3W76A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-4-189
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-4-189
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 103
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w76A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w76A01
4ADUA 3W1MA 2EKCA 2DZTA 3L65A 1EUNA 3LRMA 1MEWA 4I7WA 2ZRWA 4O15A 3W1RA 1X1OA 1AW1A 2CLMA 4FNSA 1EP2A 3AJXA 2DZPA 3PBWA 4I7VA 2DU2A 1YYAA 3SSJA 3M47A 4R7JA 2E77A 4BI7A 2C0AA 1DBTA 3MJYA 3SGUA 3OA3A 3M43A 4TIMA 5D2WA 2QEZA 4GUGA 3UXDA 3SGZA 2CZFA 4RZ4A 1H63A 5FF4A 2NUXA 5LHFA 1EWDA 2BZNA 1RZMA 1H60A 3EWUA 3TSMA 3W9ZA 5HR6A 1OFQA 1X8FA 1XC4A 5HJLA 4FNUA 5FEWA 1C29A 3O6DA 5G2HA 1VYRA 1JULA 1A5BA 3CB8A 3QJAA 1R2RA 1NF7A 1VCVA 1R47A 2J9XA 2VXNA 4L4MA 1W56A 3ZS4A 3PULA 4MY9A 3NQ2A 4MY8A 2BX7A 1AMKA 1VPXA 3IEBA 3GAYA 2YYUA 5CPOA 2D73A 3GDTA 5I3FA 3LLFA 5K3VA 5D05A 1KM3A 1BTMA 2FIQA 2FTPA 4CQ8A 3S1UA 4CQ9A 5I3GA 4EF9A 3BG9A 4LS2A 3CWOX 3TU9A 4K6AA 1ZJIA 1MO0A 1B4EA 2ZA2A 2WO5A 2E5BA 3MYPA 4O53A 2X16A 2VC6A 1LRNA 1FDYA 4P61A 1K7EA 2VFFA 2X30A 3C2FA 2RHGA 3TJXA 1TSIA 1XKYA 3UYCA 3CEPA 5L6UA 2QCCA 3GDMA 1H7PA 4Y9AA 4FO4A 4UFJA 4IJBA 5EBUA 3IV3A 4UTIA 4JTTA 1LP6A 3NM1A 1OYCA 4XTIA 4U28A 3HPXA 2CLLA 1EUAA 1OJXA 4IUOA 4JTGA 1FXPA 1VH7A 3U8GA 3FYOA 3R8RA 1I8JA 3NL2A 1KFEA 4I7UA 1OFAA 1WV2A 3WJWA 1G67A 1K03A 3S9YA 4JN6A 3LHYA 5G1TA 3W7KA 3NR0A 2X1SA 4WJEA 1LOQA 1YLVA 3SI9A 4B5NA 4WQ6A 3O06A 2E6YA 3W1LA 1M5WA 1S3HA 4E0CA 3LHUA 4O18A 1RD5A 3GR8A 3IIOA 6ALDA 3W1NA 2YW4A 5AHIA 1M7PA 2VOMA 1JQXA 4Z1DA 3TK7A 2WNZA 4FX6M 3EXTA 4O12A 1W0MA 2A85A 1X6UA 3TQ0A 4UMBA 1H7RA 3EXRA 3D0CA 4FX8A 4GNJA 5HR7A 3TMLA 3G8RA 1JUEA 3O15A 5AOUA 2IQTA 2NX1A 4DO6A 1S5TA 5DCEA 3TKFA 1ME8A 1GJPA 1YTDA 4JTJA 1A50A 4NNBA 3ATYA 2VFGA 5DLCA 2BWGA 3KVLA 3CLMA 1OFBA 1KM1A 1ML1A 5LNWA 2ZZ7A 3NYZA 3P84A 5AC6A 4UR8A 3HG3A 4HPJA 2FQIA 1K3UA 4LY8A 1T0OA 2B7OA 3W7JA 4EOUA 3EX2A 5KTLA 1ZCOA 5HQEA 3UY7A 3HGSA 2NUWA 5A8GA 2V8ZA 2YGYA 1H7OA 1OG0A 2ISSA 4GC4A 1TQXA 3T4CA 1R30A 2F7FA 1EP1A 4H4IA 3AO0A 2B7NA 1TIMA 4O16A 3CIWA 3HOJA 2E5CA 5F2GA 1RVGA 3CQ0A 1TB3A 2PC4A 4O1BA 3MHUA 5L9FA 3QM3A 2I9EA 2A7NA 3LBCA 2WKJA 3ABRA 3MHFA 2J88A 3TFXA 1C9DA 2ALDA 4Y6GA 5LNSA 1K8YA 3BLEA 5T26A 3ABOA 2R91A 3NQDA 2C18A 1LBFA 3JR2A 4O13A 3H54A 3PS7A 3GNDA 2VFHA 1YPIA 4JYEA 4O10A 3NQ7A 4WUIA 3M5VA 4QITA 4AMAA 3VKJA 4K38A 5HMSA 1TTPA 4ORMA 4DBEA 3NAVA 3PG8A 1QCWA 5K7JA 1LZOA 3SY5A 4RXFA 4UTJA 4DO5A 1QDSA 3P5YA 1J2WA 4CNOA 1KM5A 4NXSA 4Z1BA 1PCKA 3TXVA 2Q3RA 4DPPA 5F1VA 5E93A 4JTLA 3BLIA 1IF2A 4A2RA 3MHGA 2G96A 3DI0A 1QO5A 2VEIA 4U4MA 5FF3A 1TREA 1IXPA 2GQAA 3W1UA 2YSWA 4Y90A 1L9WA 3DFQA 1JCJA 3W7CA 3UY8A 2VFIA 4QNWA 4Y96A 1MZHA 1WQ5A 2W6RA 2YPIA 1H61A 2CLHA 4GUFA 3G3DA 3TSDA 3W2KA 2Z0IA 1F6PA 4X22A 1T96A 1FBAA 4E38A 3P80A 1B9BA 2DP3A 3EEGA 3MMTA 4TMBA 1KFLA 3N14A 3IGUA 1OK4A 4JY9A 3IVUA 4YXGA 3KAOA 3N19B 3WK1A 2QDGA 5BOOA 4GUHA 1IIGA 3QFEA 2ABBA 4POCA 4MIMA 3Q37A 1TPUA 1G7UA 4UFLA 2YFOA 1EIXA 1SO5A 3TV8A 3BK0A 3USBA 1DORA 3NOEA 1LRTA 4TR9A 2Y62A 1PHWA 3E9AA 4PH6A 1JVNA 1TPDA 1PS9A 4UFIA 3KRZA 3LRKA 3W07A 2X1TA 3C56A 3RLVA 4A29A 1O60A 3A9IA 3W1TA 3H53A 1DHPA 5J5DA 3G1XA 4K8HA 4O0ZA 1F76A 2GJLA 3B06A 4A2SA 3RK8A 1DQXA 5H91A 4UNKA 5AHLA 3FIGA 3MP4A 4FB7A 1SSDA 2H3BA 1J4EA 3W73A 1LROA 4OV4A 4S1FA 4P2VA 1LRQA 3GZ3A 3W2UA 3W7EA 3O6CA 5KSWA 1XL9A 4LS0A 4Z0SA 2Y70A 4GXMA 3PM6A 3E49A 1D9EA 3SR7A 3G3MA 3NQEA 4ADSA 3P8IA 2OZ0A 4GRSA 5BNKA 2WPBA 3GVGA 1GEQA 4S2CA 1MSSA 1RQEA 1P1XA 1ME9A 4LT9A 4GWEA 1VZWA 1X1ZA 3OIXA 2YW3A 3W7LA 2P0OA 3KRUA 1JCYA 3ZFHA 4NJGA 1QFEA 2WV8A 1ZFJA 4LS1A 5IBXA 4BWLC 2CLFA 2NX3A 3QW4B 2C15A 2NXIA 1QMLA 3FKRA 2CFFA 1OABA 4NX0A 5G2WA 1SW0A 5D30A 3V75A 4ZQNA 3SIZA 1GT8A 3EX4A 4PL2A 3NEVA 3UQNA 2C1HA 3TE9A 1CX9A 1OX5A 5AYXA 4LVDA 3G1SA 1G7VA 3QZEA 3KVJA 1PL9A 3MUXA 5DXYA 1FUYA 1P0KA 3NQAA 3QQ0A 3DBPA 1LOLA 3G8EA 3KXQA 1W3NA 2YX0A 4PA8A 4M6PA 5DELA 3NA8A 1S5VA 1JCMP 4C1LA 3SZ8A 4UTLA 1XUZA 4MJMA 2QJHA 2RH9A 3MI3A 3GR7A 4NX5A 3YPIA 3W88A 1K7XA 1WX0A 1JUKA 4RXGA 3M0ZA 3LCWA 5EYWA 5KZDA 3MI2A 3MP3A 5FEXA 1TPB1 3BG5A 3HPSA 4JIQA 4M6VA 3L0NA 3E0IA 3F4NA 1KLZA 5CZSA 5G2IA 2QUVA 5AN7A 1OX4A 4XKYB 4CQAA 2H8ZA 3EX3A 3M16A 4OE7A 3P5ZA 4OBTA 3MBFA 3W3OA 4WOZA 1TPFA 4JYFA 3CC1A 3LCXA 3PG9A 3N2XA 2C13A 1Q6QA 1XUUA 1H62A 4YWIA 3W70A 4ZQPA 5TQLA 1EA0A 3TC6A 3FS2A 3L5LA 3B4UA 4FIQA 4L4LA 4LUIA 4WY0A 2Y7DA 1I45A 1H7WA 2VEMA 4JS3A 4UTHA 3GXNA 4MY1A 2WOQA 1OVDA 1TTIA 3G22A 1DV7A 1WXJA 2H90A 1IXQA 3NO5A 4DF2A 2QUTA 1LM1A 3P61A 4Z1CA 5DCDA 5AC8A 1VHCA 5CPMA 3TFCA 1YXYA 2YYTA 3W87A 1Z42A 4O4WA 1AK5A 4K7YA 4OU1A 3LM7A 3L9CA 1O5KA 1GZGA 1Q6OA 1SSGA 3PBYA 1P5BA 4N9DA 4LU0A 1WA3A 2OMAA 5J5RA 4ZQMA 1RPXA 1K02A 7TIMA 2P1FA 1ZENA 3M5ZA 3BV4A 3UWVA 1Y0EA 5K4XA 3THAA 2FPYA 4CCEA 2Y63A 1FCBA 4K36A 3L5MA 3ZR4A 4QQ3A 1YDNA 1GVQA 5I3KA 3HGRA 5HWMA 1SFJA 1W31A 4ONVA 5K9CA 1YADA 2JK2A 3A23A 4Q4KA 1SZFA 1NFBA 3LI1A 5BW6A 3GKAA 3W86A 4NZFA 2Z1BA 2Z2UA 3STFA 1OFDA 3WJXA 3IVSA 1Q45A 1VGAA 3QPYA 3C2EA 3QYQA 1UJPA 3L21A 5AHNA 5C6MA 4JTKA 1LBMA 1UCWA 5CPNA 5AHEA 4GUIA 4X2RA 5EY5A 1WOAA 3GNNA 1ZHAA 4NZJA 2QCHA 2ZRUA 5KITA 2QCDA 3W7QA 2BTMA 1F6KA 5ABTA 1JUBA 3W72A 1T8XA 1H50A 4X3ZA 3A5VA 5DBUA 3NQ6A 1Z48A 3NL5A 5U4NA 3VI2A 1ZAJA 1YTKA 2J9ZA 3R5EA 3LBMA 4LOCA 1ADOA 2I1OA 1I2OA 3M1ZA 1E51A 3OVQA 3SFKA 1Q3NA 1N8FA 1WAUA 1SZEA 3DAQA 1A5AA 4MPQA 2C3ZA 5F2IA 2C6QA 4GE8A 4ALDA 3ELFA 1LORA 3W7DA 1THFD 4HIBA 5HULA 1AW2A 3DKLA 2TRSA 1K8ZA 3W1PA 3TAOA 3W1XA 3I68A 1EPXA 2A6LA 4MFDA 3GKFA 1B3OA 3HG5A 1VYPX 3NQVA 3PUDA 4ICNA 1AG1O 1I2NA 2CLEA 4AWTA 3P82A 3BPWA 3UPWA 3LOTA 4MKNA 3LV6A 4JX6A 5K9DA 1VCGA 3NQCA 2W0UA 3EX1A 3LCFA 4H6KA 3P62A 2DZSA 2TMDA 3A5FA 1TJRA 2Y88A 3PWAA 1NAL1 4KWWA 4RX0A 2GVGA 3GYEA 3H55A 4OT7A 2ZRVA 4NQ1A 5HINA 3R13A 4JIPA 6TIMA 1GOXA 2WNQA 3FA5A 3HQ1A 3LCIA 3RLUA 3FYPA 3L5AA 2XN0A 1CI1A 3HBLA 4N6EA 4BF9A 1SZNA 2ZZ1A 4JDBA 2JBMA 1HO4A 2PE4A 3W74A 3WFAA 1ZY9A 1TTJA 3GLCA 3WJSA 4CNNA 5D2VA 2V9DA 3PC0A 5F4XA 3VCRA 5D2TA 1F2JA 4A22A 2ZDRA 4UTUA 4UFMA 3LXAA 3NNTA 1FWWA 3ANYA 2FB3A 5FF2A 2EHHA 4G1KA 5D02A 3Q58A 3QMRA 3TAKA 4NVTA 1DL3A 1RR2A 3W7HA 3VFLA 2Y7FA 4JYDA 4RCXA 5LGZA 1YXDA 3BO9A 1TPC1 3DHDA 5C5YA 1L6YA 1H7XA 1QAPA 3PB2A 3F1QA 2FPTA 1W54A 4UTMA 3UWZA 1PVNA 3C52A 4AEOA 3DZ1A 3O1NA 3STGA 1ALDA 3QMSA 3QMTA 5AFDA 3IGXA 3UPBA 2P10A 2TSYA 1SO4A 2JGQA 4O28A 4UIOA 3ABQA 2PRLA 3ABSA 4UTWC 4DELA 2G5WA 3DI1A 3ZWSA 1KFJA 3IGSA 1KV8A 1YDVA 4RZ6A 4Z08A 1OF8A 4PL1A 5FESA 4JD4A 1I2PA 1JCNA 4MJZA 4WOQA 2A4AA 5DY3A 1QR7A 1I4NA 3C4UA 2OT1A 3QSRA 3BLFA 3NQGA 3NQFA 5F2LA 3EX6A 1VC4A 1KW1A 5KMYA 3S42A 2A21A 2QDHA 3T7VA 1TMHA 4O52A 4NJKA 4QM1A 3EKLA 1W5NA 4R33A 3WJYA 2CLOA 3PVFA 1KBJA 3G1DA 4MZ8A 2ZTKA 5CSSA 4MVAA 3QW3A 3N73A 3HGOA 3M5YA 2ZRXA 3GB6A 3EWXA 1FWNA 5IM51 2ZA1A 1A53A 1OHLA 4JTHA 5TBOA 3DGRA 1KTBA 1VR6A 3CTLA 3P81A 4DPQA 3O07A 1TV5A 1VYSX 4H3DA 1ZAHA 5DBTA 2A0NA 5D04C 1JRCA 3O63A 2ZRYA 3LXCA 3TJLA 3R2GA 2YXGA 3NPWA 3L0GA 4IWWA 4Q33A 4XQ6A 4RK8A 3UD6A 5MHBA 5E0KA 4KKXA 4BK9A 5G5IA 2Q8LA 2ZQ0A 1KA9F 1W3IA 4LV4A 3HPZA 3Q94A 1IXOA 1KTCA 4DXVA 1GPWA 1V7YA 4O1CA 4UCGA 2WSYA 1XBXA 2AAMA 1SUXA 3P7YA 3S0CA 1SU5A 4JY8A 1R46A 5LHEA 1BWLA 1GTHA 1D3HA 4LRSA 4PTNA 4ZQOA 1B57A 2GUUA 5CSRA 3W23A 1A5CA 1IXNA 1WDWA 1U83A 2CU0A 3M5XA 4LRTA 1SQ7A 2JGYA 3TSBA 2NZLA 1I2QA 4K37A 2YCEA 2J6XA 3CU2A 3V1PA 4UTTA 5D38A 5D09A 2BLEA 2NV1A 2B7PA 2EAWA 3NVTA 4A21A 5EKYA 2E6FA 1Z41A 1QOPA 2C16A 3W22A 1PE1A 2FDSA 3S5ZA 3GX9A 1KFKA 4N9CA 1PCWA 3P8JA 3FJLA 1KLYA 1H7NA 1SW3A 4QISA 4WY0F 2E5DA 3GXPA 3QC3A 1X7FA 2BSLA 1FCQA 2QCNA 1XDMA 1KM0A 4UMCA 1QNVA 4N6FA 1FQ0A 1VCFA 5CG7A 3QPZA 1PIIA 3KRSA 4AF0A 5LNVA 3FLUA 2EPHA 4FIRA 2RKXA 4JEQA 2A7RA 4N02A 1R2TA 3LLDA 3MO7A 3S5OA 3N2MA 1FDZA 5D2YA 3LCGA 1F5ZA 3I7RA 3NQ8A 3WK0A 1L6WA 3T40A 1HG3A 4O4VA 2A6NA 4UTTC 5AHMA 4IQLA 4MOZA 2GQ8A 2R8WA 2A5HA 4E2BA 5BMWA 3OEXA 1G4SA 4AHOA 5D37A 3E12A 4NUWA 3B04A 2V2HA 5D03A 3S6DA 4EIVA 3JRKA 3KX6A 3A22A 4MLRA 3T44A 1IIHA 3TIMA 5K2ZA 4ZL1A 3QQ1A 2FFCA 3DFNA 1KM2A 3F4WA 4O8RA 4ZZ9A 3RFAA 4TU1A 3HMJG 1WBJA 4RKAA 2Q8ZA 3LGEA 4WD0A 1GWJA 3VE9A 3C2RA 3QH2A 3W1AA 1W1ZA 3W7PA 1A5SA 1ICPA 3W7GA 3LCLA 3TROA 3PAJA 1OX6A 3LTSA 3UZJA 1ZAIA 4N4QA 3DH7A 1W5MA 4DO4A 2UV8G 3PR2A 2GOUA 4GBUA 4CCCA 2ATSA 4AF0B 1FWRA 1TPH1 3S1XA 4NJJA 4LVFA 4JR5A 1G4TA 5F2MA 2GVLA 1SFLA 4FNRA 1QWGA 1H51A 2FPVA 4J9JA 1BWKA 4BI6A 1N7KA 5E1QA 3I6RA 1O95A 1LLWA 3IIZA 4LVAA 2Y6ZA 4CCDA 1OK6A 1M7OA 1FY6A 3TUUA 4IMGA 4FHAA 1GTEA 2OT0A 4JICA 3W7IA 5C2XA 3GXTA 1VLWA 3C3NA 3S1VA 3DU0A 1WOBA 1OFOA 2GJNA 1QOQA 3W83A 3B05A 1G6CA 2FB2A 3HB9A 4IX2A 2QJIA 3CIXA 3SW6A 4LTSA 1FX6A 1DKWA 3M44A 2V30A 4YCPA 1WBHA 4M7SA 4RJEA 1QPRA 4EVZA 1NEYA 2XFWA 3LERA 4O0KA 2Y89A 3I7SA 1PHQA 1TPVA 1ZALA 1SO3A 4MZ1A 2C14A 4DBDA 2NWRA 1FCVA 1W5PA 4PC8A 2E6AA 4MZYA 2QF7A 5K4ZA 1FDJA 3DFSA 1F05A 1ZNNA 3G24A 3GIYA 3CT7A 4C1KA 2V5LA 3E02A 2QCMA 5F4WA 1SPQA 1SW7A 3DENA 4ZQRA 2JKAA 4FEZA 4MFEA 3B0PA 1KTNA 3W84A 1XBVA 3W1QA 2W79A 4YCOA 2ZZ5A 1Q6LA 4UUIA 2RDTA 2VFEA 2DZXA 1XFBA 3BW3A 5D33A 4IOTA 2WNNA 4OV9A 1W5OA 3TR2A 3NZRA 2V2DA 4FXSA 3LB0A 4ML9A 3PY2A 3EKZA 1TYGA 5U7SA 1TPEA 3E96A 1OFEA 3W85A 5G4EA 1TTQA 3BW4A 3WK3A 4XWUA 1OF6A 3MP5A 4AVFA 1D3GA 3L0KA 1LOSA 3CM4A 4LUJA 1DJQA 1F74A 4XBSA 5BMXA 1G4PA 3B03A 1VJIA 3NPUA 1V5XA 2ISWA 3DXIA 3LI0A 4HHPA 3M41A 1U5JA 1GVOA 2ZZ6A 4JDYA 4MYXA 1TRIA 3EWZA 1UUOA 4NJHA 3U6WA 1IGSA 5C55A 3BVJA 2VENA 1G4EA 5TIMA 3NPXA 3L68A 5C54A 5I3JA 1UBSA 3P67A 4TMCA 4TO8A 1SO6A 3HIJA 3VNDA 5DXXA 1XBYA 2QUUA 1JCXA 5KZMA 3TX9A 4RR4A 2V82A 4MYAA 4WX2A 3W76A 2E09A 4LVGA 1TV8A 4JX5A 1Q6RA 3C0JA 4KWVA 2Z6JA 1XBZA 4JTUA 4CLMA 2V0TA 4A3UA 4NJIA 5LKYA 4IMDA 5I3HA 1KFBA 2E1DA 4UNLA 2JKEA 3QRHA 3THQA 5D2XA 3NZ1A 5A5WA 5FEPA 5EA9A 4JTEA 4ZVJA 2ZA3A 1TQJA 2NLIA 3W6YA 3TQKA 4I9AA 3PB0A 2GQ9A 2V2CA 3UNDA 4IMFA 2YFNA 4KFPA 2ZZ2A 5LZLA 3NXFA 4E2DA 3BARA 5K9XA 4BR1A 3T55A 2E68A 1W5QA 4DQWA 4FXRA 4IPJA 2V81A 2Y7EA 3STCA 4Z1AA 5H2ZA 4O14A 8TIMA 4IXHA 3W71A 4NXKA 3OHIA 3W75A 3TCEA 3W2LA 2QCLA 1GVSA 2XN2A 3MI6A 1TV7A 5LGXA 3LV5A 3LHTA 4LC6A 3G0XA 1OFPA 2QAPA 3FFSA 2ZFAA 3IIPA 3FJ6A 1VS1A 1H1YA 2CZ5A 4XTDA 5F1UA 4W9TA 3MYOA 3NGJA 2QKFA 3BGGA 2H6RA 4HT3A 4LWWA 4PODA 1GVFA 1W3TA 4UTWA 2RDUA 3VE7A 4O11A 1O94A 1HL2A 4O50A 3P60A 4TX9A 2TYSA 4RLIA 4D2JA 1XM3A 3G1YA 2OJPA 1JCLA 2VEPA 4M19A 4WZHA 2AQWA 2ATMA 1BEUA 2X1UA 3RMJA 4ZQCA 3STEA 4UR7A 1AW5A 4HKPA 2NUYA 2A2IA 1AL7A 2ZZ4A 1ONRA 3GAKA 4K7VA 1RQBA 3WK2A 2X2GA 1H5YA 1NF0A 1TO3A 4AWSA 5CPLA 3C2OA 3FKKA 5LNRA 3BW2A 3F03K 4O1AA 1OFRA 2ZRZA 3R89A 1TJPA 3NDOA 1EP3A 3PBUA 3UWUA 3W7OA 4NT0A 5DCBA 4IMEA 2HTMA 1M6JA 3Q2DA 4KFOA 1YDOA 2AGKA 3CHVA 2HS6A 3LCHA 3GK0A 3C2VA 2GPTA 3EWYA 1EEPA 4M6QA 4R53A 1OYBA 3G18A 5CZJA 5AB3A 4OQVA 2Y61A 3CEUA 3P74A 3IVTA 1RV8A 2JKPA 1OYAA 3B0VC 2ABAA 2R94A 3LHZA 3NL6A 1SZGA 2R14A 1TPWA 2O7SA 1R2SA 5FEZA 2NV2A 3EWWA 2HS8A 4NNAA 3TW6A 3ZWTA 4JGDA 3INPA 3TDFA 3G0UA 5CZ0A 2OCZA 1N55A 5HUOA 3PSVA 5KINA 2TPSA 4HSOA 1JR1A 3TXZA 4JTIA 1GG1A 1HO1A 2NXHA 3TQVA 2I14A 1FWTA 3NQMA 1NSJA 4NNCA 1YXCA 3DHFA 4YMZA 4LVBA 1KM4A 4GJ1A 1GYLA 2J9YA 3I65A 1C8VA 3S5NA 3LTYA 3G1HA 3O6YX 5LSMA 1QO2A 4QJ1A 4Z0JA 5CGQA 3C61A 1Z44A 4AHPA 1F7BA 5AYZA 5LNUA 2VELA 3EB2A 4HN4A 4UMAA 4Q32A 4FNTA 1EWEA 2CLKA 2OX1A 4FNPA 2EF9A 4M7TA 4AHQA 3S5YA 1O4UA 5AC7A 2PRMA 3PUOA 5CKSA 3GDRA 5G4WA 2EGZA 4AXKA 2J27A 3EWBX 2XN1A 1O5XA 4HNNA 3PSWA 4HNTA 4FX7A 4WY0B 1LTDA 4DF1A 1J5TA 4IPIA 3LRLA 4RZ5A 3DFOA 2QCGA 2H8XA 5CZTA 3OVPA 1QPOA 3TMQA 1QPNA 3UZ5A 5IBXC 2CZEA 3UWQA 4QAIA 1GVRA 4AAJA 5EMUA 2PCQA 3TW7A 4UTKA 2QCDB 4JTFA 1QPQA 4KFNA 3HG2A 3LDVA 4QSHA 1LLZA 4EWND 4XZ9A 4AH7A 3G1AA 3U2OA 2DJLA 4FNQA 3EXSA 2QCFA 4UFHA 2B0MA 3RNDA 3DKJA 3NG3A 4HNUA 1T99A 2LLEA 5F4SA 2H3DA 2NWSA 3BGJA 4Y8FA 5G1YA 4LW7A 2NXGA 1B4KA 3S1WA 1UASA 2DZVA 3PBVA 2G95A 5FF7A 4HSNA 4LNYA 4O57A 2Z6IA 4UC5A 3QEZA 1W37A 4QIUA 4AWUA 1LBLA 2A1YA 2F84A 4M5PA 2X1RA 3SECA 3PUEA 4OWGA 3T78A 3C6CA 4YLWA 5EPDA 2PURA 1ME7A 3JS3A 4DEFA 5D32A 1JRBA 1AL8A 4WXYA 4OGZA 1GYNA 5HUPA 2VKZG 3UXAA 2V5BA 2QJGA 2NX9A 2G97A 3RF9A 3IIXA 1UB3A 1EX5A 3IIVA 1TRDA 3OG3A 4IMCA 1XDLA 4PFMA 2KZHA 3L67A 3L66A 5KZEA 5HWNA 2WSRA 4IXXA 1KFCA 2CZDA 1UUMA 5EL1A 1W8SA 3MW7A 1MXSA 4N9BA 4EF8A 5GVJA 2FLIA 1HUVA 5BRBA 3KOFA 3HO8A 1DVJA 3N34A 4HNVA 3TNOA 1ICSA 1YPFA 2C19A 1SR9A 3S8HA 2CLIA 2B4GA 2HMCA 3N3MA 1LDCA 4XUGA 1S5WA 1JJKA 4O17A 3LX9A 1G69A 4ZMGA 3W2MA 3W7NA 3QF0A 4IGHA 3MWAA 2Y85A 3ATZA 4IX0A 3A24A 2BXVA 4DF0A 3O16A 4YL2A 1DQWA 4XKYA 3M7WA 3R12A 1OX4B 1KM6A 1K7FA 3DFPA 4QNEA 1L6SA 1K8XA 1H1ZA 3CPRA 4S2BA 3LHWA 3LHVA 3W2JA 2E6DA 3N9RA 5SWUA 3FOKA 3KVMA 1I2RA 2DZUA 2O7QA 1XXXA 2Y7GA 3L2IA 1FWSA 1VLIA 4BI5A 5HWJA 3O05A 1HTIA 3CWNA 3TH6A 2ISVA 4LV9A 4CNPA 5HNRA 4WXZA 3W7MA 3A21A 3B8DA 4GUJA 2GVJA 5I3IA 3KFTA 3UWYA 4JXCA 1VRDA 1RQHA 1F73A 1GG0A 4GFSA 4LC8A 3RU6A 3TC7A 1BKSA 3MBDA 3NL3A 1TCDA 1P4CA 4K39A 1MEIA 5FF0A 4BWLA 2ZZ3A 1NVMA 3WJZA 2ZCGA 3TA6A 3G0SA 3GDLA 2HSAA 3M9YA 2YZRA 3HF3A 4MLJA 4ADTA 2FJKA 1XCFA 2DZWA 1MEHA 2VEKA 2ZYFA 3KVKA 3HG4A 3B0UX 4JX4A 3OBKA 2PRHA 3W7RA 1XI3A 2YDAA 3DFTA 3W2NA 3KHJA 1L2UA 3I7QA 4O19A 2QCEA 3K30A 1DJNA 5AYYA 3N9SA 1ICQA 3C8FA 4HPXA 4XBKA 2RDWA 4N9EA 3HGJA 1JQVA 5DY2A 2RFGA 3GDKA 1CW2A 1EB3A 3LTPA 1GQNA 4RV8A 3SJ3A 1FXQA 2QAFA 4N2YA 5FI8A 4PEKA 3G1FA 3PF3A 3OVRA 4UXDA 2DORA 4FF7A 3NM3A 3UWWA 3O8AA 1VHNA 1YTEA 1FCUA 1LYXA 2Q3OA 1KBIA 4N4PA 4BFAA 3HJZA 5AHFA 3QSTA 4X9SA 1VQTA 1P0NA 4O1DA 3M6YA 2WJZA 1LCOA 4O54A 4ORIA 2CWNA 2DJXA 4OHQA 2B7QA 2A7PA 4NU7A 4MUZA 2QR6A 1WYIA 1DOSA 2VFDA 3NPVA 2ZBTA 2WQPA 1PV8A 2CW6A 5DN1A 1HFBA 4JTSA 3BG3A 1KV5A 2YR1A 2WSQA 4JNMA 4K8EA 2J24A 3LXBA 4AB4A 4R34A 3G1VA 4PCFA 2ZTJA 4UFKA 3FEMA 3IRDA
chains in the Genus database with same CATH superfamily
2FHBA 3KBMA 4O15A 2PDLA 4FNSA 1EP2A 4I7VA 2DU2A 1EGZA 3SSJA 4M6UA 1SM9A 1DBTA 4DHGA 3RILA 3PZIA 3OA3A 3M43A 1K70A 1DWIM 4DO7A 4GUGA 3UXDA 3CXOA 1H63A 3JU2A 5FF4A 2Z7GA 5LHFA 1EWDA 2BZNA 1RZMA 2F8QA 3TSMA 3THDA 5HA7A 3BSMA 1OFQA 3BE7A 1X8FA 2PDYA 5FEWA 1C29A 3O6DA 5G2HA 1JULA 3TYUA 1CYGA 3ZS4A 4NKCA 2BX7A 2O9PA 3GAYA 2ZKMX 2D73A 1FH8A 5HQMA 3GDTA 2QNEA 4KS0A 3OJGA 1CXHA 4AFYA 4EF9A 4JIRA 3M0LA 4LYKA 1W9PA 5XINA 1EJTC 1K1DA 1MO0A 2WO5A 2FHCA 2VVSA 3SAZA 4JNZA 1PWLA 4AX7A 2VDHA 4P61A 2C1GA 3GH4A 4IP7A 3P6LA 3HPFA 4H6EA 4GA8A 3RJYA 1DJIA 1XP3A 2QCCA 1Q13A 1H7PA 5EBUA 3AFBA 4HOZA 2YCLA 3BOXA 3CPGA 3N18A 5I06A 1UH4A 1AJZA 1E0XA 3HPXA 1XW8A 1S2VA 5GNYA 5AZ0A 2PDBA 3GC5A 1Q85A 2DPEA 1GOMA 3UJ2A 3VCCA 1GORA 4B9YA 4IZGA 1EJXC 4B5NA 3SI9A 1H49A 1WO2A 3O06A 3W1LA 3OYZA 2PWUA 2JF7A 2FVLA 4NI8A 1ONEA 3LN3A 3W1NA 5AHIA 3T2OA 2XVPA 2WVVA 1JQXA 4QBXA 4QDMA 3HURA 1HXJA 2QT3A 5FKYA 3VNYA 4PMQA 3WQFA 5ABFB 4OFCA 2YCJA 1L6FA 5AOUA 4GO9A 2DSUA 1ME8A 2YLAA 2VFGA 2V5DA 5DLCA 5REQB 1ML1A 3WUEA 3A3HA 1PX3A 1W3JA 2D23A 5AC6A 3U57A 3HV9A 3VGEA 2RGLA 1T0OA 3GWQA 3KM8A 4B3ZA 4BA0A 3PP7A 1ZCOA 5HQEA 4R27A 5A8GA 5FJUA 2YGYA 3HM7A 1R87A 1R30A 2GVEA 3B8TA 4Q4PA 3ITLA 5F2GA 1DIOA 1TB3A 5GJPA 1RSCA 3FJNA 2QJNA 2J88A 4Y6GA 1KQZA 4XKMA 3AYVA 1EH9A 3BLEA 3WF4A 4DUXA 2Z1VA 3UZYA 3CUXA 1IEWA 3VMOA 3GNDA 3BAIA 3C5QA 2VFHA 3EBVA 4JYEA 1CBGA 4S38A 3BAKA 4ORMA 1HGWA 2AKMA 2DH2A 1UP0A 3SY5A 3K46A 1WAWA 4GIEA 1MW0A 3UYIA 4PB4A 4CNOA 1KM5A 4NXSA 5F1VA 4DLFA 1IF2A 2BDQA 2PWVA 3RR1A 2ACRA 3AWNA 1TX0A 3APGA 4U4MA 4NL1A 3WL0A 3W1UA 4IGNA 1TA3B 4Y90A 1L9WA 1EOMA 3SCQA 4KEZA 2OPJA 2YPIA 2J75A 2W66A 5FD0A 3TSDA 3TN4A 1F6PA 2D0GA 1F6YA 4X22A 5DMLA 1FBAA 3W28A 3GNOA 3S1GA 2INZA 2DP3A 3MMTA 3H8AA 1KFLA 4PUJA 1P48A 1AMYA 1QRQA 3G6MA 3KAOA 1W9VA 3UERA 3VILA 5BOOA 3DC8A 3W26A 2J13A 2ABBA 4PMNA 2DT0A 1WNOA 2VRQA 2E9MA 3RXZA 1Q2SA 3WLLA 1JVNA 2CC0A 3SURA 1PS9A 3QOMA 2J74A 3W07A 3LENA 4C6IA 4A29A 1O60A 3A9IA 3SUUA 3W1TA 3N12A 2ALRA 3G1XA 4K8HA 2XSAA 2HPIA 2J7GA 2O4MA 2GJLA 3EDJA 1DWGM 3NQBA 4ZB2A 3P3BA 3W38A 5J8LA 4UNKA 3QGVA 3FIGA 3B0XA 3BLOA 3MP4A 4LUTB 1JDFA 4FB7A 4KGJA 1JF6A 1RP8A 6ENLA 3GZ3A 1WKYA 3W7EA 4TV5A 3UG3A 1W1PA 4O0QA 1XL9A 2Z1SA 1XSJA 4LS0A 4HHHA 4M3PA 3WBAA 2Y70A 3E49A 4ADSA 3P8IA 3AMKA 3MMUA 3WDJA 3GVGA 3MKVA 1B3ZA 4ZE5A 2JE8A 3NCOA 4MAZA 4D72A 4KRZA 1J0KA 2P0OA 1CB7B 1CGTA 1PSCA 1S2TA 4NJGA 1ZQ5A 3UF9A 3UXLA 4IQDA 4LS1A 2XIJA 4BWLC 2CLFA 1A4LA 2NX3A 4D1JA 2PP3A 2CFFA 4FZIA 2WMFA 4FR6A 1NP2A 1PZ0A 3AYRA 3SUSA 1CNVA 2XGBA 4PL2A 1DWFM 4AVOA 4LCSA 1C92A 2BVTA 3WQEA 4MJ2A 1U5HA 3KVJA 1PL9A 4DI8A 1AQ0A 4S3AA 3NQAA 3ZLHA 2PA6A 2F9RA 3DBPA 3IRSA 3G8EA 3ZJKA 4PA8A 2FZDA 1G9HA 4X63A 5HPCA 1P6CA 1F8IA 4NX5A 3N9KA 3ES7A 1WX0A 1ISZA 4LF2A 3M0ZA 5EYWA 1E9YB 5FEXA 3CUIA 1BKHA 1YRRA 3ICJA 1KLZA 5CZSA 5G2IA 3W01A 3OB8A 4LFYA 5HATA 3VD3A 1M03A 3AHXA 3V1HA 1I0BA 1PTDA 4N42A 1E15A 1HJSA 2H8ZA 3EX3A 3M16A 3P5ZA 4OBTA 1RK5A 1IZKA 3KTSA 1GPFA 4WOZA 1W1B1 4XK2A 3QHOA 3A47A 2WVSA 3N2XA 3TONA 1H0GA 2C13A 1XUUA 3RPMA 4PTVA 3BDKA 4H6RA 4JFWA 4B5VA 4AZGA 1BG9A 4FI4A 2OO6A 3DYPA 1S2AA 3BSHA 4ZSTA 2VEMA 3GXNA 4MY1A 1X8CA 4DJEA 1OVDA 4IJCA 1EDTA 1AVAA 1LM1A 3QR1A 1H3GA 3EPMA 4Z1CA 5DCDA 3TFCA 1PAMA 5DRCA 3W87A 4O4WA 1LF1A 1E9IA 1AK5A 4K7YA 1HP4A 2R1MA 1BVNP 1UIPA 2XZ9A 4GZIA 3L7RA 3EB4A 3K8KA 3NEHA 3U5YA 4AD0A 1Y5WA 4N9DA 5IFTA 3T2PA 3R43A 3PFRA 1WE5A 4XZBA 4LU0A 4HU0A 1ONXA 2OMAA 1RPXA 4GBDA 1Q6CA 2FYMA 3UWVA 1Y0EA 3THAA 4K36A 1WZMA 3L5MA 2D1ZA 3HFYA 1KR0A 1YDNA 1EZWA 3HGRA 1W31A 3VX0A 3A23A 4WGHA 1SZFA 1LL6A 3ZJ8A 3LPPA 4JQ3A 3GKAA 3W86A 3BJSA 2Z2UA 3STFA 2NV9A 1JF5A 3IVSA 2EG7A 1Q45A 1UC5A 3G5EA 3C2EA 2CKSA 4QSFA 1QXLA 4X2RA 1ZHAA 4NZJA 2ZRUA 1JD7A 1Z89A 2BTMA 1F6KA 3LYEA 4IFRA 3W72A 1A5NC 3OW1A 4E5TA 1H50A 3CYVA 3A5VA 5DBUA 5A6TC 1YBQB 3NL5A 4A8LA 3ZMRA 5MKGB 3HMCA 1ZAJA 1YTKA 4LUSA 2J9ZA 3R5EA 3M0YA 4ERAA 4PULA 1D2KA 4HP5A 3PNZA 2CNCA 4HHLA 1QI4A 3EB3A 2EPMX 1N8FA 1B2YA 2GJXB 4GE8A 4XSLA 2P3ZA 1RJRA 2AL2B 3W7DA 4HIBA 1AW2A 2W4XA 1K8ZA 4H04A 3GBDA 5C2CA 3AXMA 3W1XA 3E2RA 3ARVA 1XIDA 5AC4A 3NQVA 3PUDA 1I2NA 1JXKA 2J78A 1XSKA 3P82A 4DBUA 3UPWA 2XM1A 1VPYA 4MKNA 4UQCA 1EF2A 3FW6A 4EE9A 1A5KC 1V0MA 2DZSA 4GPNA 2VNCA 2CHRA 4XVEA 1CCWB 4NQ1A 2R1PA 2XWEA 1V6VA 1RCOB 4ZO8A 1XIFA 4KBXA 3LCIA 3VAVA 3RLUA 4K1GA 3RUBL 1A5MC 4GZEA 3L5AA 2XN0A 3LK6A 2Z1WA 3OGVA 2JBMA 2D0FA 5DT5A 2HWGA 4CNNA 2GDVA 1JYNA 3HQNA 2QPXA 4LYPA 5F4XA 3U9IA 2ZDRA 4UFMA 3ANYA 3WEZA 2EHHA 4X60A 4G1KA 2XM2A 4GZJA 1GOKA 4M8UA 3VFLA 1YEYA 4TQTA 1O12A 1YXDA 1HW6A 3BO9A 3DHDA 1L6YA 1V6TA 5I78A 5F7UA 3OP2A 3DZ1A 3STGA 5AFDA 4AY7A 2PTDA 4Q8PA 5HPOA 3GUGA 2FMOA 4P8XA 1SO4A 2AMGA 2PRLA 3L4UA 1XRVA 4JTCA 2F6KA 2G5WA 1JPHA 4GHRA 1J0YA 5HMDA 9XIAA 4D6JA 1KV8A 1UOZA 1XSIA 1OF8A 2DH3A 4MJZA 1WKDA 4W5UA 3QVQA 1VC4A 3NYDA 5KMYA 5CBBA 8RUCA 1EYWA 3CUGA 1LQ2A 4P8VA 3T7VA 4AG0A 3ZJ6A 3VVGA 4QM1A 3AU2A 3CJPA 5E9XA 1DJXA 1TV4A 3G1DA 5CGMA 3GVWA 4MZ8A 2YBTA 4MVAA 2PDCA 2C0HA 3M5YA 1IV8A 2W91A 1DIEA 1RJPA 4KERA 1HIZA 4ZB5A 1A53A 2ZA1A 3GXFA 1TFVA 3DIPA 3P81A 3EAUA 4DPQA 8A3HA 2GWGA 3ZM8A 1CGVA 3ITYA 5HMEA 5IXEA 2ZRYA 3LXCA 1ZBCA 4YPJA 1RVKA 2YXGA 2PTZA 3JVAA 3UD6A 1YKWA 5E0KA 3AIQA 4A8NA 3AIUA 2ZQ0A 1UIOA 3R0KA 1Q65A 2POZA 3WLRA 1KTCA 3S46A 1IEVA 1V7YA 4O1CA 1XKJA 1WZLA 4HCLA 3OYXA 4XO7A 1CWYA 4H9YA 3S0CA 1U22A 1D3HA 3GE7A 2P8BA 4LRSA 2GUUA 5CSRA 1K9EA 4FMVA 1A5CA 2JEPA 3N17A 2CU0A 1YX1A 2ONEA 1SQ7A 4CD7A 1FWEC 1OCNA 2NZLA 1I2QA 2J6XA 3K4AA 1F3TA 4HK5A 3L4ZA 5C2GA 1ODUA 2E6FA 1EGVA 1UUQA 1Z41A 1QOPA 1PE1A 1UZHA 3AU6A 2VCCA 3GX9A 3S5ZA 4JHOA 3P8JA 1KLYA 1H7NA 1BSIA 1XIMA 4WY0F 2GOKA 3GXPA 1BG4A 3H21A 2HROA 2QCNA 4KWSA 1XDMA 4IFKB 6CGTA 4N6FA 1Z32X 1R9YA 5CG7A 2FGBA 4J3SA 1O1HA 5LNVA 1POKA 4FIRA 2RKXA 4JEQA 1W1YA 3K8LA 1ZCCA 3GY1A 4LGXA 3TP4A 3S2NA 1TWWA 3I7RA 4RW5A 1EQPA 3WNKA 1L6WA 5KETA 3WN6A 1HG3A 4NP7A 3QKZA 1A49A 4H9UA 4RE3A 4Z2HA 1Q6GA 1DWJM 3W81A 4GVIA 3OEXA 3H7RA 5D37A 2VJXA 4DWSC 1JCTA 1JI2A 3B04A 1Y8BA 3GIPA 1V77A 2BGNE 3FV9A 3S6DA 4MLRA 5LA0A 4H7CA 1NDZA 5K2ZA 3AIRA 2FFCA 3F4WA 4ZZ9A 3RFAA 1FH7A 4TU1A 3W02A 3LGEA 4WD0A 2XIIA 5FSEC 3QH2A 1W1ZA 3W7PA 3UR7A 1PYMA 3LCLA 1OX6A 1VBGA 3S2LA 2V63A 1W5MA 3PR2A 2GOUA 4GBUA 3WD3A 2ATSA 4AF0B 1FWRA 2WK2A 1V0KA 5M3WA 3VOHA 1M7XA 3DG6A 1W9DM 2WM0A 1N7KA 4IG2A 2UWFA 2CBUA 3CGTA 4IG2B 2E0PA 3W7IA 1PKNA 4QEEA 3GXTA 3C3NA 3DU0A 3W83A 4Q4MA 1LQAA 2FB2A 2FTWA 3HB9A 3SW6A 4LTSA 3AUJA 4LSBA 3IUHA 3GIQA 2Y8VA 3ITTA 4M7SA 2YL5A 4Q8TA 2XFWA 4NAFB 4XZHA 1MDRA 4O0KA 2Y89A 1PHQA 1NELA 2OLAA 1KR1A 1EFZA 1UPMB 2VR5A 4DBDA 4F9DA 1FCVA 4UOJA 4MZYA 3TYCA 3R58A 3ZZ1A 3G24A 2V5LA 3EMCA 3E02A 5F4WA 2YA0A 1SPQA 1SW7A 4MFEA 3B0PA 3VIPA 1KTNA 3XIMA 1FKXA 1RBOB 3WQDA 2OZ8A 2RDTA 3O6AA 1XC6A 2ACQA 3EKGA 4IOTA 4OV9A 4FXSA 3CO8A 2EXOA 5U7SA 4WDWA 1TTQA 4AVFA 1OF6A 4FLQA 1D3GA 1XFCA 1DJQA 3STPA 3F2DA 6A3HA 1W8GA 4BF7A 4MSSA 2HDJA 3B03A 2OFJA 3E5PA 3NPUA 3L2LA 3LI0A 3WMSA 3PZQA 1EO7A 4JDYA 1E1EA 4JKKA 4DJFA 4S3KA 4K3ZA 2G50A 2ZDSA 4NJHA 5TIMA 1NH6A 4HD5A 5C54A 2O55A 1UBSA 3VMPA 3VNDA 1XBYA 2QUUA 3UJEA 1EF3A 3TX9A 4QS6A 3W76A 2E09A 4GINA 3SRDA 1Z7AA 1Q6RA 3C0JA 4KWVA 2I7GA 1FWJC 4UNLA 5FEPA 1W6TA 4UQDA 3PZNA 4ZVJA 1TQJA 2NLIA 4G9PA 1C3FA 1QHOA 3TQKA 4HNLA 3PB0A 4HZMA 3UNDA 4B16A 4E2DA 1U1JA 4LH8A 3BARA 4H8VA 5BOEA 4BR1A 2PWDA 1W5QA 3KZPA 5BXSA 4DQWA 4FXRA 4IPJA 1E6NA 2VR4A 3STCA 4Z1AA 8TIMA 2O9RA 3RDKA 3W75A 3SDOA 2XG9A 4CQBA 1XLIA 4A3HA 4J3WA 2DZBA 4H83A 3T8QA 3LHTA 1C9WA 3GXDA 3G0XA 1XLFA 4IJRA 3K1DA 1V79A 3QPEA 3SCUA 3MCMA 2Y2WA 1H1YA 1VFHA 4XO6A 1YNPA 4XTDA 3PAOA 4AUBA 3QHMA 3HTWA 4HT3A 4LALA 4LWWA 4F0HA 3VE7A 1B54A 4DUOA 4WK9A 4TX9A 3MV01 5AYBA 3KOXA 4NSBA 3R1ZA 1ZGDA 4G2DA 2PUZA 1BEUA 1NOFA 2WHJA 1J79A 2X2GA 4I5RA 3CB3A 4GABA 1DJWA 3GD6A 5CPLA 2J25A 3LMYA 3C2OA 3FKKA 4AXNA 4C6KA 4O1AA 4Y9PA 3R89A 1TJPA 2JF6A 3NDOA 4PN2A 4MUPA 4PTMA 5DCBA 1NWSA 4IMEA 1M6JA 1C90A 3MSRA 4RL3A 1AZ2A 4WGXA 4LAOA 1J18A 2PDMA 3MPGA 1JPDX 3FHQA 4R53A 3FSTA 5CZJA 4EPDC 1UYQA 4HOWA 4GQRA 3CEUA 4N0RA 1N2VA 4LPCA 1QK0A 5CQ1A 1XLAA 3B9NA 1R2SA 4QG9A 5FEZA 5FIPA 4JGDA 5CPSA 1QNOA 1ADSA 4JL2A 1N55A 3TXZA 4JTIA 4F0LA 3WNMA 3NQMA 2OWXA 4NNCA 4EACA 5HOSA 1E6SM 4PFHA 2J9YA 3EDDA 3I3EA 4GXPA 3LTYA 3ERPA 3O6YX 3D3AA 1QO2A 4QJ1A 3TYAA 4A3QA 3XINA 3GG8A 1B90A 4PRTA 1FRBA 4QDPA 1E72M 3AHZA 4HN4A 4UMAA 1TWDA 1EWEA 5A2AA 4FNPA 2J6VA 3S5YA 2VCAA 5AC7A 2PRMA 3PUOA 4I8DA 4AC1X 4AXKA 1YE6A 2J27A 1K9FA 2XN1A 3V0UA 4C6MA 2CESA 3E38A 4V33A 1O5XA 1FHUA 4PB3A 4WY0B 1LTDA 4KETA 4IPIA 2WVTA 2H8XA 1QTWA 5CZTA 1QPNA 3GNXA 3ZJ7A 5I6SA 3UWQA 4QAIA 1GVRA 2PCQA 3FAXA 3TW7A 1RY8A 2XUCA 2V69A 4KFNA 4XZ9A 1WXZA 4I8YA 4IFOA 1WDPA 3RNDA 4HNUA 2LLEA 3G6LA 4GNKB 1GGOA 2H3DA 1GCYA 4X9YA 3CZEA 4FS9A 4PBEA 2NXGA 2OQLA 1V6XA 1UASA 2DZVA 3PBVA 3UR5A 1QOXA 4HSNA 4LNYA 4US6A 2A79A 1QW8A 4LNCA 2HBXA 1W37A 4AWUA 4J3TA 3W25A 4IIHA 4Z2IA 3SRFA 2E40A 3ARWA 2V38A 1PDZA 3EOOA 1H1NA 2O0TA 5D32A 4DEFA 4WXYA 4OGZA 4BQ5A 1E0UA 2QJGA 4AD1A 1W9UA 1TRDA 2CITA 3VD5A 4DWSB 4PFMA 1JNDA 2KZHA 3E0FA 3VOFA 4UQEA 2GL5A 5HWNA 3SRHA 1KFCA 2X0HA 2CZDA 5B7ZA 3KE0A 4LB3A 2HEJA 4N9BA 2PDHA 5GVJA 5A8NA 3H2AA 5H8PA 3QR0A 4HNVA 1J0IA 3TNOA 3L4YA 1YPFA 3OQEA 5E0FA 2B4GA 3VFCA 3H26A 3WD2A 2J7HA 5E09A 1S1RA 4XUGA 5EMMA 4UZSA 3S83A 1MRAA 2PU0A 4O1EA 4IMAA 4W8LA 2OGYA 2Y85A 3BZJA 4JTRA 3TZNA 1EJSC 1MUCA 4YL2A 3WLJA 1HKVA 4XKYA 2PP1A 1TG7A 3AZSA 3KP0A 3RU8X 5LIWX 3WF0A 3CPRA 4NZCA 3DECA 3LHVA 5SWUA 3M0KA 4ZA0A 4UQAA 3L2IA 3ARYA 1H41A 2XGIA 1VLIA 2OWWA 2ISVA 3NOYA 1HKJA 3B8DA 5ABHA 1G94A 2DZAA 5FJJA 3A4AA 3CZGA 2FZNA 4M24A 3ALFA 2VQTA 3MJMA 1A3HA 3AUOA 1VRDA 1TKKA 3TC7A 1V6WA 3KUMA 3BAJA 3MBDA 3QN3A 2ZICA 4MDPA 3SCVA 1EBHA 9XIMA 1EOKA 3BGAA 1OIMA 2ZZ3A 3WJZA 3GDLA 3M9YA 3D5HA 2YZRA 3HF3A 4LCRA 4Q8VA 3GXMA 5FJOA 2DZWA 2PDKA 2PDFA 2ZYFA 3I6EA 3CQKA 3HG4A 7A3HA 2PRHA 3E1F1 2PTWA 1I6NA 1XI3A 2Y24A 3UT0A 3QV8A 3OZYA 2VT0A 2J7EA 1QI0A 2CPUA 5I07A 4IF2A 1M3UA 4PMXA 3ARPA 3LTPA 3SJ3A 3CZJA 4N2YA 5DMNA 5FI8A 2FZ8A 2HVOA 7REQB 2PDPA 2DORA 5C9XA 3T0TA 1VP5A 1HJVA 3O8AA 4ZOAA 1VHNA 3EDKA 1J0ZA 1YE4A 4BFAA 3PPHA 3U3HA 3UR2A 3WH7A 3OTRA 1VQTA 4DJFC 2OQHA 2PP0A 2L5HA 4LUTA 4A4AA 2B7QA 3PJWA 4NU7A 4QGCA 1WYIA 4ATLA 1DOSA 2NVCA 2OXNA 2C1IA 4NHVA 5HMFA 1FWGC 2ZBTA 2CW6A 5T8GA 1HFBA 4JTSA 4RDWA 2J24A 1SVDA 3LXBA 5EBAA 2QQ6A 1UMYA 4UFKA 1O1ZA 4E8DA 3IRDA 1X6LA 5A69A 4REQB 1KO0A 1H2JA 4ADUA 3VUSA 2EKCA 3GXIA 1MEWA 3AYSA 4I7WA 3TTSA 3FAWA 1VFOA 1AW1A 2CLMA 2YLLA 1YNYA 1F3XA 3NDZA 4Z2LA 1YYAA 3M47A 3AZTA 1QW9A 4S3JA 4AIBA 4TIMA 5D2WA 1RXOB 4RZ4A 1UBPC 4QFUA 3TYZA 3IJQA 1UR9A 1NWUA 4PCTA 2FMNA 4GACA 1H60A 3EZ4A 5HR6A 2VX4A 4JQ1A 3LPFA 5HJLA 4NZ1A 1VYRA 1A5BA 3CB8A 3QJAA 1R2RA 1VCVA 2J9XA 3PULA 4MY9A 3NQ2A 4GKLA 2ACSA 2XDFA 1E3XA 3IEBA 4WKHA 3SFWA 3VOJA 4C1NA 1VEOA 3VYLA 4W7UA 5DFAA 1DJYA 3LLFA 2OEJA 3UR8A 1QHPA 5HXMA 3MKCA 3A13A 3CBWA 3IACA 3S1UA 3EYPA 1ZJIA 4Q6XA 1B4EA 2ZA2A 5D9PA 2WZIA 3GHUA 3UNTA 2A3EA 2GWNA 4KIRA 1FDYA 1IEIA 4GQGA 1XYAA 1K7EA 2X30A 4BCEA 1HP5A 3AIEA 3MMDA 3N2TA 4MTVA 3CEPA 3UP8A 5A6KA 4Y9AA 4FO4A 4J5NA 3EWCA 1AH3A 3WUBA 1T7LA 3WELA 4HJWA 1AQFA 1QI5A 3KCOA 4XTIA 4U28A 4FP1A 1P7TA 2VZVA 3IANA 1HJQA 4IUOA 3H4GA 3VGBA 1FXPA 4KWUA 1VH7A 3U8GA 2BG5A 3R8RA 4ERIA 1ZRQA 2WXDM 3WJWA 1VFTA 4HU3A 4GI8A 3SCRA 3SBFA 3R11A 3N11A 3W7KA 2EBNA 4WJEA 1LOQA 1US3A 2E6YA 1EA9C 3G77A 1E9LA 4E0CA 2PCEA 3LHUA 3Q4DA 3IIOA 3CQJA 1UKPA 4UNIA 2VOMA 2OVLA 3TK7A 5AKQA 3AWOA 3MB9A 1W0MA 3GQYA 3BZGA 4JZ5A 3RLHA 1OGBA 3TQ0A 1XIEA 3AALA 1H7RA 4GNJA 5HR7A 2V5JA 2HVNA 2OR2A 1JUEA 1LUCA 2IQTA 1S5TA 1JDEA 2J66A 2WCAA 3BCJA 2JIEA 4KH2A 3KVLA 1C8QA 4GC3A 2VZTA 5LNWA 1MZRA 4KCUA 3U0HA 3RCNA 4QJ4B 4GYPC 2PDXA 3ECQA 3OZPA 4UR8A 4HPJA 3CQHA 2DIKA 3ARSA 4UOQA 4EOUA 3EX2A 4TX6A 3HGSA 3AS1A 1UWSA 4AZ5A 2NUWA 4TV6A 4JFUA 3V18A 4PRRA 3KLLA 2F7FA 1TX2A 4PB5A 4H4IA 3SQSA 1TIMA 5H1WA 3CIWA 1KGWA 4CD5A 3CQ0A 3VGHA 4IISA 2PC4A 4GX9A 4O1BA 4LBRA 3H4WA 4ECLA 3QM3A 2I9EA 2A7NA 3LBCA 1GW1A 1Y5VA 1UJQA 3MHFA 4NRRA 1C9DA 4YS1A 5T26A 2XFYA 1LBFA 3PS7A 1S39A 3WMLA 4EANA 1YPIA 4O10A 3KOYA 2CHNA 4LJ3A 1S2CA 1TTPA 2EEXA 4DBEA 3PG8A 4WR3A 1QCWA 4C6EA 5K7JA 2HV5A 4P7RA 2E4TA 1NARA 3K13A 1TZ7A 1J2WA 3TTOA 1RD6A 1PCKA 4DPPA 4A2RA 3TTYA 3MHGA 4JQAA 3DI0A 1QO5A 2VEIA 5FF3A 1TREA 5JXQA 3RLGA 1D7FA 4YU1A 4D6IA 3HA1A 4OKDA 1OGGA 1ISYA 1VKFA 3TCSA 2XH0A 4R5EA 1KBLA 4DYJA 1JL8A 3W2KA 2Z0IA 4XAZA 3AXKA 1T96A 4K1WA 4ZOEA 3B8VA 4LQ1A 1MXGA 3SUTA 1B9BA 2F61A 3EEGA 4TMBA 4DB7A 2EQDA 1V0NA 4NAEB 1OC7A 1BQCA 3KW3A 4I90A 4JHMA 3WK1A 2DV0A 1H0IA 2G3NA 2ZWYA 1E71M 4L9YA 4GI6A 4MIMA 4F0RA 5JIPA 4U3AA 1EIXA 3TV8A 3USBA 4YTRA 3CLWA 1DORA 3WFLA 1PX4A 2IXVA 1LRTA 2E1WA 7CGTA 1PHWA 2HE8A 3LU2A 1S3TC 1TPDA 3V0TA 3KRZA 1W3HA 2BB0A 3AOFA 6XIMA 3RLVA 3F5JA 3H53A 4XAGA 1F76A 3KS5A 2RAGA 3B06A 3KWXA 3RK8A 1UD4A 1GQJA 5H91A 5AHLA 4H2HA 1B9ZA 2REQB 1ZZMA 2H3BA 3W73A 4OV4A 4E2OA 3RHGA 3BMXA 2YJQA 1IYXA 3W2UA 3O6CA 2PBOA 3W29A 4ZODA 4Z0SA 3PM6A 5XIMA 3SR7A 2Q6ZA 4GRSA 5BNKA 3GUWA 1UD2A 4WEVX 2XH7A 4GOAA 1RQEA 2VTFA 1HF6A 1W1TA 3ZOAA 3W7LA 2XFFA 2I16A 3TN3A 3VC6A 3KRUA 3IARA 2V3EA 3MU7A 2TODA 5IBXA 3PZMA 1PIGA 4PUUA 3QW4B 2TAAA 1BVWA 2NXIA 4ROQA 3I4EA 4CNTA 5G2WA 1G5AA 4M51A 5D30A 2D3NA 2IS7A 3V75A 3W24A 3SIZA 3EX4A 3II1A 3LPOA 3H2EA 3UQNA 4KEMA 1CX9A 1QUMA 1V08A 1KRMA 1XLEA 1G7VA 3G1SA 4GY7A 3UEQA 1EIBA 4KW2A 1P0KA 4MPKA 2AAAA 3QQ0A 2E28A 5B80A 1TCMA 2PLJA 1W3NA 1GJUA 3WX7A 5I2UA 1JCMP 3U5UA 1XUZA 4UZUA 2BV9A 2VR2A 3MI3A 3TA9A 1E1CB 3UZZA 1K7XA 1JUKA 2X0YA 1TPB1 3BG5A 4F40A 4M6VA 3L0NA 3RR4A 2QUVA 4J2MA 1I75A 3WQCA 1DWAM 3BQ6A 2J8TA 1JI1A 3BWWA 1GOWA 4XZWA 2ZXDA 4KWOA 3WH6A 5EU9A 2PD9A 4IUGA 1BRLA 4C6CA 1JAKA 3W70A 1EA0A 3UBPC 3FS2A 3L5LA 2NQ9A 4FIQA 3PUGA 4AY8A 5M17A 4MB3A 1I45A 2B81A 1B0IA 1IWBA 1A80A 2WOQA 3G22A 4K68A 4Q22A 2H90A 4CVWA 1IXQA 1KWGA 2J4GA 5AC8A 1VHCA 4DN1A 4DZHA 1KD0A 4HPHA 4V27A 4RDYA 2OELA 3R8HA 2R1KA 4OU1A 2QXWA 3L9CA 2YA1A 4DY1A 4QXIA 3RM9A 1Q6OA 3FA4A 3A12A 1HVQA 3AISA 1MRQA 5J5RA 3I4KA 3GFXA 7TIMA 2P1FA 4F4RA 1ZENA 3M5ZA 3BV4A 4CCEA 2P8CA 3GNPA 1SFJA 4BEQA 3ZQ9A 4GK8A 4WLCA 4MNKA 1OGSA 3VDCA 4NZFA 2Z1BA 1OFDA 3WJXA 2R1NA 1A5UA 3OODA 1UJPA 1DHKA 3ARQA 5C6MA 4JTKA 2BP1A 4GMEA 1US0A 4LY4A 5IRPA 1Q7MA 5EY5A 3IJ7A 3N4EA 3WQ6A 4DI9A 4HYRA 5ABTA 1LL7A 3MMWA 1IZCA 3ZT7A 1NIUA 1XX1A 4YVPA 1MQPA 4X3ZA 3VOCA 3CV7A 4Y9OA 3DHUA 3VI2A 4KT2A 1ADOA 1YMYA 2EPOA 3DOPA 2I1OA 1RH9A 1VBJA 4RE4A 5CJNA 1L8NA 3DAQA 4MPQA 1KB3A 3H7UA 3WG6A 1LORA 4TUFA 1QNPA 2TRSA 5I03A 2Q8XA 3W1PA 1DPMA 3VCNA 1DTUA 4J27A 3KDOA 1AH0A 4JN7A 4EAYA 3PBMA 1ITQA 2V5KA 3HG5A 1AG1O 3CV6A 1OCQA 2GFTA 3MSDA 3ORWA 3LV6A 4JX6A 4C6PA 4G5DA 3VTRA 3EX1A 4H6KA 3T05A 1LUCB 3P62A 1TJRA 4I3GA 1NAL1 5A8QA 4RX0A 2QPSA 3H55A 4OT7A 3LPGA 3R13A 1VPQA 5DRIA 3B0YA 2WNQA 1IHIA 1VF8A 4Q4QA 4HCDA 2XH4A 2GGIA 4N6EA 1CECA 4DJED 3M64A 4JDBA 1HO4A 3W74A 2Z24A 3AIVA 5I0DA 5C7HA 1CGUA 3ARXA 5GJMA 5D2VA 3TN5A 2E7FA 4JPGA 2AGTA 3ANUA 4J3ZA 3PC0A 3NSNA 5D2TA 4UTUA 3PJTA 3NNTA 4ICMA 2FB3A 4HJFA 5FF2A 5FJIA 1XPGA 2OGJA 4JCLA 2E9LA 1CXEA 3E0VA 4XAPA 2PDIA 1FWBC 1F3EA 1DL3A 1RR2A 4OOUA 5HK4A 1B3WA 2Y7FA 1SJBA 2PF0A 4XUYA 4RCXA 5ABEA 1Q7ZA 3TVAA 1TPC1 1US2A 2VEFA 5C5YA 3F1QA 3FK4A 1W54A 4UTMA 3CV1A 3FJ4A 5JBEA 1PVNA 4G56A 1E70M 3AAMA 3M0XA 1O66A 3VKAA 1ALDA 1Z69A 3QMSA 5CCZA 4ML4A 2NT1A 3VIIA 3GFZA 1P1MA 4XD4A 3SN4A 2P10A 2I5GA 1K4HA 2TSYA 2JGQA 4O28A 3C86A 3ABQA 3IJ8A 2V3FA 5LIYX 4UTWC 3VIHA 3DI1A 1ECQA 1OWQA 4G7FA 3IGSA 1TJ0A 4GYJA 1BSLA 2G41A 4FXJA 5FESA 4JD4A 4GY0A 1I2PA 1JCNA 4EWJA 2A4AA 5DY3A 1QR7A 3PBGA 4C6QA 2YL8A 3C4UA 1KRAC 2OT1A 3QSRA 3DFYA 3EX6A 5F2LA 1J12A 2J62A 4B2DD 1VJSA 2QDDA 4DXKA 2QDHA 1RCQA 3S6OA 1TMHA 4W93A 3P14A 2BS9A 3DDMA 2WW5A 4HA1A 3PVFA 3VKDA 1I1WA 2ZTKA 1AJ2A 3E0WA 3A3WA 1K9DA 3N73A 1UR2A 1QI3A 4HA0A 3EWXA 1FWNA 2PPGA 4IPNB 3CTLA 3BANA 4AD5A 2Z00A 1R85A 5A6SA 1VYSX 1Z6KA 5DBTA 5D04C 1JRCA 3MDUA 2X41A 2JIWA 5AC5A 3TJLA 4XD5A 4RK8A 1LWIA 3CHCA 4L65A 1E3ZA 4KKXA 2Q8LA 2OODA 2IQ0A 2PLKA 4LV4A 2PGRA 2ZWZA 4KPLA 1E5JA 4C60A 4DXVA 4S39A 2KX9A 1SUXA 3WEMA 4EP8C 5LHEA 1GTHA 3ARRA 2BHYA 4GNVA 7ODCA 1OM0A 4ZQOA 5A6JA 1WZAA 1IXNA 1WDWA 1U83A 3M5XA 3TSBA 1Y7VA 3CU2A 3OGSA 1R3QA 4UTTA 5D09A 1LJYA 3C0LA 2BLEA 5EKYA 4QLJA 2J8FA 4OUIA 2C16A 4LCQA 5IFPA 3K2GA 4N9CA 3UGRA 3FJLA 4S3BA 1BYBA 3GR4A 1PIFA 3QC3A 3LSCA 1FCQA 4M29A 4UMCA 4CD6A 1FQ0A 5LIXX 1VCFA 1TWSA 1PIIA 3QPZA 3THUA 5A2BA 1Y65A 3R0UA 2VQUA 1R2TA 4J3XA 4J2PA 3VDHA 1A47A 1FDZA 2ACUA 3REQB 5D2YA 4HQVA 3LCGA 3NQ8A 3WK0A 1CXKA 4R88A 2YCIX 3T40A 4O4VA 2PMQA 1UROA 2VC5A 3VIOA 2YA2A 3T4WA 1KXHA 3FHAA 4IQLA 1NY1A 3C0SA 5BMWA 4B92A 3R4IA 4Z42C 2E8YA 1G4SA 4PYSA 1XGZA 3RAOA 3JRKA 1ADDA 1ODZA 3W00A 1IIHA 3TIMA 4O8RA 4FPSA 1BHGA 3VOIA 3H4XA 1TIWA 2J47A 4RKAA 2DSWA 2Q8ZA 5HANA 3QV7A 3F4CA 3MZ2A 3VE9A 4INFA 3KCJA 1XDJA 1UWAA 3V35A 2ZXBA 3LTSA 2VRJA 3CUHA 1O68A 3PAJA 3WMBA 2ZVRA 4LYRA 2PTXA 5BXPA 2GJPA 4CCCA 1OG6A 1MW2A 3LZ3A 1XLBA 4L61A 4LVFA 3URBA 4O8AA 4PZVA 1EC7A 2CXEA 5F2MA 1E1FA 3GHTA 3N6HA 2FPVA 2WB5A 4J9JA 4BI6A 4MB5A 2FH8A 3S47A 4LVAA 2Y6ZA 4CCDA 4IMGA 1GTEA 2ON3A 2OT0A 4JICA 4IGMA 3S1VA 2YZ5A 2GJNA 3TOYA 3KHDA 4GJJA 3B05A 4J4KA 4IX2A 3B9AA 3PTDA 3CIXA 4DZAA 1NDWA 2Z1XA 1OCBA 1DKWA 1G1YA 2OEKA 4YCPA 1WBHA 4RJEA 1S2WA 2WSPA 4RNHA 1NEYA 4W8BA 2VO5A 1TPVA 1CLKA 2WANA 1ZB5A 3PK7A 3CS2A 2C14A 2QLYA 2NWRA 2WM1A 3BMWA 4CUCA 4M80A 4ZOBA 4JKLA 3GIYA 3CT7A 4C1KA 2XSBA 4ZQRA 2WYSA 4QG6A 2QPUA 2NLYA 1F3WA 1J6PA 5JIWA 3JUGA 1XBVA 3W1QA 3E2SA 2DZXA 8CGTA 4ZOCA 3S6TA 3T07A 1DEDA 2VP8A 3FXGA 2WNNA 1W5OA 5JH2A 5I77A 4GO8A 3EKZA 2P3EA 1J96A 4K8GA 1G01A 4CEUC 5G4EA 1QHZA 1VRXA 3BW4A 1DXEA 4XBSA 3I10A 3BLLA 3BLDA 3SIMA 1XH2A 4XSMA 4MG4A 2ISWA 1GONA 3GH7A 1U5JA 1M1BA 1GVOA 3ID7A 1RALA 1AZ1A 1TRIA 4RDVA 3BSGA 3V7PA 1NP0A 3EWZA 3FXYA 1UUOA 3OVGA 2EPLX 1IGSA 4XIAA 4KRUA 3BVJA 2VENA 1G4EA 5JU6A 5I3JA 5ENLA 3P67A 1XYMA 4TMCA 4XAFA 1SO6A 5DXXA 3LG3A 1JCXA 5KZMA 2V82A 1UZ4A 3TWBA 3PZUA 3VD7A 4I5XA 3IK2A 1XBZA 4JTUA 4CLMA 3VC5A 2H9AA 3LD5A 2E1DA 2JKEA 5D2XA 3NZ1A 3PTKA 3MSGA 4ES4A 1SFTA 4LAMA 2CBVA 4JTEA 4F66A 2VDGA 1I60A 1UD8A 4JTAA 3I6TA 3W6YA 1EKOA 4IIFA 1OZQA 4I9AA 2GQ9A 1JGIA 4W88A 4CCZA 4IMFA 3ITOA 4KFPA 1XLJA 3NXFA 1RLCL 5A1AA 1GVIA 2E68A 3BH4A 3LY0A 2V81A 2Y7EA 4DJDC 3J7HA 4O1FA 5H2ZA 3UA4A 2G3JA 3TCEA 3GVVA 1Q2RA 2FZ9A 3FDGA 4FAMA 4I5UA 3GTHA 4R7OA 3MWCA 5A6BA 1WUFA 1OFPA 1P0EA 2XIOA 4R3UA 1M9HA 2ZFAA 3IIPA 1PXGA 4ZO6A 3OLGA 1BD0A 5F1UA 3MYOA 3NGJA 4F48A 3BGGA 2H6RA 2X1IA 2ZXQA 4PODA 1CGYA 3KEHA 3WLQA 3BICA 1MNZA 4UTWA 3VMNA 4A8IA 4O11A 4AC7C 4O50A 1HL2A 5ABGA 1DJHA 1UR4A 5E0CA 3MKKA 1C93A 4RLIA 4D2JA 4AD4A 3CTTA 4M19A 4IH3A 4GD0A 4RDZA 3WD0A 4LF1A 3STEA 2ICSA 2V5CA 2UZ9A 3T8LA 2XIQA 2V67A 2A2IA 2E67A 1ONRA 2C8NA 1EJ7L 1RQBA 1E4MM 1HN1A 1ZBVA 4HGXA 1H5YA 1TO3A 4AWSA 2XTKA 4C7DA 3APTA 3BW2A 3L4TA 1EHNA 1TJ2A 1IWAA 4NT0A 3KOWA 3Q2DA 4B5TA 3WBYA 5BYWA 4LUYA 5MKGA 3KS6A 2HS6A 1KXQA 2QZRA 3C2VA 1EEPA 2DW7A 4M6QA 3BAXA 1XIHA 2WVUA 3G18A 2VEGA 2WQDA 4Z2JA 4ERGA 1RV8A 2JKPA 2WC3A 3B0VC 2ABAA 4ROPA 3EMQA 2BFGA 3NIYA 1E0WA 2R94A 2R14A 2O7SA 3EWWA 2HS8A 3WDHA 2PB1A 4AU0A 4XVDA 4L4OA 3ZWTA 3H2CA 1OSEA 3TDFA 3G0UA 5GNZA 3BQ5A 1CLXA 4YTTA 5KINA 1ZP4A 4BJHA 4M81A 4AZBA 4LVBA 2A3BA 3KBJA 3I65A 1NWTA 3S5NA 4MWAE 3G1HA 1ISVA 3AJ7A 3CQIA 4Z0JA 3D47A 4L1GA 1HJUA 5EMKA 1JDDA 5LNUA 1AD1A 2XVKA 2VELA 2PDQA 4MWAA 5H8UA 3EB2A 4NRSA 3RPDA 4M0XA 2G8ZA 1GVYA 3FCPA 4PMZA 4M7TA 1O4UA 3CAWA 4ILSA 1PPIA 2EGZA 1C8YA 2XWDA 3N25A 2DUAA 4GYKA 5I23A 4P7QA 2HRWA 1PWMA 4GYFA 2NQ5A 4M1BA 1K8CA 3TN6A 3NJ3A 3LRLA 4MKVA 2WLZA 4RZ5A 2QCGA 1EBGA 4W84A 2CZEA 1RUSA 4AAJA 4JBRA 5EGRA 4UTKA 1ZSXA 4D6DA 1QPQA 1JNEA 1PTAA 5CC6A 1XPYA 3RO8A 5C9WA 2YDSA 4HB7A 3B8IA 1A5OC 3B4YA 4FNQA 1QPKA 3EXSA 2B0MA 3WKZA 4Z2KA 5IDZA 4C5YA 4HA4A 3NG3A 3TEVA 5F4SA 5BRQA 3WH5A 4PRWA 5M2FX 3BGJA 5G1YA 4LW7A 1B4KA 2QULA 5GNXA 2G95A 1MQQA 4AZ7A 2Z6IA 1XCWA 2HCVA 4DJFD 4NZ3A 1LBLA 1JYXA 2X1RA 1ISWA 3RG6A 4DAIA 4OWGA 2GSEA 1NOUA 2PURA 3H2MA 3W82A 1AL8A 3QZ6A 3EDFA 3N15A 5HUPA 1YW1A 3UXAA 2VHLA 2C79A 2NX9A 3RF9A 3IIXA 1UB3A 4DVOA 8XIAA 3IIVA 3PZTA 4IMCA 1TZZA 1ZPTA 1K4GA 4F2BA 3CHDA 3I3DA 5EL1A 1IT8A 2J7DA 2PDNA 2FGLA 3SCOA 3B9DA 5BRBA 3KOFA 3HO8A 1MMFA 1E43A 5FJRA 1IQ8A 3TTEA 3S8HA 1TWIA 1LDCA 4IHCA 1E56A 2W27A 4F2UA 4E6MA 4ZMGA 3W7NA 3QF0A 4IGHA 3IJDA 3QTGA 1JFXA 1JZ2A 3V5FA 1OIFA 1DQWA 4XD6A 1K77A 2XPKA 2Y8UA 1K7FA 5MF5A 1TR9A 4ZR8A 1MNSA 1L6SA 1K8XA 4QROA 4S2BA 5CC3A 3WZ0E 3W2JA 1TUXA 3KVMA 5G4HC 4UOZA 1XXXA 1S1PA 3IJ6A 4JFTA 1FWSA 1KGUA 1E4NA 4XZIA 1UG6A 5HWJA 3O05A 3CWNA 3U4FA 1KNWA 3V5OA 5HNRA 1NFPA 2GVJA 4RUBA 3UWYA 5BWAA 1RQHA 1F73A 3VKCA 4GISA 4GFSA 4LC8A 3BAYA 3SN1A 1P4CA 2OKOA 4AD2A 2YCKX 1ZTVA 2ZCGA 3EOLA 3TA6A 5E70A 3G0SA 3CL6A 4ZE4A 5EMJA 2PDWA 4ADTA 4RPQA 2CZVA 2FJKA 5A8PA 4WDTA 4Y9NA 1Q63A 2EG8A 3KHJA 3KL5A 2QV4A 2PS2A 2QCEA 4KESA 3NZQA 2VI0A 3K30A 1DJNA 4UTFA 1HX0A 3C8FA 4PSPA 1PJ9A 3QY6A 3NZPA 2QS8A 3DGBA 1JQVA 2RFGA 3GDKA 3T0AA 1CW2A 3KRBA 1EB3A 4QS5A 1GQNA 3KBSA 1FXQA 2QAFA 4UCFA 5E6ZA 2W3ZA 3QR3A 4PTDA 4UXDA 3AXXA 3FN9A 4CQCA 3V0SA 2DY3A 1YTEA 1FCUA 1LYXA 3N2CA 1BGAA 1KBIA 4N4PA 4X9SA 2WJZA 4ORIA 2DJXA 4OHQA 3ITXA 4GI4A 2BODX 4I6KA 2OYKA 1KBKA 1D7KA 4B5UA 1Q4WA 4PUKA 1XGDA 3NPVA 1KWKA 3N04A 1XS2A 1KV5A 2ESCA 4IP4A 1L8PA 1UH2A 1XQLA 3G1VA 2ZTJA 2HXUA 1NWRA 1XINA 4S3GA 2DZTA 1EUNA 1EPVA 3LRMA 1NDYA 1DIDA 3BC9A 1J11A 1NM9A 2QHAA 1IEXA 3W1RA 1X1OA 4WSHA 3CUFA 4TX8A 2DSKA 4E4PA 1V3JA 2DZPA 1VFSA 3PBWA 3GHRA 3SUVA 3WNPA 2E77A 2C0AA 3CK5A 3SGUA 1D8CA 1GNXA 1NTHA 4DJDD 1X7IA 5FJTA 3VIMA 2Z2BA 5A8OA 3AIBA 3H24A 1WKEA 3W9ZA 3EWUA 3EA2A 1WB0A 1XC4A 1ZJBA 2QIIA 2WHKA 4AWEA 1JGMA 4WIWA 4Y9MA 3W4RA 2E8ZA 4XIMA 1V7AA 1PX8A 1KGXA 1EGMA 1R47A 4L4MA 1XD1A 1R7OA 4Q8QA 1K9TA 3WL1A 1AMKA 4TTUA 1VPXA 2YYUA 3KCLA 5CPOA 1SR0A 3UFYA 4RZBA 4UR9A 4XZMX 5I3FA 1BXCA 5D05A 1KM3A 5ECVA 2VWTA 2G4FA 2HK0A 1EYEA 2FTPA 4CQ8A 3DN5A 3RRXA 1RJQA 4CQ9A 3T9PA 3TU9A 4BQ3A 4K6AA 5CSYA 2WCGA 3GG0A 2IPWA 4PMVA 3COTA 1CEOA 4WRHA 3MYPA 4O53A 2VC6A 1LRNA 2G3MA 1E6QM 3C2FA 3T81A 2RHGA 1VEMA 3TJXA 1TSIA 1KKRA 5BWFA 4I9MA 1BLIA 3RO6A 3EWDA 1Z3NA 3ENLA 4LEFA 4ZSUA 4UTIA 3MS8A 1R7AA 4MB4A 4WKFA 4JTTA 1LP6A 3NM1A 2WZHA 4PSRA 1A3XA 2GUYA 2O56A 2JALA 2VD9A 1RA5A 4GJIA 2Y5JA 2CLLA 2WZTA 3SQLA 4AZHA 3M0IA 3GU9A 5M03A 2DIJA 4NI3A 4DNHA 1ITXA 4AYSA 3FYOA 4HU8A 3NL2A 1KFEA 2DVTA 1G67A 1UZDA 1K03A 1BXNA 2A3HA 3ITVA 2X1SA 1YLVA 1CENA 2PZ0A 1BYCA 1OC5A 4GVHA 4F9JA 3IWPA 2ZUSA 3WLTA 5HNUA 3GR8A 1WDQA 4M82A 3M0HA 2PWEA 4ZEPA 2VURA 4Z1DA 1TVPA 2V3GA 3B8SA 3EXTA 4O12A 1TMQA 2Q71A 4U10A 2A85A 3KBVA 3EXRA 4FX8A 3G8RA 2W63A 1HJXA 4Q8NA 3TC3A 3O15A 2DW6A 3WD4A 1LWJA 2VZUA 2XISA 1DP0A 4JTJA 1A50A 3ATYA 4J7RA 2BWGA 3CUZA 3CLMA 1OFBA 1KM1A 3WNNA 4G6CA 1XR2A 2ZZ7A 3NYZA 5E6YA 2FQIA 4OVXA 4H00A 4LY8A 2WJDA 5KTLA 4XISA 4YJ5A 2VUNA 3S5SA 3UY7A 3ES8A 2D0HA 2V8ZA 1XLMA 1H7OA 1CPUA 1OG0A 1E6RA 2ISSA 2ZOXA 4GC4A 1TV2A 1TQXA 3T4CA 1EP1A 5EMLA 2PF8A 3AO0A 2E5CA 3TJ4A 1Z9AA 2EG6A 3MHUA 2PLMA 4L64A 4FXFA 2Y8KA 2WKJA 2IKGA 3ABRA 5AVNA 5LNSA 2X40A 2ZUVA 3MUIA 5H8MA 1K8YA 3ABOA 2R91A 3HV8A 3JR2A 3T42A 1DXFA 1HKIA 3K4WA 4NZ5A 3UVIA 1E55A 3ZT6A 3NQ7A 4WUIA 3TYBA 2GVYA 1N82A 1W9BM 4HHMA 1KCZA 3MCOA 4AMAA 5HMSA 1I1XA 3N6JA 4K38A 4J40A 3NAVA 3OHMB 1LZOA 3R7MA 2QF8A 1FWIC 3LS9A 2QGYA 5LA1A 4IIGA 4W86A 5PTDA 3O0FA 1OT1A 4D71A 1POJA 3DC0A 2J7CA 2WJFA 5CEWA 5E93A 2G96A 4WJXA 2CBIA 4HK7A 2GQAA 4HVXA 2YSWA 1JCJA 3W7CA 2GGEA 2WZEA 2VFIA 4QNWA 3UXKA 5I7GA 4F79A 1ZP3A 4AIOA 1H61A 2C91A 2CLHA 4S3EA 4GUFA 5DMYA 4MADA 4XD3A 2WHMA 4L9ZA 1JAEA 3CMGA 4J35A 3WDRA 1JZ6A 2CXGA 3DFHA 5GPRA 1R3SA 3P80A 2AQVA 3N14A 1OK4A 4JY9A 3IVUA 4YXGA 1QJWA 4PBGA 4DYEA 1PDYA 3VO0A 4ZBCA 3QFEA 3POCA 5FA5A 4UFLA 2YFOA 3B40A 4KGLA 1UWRA 4ZO9A 4TR9A 4BEUA 2VMFA 4XZLX 2Y62A 3WQGA 3DERA 1XD0A 1JZ3A 1EDQA 2BHZA 3MZNA 3WF1A 2WSKA 3WDIA 2X1TA 4DAFA 3TYEA 4C6JA 4GGBA 2SFPA 5J5DA 3ME3A 4O0ZA 1WXYA 2Z2AA 3VZXA 4A2SA 1DQXA 4MB1A 2FKPA 3U4AA 3RGTA 1DIKA 1J4EA 4S1FA 3NURA 4PMUA 5KSWA 4Z2GA 1D9EA 3H23A 3NQEA 4D8AA 1RAKA 2OZ0A 3NUKA 3E2QA 4MAVA 1MSSA 1KFWA 1ME9A 2JEQA 4GWEA 3QHNA 3IJ9A 1X1ZA 3OIXA 1EXPA 1TVLA 3ZYZA 1HL9A 1MVYA 3ZFHA 1JCYA 1XLLA 4LAUA 1QFEA 3ISIX 4PUDA 4W8AA 4ZTXA 2WV8A 4L1WA 3OPSA 4DUWA 3CL8A 3TYDA 4WDXA 1J0HA 5DF0A 4B4HA 3FKRA 4DWSA 1OABA 4D8ZA 1JEZA 1SW0A 3WMCA 3O3RA 2VGIA 2ANUA 1QT1A 2YKKA 2C1HA 3BLKA 4ZENA 1OX5A 5AYXA 4DNMA 3B8UA 2FDMA 2GSJA 5DO8A 1FUYA 4HBKA 3WLNA 2YX0A 2BMBA 4M6PA 5DELA 3NA8A 1S5VA 1JPMA 2DFAA 3SZ8A 4UTLA 3V4BA 4JIHA 2X42A 3OLEA 4GG9A 4MJMA 3VKBA 2G37A 3WLIA 3GU1A 2X7VA 2CETA 1S2UA 3LCWA 5KZDA 3MP3A 3IGHX 3HPSA 4JIQA 1YNQA 3JZUA 4IQJA 3E5BA 3UZXA 3BTNA 3HPAA 1OX4A 5AN7A 3OGRA 3Q67A 3GTFA 3WBWA 2QVNA 4CQAA 4F0KA 5AZ1A 1ZJAA 3MBFA 1BYAA 4C7GA 3W3OA 1TPFA 1IE7C 4JYFA 1QWKA 3CC1A 4GVGA 1H62A 4YWIA 5TQLA 1JZ7A 1TELA 3B4UA 1HL8A 1ZBKA 4L4LA 4LUIA 4WY0A 2Y7DA 1GW9A 1H7WA 4UTHA 3TQPA 4AX6A 1J8VA 2X05A 1TTIA 4A8RA 4DZ5A 4DF2A 2QUTA 4JEJA 1BGGA 1QU4A 1YXYA 1TVNA 2HXTA 5M1TA 2GGGA 1Z42A 1VB9A 1QK2A 4C6FA 3LQLA 4HZ7A 1O5KA 3WY1A 4MNLA 1GZGA 2HNHA 1SSGA 4QTGA 4JQ4A 5AY7A 3WIJA 3B9EA 2PWGA 1QNRA 1WPCA 4DWDA 5C71A 1RHCA 3WNOA 2GYIA 5K4XA 1VBUA 4CQDA 3IAPA 2Y63A 3WO8A 4H8NA 3ZR4A 4PUNA 1EC9A 1GVQA 5I3KA 4C90A 1NJJA 5HWMA 4B4FA 4ONVA 1YADA 3LI1A 3SN0A 4X61A 4DX3A 4US5D 5DQPA 2R82A 4QP0A 5BXRA 2HQAA 3OIHA 1LT7A 1VGAA 2IPJA 3VX1A 3QYQA 1W3KA 3L21A 3ZT5A 1EDGA 1T40A 1UCWA 1MDLA 5CPNA 4GUIA 3LQGA 1WOAA 3GNNA 2VX6A 2QCHA 2OLSA 2QCDA 5GJNA 1JUBA 1O7AA 4B9ZA 1HNYA 3VNIA 5HQLA 3LBMA 5A8MA 1I2OA 1R38A 3M1ZA 2HISA 2HE5A 2IKJA 4RNIA 2PBGA 4HOXA 1Q3NA 4FSAA 1WAUA 2VYOA 3PJUA 1A0DA 1A5AA 2PGFA 2C6QA 3ELFA 2IPFA 1E0VA 1THFD 4LYQA 2DDXA 3DKLA 1DWHM 3W37A 1M53A 3I68A 1EPXA 2A6LA 3GKFA 1B3OA 4BS0A 4YNGA 1VYPX 3VDAA 2YDRA 4OBRA 4A35A 2ZE3A 4AWTA 1GHRA 3BPWA 3LOTA 1VJZA 5CC5A 5T91A 1VCGA 3L2MA 2W0UA 4C6OA 4I6VA 3A5FA 2Y88A 3PWAA 1R5YA 4KWWA 3EMZA 2GVGA 2FH6A 2OEMA 4JIPA 1UH3A 1E4IA 3QYSA 1T5AA 4S3CA 1V0LA 2F2HA 3HBLA 6REQB 4WSJA 1SZNA 2ZZ1A 1L2QA 5E9AA 2PE4A 2OQYA 1VD6A 4D6EA 3GLCA 2VRKA 1EL3A 2V9DA 2ZC8A 1F2JA 4C6LA 2VVNA 3LXAA 2WBGA 3ZR5A 4AZ6A 1REQA 2VWSA 1J93A 3WH9A 2XGZA 5EB8A 5CG0A 4NVTA 3CAVA 5G1MA 4ICCX 4F3HA 5LGZA 1H7XA 1QAPA 3PB2A 5HNNA 3UWZA 3P2VA 5DEZA 1F07A 5BRPA 3C52A 4N7QA 4GLEA 2QMJA 3O1NA 4DJDA 1SJDA 3DYMA 5IOBA 3QMTA 3VIFA 4HTBA 3IGXA 2OOGA 4IQEA 3UPBA 3GHSA 4UIOA 1V6UA 3RIKA 1S46A 5D9NA 3A9BA 3UETA 4DELA 2GSHA 3ZWSA 2DVUA 4ZB0A 3AIWA 4LAKA 3CAKA 3UG5A 3W27A 3WQ8A 4GIAA 2VD8A 4PL1A 2VX7A 4A05A 4TVUA 2I57A 1B3YA 3VOGA 1EJRC 1I4NA 3S2JA 3BLFA 3NQGA 3NQFA 6XIAA 2XVLA 4DM2A 2ZX6A 2UBPC 3VDBA 4YYFA 2XU2A 1HKWA 4FALA 4WJ8A 3AHYA 3EKLA 1W5NA 1LL4A 2CLOA 3FYYA 1KBJA