DQXA 3B8DA 3NG3A 3TV8A 3W1XA 3W2MA 2FHCA 1LL4A 1GZGA 2PE4A 1NQKA 4JX5A 3S1WA 2WVSA 1KV5A 1XIJA 3S1GA 3JW7A 1Q13A 2BY1A 2VVSA 4KIEA 5DMLA 5LA2A 4E8GA 3LS9A 2I5IA 3KW3A 4ZO6A 3BWWA 1TA3A 3W07A 1ADSA 5EMUA 1EQCA 2WQDA 1J79A 3HU7A 4GQQA 4IUOA 1ODZA 1B3YA 4IX2A 2PD9A 2J7EA 1JD9A 4L1WA 1W1ZA 2J7DA 1POJA 3EPNA 1E6NA 2J27A 4U3CA 3QFWA 4LNYA 4YN5A 4EF9A 4PTDA 5BZAA 1MXSA 3F4DA 2OPJA 2VCCA 1CZ1A 4AVNA 4NI3A 3WD0A 1I60A 4Q8UA 2QDDA 3MJMA 4PUJA 3CEPA 4KCWA 1UHVA 2D3NA 4FMVA 5I0DA 1QJWA 5H1WA 1QCWA 2HWGA 4UTWA 6XIMA 2BODX 1UC5A 3NPXA 4NX0A 5BWFA 1BKSA 5HAOA 4JTEA 3NL5A 1H63A 3G0UA 4PMXA 4AF0A 4RNHA 4UFIA 2VO5A 3LZ3A 2J62A 4D71A 3DKLA 3GK0A 3WENA 3UG8A 3WQ5A 2C71A 1DL3A 4FNPA 1PIFA 4TQTA 2UBPC 3OZPA 3WIJA 4G6CA 4CQAA 2PWVA 4CCEA 1T6MA 3MW7A 1YPFA 3WLOA 4I8DA 3WNMA 3VIGA 4BQ4A 3LG3A 4IJCA 1QOPA 2BGNE 2BFGA 3BE7A 3N2OA 1ZBCA 5L6UA 4XIAA 1K7EA 2C14A 3FJLA 3WLLA 2QF7A 1EOMA 2GK1B 4S3JA 1UP2A 5G4HC 3M0KA 1KM0A 4JNZA 4V1YA 3FLUA 3W1LA 1VLIA 1RK6A 1RUSA 1MEWA 3M64A 1DKWA 3IUDA 2PC8A 3CNYA 1JVNA 3SFKA 4TV6A 3NTYA 3ZLFA 3UXIA 4NYUA 2CIPA 4N6FA 4S1FA 2RAGA 3CV2A 3SGUA 4PCSA 4WXYA 2WCGA 4S3CA 2L5HA 4GZ7A 4GQ0A 3MO7A 5HQEA 3WK2A 2QCNA 5H8PA 3D46A 4UNKA 2WHKA 4LVFA 4ROQA 4HP5A 4GXWA 2PURA 1W31A 4RL3A 1H0GA 3M5VA 1ONRA 4W7UA 1Z89A 1ZBKA 1Q5MA 5FJIA 1Q2SA 4U5IA 4IF2A 2QIWA 5CJMA 4FOUA 3BW2A 4M19A 1VCFA 4P2VA 2XH7A 2EG6A 3H26A 4MWAE 3BOLA 1ITCA 2HVNA 4OBTA 1EGVA 3EPOA 1QMLA 3VMPA 1VRDA 2J66A 2P0IA 3TSDA 4K7VA 4FIQA 4OOUA 2ZX8A 4GO8A 2PCQA 3AS3A 4GCAA 2R1KA 4PMYA 3C52A 3T07A 3MTWA 3KE0A 4DXKA 2YIHA 4C6LA 1UH2A 2QXWA 3EWUA 1UASA 3NDYA 5E5CA 4HMCA 4JEJA 2VGFA 4X60A 3PSWA 3H54A 2WKJA 1PYFA 5CGMA 3DGRA 2WJDA 1WUFA 3RITA 3DI1A 1B0IA 3AXHA 2QUMA 3OEXA 3RPMA 1NSJA 1UR9A 4GKTA 1RJQA 5CC3A 2VKZG 3E0FA 3PVFA 3MHGA 5HWJA 5M3WA 3QV9A 1W37A 5D2XA 1J6PA 3C3NA 2VEPA 4H6KA 1V3IA 3NZGA 1U1HA 3BXWA 4JQ3A 1UJPA 4F8XA 5A6MA 3VYLA 2CLHA 2FTYA 4NVTA 5FJPA 2YW3A 3WF1A 3CV6A 3VDHA 1HJUA 2Z7GA 4LUIA 1GJUA 1UWIA 1ZPTA 1LROA 4AD2A 1TJ1A 3OYZA 5HMEA 9XIMA 4KWOA 2GPTA 2XWEA 1BLIA 3RFAA 2VEGA 2ZQ0A 4H9UA 1MUMA 2WMKA 1QASA 5CLTA 3TTYA 1TTPA 3I10A 3V7PA 5M2FX 5KTLA 3W1TA 2XM2A 3FGCA 4I6VA 4LYRA 3THDA 1FWWA 3EWWA 1QI5A 4M1BA 3C0QA 5FJJA 4FOJA 3POHA 4GJJA 4ZXLA 3OG3A 2Z0IA 3U6WA 1Z32X 1VGAA 4QS5A 1KR1A 4S3FA 4UMBA 4UFHA 1OFDA 2BHUA 3TFXA 3R8HA 1DJNA 4PL2A 3PWIA 3PBWA 2YPIA 4CD8A 2NVDA 1A0EA 1IWAA 2VR5A 2QT3A 1LP6A 3N04A 1GVFA 5LZLA 1SO5A 4TOQA 2Q09A 2R24A 4DB7A 4O50A 5FL0A 3TTOA 2VYOA 4N0RA 1KNWA 1GVOA 4WCJA 4V28A 2ZX7A 2Z4GA 4POCA 3P84A 4JQ2A 4XAPA 3VDGA 4KF1A 3W00A 3GVQA 5DRIA 3RJXA 3R89A 2ISFA 4G2DA 1K3UA 3HBLA 3GBDA 5HK4A 3BAXA 4FF7A 2Y5SA 4JN7A 3AXMA 3FYPA 3NSNA 2DVXA 1RBLA 2JALA 4RW3A 3H2AA 5K9DA 3W22A 1RZMA 2GDQA 2OEJA 4J3UA 3EEGA 3VCNA 1WXYA 2IPWA 4XAFA 1DIEA 1PHQA 4AX6A 5FCZA 5DMYA 5K9XA 2D0GA 1YXDA 3TYUA 4UC5A 3OG2A 4KFOA 4X9SA 1H41A 2Z1BA 1C92A 2Q8LA 3W74A 1BTCA 1GYMA 4NJJA 1NH6A 1BHGA 2GDVA 4N9CA 2ZZ4A 3IK4A 1K4HA 2HISA 1W8SA 1CT5A 1QPRA 4A2SA 3WF4A