3W76A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-4-189
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-4-189
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 103
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w76A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w76A01
3Q37A 5KZDA 3ZS4A 6TIMA 2QCFA 3DGRA 1GVOA 2ZZ7A 4U4MA 3S5OA 5F4SA 1OFQA 1LBMA 2R91A 3NPXA 1FXQA 2WV8A 3NQ8A 3EX6A 3TXVA 3PULA 3CT7A 3NL2A 1NAL1 5D33A 5LNWA 4MVAA 2TMDA 3BW4A 2GUUA 3NPUA 3W71A 3GR8A 3EKLA 2WOQA 1M6JA 3L0NA 2X1SA 1GQNA 5IBXC 3STCA 4KFPA 4UTTA 2CZ5A 1LOSA 2H6RA 3W7KA 5D05A 1LBFA 3PG9A 3TV8A 1FX6A 5HJLA 5HWMA 1EX5A 4O13A 4JYEA 5TIMA 1M7OA 1EP3A 3C2EA 3EWUA 3AJXA 3PR2A 4LTSA 4GUFA 4MJZA 3UPWA 5D38A 1D9EA 1JCNA 3N2XA 1W0MA 2RHGA 1Q6LA 2RDWA 4M6QA 3LXCA 1H60A 4WX2A 2QEZA 3P81A 3HOJA 1YDOA 4N4QA 2ZRVA 1TB3A 4EOUA 4O1BA 1KM5A 5GVJA 1TPEA 3RU6A 3W73A 4X3ZA 4QM1A 4ONVA 2BWGA 5FF0A 2VEKA 2EF9A 3W7HA 3BO9A 2WKJA 3MYOA 2VOMA 5I3HA 4RXFA 1A5SA 4XKYB 1FWWA 4O16A 1KM2A 3O63A 1GG0A 5DCBA 2J9ZA 3LI1A 2TPSA 2Y63A 1B4KA 3GNDA 5KSWA 4O50A 2ZA2A 3IV3A 2JGQA 3HGRA 4ZQPA 2YGYA 1TPWA 1JVNA 4N9DA 5KITA 2JKAA 2X2GA 4JX6A 4TU1A 1ZAIA 3EWWA 2ZZ2A 4O57A 1TTIA 4O1AA 3QMSA 1B9BA 1VHCA 2GPTA 4PA8A 3GK0A 1DHPA 1A5BA 4OE7A 1DJNA 2ZRUA 3QFEA 1ML1A 1KFJA 4JN6A 3G1XA 2E5BA 1AL8A 1I2RA 1THFD 1L6WA 3KFTA 1UB3A 2RDTA 4JS3A 2VFFA 3DI0A 1ZENA 2A5HA 3O6CA 3M5ZA 3L5AA 3NPWA 4FF7A 4FNPA 2QUUA 3R89A 3KRSA 3C2OA 4JTHA 4DPPA 3M0ZA 2E5CA 1N8FA 3KRUA 3W88A 1TPVA 3BW2A 3C4UA 1XI3A 4QNWA 1KFBA 2V9DA 4LW7A 2FPVA 4Z1AA 4BWLC 1XXXA 1W54A 4Z0JA 1SR9A 3W1UA 2EKCA 4A22A 5HUPA 1VS1A 3EWXA 5KZEA 3M6YA 1L6SA 2B7OA 4S2CA 3NQGA 1W5NA 4PEKA 3RLVA 5J5DA 2VFHA 5G1TA 1TPDA 4ZQNA 4RK8A 5FF3A 3DKLA 3G3DA 3HG5A 5E0KA 4BI7A 2GQAA 2TRSA 3VFLA 1JQXA 2VKZG 2WNNA 3V75A 5LHFA 2NX9A 3L65A 4RCXA 2O7QA 3A5FA 3P74A 3MP5A 1XDMA 3NOEA 1H50A 3TFXA 5DCEA 4N9CA 4DO4A 2YW4A 1K3UA 3TFCA 3GXNA 3NVTA 4WY0F 4QQ3A 1PV8A 3TKFA 3CLMA 3OHIA 2HMCA 2QJHA 2OT0A 3FYOA 3KXQA 4R53A 5C54A 2PRHA 5KTLA 3R8RA 1Q45A 3HQ1A 1DOSA 1N7KA 4FO4A 5G4WA 5HULA 4MJMA 3MYPA 4UTWC 4UFJA 3W1TA 1O4UA 3DFNA 2ALDA 5CSRA 2Y7DA 2C3ZA 2BLEA 1R2SA 1LOQA 1XKYA 5C5YA 3GXPA 3O16A 5HWJA 4DBEA 3DFPA 2BX7A 1KM0A 4MY8A 3G18A 3EXRA 2V2DA 3VI2A 1F73A 2E77A 3S42A 2GVLA 3OIXA 2RFGA 5DY2A 4KFNA 1AW5A 1HTIA 2G5WA 3M47A 3RLUA 3WJSA 2OT1A 4EWND 2ZYFA 2NUWA 1SZGA 3L68A 4S1FA 1OG0A 2Q3RA 1FY6A 2J24A 5F1UA 1D3HA 1VRDA 3A23A 1SUXA 4P61A 3UYCA 2J27A 2NWSA 2CLHA 4IMFA 3IRDA 3CQ0A 4BR1A 1QCWA 4LVBA 5K3VA 1Q6QA 1UASA 3T55A 3PM6A 2A7NA 1MZHA 4BF9A 4JIQA 5TQLA 1LCOA 3W7GA 1GPWA 1OX4A 4IXXA 1SFLA 1T96A 3ANYA 5AOUA 3O07A 4FNUA 1KV5A 3QRHA 2C14A 4QIUA 1ONRA 3U8GA 3M9YA 3FKKA 5E93A 4JTTA 1X1OA 4N4PA 5AYYA 1BKSA 2QCGA 4Y8FA 4GJ1A 2H3BA 4M19A 3G1AA 3O15A 3PBUA 1F6KA 3NM1A 4RKAA 3WJYA 1W3TA 1EP1A 1VQTA 3MP4A 2VC6A 1X1ZA 4UTUA 4W9TA 3PBYA 4LVDA 4UMBA 1GG1A 3CB8A 3W7LA 3HGOA 5HUOA 2Q8LA 5HNRA 3M41A 3S1VA 1LZOA 1JCYA 4AWTA 4WZHA 4K36A 3MHFA 3P60A 4ADSA 1GJPA 3NL6A 2Q8ZA 2V5BA 3LCLA 3L21A 3B0VC 2Y70A 1I45A 4O4VA 4PL2A 1NSJA 4LS2A 1VYSX 1OVDA 5FEZA 3IIOA 5CZSA 1RQBA 2J9YA 5LKYA 4UFLA 3QW4B 4JX5A 5C6MA 5D2VA 3IIPA 5G2HA 3TW7A 3B06A 4Y9AA 3UNDA 1EA0A 4LU0A 2ISSA 4A2RA 1VC4A 4RV8A 1LOLA 2X30A 4FNQA 1S3HA 2O7SA 4CQ9A 1G69A 2Q3OA 1Z42A 3GDRA 4FXSA 3B05A 4O19A 4LUIA 4UMAA 3RNDA 3GYEA 1KBJA 2YSWA 1G7VA 2ZBTA 5BMXA 5I3KA 5J5RA 2BSLA 3QMRA 4U28A 4M6PA 3LV6A 4UTKA 1TRDA 3IVTA 1LROA 3DFOA 4O18A 2G95A 3QSRA 3LTYA 3P67A 3BW3A 3UXAA 3SECA 1TV5A 2RKXA 3QSTA 5DXXA 4DF1A 2FB2A 1YDNA 5HR6A 1SZNA 1P5BA 3FIGA 5EL1A 3AO0A 4LS1A 3N19B 4X22A 4LC6A 3B0UX 5LSMA 4IMEA 2AAMA 1TTPA 2C0AA 2I14A 5L9FA 3K30A 1TSIA 4CLMA 1DORA 2CLOA 3EWYA 1VYRA 3VCRA 1I2QA 1JR1A 1ICPA 1CX9A 4GUHA 4NJIA 3W70A 1XFBA 2FPTA 1IF2A 4O0KA 1W5PA 1LTDA 3PUOA 3PSWA 3G0UA 3UWZA 1LRNA 3DHDA 3A9IA 3OEXA 3ABOA 3PSVA 4KFOA 2FTPA 4TMBA 1SO4A 1VYPX 1KTBA 1ZALA 3LXBA 1RR2A 3IVUA 3LHVA 3S5YA 5K7JA 5KMYA 2ZA3A 3R13A 2ZZ3A 3PG8A 3W2UA 2JGYA 3E12A 4UFHA 5HINA 1ALDA 3CU2A 4O52A 3HBLA 4QJ1A 1H62A 1FDZA 2R94A 2P0OA 3NA8A 3TDFA 1YDVA 1EUAA 4E0CA 3DZ1A 1YTEA 2B7QA 2VFEA 2YFOA 2HS8A 3LCWA 1KM1A 5AC6A 1DBTA 3W2LA 5AHFA 5EYWA 3QW3A 4Z1BA 5EMUA 5LNSA 3W7QA 2WO5A 5KINA 4QAIA 1WBJA 2X1TA 3G1DA 1J4EA 4MYXA 3TJLA 1SSGA 2QDHA 3P5YA 3KAOA 1FUYA 1GEQA 1UBSA 1HUVA 3TC7A 1AW2A 3DU0A 4OU1A 1Q6OA 5DN1A 1XBXA 2H90A 3W7JA 3W85A 2FJKA 4M7TA 2J88A 1XCFA 3LOTA 1NEYA 4Q32A 2ATMA 1P4CA 2WJZA 3CEPA 6ALDA 4M7SA 3KVJA 4L4LA 4X2RA 2Y6ZA 1SW3A 3UD6A 1WXJA 4LY8A 4NJHA 3W84A 2QCDB 1XC4A 3HIJA 1NF7A 4O1DA 4A29A 1XBZA 4QSHA 3W3OA 2W0UA 4NQ1A 5AC8A 1G6CA 2C13A 2QAFA 1VHNA 3F1QA 2Z6IA 5I3JA 3FYPA 1KM4A 2A2IA 3IGXA 4ZQMA 1ME9A 1W5MA 3VE7A 1JJKA 3C2FA 1LBLA 4PTNA 1IIGA 3OVQA 3NL5A 1BWLA 2JKPA 1H1ZA 3KOFA 1WDWA 3TQKA 4LUJA 3FJ6A 1TO3A 2EAWA 2C18A 4LVFA 4AF0A 3CIXA 5I3FA 1G4TA 3DH7A 5ABTA 3U6WA 3VE9A 3BK0A 2E09A 3LHYA 4O0ZA 1DJQA 1QMLA 1GZGA 1YTKA 1Z41A 1LM1A 1H7PA 2NZLA 5CZ0A 4RXGA 3NQVA 1ME8A 1JQVA 3MMTA 4HPJA 1JRBA 2CLKA 1EWDA 3FEMA 2J6XA 1JUEA 3S1UA 3BGGA 3W1LA 4DELA 1PS9A 2XN2A 4X9SA 3R5EA 2QF7A 2JK2A 4GUJA 1A53A 4UTHA 3CWNA 3EX2A 3KVMA 3W6YA 4HT3A 4LRTA 4OT7A 1G4PA 3TW6A 3SR7A 1HG3A 1TTQA 1HL2A 3S0CA 4DO6A 2DZSA 1EUNA 1OFEA 3F4NA 3FOKA 3TIMA 3THQA 3P80A 2NUXA 3LI0A 2DZVA 5EKYA 3PB2A 4MOZA 3LTPA 4MZ8A 4NU7A 1JCXA 3UXDA 2XFWA 5H2ZA 2DZPA 3M44A 3JRKA 1EP2A 5H91A 1AK5A 5BRBA 5D32A 2QCCA 4IUOA 1V7YA 5DBUA 3W7IA 1UJPA 5LNVA 3UWVA 4R33A 1ADOA 5AN7A 5D30A 2E6DA 4EIVA 4O4WA 4UTIA 1KFCA 5C55A 1Y0EA 3ZFHA 4DQWA 4JR5A 2QKFA 4POCA 1Z44A 3A24A 4AHOA 3N3MA 3LRMA 4YL2A 3RFAA 3B8DA 2DORA 2NXGA 1O5KA 5F2MA 3B04A 2Z1BA 3QPYA 4GE8A 2IQTA 2GQ8A 3PWAA 5BNKA 1AW1A 2H8XA 4O15A 4TR9A 1TMHA 2DU2A 3N73A 4OGZA 2RH9A 1T99A 4QISA 2QUVA 4WOQA 3HJZA 1QO2A 3G1YA 3C52A 4NZFA 3W2NA 5IBXA 3TH6A 1SO3A 4GUIA 3LCIA 3A5VA 4YWIA 2V81A 1VR6A 4H6KA 1TRIA 2PRMA 4Z1CA 4O53A 1FCBA 3S5NA 3W9ZA 4OQVA 4HN4A 1G4EA 3ZR4A 3NL3A 1NVMA 1X7FA 5F4WA 1WQ5A 3E02A 5U7SA 2A7PA 3TAOA 4N9BA 2FQIA 4YLWA 3NO5A 3W75A 3SFKA 4OBTA 3FFSA 3NYZA 2TSYA 4CCDA 1GTEA 2WPBA 3BARA 2V82A 4O17A 2V30A 2A6LA 2EGZA 1ICQA 3R12A 2B4GA 3LV5A 2AQWA 4R34A 3SI9A 4DPQA 3F03K 4ALDA 3GAYA 3G0SA 3NQ2A 2ZRZA 1WX0A 3LCFA 3L5LA 4JTGA 4JTFA 1G4SA 1TREA 4BFAA 3QH2A 3MBDA 1UUMA 4E2DA 5AB3A 2ZRXA 3NEVA 1VGAA 1IIHA 2XN0A 3VKJA 4XTDA 1WV2A 3T7VA 1GOXA 2E6AA 3HO8A 5AHIA 1S5VA 2R14A 1JCJA 3L2IA 1W31A 5AC7A 2GOUA 4CCCA 3M5YA 2OX1A 2I1OA 3CHVA 4GWEA 4MY1A 4Y96A 5FEPA 3RMJA 3Q2DA 4JICA 2WQPA 2NX3A 4FNTA 4EVZA 4O8RA 2Y62A 4UR8A 3V1PA 4XTIA 1AMKA 4PCFA 4CNOA 1FWSA 4MPQA 3LXAA 1IGSA 3GXTA 2C16A 4NX0A 3WK0A 4JTKA 3TSDA 1CW2A 1I4NA 4JTLA 2DP3A 4P2VA 1K8YA 3SGZA 4A2SA 4AHPA 3FLUA 1ZCOA 1TJRA 3EX1A 3A21A 4WJEA 2NX1A 4XQ6A 2PURA 1ICSA 2QCEA 5FEXA 2ZZ6A 2QUTA 1O60A 5SWUA 2DJLA 5D02A 4JYDA 2Z0IA 1D3GA 5F1VA 3W7RA 2G97A 4LNYA 3E9AA 1WAUA 3DAQA 4GRSA 3QJAA 1FWNA 3NQMA 5IM51 4FEZA 4FX6M 3PVFA 3NQ6A 3H53A 1FDYA 5LGXA 2WSRA 3FKRA 3I65A 4MFDA 3G3MA 2YFNA 5K9DA 4RZ4A 1O95A 2E5DA 1GVSA 7TIMA 4IOTA 3NNTA 4MLJA 4YXGA 1OX6A 3CEUA 1M5WA 1ZHAA 3IVSA 2W6RA 1OFBA 3GDMA 3C8FA 4N9EA 3GAKA 5CPMA 1SZFA 4OHQA 5L6UA 2CFFA 4NNCA 3C61A 4IPJA 4WY0A 1J2WA 4LS0A 1A5AA 4ZL1A 1L6YA 4TX9A 1SO6A 4UNKA 4WOZA 3IEBA 3HMJG 1WYIA 3H54A 3ZWSA 1GT8A 2HSAA 4UTLA 1WOBA 4A21A 1F5ZA 4K38A 5BW6A 3B03A 5FEWA 1OK6A 1RQHA 4FXRA 2D73A 4Z0SA 2ZRYA 4M6VA 2ZFAA 3C2VA 2HS6A 2YX0A 3NR0A 4JDYA 1W1ZA 5CPOA 1OF6A 1SZEA 4UCGA 4IGHA 4K8HA 3FJLA 4IMGA 5BOOA 2V2CA 4R7JA 4LV9A 5EY5A 2GQ9A 2BXVA 1KA9F 1IXNA 1QPRA 5K4XA 1QDSA 4AXKA 3NPVA 4I9AA 1H7WA 4OV9A 2C19A 1OHLA 2VELA 4Q33A 1K02A 2DZWA 3ELFA 2YPIA 2YYTA 4PH6A 2ZTKA 3WJWA 4DF2A 3HGJA 1F74A 3HG3A 3EWZA 5DY3A 4YCOA 4J9JA 3GKAA 3ZWTA 1QR7A 3C0JA 1PCKA 1O94A 2ISVA 4AVFA 2ZA1A 4RZ5A 1TPFA 1ZJIA 4MKNA 4GC4A 4DO5A 4Y90A 3UZJA 2J9XA 3I7SA 4FIQA 1SW0A 3HPSA 1TPUA 1OK4A 3GDTA 2YW3A 1K03A 1T8XA 2ABBA 2V8ZA 2CLFA 2WNQA 1EB3A 1TV8A 3TMLA 3H55A 3TSMA 5D2WA 3SIZA 5D2YA 3W2KA 3UQNA 3DFSA 3PUEA 2H3DA 4JTSA 1VZWA 3OBKA 4QNEA 2FPYA 3M5XA 5K2ZA 1LRTA 2FFCA 3LGEA 3UWYA 1VPXA 2GJNA 1U83A 1W3IA 3EKZA 3TQ0A 3P8IA 1YPFA 4PFMA 1KW1A 2I9EA 1PHWA 1JUKA 3LHUA 4ADUA 2QR6A 4N2YA 3T44A 2QCHA 3RF9A 5DCDA 1BTMA 3G8EA 1XUUA 2ZCGA 3W07A 1SSDA 3NDOA 3O1NA 1ZNNA 1HO1A 3NQFA 3UWQA 1QWGA 4HNVA 2CW6A 1LDCA 4N02A 2C6QA 1OFDA 3I6RA 1PIIA 3BG9A 4FB7A 3N14A 3NAVA 3UY7A 3DBPA 2NV1A 4FX7A 4ML9A 4A3UA 4FX8A 1C8VA 4Z08A 3M5VA 2WNZA 4NXKA 3MJYA 5LNRA 2A7RA 2KZHA 4DEFA 2VFIA 3W1RA 1KLYA 3SGUA 4MLRA 1P1XA 2CZEA 4IWWA 1VH7A 3G24A 2ZDRA 3SJ3A 1XBYA 1MEIA 2QJGA 3UZ5A 2QAPA 3L0KA 2OZ0A 4BI5A 5I3IA 2CLEA 4MY9A 5DXYA 1R30A 1RZMA 4XKYA 5K4ZA 1MEWA 4FHAA 1OX5A 4JD4A 1OX4B 2EPHA 3NZ1A 1HO4A 3DXIA 3BG5A 3F4WA 3GLCA 3HPZA 1MO0A 1KLZA 3NXFA 4TMCA 1FWTA 2NUYA 2VXNA 1W56A 2V5LA 5G4EA 1P0NA 1ZFJA 5A5WA 4WY0B 2A6NA 4OWGA 3W7PA 2FB3A 3MI3A 5CPNA 3LRKA 3N34A 2YYUA 4ADTA 1I2PA 3PBVA 3W1MA 4NUWA 1EWEA 3MWAA 4O11A 3N9RA 1GYNA 3O6DA 5K9CA 1LRQA 4DXVA 4UC5A 4UMCA 2PC4A 3DI1A 3G1SA 3QQ1A 4HNNA 1YPIA 3P8JA 3LBMA 2BTMA 3TCEA 3UWUA 3ABSA 4UNLA 3ATYA 4RLIA 4WUIA 2VEPA 4ZVJA 2E6YA 3QM3A 3E0IA 2ZZ1A 5E1QA 4NNAA 1FDJA 4ORIA 2YCEA 2YXGA 1T0OA 3MUXA 3DFQA 3GIYA 3W7MA 3PF3A 5D03A 4MZYA 1IXQA 5CZTA 4XBKA 4UTTC 1H7OA 1AL7A 4E2BA 3VNDA 5AHNA 3A22A 3EXTA 1PL9A 3G0XA 4GXMA 3W1NA 1W5QA 3P7YA 3W1XA 4IMDA 1WOAA 3L5MA 2R8WA 5HQEA 4HNUA 3NQ7A 3TE9A 1ZAHA 1W8SA 4JTUA 3DKJA 1KBIA 3ABQA 3M7WA 2QDGA 3INPA 4I7UA 4WQ6A 3TJXA 1LORA 5DLCA 3QF0A 2VEMA 3QZEA 4LVAA 4FNSA 3W7OA 1Q6RA 1OYBA 3GX9A 5LGZA 2Y89A 2B7NA 4M5PA 5F2IA 3FA5A 3NQCA 4K37A 3KX6A 3NZRA 4IMCA 3IGUA 2BZNA 2H8ZA 1DV7A 3MI6A 3W7CA 4UR7A 3W87A 4IX0A 2ZTJA 1EIXA 5C2XA 5HWNA 5DELA 4NT0A 2Z2UA 5DBTA 4IQLA 1JCMP 3L67A 3TNOA 1S5TA 3KVKA 3ABRA 1GYLA 4Y6GA 3MO7A 1C29A 3OVRA 4JY8A 2V2HA 3S6DA 3TA6A 5D04C 3STFA 1TIMA 1TTJA 4AHQA 1R47A 4HPXA 1W5OA 1V5XA 4NZJA 3TAKA 1F7BA 4O12A 4PC8A 4ZQOA 1F76A 3C6CA 1LLZA 3W1AA 5F2LA 3BG3A 3N2MA 5AHLA 1JULA 1K7XA 3QMTA 1QNVA 5AYXA 3STGA 3LRLA 3M16A 3W2MA 4CQ8A 5AHEA 2UV8G 2QJIA 3LCXA 3QYQA 4AB4A 4OV4A 1N55A 3LDVA 1TPC1 3W7EA 3CIWA 1R46A 4K8EA 1XDLA 3T40A 4CCEA 1H7XA 4I7WA 4GUGA 3M43A 1RVGA 2B0MA 5CZJA 4UIOA 3HG4A 3G22A 1LLWA 3B4UA 4CQAA 2XN1A 2X1RA 4HSNA 1VCGA 1RPXA 2DJXA 4LRSA 3CWOX 4Z1DA 5LZLA 3EX3A 1YYAA 5I3GA 2WSQA 3LBCA 4TO8A 1QAPA 4CNPA 3O6YX 2RDUA 5D37A 5HMSA 1F2JA 3W1QA 1K8XA 2GJLA 3USBA 5AYZA 2NWRA 3M1ZA 3LHWA 4PL1A 4AH7A 3D0CA 4UUIA 2FLIA 3W7DA 2W79A 1RD5A 3S9YA 2ZZ4A 3JR2A 3IIVA 3LLDA 1OYAA 1A50A 1XBVA 1E51A 2F7FA 1IXPA 1KTCA 1L2UA 1F05A 5G2IA 3DFTA 1IXOA 4O10A 2Y88A 2A21A 4H4IA 2E68A 1OFOA 2ZRWA 4WXZA 2Y85A 3WJXA 1X6UA 3MI2A 2OMAA 4ZQCA 4PODA 4KWVA 3KHJA 1DL3A 3DHFA 1TPH1 1AG1O 1S5WA 3CPRA 1VLWA 3MBFA 1I2NA 1FXPA 4UTJA 1GVRA 3S8HA 4JYFA 4NXSA 2GVJA 5T26A 3PUDA 3EEGA 4N6EA 3EX4A 1K7FA 4HIBA 5D09A 2OJPA 3OA3A 3O8AA 2PE4A 4CNNA 1OFPA 5CKSA 4ZZ9A 8TIMA 2C15A 3HB9A 1YADA 1SQ7A 4O1CA 4XWUA 1JRCA 4AF0B 4O28A 1VLIA 2QCMA 2CLIA 1XUZA 3BV4A 2CU0A 2VFGA 3T78A 3ATZA 4EF8A 3UWWA 5CSSA 4JX4A 3TROA 4NJJA 4I7VA 4BWLA 1OFRA 2ZQ0A 2X1UA 2AGKA 3TC6A 1W37A 4UFMA 4NX5A 4HNTA 1A5CA 1EPXA 2YDAA 4MYAA 1PE1A 3NG3A 3TK7A 1L9WA 3L66A 2JKEA 5FF2A 4MUZA 1GTHA 1UUOA 1VCFA 2Z6JA 4IPIA 5FESA 3CTLA 4WD0A 1FCUA 3P5ZA 2VFDA 3PS7A 1W3NA 2E6FA 2CLLA 3P84A 2EHHA 1QFEA 2E1DA 3TXZA 3TMQA 4AEOA 3NGJA 3EWBX 1B3OA 3KRZA 4LVGA 4BK9A 5HR7A 1C9DA 4C1LA 2TYSA 1FBAA 1QPQA 3DENA 1CI1A 4E38A 2C1HA 4AAJA 3LHZA 4ORMA 3JS3A 1H1YA 3W72A 1FQ0A 1DKWA 4N6FA 1VJIA 2ISWA 1OJXA 1LP6A 4KWWA 2ATSA 3GB6A 2DZTA 4H3DA 5FF4A 5MHBA 4JTJA 5A8GA 4DF0A 2V0TA 4HSOA 3OG3A 2QCLA 1ME7A 2JBMA 1TQXA 4UTWA 3S1XA 3TR2A 1TV7A 2GVGA 2QCNA 1MXSA 1I8JA 5F2GA 1RQEA 1EEPA 4S2BA 4GNJA 1KFLA 3LHTA 3S5ZA 3I68A 3WK3A 3O06A 1QPNA 2VEIA 1DQXA 4ZQRA 3GDLA 2Y7GA 4UFIA 3NM3A 3G1HA 3PBWA 1OF8A 3HG2A 2WSYA 3W74A 5U4NA 4NNBA 2A0NA 3NQEA 1OABA 3E49A 1I2OA 1JCLA 2DZUA 1QO5A 5BMWA 1KFEA 3I7RA 4K7YA 2X16A 4EF9A 5D2XA 1X8FA 4RJEA 1OFAA 1TPB1 2PRLA 1NFBA 4LC8A 1SO5A 3KVLA 3WK2A 1SFJA 4XZ9A 4B5NA 1KM6A 4IX2A 2B7PA 3NQAA 4FNRA 3QEZA 3TQVA 1KV8A 3CC1A 2F84A 4JGDA 2QCDA 2VENA 3STEA 2OCZA 4XBSA 4FIRA 3SZ8A 3W83A 5EPDA 5EA9A 4AMAA 3C2RA 4MFEA 4G1KA 4ICNA 3W2JA 2NLIA 3TX9A 2ABAA 4HHPA 4IXHA 3UY8A 3YPIA 1J5TA 4JXCA 3LB0A 2DZXA 3LCHA 3O05A 4TIMA 4NJKA 3I7QA 2PCQA 3R2GA 4LV4A 1H63A 3MHUA 4GFSA 3GZ3A 3QC3A 3LERA 3PY2A 2FDSA 5F4XA 5G5IA 3U2OA 1XM3A 2ZZ5A 4L4MA 2CZFA 1TCDA 1H61A 1K8ZA 3PB0A 2P1FA 2A4AA 4JY9A 1TJPA 4JDBA 1B57A 1R2TA 1H5YA 2Y7EA 3IIZA 3GDKA 3GR7A 1B4EA 5TBOA 2Y61A 3TU9A 5AFDA 4MZ1A 5D2TA 2YZRA 4K7VA 1H51A 1TQJA 4IJBA 4UTMA 4RR4A 1GWJA 4ZMGA 3TUUA 3C56A 3BPWA 4DBDA 1F6PA 5LHEA 3WJZA 1Q3NA 1U5JA 1SPQA 1RV8A 3GKFA 1QPOA 1QOPA 3W86A 3LLFA 3SSJA 1LYXA 3IGSA 4JIPA 2NV2A 4AWUA 3S1WA 4LT9A 2YR1A 2LLEA 4Q4KA 4GBUA 1GVQA 4MIMA 3MW7A 1M7PA 1ZY9A 3E96A 3BGJA 3L9CA 3RK8A 4YCPA 3W7NA 3WK1A 1JUBA 1GVFA 3C3NA 3WFAA 3LX9A 3THAA 3W76A 1WBHA 1YLVA 4HKPA 1NF0A 1P0KA 5FI8A 1TYGA 4LOCA 4D2JA 1YXDA 3OVPA 2A1YA 5FF7A 4UXDA 3QPZA 3PC0A 1ZAJA 3SW6A 1FWRA 3LCGA 1BWKA 4BI6A 4NJGA 2G96A 1BEUA 2FIQA 3CM4A 2CWNA 1H7NA 1WA3A 2HTMA 3GNNA 4O14A 3W23A 3G8RA 2Y7FA 3UPBA 1KFKA 1SU5A 3N9SA 4YMZA 3B0PA 1PHQA 1SW7A 4RZ6A 3EB2A 3HF3A 3Q94A 4UFKA 4C1KA 4RX0A 1H7RA 1O5XA 5G2WA 3HPXA 1G7UA 3LTSA 3Q58A 1OYCA 1K7EA 3P61A 1YTDA 5LNUA 5CG7A 1FCVA 3SY5A 3T4CA 3NQDA 3BVJA 3P82A 1DQWA 3IIXA 4XUGA 4KKXA 3MHGA 3G1FA 2NXHA 4JNMA 4K39A 5AHMA 2CLMA 2CZDA 1FCQA 1HFBA 1YXCA 3GVGA 5G1YA 2P10A 4JTIA 1DVJA 1KM3A 4JTEA 3MP3A 1QOQA 3L0GA 1XL9A 4QITA 3EXSA 1PVNA 2NXIA 1YXYA 4WXYA 5EBUA 1MEHA 5KZMA 5CGQA 3QQ0A 3FS2A 1KTNA 3BLIA 3G1VA 1MSSA 5CPLA 4AWSA 1R2RA 3TSBA 4O54A 1PCWA 1G67A 4JEQA 3PAJA 4K6AA 5K9XA 1Z48A 3P62A 1VCVA 1UCWA 3LM7A 4LWWA 4NVTA 2A85A 3BLFA 3W22A 3W1PA 3HGSA 3BLEA
chains in the Genus database with same CATH superfamily
3DN5A 3DGRA 3ISIX 3WLPA 1GVOA 2GLKA 1GGOA 4WRHA 3BZGA 1FXQA 4IFRA 2PC8A 3TXVA 3PULA 3W81A 4NY2A 3CT7A 1DWFM 2A3BA 2PAJA 5LNWA 1HJWA 2GUUA 1LWIA 2DVTA 2VDIA 1M6JA 4F66A 3AIVA 3LBOA 2CZ5A 1XIMA 3W7KA 1J5SA 3AJ7A 3SO7A 3WNLA 1LBFA 3PG9A 2OZ8A 1EX5A 4XB3A 4JYEA 1E4MM 1EP3A 3PR2A 4LTSA 4MJZA 4C6QA 3R8HA 1D9EA 2RUSA 2RHGA 2DUAA 3CT2A 2RDWA 3S9ZA 4GG9A 3ZJKA 1EYWA 4WX2A 3FGCB 2QGYA 1P6BA 2XZ9A 2HDJA 4N4QA 5GVJA 2OXNA 4QE5A 3SCVA 1F07A 5FF0A 3RDKA 4DWSB 3UETA 2X42A 2VOMA 3LYEA 3OYZA 4O16A 1GG0A 5DCBA 2J9ZA 3LI1A 1ONEA 4XAGA 3GNDA 4HNOA 4ZQPA 4UBPC 1JVNA 5KITA 1FWIC 3VTRA 4O57A 1TTIA 4O1AA 1VHCA 2Z2AA 2X05A 4OE7A 4JIRA 2ZRUA 3HZ3A 1ML1A 3QFEA 1KFJA 1HN1A 1Z8AA 4V33A 4JKLA 4OTKA 5HNNA 1R9YA 1D7KA 2RDTA 2C1GA 3U0HA 4FF7A 3R89A 1GOMA 5DQPA 3C2OA 5HQLA 3GG1A 2GDUA 2V9DA 2FPVA 1ONWA 2DUXA 3OYXA 4Z0JA 5E9AA 3GH5A 4A22A 3AHYA 3S47A 2PGEA 4YIWA 4HYWA 2XPKA 2B7OA 4E2OA 1KCKA 4PEKA 1BGAA 4ECLA 3QHNA 1KKRA 3B97A 3HG5A 3IWPA 4PCSA 4H04A 3VKKA 3GW3A 2NX9A 2QQ6A 1MUMA 3A5FA 3B0XA 4DUWA 3MP5A 1KR1A 1UQYA 4RDZA 1EOKA 1H50A 1O5RA 2FZNA 3T0DA 2X0SA 4AY8A 1R7OA 4MKSA 4NAFB 3ZZ1A 1K3UA 3TFCA 3GXNA 1Y65A 5CBIA 4P7OA 4WY0F 4QQ3A 1PV8A 2QJHA 3S2LA 3FYOA 2VGIA 3M4HA 3KXQA 5C54A 5M2FX 5HULA 3AHVA 4MJMA 1NU5A 4U5KA 4PYSA 1KXQA 1W9BM 2ZC8A 4F8XA 1I75A 1GKPA 4EACA 5CSRA 1GW1A 2BLEA 1R2SA 4DBEA 2Q71A 1UWSA 1KM0A 4DVOA 1TG7A 2E77A 3UJ2A 3XINA 1BXNA 1EBGA 1UP2A 3RLUA 4G5DA 1IWAA 3WJSA 5A6AA 2WPGA 2ZYFA 1G0CA 1UD8A 4B2DD 1Y8BA 3NXLA 2Q3RA 2XH2A 1D3HA 3GXIA 2B81A 4HNCA 4L6HA 1TMLA 4P61A 3UYCA 3VOJA 3EWCA 2CLHA 4IMFA 3HMCA 1E5NA 4LVBA 5K3VA 3PM6A 1CGWA 1MZHA 4MNJA 5TQLA 3W7GA 1FHVA 4GINA 3O07A 4JL1A 3SJNA 3N11A 2C14A 4QIUA 4DIAA 4JTTA 3UVAA 2QCGA 4MGGA 4GQBA 4Y8FA 4M19A 1V8EA 1U5VA 1TMQA 3JW7A 3SCRA 3NM1A 2XM2A 4RKAA 1B2YA 4ZOCA 1VQTA 1UD3A 2VC6A 1X1ZA 4V27A 4H8NA 4W9TA 3N2BA 3LG3A 5BYWA 4LVDA 1GG1A 2QT3A 4ZOBA 4QFUA 2Q8LA 1V6VA 5HNRA 4J35A 1JCYA 3P60A 4ADSA 2OPJA 2PGRA 4PGLA 3NL6A 4MNKA 2VZVA 1QHOA 2VUNA 2Y70A 3LUTA 3TN4A 4E3TA 3WDIA 4PMUA 4H9VA 4D6FA 3FA4A 2V67A 4LS2A 2PU0A 4QE4A 2I17A 4GYPC 1AH0A 1S3TC 4Q3MA 1XQLA 1VBGA 1RQBA 5LKYA 4UFLA 4LYPA 1CGYA 5D2VA 2GFTA 3B4YA 4LU0A 2XWEA 3LPPA 1M41A 2PCEA 4G6CA 3SIMA 3VIFA 1G69A 3OA5A 3DESA 3GDRA 1J0HA 4FXSA 5GQBA 3ZVHB 1XICA 3GYEA 2YSWA 1G7VA 5HANA 1BSLA 4W8BA 2PDYA 5I3KA 4HJFA 4P7QA 3QMRA 1XG4A 4E3VA 5FL1A 1I0BA 3IVTA 5D4YA 3G5EA 4P8XA 4O18A 3QSRA 3LTYA 1UR8A 3QLDA 3P67A 3PZMA 4L56A 2RKXA 5CC7A 3KE0A 5HR6A 3FIGA 3IK4A 3SRFA 4QP0A 1V03A 4X22A 1XFCA 3H2MA 5EFFA 1BXCA 3T0TA 5L9FA 3TOYA 5AC5A 4M56A 4WKAA 1VYRA 3WH9A 4F2TA 1ICPA 2UY5A 1BGGA 3W70A 1ZRQA 2JIEA 2PF8A 3VD9A 1LTDA 3WEZA 1JXKA 3OEXA 3A3XA 3NZPA 2FTPA 3EPNA 3LXBA 1SVDA 3IVUA 1PWLA 5KMYA 4L4PA 2ZA3A 4HYRA 2ZZ3A 2O0TA 3PG8A 3AZSA 2ZICA 1LQ0A 4YPJA 4HCHA 4IQJA 1OIFA 3PFRA 1FDZA 2P0OA 3M0YA 1YDVA 4E0CA 2OZ3A 1J6OA 1NFPA 3UYIA 4F4RA 3CIVA 3MS8A 1VENA 4RE4A 2X7VA 2WVVB 2YOCA 1DBTA 3VOIA 2FZBA 2XU2A 5EYWA 1G94A 5EMUA 2PLJA 3VZYA 2X1TA 4MYXA 1WXZA 2Q09A 2NT0A 3Q4DA 2Z4GA 4D71A 1BRLB 2QDHA 2UWFA 3FJ4A 5FSEC 4D6DA 1SJCA 4FSAA 1XH1A 1AW2A 3N18A 3KTXA 3K5XA 1XBXA 2ZVRA 5I7GA 3KW3A 1A3XA 3W7JA 3MTWA 2P88A 4H6EA 2J88A 1NEYA 4XZWA 4CUCA 5LIYX 4AIEA 4AD3A 3KVJA 4L4LA 3SUSA 4WDXA 3T4WA 3TYAA 1WXJA 4NJHA 2WHJA 3W84A 1Q7QA 1L8NA 1D7FA 1XBZA 3D6NA 3QY6A 1QK2A 2HVNA 1CXLA 4PUNA 2Z6IA 1H09A 5H8MA 1TWSA 1PPIA 4UQDA 4FI4A 3IGXA 1ME9A 1W5MA 3GNRA 5A94A 4JCMA 3VE7A 1LBLA 1IIGA 4PFHA 1BWLA 3H4GA 2JKPA 3EEZA 4PTMA 4PMDA 1W1VA 5FAGA 2C18A 3CQKA 3DCPA 2O56A 4PMYA 4O0ZA 3KM8A 3LS9A 1S1RA 9RUBA 1UMYA 4RXGA 2ACSA 1JQVA 1HL8A 2WC3A 4RDVA 3TA9A 3RXZA 3E38A 2XN2A 4HBKA 4X9SA 3VIMA 1Q6DA 2QF7A 4HMCA 3KZSA 3E0WA 2F6XA 1OZMA 4OT7A 1TVLA 3SR7A 5IDZA 1OSEA 3BAJA 1RA0A 4O1EA 1HL2A 3S0CA 4DO6A 2DZSA 1OFEA 1EJTC 3FOKA 3A4XA 3TIMA 1UJQA 2BHYA 1Q4NX 2DZVA 3LTPA 4YWSA 1CXKA 4MZ8A 1CGUA 3QHOA 1JCXA 1ZL1A 4NU7A 3UXDA 2XFWA 1UW9A 2DZPA 3QR0A 4Q4QA 3RLHA 5TF0A 5H91A 4ACYA 2Y8UA 5FSDC 2QCCA 1JDCA 1ZJHA 3W7IA 5DBUA 1ADOA 3ZQ9A 4O4WA 3OZYA 4LCSA 3ZFHA 3F4CA 4POCA 1Z44A 4NZ3A 4AHOA 1UBPC 2PDPA 3LRMA 1BHGA 3RFAA 4L1WA 3B8DA 4F79A 1AMYA 4Q7NA 1QJWA 3IRSA 3AYSA 4YJ5A 3GUGA 2RH9A 2ZDSA 2QUVA 3AIBA 3ZOAA 5I07A 1UZ1A 1SO3A 3LCIA 3A5VA 4Z42C 3T08A 3PZOA 1TRIA 3L4UA 2PRMA 5HPCA 4O53A 1FCBA 4LBRA 4OQVA 4HN4A 1WDPA 1G4EA 4GNKB 3BMWA 3NL3A 2GOKA 1UR3M 5F4WA 4C6DA 3LSBA 1U30A 2D2JA 3UA4A 3LN3A 5C8BB 4Q8UA 1ZJAA 2IPWA 1E6PA 2HXTA 1MMFA 4EPEC 1UH2A 1GTEA 2V82A 4NILA 2V30A 4BQ3A 3F4DA 3LU2A 1W2PA 3LV5A 3AMLA 3F03K 4QJ3B 2XVGA 2DSWA 4NASA 3N29A 3CHEA 2ZRZA 3VIGA 1EJUC 5JQ9A 4BFAA 2ZRXA 3VKJA 1IIHA 4XTDA 1WV2A 5LYRA 2E6AA 3HO8A 1XIHA 4BEQA 1CNVA 1JCJA 2IPFA 3W82A 4J3WA 5E5CA 1Q2SA 1TUFA 4NAEB 5MKGB 4BF5A 4S3BA 1XH2A 4O8RA 3R11A 3HURA 2DVUA 3V1PA 2KX9A 4OBSA 1AMKA 4CNOA 4ZTYA 3WQVA 5EGRA 2E8ZA 1XLLA 2QV5A 3SADA 2E9MA 1LUCB 3L7RA 3TSDA 4S3EA 4JTLA 5I79A 3PNUA 3EDFA 4A2SA 3H7UA 1L6GA 4A05A 1ZCOA 1GHSA 1KRAC 1NDYA 2CBJA 1KRMA 3GXMA 4PB3A 1ICSA 2QCEA 5I6SA 2QUTA 4DJEC 4PUMA 1O60A 1R3VA 4OBRA 4IPPA 3M0JA 3W27A 2FHCA 2WJDA 1J79A 3ARPA 2XIQA 2ON3A 3NQMA 1UC5A 3EWDA 3NQ6A 2PDJA 4BHYA 3AMKA 3H53A 2WSRA 3BV7A 3FKRA 2WZHA 2VX5A 1N8IA 2E5DA 3BDKA 7TIMA 2XIOA 3NNTA 2GQ3A 2ZXAA 1YBQB 1XLBA 4N9EA 3RM8A 3WH6A 2CFFA 3C61A 1FWCC 1FWBC 1R86A 3PWGA 3J7HA 1BYDA 3BAKA 4TX9A 4F0RA 4ZB0A 5CPQA 4M80A 4PN2A 1VFFA 4UTLA 1WOBA 1MDRA 3VNKA 1RK6A 1F5ZA 3H8AA 3GO2A 1RQHA 1HX0A 1GNXA 2PDFA 3VDHA 2ZFAA 3DGBA 3NR0A 4Q8TA 5B7YA 4UCGA 1WP6A 1E3ZA 2YCJA 4RW5A 3XISA 3FEQA 4C7DA 2GQ9A 1WE5A 2VD8A 2BXVA 1IXNA 2D69A 4AXKA 1IEIA 3I6EA 3NPVA 1H7WA 3HU7A 2C19A 2VM8A 1K02A 2BVWA 1S2UA 1HF6A 4C7FA 4EAMA 1F74A 2QJNA 3HG3A 4LXFA 5DY3A 4NRRA 1GOKA 1AJZA 3GKAA 4MF4A 2O9RA 4XSLA 4D6JA 3L4YA 1W1B1 1TWDA 3H2FA 1PCKA 1O94A 3CQHA 2ZA1A 5C9XA 2VC5A 4GC4A 1NOFA 1WXYA 4FIQA 2VRJA 3HPSA 1G01A 1TPUA 4PB5A 1NARA 2ABBA 3VIHA 1DJZA 1IWBA 4AUBA 3MA8A 5CSUA 1XIGA 1PX8A 3SIZA 3UQNA 4AQLA 4YTTA 4PMNA 4JTSA 3BUVA 4QNEA 4X61A 1YKWA 2PWUA 2WWCA 4E4FA 4W4QA 3LGEA 4QR6A 2WZIA 1VPXA 2EKGA 1W3IA 3EKZA 4PFMA 4NZ5A 3WF4A 3W4RA 4ADUA 1QW8A 4AZCA 2QR6A 4FZIA 1BTMA 1XLKA 2GVYA 3V16A 2XG9A 2ZCGA 3NDOA 3G6LA 1TUXA 3NQFA 3UWQA 1QWGA 4N02A 1V0MA 2WKLA 4KERA 4H7ZA 1FH7A 4CCZA 4FB7A 3O3RA 3CMFA 3NO1A 1NWUA 2NV1A 3WUGA 4FX8A 1C8VA 4GOAA 1KQZA 3CL6A 1ZB5A 1RJPA 3GFZA 2WNZA 4NXKA 3RMEA 1B3WA 1BTCA 5LNRA 4QLJA 2VFIA 3B8WA 1WPCA 2ZDRA 1A0CA 5HMEA 3CMGA 3L0KA 3V3WA 3CMJA 2C7FA 2HXUA 4XKYA 4EXBA 2PB1A 4IPLA 1GVEA 2EPHA 1HO4A 4EXQA 3GLCA 1MO0A 1KLZA 3ORWA 1MWOA 4TMCA 4Y9PA 1BKHA 1POJA 4IQDA 2VXNA 1W56A 2XFRA 4WY0B 4OWGA 1W9UA 3WSUA 1US0A 1AQHA 1EJSC 3LRKA 5A6KA 2E7FA 3VGHA 2PDNA 3W1MA 1EWEA 2VZOA 1S1PA 4UC5A 4UMCA 3G1SA 3QQ1A 4KMQA 2YB4A 1VFOA 4HNNA 1YPIA 2AAAA 2F2HA 2PDLA 3ABSA 4UNLA 2QVNA 3UERA 2DVXA 3ZR6A 4WUIA 2E6YA 4Z2HA 5E1QA 5ABEA 1FDJA 5GJPA 1B31A 3GIYA 2D0HA 3GR4A 5CZTA 2YL9A 2WZEA 2GSJA 4U3CA 5C71A 5AHNA 1QT1A 3FK4A 3ARTA 3G0XA 3W1NA 3ZJ6A 5I02A 3P7YA 4Q8QA 4IMDA 3M0HA 1E73M 1OCNA 2R8WA 5HQEA 1O6IA 4UZSA 4V2XA 1EA9C 4RE0A 2OOFA 3ARUA 1VPYA 1TA3B 1W8SA 3R1ZA 5CSYA 3TYEA 1FKXA 2FHBA 3M7WA 3INPA 1GVYA 5H8PA 3TJXA 4Y9MA 1YX1A 5DLCA 3QF0A 3ZT5A 3QZEA 4FNSA 1E40A 1Q6RA 3GX9A 5GPRA 2B7NA 3CHCA 4HA4A 1DV7A 3VGFA 4LCRA 3W7CA 4UR7A 1YNYA 1QVBA 1YPXA 4NKCA 2OQLA 4UOZA 3GHSA 4L9ZA 3VGDA 2OR2A 2NV9A 4J3UA 4LAMA 3PPFA 4JTDA 3AS1A 2A3CA 4I9TA 1EIBA 1NM9A 5H8UA 1C29A 3OVRA 3VDAA 2V5CA 4JY8A 3ES7A 2V2HA 1KCLA 3S6DA 2BXZA 2E1WA 4PUWA 4NSBA 1PTAA 4J7RA 2IQ0A 3VNMA 1F76A 2BVTA 3VC6A 1HGYA 2WC4A 2J4GA 1K7XA 3QMTA 3KCJA 4GVFA 3WQCA 2UV8G 4BF7A 3QVQA 1JXJA 5AVNA 4OV4A 3VGGA 4U2ZA 5EMYA 1TPC1 3VOCA 4K8EA 4GZIA 1VEOA 3K4DA 3GZAA 4DWDA 3M46A 4I7WA 5CZJA 2Q8XA 4R7WA 3G22A 3MUAA 4CQAA 2XN1A 2RAGA 4LRSA 4HPGA 5AVHA 2FYMA 3MKKA 2XVPA 2EJAA 3VOGA 3H12A 4XO7A 3EX3A 5A6BA 1QNPA 4KIRA 3LBCA 4TO8A 4J3XA 4R85A 2RDUA 1K8XA 2GJLA 3JVAA 5AYZA 3LHWA 4AH7A 1U1HA 4LUYA 2FLIA 1XV8A 2HE5A 1W3KA 1OQFA 4Z2GA 2FZ8A 4K3ZA 1OYAA 1E0VA 1E51A 2XISA 3AMGA 3DFTA 4V15A 2A21A 2YCKX 1XYCA 3WJXA 4GQ0A 4ZQCA 3V0UA 3KHJA 3C5QA 2W27A 1RP8A 1VLWA 1FXPA 3QKZA 3S8HA 2G3FA 3PUDA 2ZC1A 2BB0A 1W3LA 4N6EA 3EX4A 1K7FA 5D09A 4FA3A 1O1HA 4GACA 4H6QA 3TZFA 1VLIA 4TTGA 4MMWA 3SN0A 1OGBA 1XUZA 4HD5A 4EF8A 1PZ2A 3T0CA 2FTWA 4JX4A 1P0EA 4I7VA 1KCZA 1OFRA 4LUSB 4B4FA 5BXRA 2PDMA 4EPDC 2AGKA 4TVDA 1PO9A 4UFMA 4Q7IA 4US6A 4NX5A 4HNTA 1RBOB 2YDAA 3FA3A 3A47A 4MYAA 1PE1A 4NYUA 1T40A 5E6ZA 2VX4A 5FF2A 4MUZA 2Z6JA 4YTSA 1JZ7A 4U33A 4U31A 3S2NA 4ZXOA 1JYVA 3PS7A 3K8LA 2EHHA 2E1DA 3TXZA 1GZJA 1E4IA 3CAVA 3TMQA 1R9XA 3WEMA 3NDYA 1RCXB 5E0FA 4QS6A 1VFSA 3ARXA 1C9DA 1S2TA 4C1LA 4TUFA 2PZNA 4LNCA 4JEJA 3LHZA 3TWBA 2HJPA 3JS3A 2AMGA 1H1YA 2NSOA 1FWEC 1BQCA 1FQ0A 4NI8A 1OJXA 2Q01A 2RJHA 4KWWA 2ATSA 2DZTA 2NLYA 2J7GA 2J7CA 3BICA 5M3WA 2W67A 1JZ2A 2WC7A 2QCLA 1A4MA 3S1XA 1KFWA 3FHAA 4QEEA 1MW2A 3TR2A 1CTNA 4F0HA 4FF5A 4UNIA 3AROA 5ABGA 3LHTA 3WK3A 4B91A 1DQXA 1V3MA 1JL8A 4QROA 4S39A 3HG2A 3WNNA 1NWTA 2J25A 1D8WA 3GYCA 1ISZA 1D3CA 3CLWA 3B9NA 2E40A 4LX4A 2VT0A 4ZB5A 1FWDC 5D2XA 2J47A 3W6MA 5M5DA 2PRLA 1NFBA 5CGTA 4DBWA 1U2YA 4IX2A 1J8VA 5ECUA 2B7PA 3NQAA 1ZQ5A 5HMDA 3NYDA 4ZO8A 4JGDA 3REQB 1E70M 3RO6A 5EA9A 3APGA 1EOMA 4G1KA 3DC0A 3TX9A 1M7XA 2IPJA 3CV7A 2DGAA 3EOEA 2REQA 2XGBA 4AIBA 1J5TA 2PLCA 3D5HA 4Q8PA 2Z1KA 3LNPA 3WQ4A 3M0MA 4LV4A 1JF5A 2CBUA 1H63A 2IS7A 1RD6A 3QC3A 1K9EA 1QASA 4HOXA 2FDSA 2PTWA 2CERA 1KQYA 3C0QA 5G5IA 5BU9A 4CQCA 1RA5A 3EZ4A 3MWCA 1AA1B 1TCDA 1H61A 3RPTA 3ARZA 4L6OA 5A6LA 2FKPA 1ZU8A 3H2EA 1V93A 3U9IA 3R79A 3UXKA 3MY9A 1LLOA 3GE7A 3CXOA 4M29A 5AFDA 3BXWA 4AX6A 3KBMA 3ITGA 1WKDA 3QXBA 1H51A 4RR4A 3CZLA 3NFUA 1GWJA 3IV8A 3CASA 4DBDA 1F6PA 4Y9OA 5LHEA 5LXEA 1SPQA 2WSKA 4BCEA 4IICA 4JIPA 2NV2A 4GYJA 3K13A 4IFKA 4ZXLA 1Z6KA 3E96A 3L9CA 4HMNA 3WQ5A 2QDDA 1TZ7A 1TIWA 3LX9A 1P7TB 3W76A 1GHRA 3V5FA 2ZXBA 2HVOA 4HKPA 8XIAA 4I5UA 1PTDA 2PTXA 4D2JA 3C0SA 1XIEA 3DECA 2F6UA 2A1YA 4TX8A 1Z3NA 3CB3A 3W24A 3LCGA 1VAHA 3VNLA 4BI6A 4NJGA 2G96A 1BEUA 4D1IA 3NCOA 4E8DA 2CWNA 4O14A 1GJUA 3W23A 4WKHA 2G4JA 4W88A 5I06A 4YMZA 4N42A 1PHQA 1SW7A 3RPMA 3HF3A 2WHLA 2AKZA 2W5FA 4UFKA 4I6VA 1TWZA 1JYXA 4KF1A 4P7RA 3AMDA 2EG7A 3SY5A 3NQDA 4B5TA 4JNMA 1Q65A 5MF5A 4AVNA 2VD9A 1HFBA 1YXCA 3F4VA 5PTDA 2DV0A 4JTIA 3ZMRA 4PMJA 4EAYA 1S46A 3OJGA 3K1GA 3N1AA 2ACQA 4X0VA 1ELSA 2ZUTA 4EANA 5CGQA 4IHCA 3CH0A 1KTNA 2QPUA 3G1VA 1DPMA 2HE8A 1YMYA 1VFMA 4O54A 1UUQA 1G67A 4WSHA 1LL4A 4K6AA 5K9XA 1Z48A 1UCWA 3LM7A 3SRHA 4HZMA 5ECVA 1JG9A 3URNA 3W1PA 3Q37A 5KZDA 6TIMA 1K70A 3AIWA 3V7PA 3PANA 5CZKA 1OFQA 3NPXA 2ZUUA 1KGWA 1PEZA 3IAPA 3RCMA 3WCZA 3LA4A 4KS0A 6REQA 1K6AA 3BW4A 3NPUA 4WKFA 2OELA 3W71A 3GR8A 2WOQA 3L0NA 2X1SA 4TV6A 1GQNA 3BCJA 1NELA 1M65A 4L1GA 3O9NA 1O5QA 3TV8A 3F7JA 5HJLA 2XFFA 5HWMA 5CLTA 3OBAA 1QI3A 4GD0A 3EWUA 1CB7B 3UPWA 2XSXA 5JVLA 4TQTA 3LXCA 4V1XA 1EXPA 1DWAM 5I00A 1E9IA 3I3DA 3I3EA 3UFYA 5HK4A 3OGRA 5A8QA 3KBWA 1UD5A 1VRXA 2BWGA 1Q13A 4IFOA 3ICJA 2VEKA 4GO9A 2EF9A 1LT7A 3BO9A 3WF2A 2G3JA 3WD4A 1QW7A 4RXFA 5FACA 4XKYB 4ZODA 4GO8A 4ICMA 3I10A 3NTYA 1ECQA 3WLMA 4DM2A 3P6LA 1IZKA 2TPSA 4MWAD 5KSWA 4YS1A 2E67A 2JGQA 3HGRA 3M0KA 1TPWA 1QPKA 2JKAA 4JX6A 4TU1A 1HJUA 3GHTA 2G41A 7XIMA 1V3HA 2Z25A 2GVEA 1Q2RA 3WNOA 3WNPA 2Z29A 1NDWA 3CZEA 2E5BA 1XYAA 3KFTA 3CK5A 3ES8A 1L6WA 3BC9A 1E15A 2GUYA 4JS3A 2VFFA 3DI0A 5H6HA 4ROQA 1PXGA 2A5HA 3VU2A 3WL1A 1M53A 3UZXA 4FNPA 2CPUA 4B3LA 4PUKA 3KRSA 4F0SA 1UWRA 2BVYA 4ENLA 2HEJA 4CKQA 4JTHA 3KRUA 5I24A 1XI3A 1R5YA 1MNZA 3QV8A 1XXXA 1W54A 3KUMA 1A5OC 3W1UA 5KZEA 4S2CA 3A4JA 5IFPA 2X41A 2VCBA 1TPDA 4RK8A 2WM1A 3DKLA 5E0KA 3WF1A 2TRSA 3L2LA 1HIZA 3SRDA 1ZJBA 3KL5A 3XIMA 3L65A 1FWGC 1R7AA 3WL0A 3P74A 4I3GA 3UXLA 1XDMA 4BQ4A 4KRUA 4XBJA 3N4AA 3TYBA 2DT1A 2PSNA 4G7FA 3NVTA 3TJIA 3TKFA 3CLMA 1PZ1A 3OHIA 4CD7A 3T2QA 4GVHA 2VNCA 4R53A 1TZ9A 4AD4A 2GGHA 3OVGA 2PRHA 1XIDA 1VPQA 2I16A 4H9TA 5KTLA 1H0GA 1Q45A 3H2OA 5G4WA 2V69A 1XLEA 3MYPA 2BS9A 5C9WA 3WD0A 2QYGA 1O4UA 2ALDA 1F3TA 3O16A 3EMQA 2BX7A 3G18A 1JGIA 2V2DA 2E8YA 1Z7AA 2GVLA 2RFGA 2FFIA 1HTIA 2VCCA 4EWND 1SZGA 1OG0A 4U3AA 2J24A 1NDZA 5F1UA 4MJ4A 4RDWA 3IRDA 1CENA 2BNJA 1V6XA 1Q6QA 3FXYA 3UR8A 2A7NA 2G8ZA 2X8RA 4HZ6A 3CUFA 1GPWA 1MW1A 1OX4A 4IXXA 3ARQA 3SCWA 2DUZA 1T96A 3A3HA 3ITTA 1ONRA 1R3RA 4LB4A 5E93A 2PDXA 4N4PA 3WBXA 2WCGA 1E1EA 4XD6A 1V08A 2DT2A 3OGSA 2W63A 1EJRC 3G1AA 3R0DA 3O15A 3PBUA 1F6KA 4ES4A 4JNZA 3GU1A 1W3TA 4FOJA 1C3FA 3SB0A 1L8PA 4AU0A 4HA1A 4UTUA 1V6WA 4AFYA 3DHUA 1K77A 3WLQA 3CB8A 4HB7A 3W7LA 1NQ6A 3BLDA 3HGOA 1VBHA 4B9YA 1XRSA 4OIFA 2ZUWA 2VC9A 3T8LA 4WZHA 1YNQA 4K36A 3IUHA 2PDBA 3VNIA 3CYJA 3LCLA 4LAZA 1I45A 4CN6A 3CJPA 4XD4A 4DX3A 4PL2A 4AZBA 4QJ5B 1PIFA 3BMXA 2OWCA 3E2VA 4DZ5A 5ABFB 3W37A 2J9YA 3QW4B 1M68A 3IIPA 2QDEA 4FLSA 3B06A 1X6NA 5HAOA 4Y9AA 3UNDA 4W85A 4TV5A 4KEUA 2F9RA 4A2RA 4RV8A 1LOLA 3GNXA 2X30A 4FNQA 2O7SA 2CYGA 1BWVA 1Z42A 1KRCC 4PUUA 3QZAA 3GC2A 1UG6A 3VX0A 1P0DA 1KBJA 1KBKA 1OADA 2ZBTA 1UWTA 5BMXA 2BSLA 4QDMA 2YL5A 3LV6A 1UROA 3TYCA 1LROA 5E9XA 2G95A 3M0XA 4QTGA 3BW3A 2ODOA 4E6MA 4B5XA 5EL1A 3VD7A 1EBHA 4LC6A 4XZNX 1TX2A 4NZCA 4PSPA 4CD6A 2I14A 1DE6A 3QV6A 1TSIA 2CLOA 4KQNA 3PZTA 4LBSA 1JR1A 3AFBA 4NJIA 5FL0A 4O0KA 5DX7A 3G0UA 1A3HA 3ABOA 3PSVA 4XAPA 2PBOA 4TMBA 1KTBA 1KGXA 1P0BA 1RR2A 3R13A 3FVMA 3W2UA 3HPFA 2PTYA 1HVQA 4AC7C 5HINA 1ALDA 3GXFA 3SUVA 3HBLA 4M3PA 3TDFA 1W1YA 3DZ1A 4DJDA 1BSIA 4M1RA 5HMFA 3T8QA 4JHZA 1XYLA 1E0UA 3AYVA 4ICCX 1BF2A 1WBJA 1V0LA 3TJLA 1HJXA 3N9KA 4S23A 4JTRA 1XGDA 3P5YA 3KAOA 3F2CA 1EJ7L 4IG2A 2R1PA 4PZVA 1HUVA 3TC7A 3GS6A 2H90A 2INZA 1JPIA 4M7TA 1XCFA 1XINA 1B9ZA 1PYMA 4XZBA 2WJZA 3LEPA 1CDGA 1QWKA 3P93A 4QCFA 3ITOA 5DMYA 2QIIA 4R88A 1R6WA 4DNHA 3QTPA 2ACUA 1XC4A 1E6SM 1V3IA 2GDQA 4Q8MA 1FRBA 4NQ1A 1TE6A 4GKTA 4QE1A 1EF2A 1DP0A 2C71A 3EPOA 3LSCA 5I3JA 3FYPA 3MUZ1 1KM4A 2PDQA 3SSZA 4ZQMA 2ANUA 3EBVA 1AZ1A 4C1NA 1E9LA 4KGLA 1O1ZA 3MMDA 3PJTA 3NL5A 3GXDA 4J5NA 4RW3A 4HPHA 4KT2A 1WDWA 3HV8A 1MUWA 3VOHA 4B3ZA 3CIXA 5ABTA 1ISXA 3PPCA 5CH9A 4GI4A 2NQHA 1GZGA 2PWHA 1H7PA 5CZ0A 3NQVA 1ME8A 3W6LA 3BZJA 3M0VA 4HPJA 2XIIA 3S1UA 1XCXA 1ZBKA 4DELA 3QYSA 4C6OA 2PP3A 2OWWA 4LY4A 4U2YA 2OLHA 1E9YB 3KBNA 3CWNA 3E74A 1UD4A 1G4PA 3KOXA 3TW6A 1HG3A 1MZRA 3WBEA 3STPA 3F4NA 5IXEA 4F0LA 2PGWA 5CC6A 2NUXA 3LI0A 2E3ZA 3PB2A 4MOZA 3VMOA 4CN1A 4A8LA 5H2ZA 5A6BD 3M44A 1EP2A 1ZBVA 1AK5A 3BE7A 3MKVA 1V3LA 3FDKA 1V7YA 3VO0A 5AN7A 1RJRA 2PODA 5D30A 2E6DA 7REQA 2ESCA 2L5HA 5C55A 3Q45A 4JR5A 4F0KA 4S3GA 4UTFA 2XINA 3A24A 4J2PA 3ZIZA 5DRCA 2CWXA 4AXNA 2YA2A 3AYRA 3B04A 1PDYA 3AISA 1OCJA 2IQTA 2GQ8A 5BNKA 4JTAA 1DE5A 2H8XA 3URBA 3CUZA 1TMHA 3N73A 4OGZA 1T99A 4QISA 4WOQA 3ARSA 1PWMA 1QO2A 3NWRA 2WAGA 2XIJA 1I60A 2VEGA 3W2NA 3N4EA 1ECEA 5JIWA 3TH6A 5HNTA 4YWIA 4H6KA 2V81A 1VR6A 1EDGA 5JIPA 3W9ZA 3S9IA 4EE9A 5DMMA 4H19A 4DJFD 2BY2A 2UY4A 3S46A 3TAOA 4N9BA 3CO8A 1JZ6A 4Q7BA 3IJIA 2FQIA 4RPQA 3GC4A 2POTA 2XVKA 4PTXA 3FFSA 3VAVA 4D8LA 4CCDA 1CPUA 2WPBA 3BARA 4O17A 2EGZA 1ICQA 2WCSA 3R12A 4DPQA 3CBWA 3PZUA 5A6MA 3GAYA 4F9DA 3WLNA 4JTGA 2NVCA 4AY7A 3H26A 1G4SA 1C8XA 5GJMA 3UZZA 2FVKA 3WO8A 4IMAA 3NEVA 4HCLA 1VGAA 2G50A 2JIWA 3GD6A 1E3XA 2FDMA 5AHIA 1XLGA 1Q7MA 3EMZA 3RHGA 5AC7A 3BLLA 4BQ2A 1GOIA 4MB5A 3M5YA 3MDUA 1OEPA 1FA2A 2WANA 4MY1A 1UOZA 4F2UA 4H8VA 5FEPA 2WQPA 4EVZA 4GZEA 4UR8A 4HK6A 4PCFA 2VZTA 1XS2A 3LXAA 4GY0A 1I1XA 3LENA 1KNWA 5LXXA 4NX0A 3QQWA 3E5PA 2XVLA 2DP3A 4P2VA 4FR6A 3BSGA 4HK7A 1H41A 1TJRA 3A21A 4LYQA 3BLPX 1MQRA 1EJWC 1US2A 2NX1A 4GC3A 3UP8A 1CYGA 1EJVC 5D02A 2Z0IA 1EEXA 3UT0A 3W7RA 2YB1A 2G97A 1YW1A 3E9AA 1WAUA 5JBFA 1E6ZA 5IM51 5CGMA 4FX6M 3T09A 5LGXA 1FDYA 3BSMA 1TJ1A 4MFDA 2DH3A 5K9DA 4RZ4A 1E6RA 2GK1B 3ARRA 2WSPA 4JQ4A 1OFBA 3C8FA 3GAKA 5CPMA 5L6UA 1EGZA 3M0IA 1J2WA 4J4KA 2I7GA 1L6YA 3QGKC 4WOZA 3BANA 1YNPA 1WYIA 3H54A 4QDWA 4GBDA 2HRWA 4AZ6A 5FEWA 3K4AA 4C5ZA 2BVDA 1JFXA 2D73A 4M6VA 1MNSA 2HS6A 3VA8A 1DJWA 2PPGA 4MG4A 1W1ZA 5CPOA 4K8HA 3FJLA 3OQ8A 5BOOA 5CJMA 1IHIA 2C0HA 3E0FA 4LV9A 2R1LA 4GVGA 4L5ZA 3WQDA 2O9OA 1SYTA 4OUIA 3C8NA 2FHFA 3WZ0E 2VP8A 4I9AA 4Q33A 4WF7A 4PH6A 2ZTKA 3B8SA 1EKOA 1VD6A 3HGJA 2OOGA 1YEYA 3EWZA 5FA5A 4YCOA 1EF3A 2DZAA 4H9XA 4PCTA 4J9JA 1TZZA 3KOWA 1U33A 1EL3A 4Z2JA 3VM7A 1QHPA 4DO5A 4Y90A 3UZJA 3I7SA 1GKQA 4LALA 5AC4A 1SW0A 1OK4A 3GDTA 4QGCA 3VPLA 2IXVA 3GFYA 1EB3A 4N7QA 1J18A 3H55A 5C2CA 5D2WA 3W2KA 3DFSA 1F9CA 3AYTA 4NYYA 4P5UA 4FXJA 1TWWA 2FPYA 2IW0A 3RIKA 1DWIM 3CV2A 4C6EA 1YPFA 2I9EA 2OSYA 1V0NA 5GNZA 1UD6A 4E4UA 3UJFA 3AS3A 5ABHA 4KWUA 3A64A 1XUUA 1X7IA 2OZTA 6ENLA 3O1NA 5EBAA 3TONA 1JI2A 3ARVA 4XD5A 1OT1A 4FMVA 4RUBA 4KPLA 2YDRA 3N6JA 3T05A 4CQDA 1PIIA 3BG9A 4QDPA 1X38A 3NAVA 3CHFA 3DBPA 3IUDA 4A3UA 1UC4A 5CBBA 4ZTXA 2UY3A 1QBBA 3M5VA 3MJYA 1CXHA 4GGBA 1OY0A 3BGAA 3FX4A 4GYKA 4QXIA 3ABZA 1B30A 4QHRA 5BROA 2VI0A 3WMBA 1OD0A 1XBYA 1T8QA 4BS0A 1KGUA 3E2QA 2CIPA 3KCLA 4FLRA 5DXYA 1OX5A 3DIPA 1OX4B 3NZ1A 2WVSA 4A8IA 3DXIA 4ZFCA 3F4WA 3HPZA 1FWTA 4H8HA 3R8GA 2NUYA 5HJXA 2YCLA 1MXGA 1GPFA 3U5YA 1RJQA 4GABA 5A5WA 1BAGA 2A6NA 1LL6A 5CPNA 2FB3A 1QNOA 5AYBA 3N34A 1I2PA 3PBVA 3MWAA 4O11A 1RLCL 3O6DA 1UR0A 5ENLA 5CXPA 1OGSA 3P8JA 3LBMA 1GQLA 3KLLA 1VBJA 4GFIA 2OEMA 1H5VA 3BCDA 3C86A 5LIKX 4E8GA 4NNAA 1RHCA 4ORIA 2YXGA 1T0OA 3VVGA 3H7VA 3CUGA 4QG8A 3W7MA 4MZYA 1IXQA 1QXLA 4NG3A 3DFYA 4XBKA 1BYAA 2ASHA 1S5NA 3A22A 3EXTA 1PL9A 1ISYA 4GXMA 1VIZA 2GZXA 4UQBA 4I8YA 1WOAA 5C9RA 4DAIA 3L5MA 1JPKA 3FJNA 4HNUA 1NOUA 3NQ7A 1UWQA 5KETA 1B3YA 1KBIA 1Q6GA 2YXXA 2E4TA 3ABQA 3U4FA 4ZR8A 3ARWA 4KEMA 4HU3A 1KD0A 4XVEA 4PR4A 5LGZA 3KS6A 2Y89A 3SN4A 1XRTA 3KZPA 3AXKA 3KX6A 4C6LA 2H8ZA 3MI6A 1ZLPA 3AICA 2WMHA 5D9MA 2ZTJA 4YTQA 2I56A 3NSXA 2WKGA 2D20A 1JYWA 5DELA 2ACRA 4NT0A 3FV9A 2Z2UA 5DBTA 1WZLA 1JCMP 2W92A 3TNOA 1S5TA 1IYXA 1JAEA 1EDTA 4RDYA 1N82A 1W1IE 2D3LA 4Y6GA 3MO7A 1WKYA 1AH4A 4C6JA 3STFA 4AHQA 2CLPA 3BURA 1R47A 3FW6A 1UR4A 1O68A 1V5XA 4NZJA 1A5UA 3ZLFA 5A6JA 5T91A 5C9UA 1IZJA 1E1CA 2VGBA 3W1AA 3BG3A 5AHLA 5AYXA 3STGA 3W2MA 4CQ8A 3GVWA 5AHEA 2QJIA 2O9PA 3LCXA 3N2CA 1S5MA 2PDCA 4IIEA 1N55A 4MWAC 4RNJA 3SY8A 1V77A 1T7LA 4HOWA 4TX6A 3W7EA 2X2YA 1BXBA 2WVTA 1R46A 3T40A 4CCEA 2FJUB 3G1RA 2ZKMX 4OUEA 3MT1A 4W87A 3VCNA 2VGFA 4JHOA 1YQ2A 4UIOA 3EOLA 3UCCA 1DJHA 1NIUA 1W9PA 3MZNA 1HVXA 1VCGA 2JFEX 1QNQA 5EMMA 5LZLA 4KEVA 1SJAA 5FCZA 1YYAA 4C5YA 2G37A 3LMZA 4CNPA 1F2JA 3T2PA 1EQCA 2F6KA 1H49A 4PL1A 3D0CA 3W7DA 3UJRA 1RD5A 4HA0A 2ADAA 3P3BA 2ZZ4A 1A0DA 3JR2A 2AQVA 2XSBA 4L80A 3LLDA 4MHBA 4M6UA 4YYFA 4R7OA 4C7GA 2F7FA 1F05A 1ZGDA 4O0QA 1MUCA 1OFOA 3OZPA 2QV4A 4BJHA 1SM9A 1XSIA 4PODA 4JHMA 3DHFA 4OKDA 1TPH1 1S5WA 2VQTA 3CPRA 2YIHA 3SM0A 3WDPP 1I2NA 3H22A 2OLSA 4AZHA 2D24A 1UA7A 4NXSA 2GVJA 5T26A 3ONCA 4TTUA 4S3DA 4C1NB 3QN3A 3WN6A 4TOQA 2V5KA 2OJPA 3OA3A 4MDOA 3O8AA 5CKSA 3QGVA 4ZZ9A 8TIMA 3HB9A 3S3GA 1UHVA 4QX4A 1JRCA 3BQ6A 1TELA 3P2VA 2OSWA 2VMFA 1NTHA 2CU0A 2VFGA 3ITVA 3EDDA 5CSSA 5FJRA 4IJRA 3VC5A 4BWLA 2YL8A 1F3XA 2ZQ0A 4XVDA 1W37A 1EPXA 1VP5A 1V6TA 3TK7A 5FKYA 2UZ9A 2JKEA 4C6MA 2BGQA 5I78A 5FESA 4WD0A 4I6KA 3P5ZA 4IT1A 4K2SA 1W3NA 2DQWA 5T8GA 4GQQA 4WHBA 1S2AA 4M24A 3GH4A 2YBUA 1OC6A 3L4XA 4AEOA 3NGJA 3EWBX 3AHXA 2DFAA 4LUTA 4GCXA 1EJXC 3KRZA 2XDFA 4LVGA 3UW6A 1FBAA 1CI1A 4Q4SA 4E38A 3MB9A 2X7WA 3HJEA 2C1HA 3VXGA 4XD3A 2OO6A 2ZE0A 1FOBA 1UZDA 3SCSA 3W72A 4N6FA 1V51A 1HJSA 4DN1A 4JTJA 3VFCA 5KEZA 1DJIA 4UTWA 6TAAA 2GVGA 1JZ3A 5FJIA 3S5ZA 2JALA 2WLZA 2Y7GA 1TV2A 1JDAA 3PBWA 1OF8A 3W74A 1SMAA 4NP7A 4NNBA 3Q65A 3BOFA 3CWHA 2Y1HA 3WH7A 3DYOA 3WD2A 1PBGA 1OB0A 4K7YA 1D2KA 1OFAA 4LC8A 2J62A 2Y2WA 1RAKA 2F61A 4XZ9A 5DT5A 5HQMA 3QEZA 1FFQA 2XM1A 3CC1A 2QCDA 3UWEA 1JZ8A 2VENA 4B92A 3W83A 5EPDA 4ERIA 1GJWA 4P8VA 2ZX5A 3C2RA 1CT5A 4MFEA 4ICNA 3W2JA 5A95A 5A8OA 4AZIA 2WLYA 3I6TA 2PLMA 1EZWA 4IL2A 3LB0A 4S3AA 1E6QM 5D8ZA 3LCHA 2HZGA 1PAMA 2EBNA 3EPMA 4JQ2A 3OTRA 1BG9A 1PZ3A 2WVUA 2NQ5A 3LERA 3T9PA 3MV01 1KB3A 4L4MA 2CZFA 1IV8A 4PE8A 1K8ZA 3DERA 2QJMA 1MQQA 1MVYA 4JY9A 1KRBC 1OZQA 3ID7A 1B57A 4IPNB 1Q8AA 1RLDA 3W02A 3IIZA 3GDKA 5REQB 4MZ1A 1T41A 1X1NA 1M7JA 1LL7A 4AC1X 1QOXA 3B40A 4DJDD 5E6YA 4K7VA 1TQJA 1BVWA 3H21A 3C56A 1Q3NA 1CLKA 1U5JA 2CESA 1RV8A 2J7BA 3W86A 4WDUA 4V1YA 3VDGA 1LYXA 1F8IA 6XIMA 3TC3A 4J3VA 3FGCA 2EPLX 1V02E 2YR1A 4JFTA 2WMIB 3KP1A 4WDTA 3MW7A 1K1DA 3AXMA 2PA6A 5HA7A 2BXYA 1M7PA 1XD0A 3JZEA 3WFAA 2Y5JA 1D8CA 4ZGYA 3B0YA 3E5BA 4JZ5A 5FI8A 1TYGA 2CBVA 3ITXA 3UEQA 1FH9A 1K4HA 1Q66A 2VYOA 2CKSA 1BVZA 1QI2A 4C91A 3E2RA 2PLKA 3SW6A 4DM1A 4AD0A 2D2OA 1XH0A 1BWKA 4A3HA 3CM4A 1WA3A 4QAWA 4FALA 4DAFA 3CAKA 2Y7FA 3UPBA 2R6OA 5IDIA 4DI9A 1R8LA 3A3WA 2AL2A 3EB2A 3Q94A 1AD1A 4I5RA 4B5UA 4C1KA 1O5XA 2BG5A 2V3DA 5G2WA 3HPXA 1Q6FA 1FCVA 3BVJA 3BAIA 3POHA 3IIXA 2QZRA 3G1FA 3JZUA 1BG4A 2IKIA 2CLMA 4R5EA 2CZDA 4I5XA 1XLFA 4UB9A 1FCQA 3GVGA 2GYIA 2P10A 1KM3A 1IEVA 4ZO6A 2F2KA 3TN5A 1XL9A 5G4HC 1YXYA 5EBUA 1H3GA 3QQ0A 4HHLA 1DQUA 3WELA 5HOSA 1QRQA 1WZAA 5CPLA 2QLYA 1R2RA 1PSCA 4Z2KA 2WJFA 4B4HA 2GJXA 1AODA 2ZIDA 3WQ6A 5HXMA 4NVTA 2QW5A 3BLFA 2BODX 3HGSA 2QCFA 4HYVA 2OX4A 4U4MA 2A3AA 4HU8A 1JZ5A 1E55A 4J27A 5I77A 3WEOA 3LK6A 3NQ8A 3RU8X 3WKZA 1RY0A 1FHDA 5D33A 4C6FA 3BAYA 1XISA 4J2MA 4MVAA 2J8GA 1GOOA 1E9ZB 5AYIA 3S83A 1DIEA 4GHRA 2R1MA 3PN8A 5IBXC 3T2OA 1AJ0A 1HKWA 3W25A 4M1BA 3TTYA 4XAYA 5D05A 1Q6CA 1V79A 1PUDA 2ISDA 4DZAA 4KIEA 4O13A 3OODA 4PCNA 5DT7A 2TAAA 4HHMA 4L9YA 5TIMA 1M7OA 3VD5A 3WLTA 1XLMA 3ARYA 5D38A 1XYMA 1JCNA 1K9FA 2I5IA 3G6MA 1W0MA 4UQAA 4M82A 1H60A 4ZOEA 2QEZA 3P81A 4LYRA 5F7UA 5RUBA 3ZLGA 3CYVA 3KOZA 3HOJA 1TB3A 4EOUA 4O1BA 4JIHA 1KM5A 4U10A 1TPEA 3RU6A 5AECA 4YVVA 2PDGA 3ITLA 2WZMA 2DIJA 4JBRA 3W7HA 2WKJA 3MYOA 5IOBA 3VMNA 5IFTA 2VC7A 4HZ7A 3O63A 1V0KA 2H9AB 1B4KA 4KESA 4GY1A 3IV3A 5D9OA 1M9HA 1X96A 2X2GA 1ZAIA 2AGTA 3QLLA 4LANA 3QMSA 2GPTA 3TW9A 4PA8A 4LCQA 1DHPA 1A5BA 1DJNA 4RL3A 3D47A 3CH9A 3G1XA 1R85A 1THFD 4UZUA 4C6NA 1GORA 4DJFC 4GX9A 1ZENA 2GSEA 3M5ZA 1CECA 4GISA 5LIXX 2J7FA 1XIFA 2DDXA 3KL0A 3OIHA 2J66A 2AL1A 4HHHA 4DPPA 3M0ZA 1N8FA 3W88A 1TPVA 3BW2A 3C4UA 2MUCA 4AIOA 1KFBA 2QUMA 4LW7A 5LA1A 1KBBA 3WY1A 1SR9A 2I5QA 3A4WA 2OKTA 1VS1A 3M6YA 3KBSA 1YE6A 2ZXDA 3RLVA 1S2WA 1F8MA 5G1TA 4JFWA 5FF3A 2GQAA 3SN1A 3ZVHA 1JQXA 2WNNA 3V75A 4MWAA 5LHFA 2DW6A 3EOOA 1AH3A 4R3UA 4UCFA 4RCXA 3PWIA 1IR1A 3B9AA 1QNSA 4G9PA 3TFXA 4IUGA 3LNMA 1UIPA 3HQPA 4KWSA 4KW2A 2Z2BA 3E2SA 4H9MA 1ZCCA 2UBPC 5A2CA 2OT0A 4FOUA 1UYQA 2VCAA 5EFDA 1A5LC 1W1A1 2BOFX 3R8RA 3HN3A 2CEQA 1N7KA 1QNRA 3SCUA 4P7NA 4L4OA 1RH9A 2ISFA 3APTA 3W1TA 4KCUA 4AIUA 3O2LA 2Y7DA 3WH5A 1Z9AA 3M7SA 2PTZA 4LAUA 3GXPA 4W89A 5HWJA 3EXRA 1PJ9A 3NIYA 3PTKA 3VI2A 3MV11 1PB0A 2QPXA 2ZUNA 3S42A 4HN8A 3OIXA 5DY2A 3IAQA 3KWSA 1AW5A 4DUOA 3FXGA 2NUWA 5H1WA 1EC8A 1SGJA 1HP5A 1FY6A 1NDVA 3R0KA 1P6WA 1JGMA 4CNSA 4RPPA 3A23A 1SUXA 4REQA 2HK1A 2NWSA 3CQ0A 4MADA 5FOOA 1LCOA 2NT1A 3EB3A 3URQA 4PUJA 4ZO7A 1SFLA 3ANYA 5AOUA 3E6EA 4FNUA 1KV5A 1QI4A 2WVVA 1TR9A 3U8GA 1XWYA 3FKKA 5AYYA 4KETA 1BKSA 2O4MA 4HU4A 4GJ1A 3A6OA 3DHPA 4HPNA 2OYMA 4IP4A 2H3BA 3WJYA 2WCAA 7ODCA 1EP1A 3PBYA 2INFA 3GW0A 4E4PA 4UMBA 4B5VA 1XLCA 1V4YA 4WSJA 1LZOA 3QTGA 2V3GA 3MHFA 1GJPA 2GJPA 1UH4A 1PKMA 1C90A 3B0VC 8A3HA 4OECA 3WQOA 3GIPA 5I03A 4PRWA 1OCBA 1NSJA 3DX5A 1VYSX 1OVDA 2ZX7A 4GIYA 4PBGA 1Y5WA 1ODZA 3N3TA 3RO8A 2WK2A 3DUGA 4JX5A 2X0HA 4MDPA 3TW7A 4G2DA 3GTFA 2CHOA 1EA0A 1VC4A 3VCCA 4CD8A 4R9XA 4CQ9A 2Q3OA 3DOPA 3U5UA 3B05A 3UZWA 3IGHX 3RNDA 3OG2A 3ANUA 3SUWA 1TKKA 3PJUA 4HNLA 1WDDA 2J13A 4LH8A 4ACZA 3ERPA 4U28A 4M6PA 4UTKA 3GTIA 1TRDA 5JMUA 3WBAA 4EXAA 1W1TA 1EYEA 1GUVA 3N13A 3UXAA 1TV5A 4IZGA 3QSTA 2GGGA 1J11A 1SZNA 4X2PA 4LS1A 1E5JA 3N19B 9CGTA 1S38A 2EPNA 5LSMA 2AAMA 1DHKA 1TTPA 1BVNP 3B8TA 3K30A 3CNYA 1A5MC 4YNGA 1NP0A 1DORA 1W91A 2SFPA 3UBPC 5BWAA 2J6VA 1WNOA 3OP2A 2J8TA 1I2QA 3R6IA 2AOSA 1CX9A 1HKJA 5CEWA 2FPTA 3VKAA 1W5PA 3PUOA 4D6HA 4HQVA 3UWZA 1LRNA 3DHDA 3TTSA 4KFOA 3WLKX 1SO4A 1ZALA 2GWGA 3F5LA 2PTDA 3S5YA 3WBYA 3CV6A 3TYDA 1WDQA 2JGYA 1WDSA 3GG8A 5FIPA 3SUUA 4UFHA 3QY7A 5DANA 3EA1A 1WAWA 4QJ1A 4Z1YA 2R94A 3CUXA 1C8YA 1EUAA 5B80A 4L64A 4IP5A 2YFOA 2HS8A 2VDHA 4WEVX 1Y5XA 3HPAA 4H41A 1HQTA 5AC6A 4Z1BA 3H2CA 5LNSA 1AQMA 1SJBA 2WO5A 2V3FA 3G1DA 4K68A 3GVRA 1FUYA 1US3A 4OU1A 2VO5A 1Q6OA 1L0PA 4BA0A 4F40A 4IGSA 2FJKA 3W85A 4A4AA 1E71M 3IARA 1GEHA 1RXOB 1ESWA 2ATMA 5M17A 2DSVA 3CEPA 2NQZA 4M7SA 4X2RA 4TVCA 3FN9A 3UD6A 4LY8A 2HROA 2QCDB 3HIJA 1NF7A 4O1DA 4BZYA 1UP3A 2PBGA 2W0UA 5AC8A 2QAFA 3F1QA 8CGTA 3RGTA 2YCIX 3MMUA 2Q02A 1UMLA 3NZGA 3GY1A 4W84A 1JJKA 1LQAA 1XD1A 4NAEA 3OVQA 3QGAC 1XX1A 2VX6A 4XG1A 2D1ZA 4IGMA 1H1ZA 3GDBA 2VR4A 2XH7A 3TQKA 4RE3A 1JDEA 5T9BG 2JEQA 2EAWA 1UKSA 5I3FA 3OLGA 2EG8A 3DH7A 1UA3A 1AVAA 3BK0A 2E09A 2I5GA 1LUCA 3LHYA 1W9DM 3VILA 4XAFA 1ISVA 1LM1A 3FCPA 4F9JA 4TXEA 4GX8A 1JRBA 3FEMA 5JH1A 1NQKA 2XH4A 4K8GA 5JH2A 1VEPA 1PS9A 2WXDM 3R5EA 3LQLA 3MC5A 2J74A 1XLJA 4GUJA 4UTHA 1HKIA 2YA1A 4HT3A 4LRTA 3CQIA 4KWOA 1YHTA 1VFHA 4ATDA 1EUNA 3V0TA 3THQA 3ZJ8A 4E5TA 3QBUA 5EKYA 2FZDA 5B7ZA 3THDA 2CHNA 2FGLA 4Y7EA 3NEHA 2HK0A 5BRBA 3MQTA 1IEWA 1UJPA 3UWVA 1YBQA 2V6AA 4NF7A 4DRSA 4W8AA 5JXQA 3FDGA 4UTIA 2FTYA 1LWJA 4FP1A 1NP2A 2BFGA 2QKFA 3GH7A 3BL3A 3N3MA 1BFNA 4YN5A 3IUIA 5F2MA 3EKGA 5J04A 3U2EA 4GE8A 4WSKA 1AW1A 4O15A 1CLVA 4TR9A 2DU2A 1DTNA 2HCVA 5C0QA 5BOFA 3HJZA 2WQDA 3G1YA 3C52A 2XGZA 4NZFA 4JQ1A 2V3EA 5IBXA 4B9ZA 1KWKA 2AL2B 4GUIA 4FLQA 4OJYA 3KOYA 4CVUA 3S5NA 3ZJ7A 3ZR4A 1WQ5A 3E02A 4YYCA 2A7PA 1OM0A 1B5TA 1E4LA 2VWSA 3VKBA 1CGTA 4YLWA 3W75A 3SFKA 1NOWA 3NYZA 2TSYA 2A6LA 2QGHA 2ONEA 3SI9A 4R34A 4L6DA 4RNHA 3K2GA 4ALDA 3KRBA 2Y0FA 3RUBL 1TREA 3V0SA 1UUMA 4E2DA 5AB3A 1IE7C 3GNOA 2XN0A 1S5VA 5LA0A 2Y5EA 2R14A 1BLIA 2GJXB 3L2IA 1W31A 3WENA 4CCCA 2DIKA 4LPCA 1LQ2A 3CHVA 1P6CA 3WUFA 4GWEA 2D22A 2OYKA 3IS4A 3TYZA 4JICA 1O7AA 2WMFA 2Y62A 5A2AA 4U5IA 4DJFA 3GIQA 1GKRA 3VX1A 3VDBA 1IGSA 3GXTA 2C16A 5HNUA 4JTKA 2Z28A 4XIAA 1CW2A 1I4NA 1K8YA 4GXWA 1DWGM 1V02A 1U1JA 1VJZA 3VOFA 4BEUA 2ZUSA 2Z24A 4XQ6A 2O4QA 3N25A 2PURA 1FP8A 1W1PA 3BOLA 3MO4A 3QHMA 2WNWA 3F5JA 4LB3A 1MRAA 5SWUA 2DJLA 1NWSA 4JYDA 4HK5A 1E43A 2WJEA 1L2QA 1C8QA 4LNYA 4RNIA 3I3BA 3DAQA 2PWVA 4GRSA 3QJAA 4IM4A 1FWNA 1K9TA 3DYPA 4FEZA 3QFWA 2V68A 3N6QA 3MU7A 3I65A 3U4AA 2X0YA 3IJ6A 3MSRA 3AOFA 4MLJA 4YXGA 1M5WA 1ZHAA 3DFHA 2VHLA 4E2VA 2W6RA 3NSMA 4EPKA 4OHQA 1ADSA 1F3EA 2Z7KA 9XIMA 4QS5A 4WY0A 4LS0A 1A5AA 4ZL1A 3ALGA 2HPIA 1UPPA 3ZWSA 1GT8A 5I5RA 2HSAA 3LPOA 3UGVA 4A21A 4K38A 4GYFA 5BW6A 3B03A 3MDWA 2FZMA 4W8LA 2ZRYA 3TWAA 3C2VA 3DG7A 2OSXA 3WLJA 3AALA 1PZ0A 1OF6A 1ZUAX 1SZEA 5TD4A 6PTDA 1ITQA 1RP9A 3WQGA 4IMGA 1JPDX 4WGHA 4P7LA 4PSRA 3QR3A 2D0FA 4R7JA 5BWFA 1DJYA 2NVAA 5EY5A 5GNYA 3POCA 3VZXA 1KA9F 1QPRA 1FH8A 1QDSA 4DXKA 4OV9A 2VELA