3W7DA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-5-170
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-5-170
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7dA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7dA01
4O1BA 1LCOA 4K36A 3OA3A 4O4WA 3EWYA 6TIMA 2FB2A 1TIMA 5AOUA 2V2DA 3NL6A 1XBXA 5F1VA 4HNUA 3EX6A 4IQLA 5C5YA 5D2YA 2DZWA 4JTEA 5F4SA 3W7KA 3NQDA 4A29A 3W71A 3S8HA 5G1YA 4Z0JA 4O12A 3R89A 1LBMA 3NQFA 3T44A 3TK7A 4OV4A 4O28A 1VPXA 1SW7A 2QF7A 1XUZA 4M5PA 1TTJA 3HG3A 4AHOA 1YYAA 3V1PA 3KRUA 3LHWA 3GKAA 3TV8A 1DVJA 3MI2A 4M7TA 3Q58A 2CLLA 2NLIA 3S5YA 4WOZA 2YR1A 1ZNNA 4FNSA 3NQEA 5DELA 3C2VA 3BLIA 3P8JA 1ML1A 3D0CA 5A8GA 3TE9A 2DU2A 3M5VA 4RLIA 3MP3A 3OVQA 1TMHA 2VEKA 2Y61A 3E9AA 3RNDA 3LTPA 5HR7A 5D33A 3O1NA 3W85A 3KVMA 4P61A 3MYOA 2C1HA 3W1TA 2VFGA 2ZZ3A 1TPWA 4FO4A 1DORA 5DBUA 3C2RA 4ZMGA 3MO7A 1SO4A 3P67A 2V5LA 4Y96A 1N55A 4LVBA 2P1FA 2YFNA 3C56A 1TV7A 3TQKA 3CEUA 4M6VA 1KV5A 1QFEA 5HULA 4KWWA 3W84A 1SZFA 1TPB1 1F6PA 3FOKA 3W7GA 3DHFA 2C18A 1S5WA 4AMAA 3YPIA 1WX0A 2WO5A 3SR7A 3HQ1A 1TPUA 4LY8A 1EPXA 2A85A 5EA9A 3QQ1A 4D2JA 1NAL1 1PCKA 1GG0A 3M5XA 4O1CA 1ZAJA 4UTKA 1QPNA 4O15A 4PH6A 3MP4A 3HMJG 4R53A 2WPBA 3TUUA 4A2SA 2NXIA 2WJZA 4ADUA 1WOBA 4DO4A 4NJIA 1KFBA 1XM3A 3EWWA 4IUOA 2P10A 3PVFA 3VE7A 3TJLA 3QSTA 4K38A 2WNZA 2X1RA 3MBDA 4PC8A 4PEKA 3CB8A 1GJPA 1TPEA 4JYDA 2GVLA 5FESA 4M19A 1M7OA 4DBDA 2G96A 3MHUA 3LX9A 5LHEA 3BW2A 2H8ZA 5C6MA 1OF8A 1KBJA 2A21A 3WK3A 3N9RA 3E96A 3THQA 3GNDA 3CWOX 2C13A 2CZEA 3E02A 1H62A 4IMGA 4MIMA 3SJ3A 2AAMA 3UWYA 4HPXA 2H90A 4BI6A 2E6YA 4Z1DA 3NQ6A 2QCFA 2XN0A 2ZBTA 1GYLA 3C2EA 3DGRA 3UZJA 1KM2A 4JN6A 1JUBA 2Z1BA 1QPOA 2V82A 1Q6QA 4HN4A 2PE4A 5HWMA 1P0KA 2GPTA 3KRSA 3WK0A 4JXCA 4LT9A 3AO0A 2B7PA 5DLCA 3PM6A 4Q32A 3WJZA 2QCGA 2ABBA 4N9DA 1AG1O 3DH7A 4XBKA 2NV1A 2RDUA 4JDBA 4JYFA 3GXPA 4JYEA 3A21A 1UCWA 2R94A 1DJNA 4I7UA 3BVJA 3W70A 1OFBA 5FF4A 1XDLA 4K39A 3C52A 4ICNA 5D32A 3S6DA 1E51A 5AC8A 1B57A 1YDVA 4IX0A 3RFAA 5AHNA 3QPYA 1F76A 3NZ1A 4AEOA 2FFCA 1OVDA 3LI1A 4JTGA 4UC5A 3BGGA 2WKJA 3SI9A 4RX0A 4WD0A 4NVTA 4NJHA 2KZHA 4ZQNA 1SPQA 4CLMA 2H6RA 4AH7A 3W73A 4UTTC 1GVQA 4HSNA 3KVKA 4JR5A 1OFDA 4DO5A 3VCRA 3TH6A 3W1MA 5CSSA 4IMDA 2TRSA 1ZAHA 4JS3A 3EWXA 2E6DA 4PL2A 4NX0A 1X1ZA 2QR6A 2EHHA 3ATZA 4Y8FA 5KMYA 1SW3A 4K8EA 4S2CA 5LZLA 3GDMA 4QNWA 1G67A 1PL9A 4O11A 1OFEA 2IQTA 2EKCA 3Q37A 3RLVA 3GLCA 3O06A 1YTDA 4EOUA 3FYOA 2BSLA 1R2TA 3TQVA 2OZ0A 3SECA 4M6PA 3MI6A 2GJNA 2X16A 4IMFA 1OG0A 2Y70A 4LVFA 1JQXA 3MMTA 1I2PA 3T4CA 2PRLA 3N73A 2FIQA 3F4NA 4CNPA 2ZRXA 1IIGA 4MY8A 4UMAA 3DI0A 1LLZA 1I2RA 1GYNA 2NV2A 2NWRA 1SFLA 3STFA 1OF6A 1VC4A 2V9DA 3KAOA 4O1DA 1SZNA 3CIWA 4O53A 1GTHA 1TV5A 5AC6A 1QWGA 1OX4A 1HL2A 1JCYA 3W1LA 2WSRA 4B5NA 1D3GA 4MY9A 5EPDA 3CC1A 5BW6A 3INPA 4HT3A 4ALDA 3W23A 1V7YA 2DJLA 1PHQA 4JNMA 5D09A 1GEQA 1ALDA 4LS2A 4S1FA 5FF3A 3LCXA 1I2OA 4JTHA 4GE8A 4A3UA 1NF0A 2Y63A 1T0OA 3LM7A 1Q45A 4FX7A 4MLJA 2V2CA 2BLEA 3DFSA 3W7CA 1GOXA 4UFJA 2DJXA 3HF3A 3C6CA 3SW6A 2B0MA 4JTKA 3ZS4A 3BG5A 1V5XA 2B7NA 3U2OA 3KRZA 5F4WA 1K02A 3E49A 3ABSA 1M6JA 4XUGA 2GQ9A 3NQVA 4JX6A 3W1RA 4H3DA 2GQ8A 1H50A 1EX5A 1VZWA 2VEPA 3PWAA 4JEQA 5C2XA 2ATSA 4O18A 3EX1A 4Z08A 3KX6A 5C55A 2ZZ6A 4LRSA 4GBUA 4OV9A 2QAPA 3M7WA 2QEZA 2Y7EA 2X1SA 5I3IA 1KLZA 3MHGA 2G5WA 2JKAA 1W3IA 2C3ZA 5H91A 1OX4B 2ZCGA 2ZRVA 5AYXA 1F6KA 4E2BA 5IBXC 1K8XA 1O5KA 5G2HA 4JIPA 3S1VA 1TTQA 2YDAA 5CZSA 3DFNA 2B4GA 4AB4A 4O10A 3HGJA 1Z44A 5F2LA 3GYEA 3W7RA 4L4LA 4WY0A 3MWAA 1F05A 2E6AA 2J27A 5FF7A 3CWNA 4N6EA 3NPXA 4A22A 3STGA 1BEUA 2ZZ7A 3P7YA 1RQBA 1JJKA 3F03K 3UWUA 3VKJA 5HUOA 1SO5A 1JCNA 4NX5A 5AHFA 3F1QA 2EF9A 5BMWA 1L6YA 3MI3A 2HSAA 2X1TA 2OMAA 2FQIA 1YTKA 3S42A 5TQLA 3W7MA 1SZGA 5BMXA 2WSYA 3IVUA 2CLFA 3W2JA 1YXCA 4GUFA 3GDRA 1MXSA 3LHTA 5LNRA 4UFKA 3BPWA 3PR2A 1KBIA 2Q3OA 4LC8A 3QEZA 2TMDA 4ZVJA 4FXSA 4UMCA 4K37A 3KFTA 1WOAA 2C16A 2AGKA 3LGEA 3PBVA 4CNOA 1OABA 3FYPA 1LRNA 5KSWA 1T8XA 3L0NA 1DJQA 1Z48A 1YLVA 2JKEA 3DHDA 3H54A 1R2RA 1SQ7A 3CLMA 3GNNA 4EF9A 5FEPA 4WY0B 3CQ0A 5I3FA 3PBWA 3JRKA 4JTIA 4LVGA 3HG4A 3SFKA 1PE1A 1WV2A 4HSOA 4IX2A 5CPLA 3DU0A 1PS9A 4MJMA 2GJLA 3M16A 4NNCA 4AXKA 3GVGA 4NQ1A 1F5ZA 4ORMA 4UTTA 3IVTA 4HKPA 1K7FA 2A6LA 5K9CA 4RV8A 2H3BA 1DKWA 3GDKA 2QDGA 1XBZA 4EWND 1FWNA 1ZY9A 3PB0A 5K4ZA 1A5SA 4FIRA 3L5AA 4AWUA 2OX1A 2DORA 2V81A 2YYUA 2LLEA 3R12A 3L65A 5F1UA 5K9XA 3VFLA 4TR9A 2YSWA 3TXVA 1YPIA 8TIMA 2FPVA 4TMBA 1OHLA 3W74A 4N6FA 1Q6LA 1FWTA 2NX3A 4RXGA 3W2KA 2CW6A 3OIXA 2XFWA 1I8JA 1XI3A 2WQPA 1NVMA 5CPNA 4QJ1A 3HB9A 3NVTA 4ZQCA 1C29A 3O6YX 4TIMA 3OEXA 3W83A 5HINA 3TNOA 1VYSX 1FX6A 2Y89A 4HIBA 3QZEA 1ME7A 2C14A 1S5VA 3JR2A 3TKFA 5E1QA 1I2QA 3TSBA 3OVPA 4O57A 1IXNA 1VCFA 4DPPA 5H2ZA 4NJJA 1R47A 3MW7A 2GOUA 5KINA 2ZFAA 1OFPA 1H7OA 5EMUA 2Y6ZA 1QOQA 1F74A 4L4MA 3RK8A 1XDMA 1P1XA 4J9JA 3NO5A 4MFDA 3LB0A 1FDZA 3UXAA 4GC4A 5LNVA 2OT1A 2PRMA 4OGZA 4X2RA 3G1HA 1RPXA 5E0KA 1P4CA 2G95A 1N7KA 4NUWA 1FDYA 3TCEA 4UTHA 3BW4A 1UJPA 3BLEA 4UFMA 2Z0IA 3G8EA 4LU0A 3TIMA 3NA8A 2Y62A 3UXDA 5G4WA 4E38A 1SSGA 1GVFA 2JGQA 1GPWA 3GK0A 1ZHAA 3L5LA 4ORIA 3DFOA 5IBXA 1JVNA 5EKYA 2ZDRA 5KZDA 3NZRA 1MEIA 1AW1A 1KFEA 2CLKA 5J5DA 1M5WA 1JRBA 3EX3A 1O94A 3B04A 3W7LA 1TPVA 4XTDA 4O14A 2VFIA 4WQ6A 3B03A 1H51A 3DFTA 4R34A 3LLDA 1KM1A 4K6AA 3HOJA 2ISSA 1J4EA 1FDJA 4I9AA 1SW0A 4RCXA 4PL1A 4UTWA 4IPJA 1DOSA 2PURA 4CQ8A 3NM3A 2HTMA 3LCIA 4U4MA 4K8HA 1R46A 3NXFA 3T7VA 1Q3NA 3W7PA 2CLEA 1XKYA 2E5CA 1GVRA 1LOLA 3B0PA 2V5BA 5U7SA 3T78A 5KITA 1VHNA 1DHPA 5CPOA 2QJIA 3L66A 1EIXA 3N2MA 2I9EA 4R33A 4JY8A 2NUXA 4UNLA 4MKNA 3I6RA 3MBFA 2NZLA 1W5PA 3W72A 3PUOA 2V2HA 3FFSA 1OYBA 2DP3A 4UCGA 5SWUA 4GUGA 4NZFA 1H5YA 4XTIA 4W9TA 3S1XA 2RDWA 4NJGA 4EIVA 3R8RA 1G7UA 3BG3A 3R5EA 4TU1A 3GR7A 1TSIA 3NOEA 1LRQA 3NL5A 4P2VA 3L68A 4I7WA 5U4NA 4FNUA 3TMQA 1RD5A 1XCFA 4QSHA 2PC4A 1SU5A 2ZZ1A 4N4PA 1OFRA 3EB2A 5CPMA 2E09A 2XN1A 2H8XA 2DZUA 2C6QA 2CZ5A 5K3VA 3W2UA 3H53A 4NXKA 3F4WA 1TYGA 1H1YA 3HG2A 4BWLC 3G24A 1YTEA 1A53A 3OHIA 3GAYA 5HNRA 2E77A 3W7NA 1SR9A 1GVOA 4YL2A 3FLUA 5FF2A 4HHPA 5KZMA 4ZL1A 3EXTA 3GR8A 2CFFA 1PVNA 1W5MA 5G2IA 3ELFA 1XBVA 3A24A 3DKLA 3TAOA 3IIXA 3BW3A 4NNBA 4ZQMA 5CZJA 1H63A 3MJYA 4JIQA 1PIIA 4O1AA 1S5TA 3LCGA 1MO0A 1K03A 4FNRA 3NAVA 3W6YA 4JX4A 2JGYA 4Z1CA 3IIZA 3HPXA 1THFD 4MFEA 2R14A 1TRDA 3P8IA 1W37A 3G1FA 2ZZ5A 4LWWA 3LXCA 1LORA 3N14A 3P61A 2TPSA 4N2YA 1B4KA 3GZ3A 3LHUA 2YGYA 5G2WA 1ME8A 1DV7A 2YCEA 3SZ8A 3IEBA 4IJBA 3MHFA 2X1UA 4CCEA 1DL3A 5CSRA 2QCNA 1QO5A 5DCDA 1XBYA 4PTNA 1VH7A 4HNNA 3DENA 5D05A 4NJKA 3TSMA 3BO9A 3P84A 3K30A 4FXRA 5I3KA 4OHQA 4S2BA 3PUDA 4OT7A 3L67A 3LCHA 5FF0A 3TR2A 3QMRA 4BF9A 2VOMA 1G4EA 2AQWA 4PCFA 4R7JA 2VFEA 1WXJA 1RZMA 2EPHA 2QCDA 3W2NA 4MPQA 3BGJA 2DZVA 3DZ1A 5D2VA 4O13A 2QJHA 1LRTA 3EEGA 3M41A 1VLWA 4ZQOA 2RKXA 1B4EA 3ATYA 3GAKA 4UR8A 4JDYA 1ZALA 3S9YA 2I1OA 1Q6OA 4Q4KA 4KKXA 3WJYA 2E5BA 4RKAA 3CU2A 3LXBA 4LVDA 3TSDA 1LOSA 1VS1A 4ONVA 1XUUA 1A5BA 2ZRWA 2C15A 3R13A 3W22A 1TQXA 4RZ5A 3O07A 3LRKA 3CIXA 4LUJA 3W1NA 1C8VA 3QPZA 3LDVA 1VYRA 1JR1A 3M44A 2A0NA 3U8GA 3TFCA 1BKSA 4GJ1A 3W1UA 3O6DA 3R2GA 4BR1A 2FLIA 5DY2A 1OYCA 1L2UA 3C61A 4O4VA 4UFLA 1H7RA 1JULA 4O52A 3LTYA 3TW6A 3IRDA 2J9YA 2ABAA 3WJSA 1W8SA 3NQ7A 4RJEA 4UTMA 2Q8ZA 3B0VC 3EKLA 3I68A 3P60A 3HBLA 3EKZA 4DO6A 2OT0A 4JY9A 4N02A 2QCDB 2YYTA 4CCDA 1UBSA 3E0IA 1A5CA 3NEVA 4OBTA 1K7EA 4FHAA 4JX5A 3I65A 3GXTA 4M7SA 4IWWA 1LLWA 1O5XA 1SUXA 3BK0A 3CTLA 5FEWA 1OFQA 2EGZA 4RXFA 3TMLA 3W2LA 3EWZA 3RF9A 1EP2A 1WBJA 3LTSA 1BWKA 3DFPA 5DCEA 3SGZA 3VI2A 1JCLA 3DXIA 3S5ZA 2XN2A 1OFAA 3GXNA 3N2XA 1ZAIA 5I3JA 1EP1A 5D04C 3N9SA 4QM1A 4A2RA 2J9XA 1GT8A 4U28A 3TFXA 1EP3A 3PG9A 1SZEA 4LUIA 1ADOA 1RVGA 3IV3A 5G4EA 3C2FA 5LHFA 2RFGA 4WX2A 3LBMA 1DQWA 1ME9A 1CW2A 2A7RA 4XBSA 2CWNA 3HGOA 2QUTA 1JCJA 1GVSA 5GVJA 3CEPA 3LI0A 1DQXA 4UTJA 2FJKA 1FY6A 3IIPA 1NF7A 4MYXA 4NXSA 2GQAA 3LRMA 2ZRYA 5HR6A 2QCMA 5F2GA 2E68A 2VELA 4Z0SA 3A5FA 3W7DA 5I3HA 1D9EA 3FKKA 2NX9A 2A1YA 1YADA 1FWSA 3W3OA 2FPYA 1LDCA 4ZQRA 1OYAA 2WNQA 3CHVA 3VNDA 1QNVA 3LHVA 2BXVA 1J5TA 4BWLA 1RV8A 4MJZA 1HO4A 1KM4A 1KA9F 4X22A 1GQNA 2ISVA 5AHIA 4Y90A 1FBAA 4KWVA 2YPIA 3PC0A 1H61A 5HWNA 4YCOA 4NU7A 5TIMA 1RQEA 4DPQA 4LV9A 3QMTA 3BLFA 5LNWA 4IMEA 4A21A 1FWWA 5G1TA 4BK9A 1BTMA 2OJPA 4XKYA 5CG7A 2Y7FA 3GKFA 2A7NA 4CQAA 1EUNA 1K3UA 3PULA 3NQCA 4O17A 4DBEA 1NFBA 1AL7A 2QCLA 4M6QA 1W3NA 3N3MA 1ZJIA 1Q6RA 3FKRA 3L21A 4H6KA 4JTTA 3G0UA 5ABTA 3N19B 5CZ0A 3LRLA 1TREA 3O05A 3GB6A 5K4XA 4WXZA 2R8WA 1PCWA 3VE9A 3LLFA 1ZENA 3UWQA 2VKZG 3M6YA 1HFBA 3IVSA 1OJXA 3EXRA 1ICSA 1HUVA 3HGSA 2ZRZA 3WJWA 3LCLA 4LRTA 3A22A 3M0ZA 1KM0A 5I3GA 3G1XA 1UUMA 3GDTA 1ZCOA 2RDTA 4UTLA 4OQVA 2C0AA 3Q2DA 5AN7A 3LERA 1CX9A 1UUOA 3L9CA 3DBPA 2GVGA 1MZHA 3LV5A 3LHYA 3L0KA 3A9IA 3EXSA 3QFEA 4UTIA 4Z1AA 1JCMP 2QCCA 1ONRA 4YWIA 3PUEA 3STEA 1XXXA 3G1VA 4GUJA 4ADTA 1KTNA 5D02A 2X2GA 3NL2A 3UPBA 5HUPA 3C3NA 1Y0EA 3KXQA 1LP6A 1MSSA 4O16A 3DI1A 1P0NA 4XKYB 1FUYA 2VFFA 3G1DA 5L6UA 2UV8G 3S5NA 4DXVA 2CZDA 2BZNA 2J9ZA 3LCWA 1R2SA 4MUZA 2V8ZA 4HNTA 3W1PA 4POCA 1T99A 5D03A 4AAJA 3TQ0A 3TJXA 1TV8A 3NNTA 3NPVA 1SFJA 3FIGA 1WQ5A 2H3DA 1OX6A 1JUKA 1A5AA 4CNNA 4KFNA 2QKFA 1AMKA 3M9YA 2TYSA 3QH2A 2DZTA 2VC6A 4JICA 2HMCA 1F2JA 1NEYA 1I45A 2PRHA 1WBHA 2QDHA 1I4NA 2YW4A 3W1AA 2QJGA 3PF3A 1K7XA 1H7WA 1TO3A 2CU0A 2TSYA 2ZTJA 3W75A 3UZ5A 1ICQA 2BWGA 2Y88A 5FI8A 1HTIA 1KM5A 2F84A 4QNEA 4AHQA 2QAFA 2ZRUA 3W07A 4MOZA 2GVJA 1I2NA 3NQGA 3A23A 1O60A 3EX4A 3N34A 1EB3A 1JRCA 3DKJA 1ICPA 1G6CA 1WDWA 1YXDA 1W56A 5HWJA 1MEHA 1QCWA 3UD6A 1C9DA 4NZJA 3O16A 4IXHA 4O54A 3AJXA 3TAKA 5T26A 3L5MA 3ZR4A 1D3HA 3IIVA 4YLWA 1KM3A 1AL8A 2WOQA 4O0KA 3TU9A 4LV4A 2BTMA 3EWBX 3V75A 1QAPA 1Z41A 2ZTKA 2E6FA 1W5OA 4AWSA 2CLHA 5AHEA 1FCBA 2BX7A 3FA5A 3IIOA 5KTLA 3M43A 3W7HA 1S3HA 4CQ9A 4QISA 3HPSA 1G69A 3KVJA 3W2MA 3CM4A 5CGQA 1TPDA 3KHJA 4G1KA 1KV8A 2FTPA 3TXZA 4WXYA 5HQEA 5FEXA 1PHWA 4RZ6A 3QYQA 5DXYA 2EAWA 3P74A 3DFQA 3UQNA 2Z6JA 5AYYA 1EUAA 2DZPA 5D30A 4C1KA 3ANYA 3QRHA 3M1ZA 3NM1A 3C4UA 3WFAA 1GWJA 5LNSA 4IOTA 2ZZ2A 3NQMA 4WOQA 5BOOA 1AK5A 2VFDA 2D73A 3NQ2A 4HPJA 5TBOA 3FJ6A 2JBMA 3QSRA 2WV8A 4XZ9A 4FNTA 4PA8A 5K9DA 5DY3A 2E1DA 3UWWA 4YXGA 5EBUA 3O63A 1G4SA 4GUIA 4O19A 1XC4A 5C54A 4MZ1A 3BARA 1DBTA 4YMZA 5EYWA 4WZHA 2OCZA 2JKPA 4FF7A 1IXQA 3QW3A 4TMCA 2ATMA 3W7IA 3RLUA 2O7SA 1FWRA 2GUUA 3UPWA 1OFOA 4EF8A 1VRDA 1QDSA 2QCHA 1W31A 3ABRA 3RMJA 2QUVA 1F73A 1SSDA 1W54A 1KTBA 3NG3A 1VYPX 1HO1A 1L9WA 4ML9A 4I7VA 5D2TA 1CI1A 3T40A 3P5YA 2B7QA 4DF0A 3B06A 1U83A 4GXMA 1QR7A 1W5QA 1MEWA 2YX0A 1VCGA 4LVAA 3UY7A 1TTIA 5J5RA 2FB3A 1W1ZA 3BG9A 3S1WA 3S5OA 2DZXA 4FB7A 4DF1A 1OK6A 4WUIA 1LTDA 1O4UA 2I14A 3IGXA 1IXOA 4N9CA 3ABOA 2O7QA 4TX9A 4UUIA 2NXHA 3MYPA 1JQVA 3OG3A 5D38A 4QITA 4K7YA 1FCVA 5AB3A 3L0GA 4GNJA 1VHCA 1YPFA 5F4XA 2B7OA 1H7NA 1K8YA 2R91A 1FCUA 3B05A 3HIJA 1LOQA 1LM1A 3QQ0A 3QF0A 4RR4A 1PV8A 1LZOA 1EWDA 5IM51 5KZEA 1NSJA 3BV4A 3UY8A 4LW7A 4Z1BA 4QIUA 3W88A 1KFJA 3P81A 5AC7A 5EL1A 1B3OA 5DN1A 1JUEA 1X6UA 2PCQA 3SGUA 4E2DA 1TCDA 3LV6A 4GFSA 3NGJA 4RK8A 5LSMA 1VJIA 1L6SA 3W9ZA 2NX1A 4GUHA 4ADSA 4GRSA 3NDOA 5L9FA 4OE7A 4PODA 2QCEA 3CT7A 4Q33A 1FCQA 1KFKA 3QW4B 1W3TA 4LC6A 1AW5A 4HNVA 2WNNA 4DF2A 1G7VA 4N9BA 4UR7A 2NWSA 2ZA1A 2W0UA 4MZ8A 2X30A 5CKSA 3OVRA 2F7FA 3G8RA 3B8DA 3KOFA 3USBA 4K7VA 3GX9A 3O8AA 3W86A 1G4PA 5E93A 3S1UA 5K7JA 1TPFA 3SSJA 3FS2A 2W79A 1BWLA 5EY5A 1VGAA 2RHGA 3NL3A 1KTCA 5DCBA 4O8RA 1UB3A 2W6RA 3HJZA 5AFDA 3PAJA 3P82A 3PG8A 3PSWA 1JCXA 2J24A 2C19A 1QPQA 4JTJA 4AVFA 3THAA 4JGDA 5D2WA 3G3MA 3P5ZA 5MHBA 4IXXA 3M5ZA 1ZFJA 3QC3A 3JS3A 3M5YA 1EA0A 2CLOA 3I7RA 5CZTA 3TROA 5LKYA 2VXNA 3G3DA 1IGSA 1TRIA 3E12A 1QOPA 4PFMA 1VR6A 3Q94A 4MZYA 1HG3A 2ALDA 3G1AA 4OWGA 2A5HA 4QQ3A 3C2OA 1KFCA 1FXPA 1SO6A 2VEIA 3FJLA 3GIYA 3I7SA 3TA6A 3WK2A 4BFAA 5BNKA 3S0CA 3W1QA 2RH9A 4NNAA 1H60A 4O0ZA 2VEMA 1LBFA 4ZQPA 1TPC1 3B4UA 2Y7GA 1IXPA 3PBYA 3QMSA 1FXQA 1W0MA 2HS8A 3HPZA 3TC6A 3C8FA 2CLIA 3G22A 4JD4A 3SIZA 3NR0A 5BRBA 2ZZ4A 4XQ6A 3ABQA 4KFOA 3RU6A 3T55A 4AWTA 2Q8LA 4MLRA 2Z6IA 3OBKA 2A2IA 1X1OA 3STCA 3U6WA 3GDLA 3LHZA 3W7JA 3W7OA 3QJAA 1H7XA 5A5WA 4O50A 5F2MA 1X8FA 2YFOA 4MVAA 1AW2A 1H1ZA 1TJRA 2JK2A 3SY5A 1KFLA 3LBCA 4LOCA 3O15A 3I7QA 2A6NA 3P62A 3ZFHA 3M47A 5D2XA 3PY2A 4IMCA 1TTPA 1KLYA 1K8ZA 1QMLA 3TX9A 2FPTA 1LYXA 1QPRA 1FQ0A 1WA3A 4NT0A 5LNUA 4UFHA 1P5BA 2ISWA 1VCVA 4LS0A 5LGZA 1T96A 4UNKA 1TQJA 3NQ8A 3B0UX 2Q3RA 4H4IA 3LOTA 3NQAA 3W1XA 4JTUA 5HMSA 1B9BA 1TB3A 3UYCA 4Y9AA 4AF0A 3G1SA 2Z2UA 2NXGA 3HO8A 4CCCA 2P0OA 3TW7A 4UTWC 3L2IA 1RQHA 2HS6A 4YCPA 3W7QA 3ZWTA 3UWVA 2ZYFA 1WYIA 5DXXA 5D37A 2V0TA 4FX8A 1M7PA 1YXYA 4KFPA 1R30A 5AYZA 1LBLA 3G18A 4FEZA 3H55A 2Y7DA 1A50A 3G0XA 1EEPA 1EWEA 4WY0F 2YXGA 3EWUA 4MY1A 2ZA3A 3ZWSA 3TDFA 4DEFA 2E5DA 3DAQA 3PS7A 1UASA 3CPRA 3LCFA 5LGXA 3G0SA 2VFHA 4DELA 4EVZA 1O95A 1RR2A 3C0JA 3IGSA 1G4TA 2Y85A 3HGRA 2NUYA 4UXDA 4LTSA 3W7EA 1GTEA 3MP5A 3TC7A 1XL9A 2CLMA 1TPH1 4UFIA 1OX5A 4UTUA 4AF0B 4LNYA 4Y6GA 1N8FA 5F2IA 2A4AA 1KW1A 2WSQA 1W5NA 3G1YA 3EX2A 2ZQ0A 2J88A 1XFBA 3WJXA 5DBTA 4JTFA 1IIHA 6ALDA 1L6WA 2DZSA 4BI5A 4OU1A 3PBUA 5K2ZA 5HJLA 4BI7A 3W87A 4X3ZA 3HG5A 2J6XA 4MYAA 4WJEA 3NPWA 3PSVA 1TJPA 4RZ4A 1H7PA 3IGUA 4ZZ9A 3A5VA 3UWZA 1YDNA 4DQWA 4FNPA 3LXAA 1VQTA 5G5IA 3UNDA 3FEMA 4UMBA 1U5JA 4FIQA 2VENA 3PB2A 2A7PA 1KM6A 3NYZA 2FDSA 4FX6M 4C1LA 2CZFA 4JTSA 1F7BA 1QO2A 4XWUA 4TO8A 3QM3A 3NPUA 1J2WA 3P80A 1OK4A 4UIOA 1Z42A 4N4QA 5FEZA 2NUWA 4AHPA 3W76A 3MUXA 1GZGA 4N9EA 3WK1A 1YDOA 2V30A 1WAUA 4GWEA 4E0CA 2QUUA 1GG1A 3KVLA 4LS1A 4JTLA 2YZRA 1IF2A 3O6CA 1X7FA 4IGHA 5AHMA 5AHLA 2ZA2A 4FNQA 2G97A 1VLIA 4X9SA 7TIMA 1SO3A 4IPIA 2YW3A 4QAIA 1LROA
chains in the Genus database with same CATH superfamily
2Y8KA 4O1BA 4J28A 1TJ0A 1F8MA 1LG2A 3TTOA 1N8WA 3BQ5A 2G3IA 2W27A 3MT1A 4W86A 3WLJA 4WVXA 5F4SA 4AIUA 1PKNA 4WKHA 5IFPA 4Z0JA 3STPA 3CH0A 3VDCA 3T44A 3VM5A 3HQOA 4OV4A 1KWGA 4YVPA 3ZLHA 3TJ4A 2QF7A 4KS0A 1E56A 1I9CB 1YW1A 2OYMA 3SCNA 1YYAA 3KRUA 3LHWA 1R7AA 3TV8A 1DJXA 4Q4MA 4DBWA 5BU6A 4M7TA 3PJXA 1UIPA 3BMWA 3S5YA 3FJ4A 2W9MA 1AZ1A 1E73M 1UR1A 3A3WA 2BVYA 2PGFA 3P8JA 4GH3A 4U5IA 3D0CA 3TE9A 1ZB5A 3LEPA 3CZKA 5BXPA 1UWRA 2Y61A 3LTPA 5HR7A 3GH4A 2Z00A 4P8VA 3SAZA 5HQLA 3KVMA 3V5FA 1HJSA 2J13A 3RM4A 1HGWA 3PTMA 3VGDA 5E6ZA 3TQKA 4QS5A 1U22A 4ZOCA 4M6VA 2YDSA 5HULA 2HROA 1SZFA 3UR5A 3WIJA 3DHFA 1GOOA 1S5WA 1W9UA 1M1BA 1V7AA 3GU1A 3PZ9A 2NQHA 4H41A 1GOKA 3O2LA 2DZAA 1TPUA 2WJFA 3VZZA 1PCKA 5G1MA 3CT2A 4UTKA 3TOPA 4AD3A 3TNBA 3HMJG 4R53A 4V28A 2WPBA 2G41A 3TUUA 3VABA 3LENA 3RG6A 4A2SA 4ADUA 4C6EA 4JKLA 1KFBA 4XO7A 1XM3A 2P10A 4BJHA 2PLJA 1EF3A 2OVLA 3PVFA 5A94A 1PBGA 1GYMA 4Z2LA 2VOTA 3KTXA 4AZCA 3H70A 3ES7A 1JEZA 4QQUA 5C6MA 1OF8A 1QNOA 2A21A 3WK3A 4IL2A 3NSMA 3PFMA 3ZYZA 2CZEA 1H62A 3C5QA 2H90A 2E6YA 2QNEA 3NQ6A 3OQ8A 3DGRA 4GY0A 3VU2A 4JN6A 1JUBA 1QPOA 3MZNA 3MB9A 2P0IA 2GPTA 2ON3A 2VM8A 4LT9A 4NZ1A 3PZVA 4DZHA 3PM6A 4AYSA 4CGTA 5FL0A 3WJZA 2ABBA 4OUIA 1EH9A 4MGGA 3GXPA 3H24A 1VF8A 2G8ZA 3A21A 4J1OA 1DQUA 2R94A 3BVJA 2G3NA 3W70A 1XDLA 2QVHA 3C52A 1Z69A 5H8UA 3GO2A 1P6CA 3CPUA 3RX2A 4AZCB 5H1WA 1G1YA 2XDFA 4LF1A 1W1TA 2D2JA 3QPYA 1S2VA 5E0CA 3NZ1A 4Z2IA 3VOGA 4AEOA 2HNEA 1OVDA 3BGGA 1P0EA 2O4QA 3SI9A 2EPOA 4H00A 2ZUTA 2ZUNA 3AZTA 2F61A 4UB9A 2FMNA 2KZHA 2ZADA 1AQFA 1SPQA 4CLMA 1AODA 4J3VA 4UTTC 5A95A 1TELA 3NSNA 5DT5A 4NKCA 5T9BG 4OBRA 3OZMA 3BLOA 1ZAHA 2G0WA 3B8TA 4JS3A 5JXQA 2CKSA 2E6DA 1XSJA 3ZR5A 2V63A 4S2CA 2ZX6A 4QNWA 1PL9A 4E8CA 3RLVA 4QDWA 4EOUA 3FYOA 2BSLA 2WMHA 3TQVA 3V0TA 2OZ0A 3SECA 4ZCWA 2FZ9A 4M6PA 1IGWA 2VL4A 4LVFA 1RAKA 1DJYA 4C6DA 1JQXA 1UC4A 4CN1A 2PWDA 2ZRXA 4UMAA 4RNJA 1I2RA 1JDDA 1K77A 4XISA 4XB3A 3KAOA 4O1DA 1SZNA 4P7RA 1XLMA 2FVKA 1PX4A 1D3GA 2D22A 4MY9A 5EPDA 3RRXA 3RX3A 1WKYA 3URNA 2X0YA 3SFWA 1WNOA 1XLGA 3W23A 3UJFA 1E4MM 3ITVA 3DCPA 1PHQA 1GEQA 1ALDA 3LCXA 4H9TA 4C91A 2D2OA 1RK5A 1ONXA 1T0OA 1PB0A 4FX7A 4MLJA 1E9ZB 1X1NA 4Q8WA 2V2CA 1YNYA 3W7CA 4IJCA 2IW0A 4UFJA 3HF3A 3KRZA 2BASA 1PTAA 3ABSA 1FWEC 2GQ9A 4XUGA 3NQBA 1KGXA 4JX6A 2VRKA 1QT1A 3W1RA 3DFYA 4H3DA 3WBYA 4HYVA 3T2PA 1SFSA 1VZWA 4TTGA 1EJTC 5C2XA 2ATSA 4S3AA 3EX1A 2DSZA 3DUGA 4AD4A 4GBUA 2XJ7A 1A3WA 3TYAA 3M7WA 2VEGA 3VIGA 5I3IA 1KLZA 3GTNA 4KRZA 1ADSA 1W3IA 3GVRA 2ONEA 3KLLA 1F6KA 4ERIA 5IBXC 1K8XA 2WZTA 1FH9A 3DFNA 3ZO9A 2I9UA 2QJNA 2PTXA 3PK7A 5A6JA 3TVAA 3E1F1 1Z44A 1NP2A 3GYEA 4JFTA 1UOKA 4L65A 3LNMA 3S9IA 3M0JA 2GJPA 4WY0A 3K1DA 3WQ4A 1F05A 2J27A 5FF7A 1E9LA 3QV8A 3NYDA 3CWNA 1EGVA 5FAGA 3STGA 1N8IA 2ZZ7A 4QGCA 1XLCA 1RQBA 4BEQA 4WGXA 1JJKA 4HHLA 3SCPA 3N3TA 2FH6A 3PZOA 5HUOA 1SO5A 1JCNA 3JU2A 3GUWA 3MSDA 5AHFA 3SM0A 1B54A 5BMWA 5F7UA 2QYGA 4L1WA 2X1IA 2A3BA 2OMAA 2FQIA 2HDJA 5LIXX 1SZGA 1QVBA 3W2JA 4GUFA 1A4MA 4H19A 1Q66A 1MXSA 1IEIA 3KCJA 4PUJA 3BPWA 4Q8PA 3VKDA 1US0A 2WBKA 4G1NA 1ZS2A 2DT1A 4CNOA 1U1HA 2XWEA 9CGTA 1JYVA 1E71M 1BYCA 3A13A 2PDMA 3UXIA 2WHLA 1Z48A 1W1A1 3TYZA 3D3FA 1UZ1A 3WELA 4GO9A 3GNNA 3U2EA 2BY1A 4WY0B 2DGAA 1XIJA 4F0KA 3PBWA 4JTIA 4LVGA 1VPYA 3FK4A 4IX2A 4HSOA 5CPLA 1PUDA 1JPDX 3DU0A 2V3FA 4PCPA 2ZVRA 3TC3A 5J04A 1PS9A 4MJMA 2IPFA 3WSUA 4FF5A 4AXKA 3GVGA 4MM1A 1GKQA 1JF6A 3AOFA 3QHNA 1FWAC 3VGGA 4HKPA 5EB8A 1KQYA 6PTDA 5C8BB 3HMCA 2H3BA 4MAVA 1VAHA 1XBZA 1ZY9A 2FFIA 3PB0A 3ZJ7A 5JBFA 3SCOA 1H0IA 2DORA 2V81A 3ERPA 2EQDA 2ZXQA 3CZJA 5F1UA 4TR9A 5A1AA 4RDZA 3TXVA 1IV8A 3W74A 3T42A 1FWTA 3VOFA 1RA5A 1IEQA 3WH6A 1HT6A 3CZLA 4IIDA 4R7WA 1E0XA 3ZIZA 5FA5A 2NVAA 1GNXA 4HU0A 3QOKA 5FSDC 2WMFA 5CPNA 4QJ1A 3HB9A 1JCTA 3N2TA 1J0JA 1J12A 3SUTA 3LQLA 1E40A 4IIGA 4HIBA 3WF1A 3QZEA 2G4FA 1ME7A 2RGLA 3PZUA 1CGXA 1HGYA 2C14A 3UYIA 4GY7A 1A5NC 3ZOAA 5E1QA 3V16A 2ZX7A 2XHYA 5H2ZA 2QT3A 4NJJA 4XZLX 2BHYA 1UR3M 1GJWA 3T8LA 3WMCA 2WC3A 3R94A 2GOUA 2VD9A 1GZ1A 2ZFAA 4P8WA 1OFPA 1H7OA 5EMUA 2WAGA 2XVLA 3RK8A 1HN1A 1XDMA 1P1XA 1A5LC 4J9JA 2DIKA 3N4AA 4MFDA 1GW1A 3BZGA 3GVVA 3NO3A 4PTVA 1CYGA 2OT1A 4KT2A 4PCTA 2G95A 1N7KA 3BSGA 1K9EA 3TCEA 4UFMA 4LU0A 4J3TA 2Y62A 3UXDA 3AU2A 1VBRA 3O0FA 2PUZA 3WBWA 1GVFA 3IGHX 4I8DA 2JGQA 3WDJA 5CAHA 1GPWA 4JN7A 5FACA 3AYSA 4QE5A 3OODA 3VNYA 1B5TA 1JVNA 3OGRA 4GQ0A 1QTWA 4UZUA 1K6AA 3EX3A 2HVMA 2XIMA 1O94A 3XINA 1DWFM 1TPVA 4XTDA 3B03A 1H51A 4AW7A 1J4EA 5JUVA 4Y9PA 4I9AA 1KNWA 1YHTA 4U3CA 4XSLA 4RCXA 3O7UA 1TMQA 1KD0A 4DY1A 2OLAA 1CXIA 1FHLA 4B5TA 1UKPA 4A4AA 3MVIA 3LGGA 4W8AA 4HMCA 5JU6A 1Q3NA 2YL6A 2VJXA 2CLEA 3HJEA 3SN0A 2E5CA 4GXWA 4CU6A 1GVRA 2ZXBA 5KITA 1ZL1A 2XTKA 1HVXA 1UPMB 3VDAA 5CPOA 3EDFA 3L66A 3MZ2A 1MUMA 4JY8A 2NUXA 1NDWA 3W72A 1RUSA 5BXTA 3FFSA 2DP3A 4UCGA 1Y8BA 3IUDA 5FJUA 2IQ0A 3TN4A 2D20A 1ZPTA 1WAWA 4EPKA 4EIVA 3WQPA 3GR7A 1XLHA 4FNUA 1GKRA 3NJ3A 3WO8A 1RD5A 2PC4A 4UWMA 5HATA 4DJFA 3VA8A 1SU5A 2H8XA 1AZ2A 3H53A 1H1YA 2AQOA 2J79A 3G24A 3VZYA 3OHIA 4RNHA 1XLAA 4B3LA 3WQOA 2O9TA 3NIYA 3S9ZA 1VJSA 4NG3A 3ZVHA 1S1RA 1JDFA 4ZOBA 2EXOA 1Q63A 4ZL1A 3T0TA 1BD0A 3ARYA 4OOZA 5G2IA 1XBVA 3L7RA 1LL4A 1H63A 4JIQA 1PIIA 4O1AA 2ZX9A 3F5JA 2PBGA 3LCGA 3S2NA 4EAYA 3N15A 1Q65A 3CXOA 1UZHA 1XQKA 3W6YA 2GDQA 4LXFA 4ZO6A 4PTMA 3IIZA 3AIUA 3VOIA 3G1FA 2ZZ5A 1UD2A 4LWWA 2V67A 3N14A 1S5MA 2TPSA 5A6BD 3SJNA 1GEHA 4CU8A 3EBVA 1EJVC 2NLYA 3EOUA 4H01A 1QI0A 2YGYA 3GFYA 1CLXA 5G2WA 3LGDA 3SZ8A 1CGYA 4GQBA 1BQCA 1XBYA 1EPVA 1VH7A 2X7WA 1M04A 4NJKA 2WMKA 4FXRA 4MADA 4OHQA 1X38A 3PUDA 5BRPA 5FF0A 1KC7A 4XIMA 3TR2A 2DVTA 4LX4A 1JFHA 4A8LA 1GVYA 2VZTA 2AQWA 3GQYA 1WXJA 5IDIA 1RZMA 1V02A 2F6KA 2V5JA 1E9IA 4W93A 3ZVHB 4MPQA 2DZVA 3DZ1A 3H6OA 4X63A 2QJHA 3D3AA 3EEGA 2CXEA 2OOGA 3FEQA 2E3ZA 1M03A 2RKXA 2ZKMX 1B4EA 3ATYA 4JIIX 3H4XA 3WQ8A 2GL5A 5D8WA 3LXBA 3OG2A 3TSDA 1VS1A 1H49A 2J75A 3AS0A 4QG6A 3W1NA 3HFTA 2YA0A 3LDVA 3FYYA 3M44A 3WZ0E 5DMNA 1X6NA 1RD6A 1BKSA 3QZAA 5DMYA 5JVLA 2FLIA 3UZWA 4OKDA 4UFLA 5HK4A 4EE9A 1TJ2A 3TW6A 5AVNA 5JBDA 4I5RA 2J9YA 3VIHA 1VP5A 3FHQA 3WJSA 3NQ7A 1HX0A 4RJEA 4UTMA 1FP8A 3W82A 3PWGA 3H7UA 2BBFA 4DO6A 1TR9A 3D5HA 5IFTA 2YYTA 3DN5A 4CCDA 3GG8A 3KL3A 5FKYA 4KESA 3CPGA 3APTA 4M7SA 4ZGYA 3D6NA 3BK0A 5HMEA 3FVDA 3KBNA 5FEWA 1A3XA 4QTGA 1OFQA 5CH9A 1WBJA 2I57A 1UD6A 5DCEA 2GVYA 3VI2A 3S5ZA 3WD3A 4JHOA 1ZAIA 1EP1A 5CBJA 5HQMA 3N9SA 2YLLA 1GT8A 3TFXA 2BODX 4BF5A 1EYEA 3OQEA 5G4EA 2A3CA 3M0KA 3WLQA 4JIHA 4WX2A 4TOQA 1S2AA 4XZNX 1WDQA 4AD5A 1IEWA 1FY6A 2RUSA 4RE4A 4ROPA 5JIPA 3LRMA 3SCUA 5HR6A 1PIGA 1MUCA 4OIFA 5F2GA 1HJWA 2QW5A 4BQ3A 4Z0SA 2XVPA 4O1FA 3OZOA 1SJAA 4PRWA 4ZOEA 1D9EA 3FKKA 1FWIC 1NQ6A 2WNQA 3CHVA 4DYEA 2ISDA 2VX6A 2VRJA 2C8NA 4E2VA 2NQLA 3LHVA 2G3JA 5CXPA 1KM4A 3R4IA 2QF8A 4K1GA 1G94A 4KWVA 3PC0A 2Q8XA 4YVVA 4S39A 1H61A 1OG6A 2XVKA 3ZVIA 4NU7A 3EA2A 1RQEA 3QMTA 1VEMA 3FGCA 2WM1A 2HVNA 2NT1A 2R1MA 4LEQA 4PTDA 2PDYA 3GKFA 2A7NA 4L6OA 4CQAA 1EUNA 3OLDA 3PULA 4ZSTA 4O17A 1CLVA 3IPWA 4O1EA 1CXFA 1W3NA 2PD5A 3DOPA 2GJXA 2GK1A 4EX4A 3FKRA 3L21A 4H6KA 2E0PA 4DNMA 5ABTA 3BJTA 5CZ0A 3LRLA 3O05A 4C7FA 4WXZA 3EDKA 3HFYA 4L80A 2VKZG 1HFBA 3MDUA 1ECEA 1ICSA 3HGSA 3ZZ1A 1XF0A 2P50A 4WGHA 1ZCOA 3Q2DA 1CX9A 1UUOA 2R82A 3DBPA 1XH1A 1L2QA 1WKDA 3QFEA 4Z1AA 3OBEA 3VMPA 2QCCA 4B3KA 1ONRA 3SB0A 2F9RA 3H12A 3STEA 1E1FA 3I10A 3LBOA 4GUJA 2X2GA 3PZNA 3FGCB 2PP3A 3C3NA 4PFHA 2VDIA 2Q02A 3DESA 1P0NA 4CD4A 3G1DA 2CZDA 2J9ZA 3LCWA 5FJIA 3W1PA 2CHNA 3AIWA 3AI0A 3MV11 1Q6GA 2PDNA 2GJXB 2GK1B 1ELSA 3R25A 3U4AA 3VNLA 1AUSL 1SFJA 1VFUA 1OX6A 4CNNA 4WCJA 5EU9A 4BQ2A 4GZIA 3WQFA 1I45A 3P6LA 1WBHA 5JQ9A 3PF3A 1K7XA 2TSYA 1Y5XA 2D3NA 2Y88A 4XAZA 4YTSA 2BVDA 2F84A 3T2QA 2W92A 4AHQA 3S83A 4D72A 4GVIA 4WSHA 2GWNA 4TTUA 1CLKA 4DI9A 3NQGA 3CIVA 3A4XA 3H7VA 1JPHA 3TYDA 4HQVA 3N34A 4Q4PA 3DKJA 4E6MA 1CGUA 1CGVA 4IPLA 2ISFA 1WDWA 3VPLA 1W56A 1MEHA 1C9DA 4V1XA 3AJXA 3AMGA 4ERGA 1F6YA 4GXPA 1KRCC 5T26A 3ZR4A 4WEVX 1E6NA 1F61A 1KM3A 3QY7A 3TU9A 4LV4A 3FA3A 4AWSA 1QHZA 5AHEA 1UA3A 1UA7A 1G69A 3CM4A 3WF3A 1KV8A 2PDHA 2DEPA 3TXZA 4WXYA 2CBVA 5FEXA 5EFDA 1H1NA 4OZOA 5DXYA 5DMLA 4NHVA 3P74A 3UG3A 4C1KA 4LEFA 3QRHA 3M1ZA 1AD4A 3C4UA 5LNSA 3WNKA 2VR4A 4Q8UA 4WOQA 1AK5A 1U5VA 3NQ2A 4HD5A 3MC5A 2JBMA 5CPTA 2EJ1A 3WDHA 4XZ9A 2VX4A 1RBLA 7A3HA 4G56A 1CGTA 4O19A 1XC4A 4KETA 1ZCCA 5EBAA 1V6WA 4HCDA 4C6PA 5EYWA 4WZHA 1IHIA 3ITTA 3ITGA 2JKPA 1UZ4A 3IJ9A 4MKVA 1GVEA 1GK8A 2ATMA 4YHGA 1FWRA 3SO7A 2GUUA 3AICA 4EF8A 3WQ5A 1TWZA 3MKVA 1QDSA 2UY2A 3LLXA 1KXTA 1W31A 3SIMA 3CAKA 2VTFA 1SSDA 4MB3A 5HJXA 4ML9A 4E3TA 4MWAD 1K9DA 4QCEA 1JNDA 2B7QA 4DNHA 3RJYA 1U83A 2X42A 1YNQA 1QR7A 1W5QA 4PSPA 1V4YA 5J5RA 1C8QA 4GMEA 1E4IA 2FB3A 1W1ZA 2QPSA 1UZDA 3S1WA 4D9PA 1D8WA 3RRAA 4YIWA 1LTDA 2I14A 1FP9A 3OA5A 4N9CA 1LL7A 3OB8A 2O7QA 2ZWYA 1P7TA 4GGBA 4Q7NA 4E4PA 4UUIA 1SJBA 3OG3A 2V6AA 1W8GA 4K7YA 1FCVA 5AB3A 3L0GA 4M1BA 2B7OA 1LOQA 4K68A 5CJMA 3VNMA 3C8NA 1PV8A 1LZOA 4MNJA 2EEXA 3TZFA 1EWDA 4AY8A 2QGYA 5CC6A 1JDEA 4LYPA 5HNUA 3BV4A 1YE6A 1F9CA 2OKTA 1XLEA 4LW7A 3WUFA 3I6EA 4HNLA 1KFJA 2PMQA 5FJRA 1B3OA 3SGUA 3QLDA 4FOJA 4RK8A 5LSMA 4NRRA 1L6SA 5B7ZA 3ZR6A 1GHSA 4JKKA 1PYFA 4GRSA 1DE6A 2CYGA 8XIMA 1QHPA 1JDAA 1PKYA 3PTQA 2YA2A 1ZLPA 3GHUA 4GIRA 1W3TA 4DF2A 1QK2A 2NWSA 4MZ8A 4Y7EA 3VKKA 1P7TB 1MQRA 3KOFA 4K7VA 3W86A 1G4PA 5CSUA 5K7JA 1TPFA 2Z4GA 4YU1A 3UJ2A 5C9UA 1BWLA 1UR0A 1VGAA 1KTCA 4G2DA 2W6RA 5AFDA 1J0YA 3JVAA 4ZFCA 2PSNA 2DZBA 5D2WA 3G3MA 5MHBA 4IXXA 3G6MA 3M5ZA 2C0HA 2GZXA 2ESCA 2XINA 1LT7A 2CLOA 1TRIA 4MZYA 1HG3A 3G1AA 4HU4A 4OWGA 2KAUC 2CITA 9RUBA 4S3EA 3ABXA 1EXPA 3FJLA 3AMLA 3I7SA 3WK2A 1TE1A 3B4YA 3GBDA 1LBFA 1TPC1 1T5AA 4TV6A 3B4UA 2X09A 3RIKA 4YYFA 1IXPA 3PBYA 3QMSA 1W0MA 3B9DA 3GE7A 2PLKA 5A6SA 1H0GA 4HGXA 1IQ8A 4GX9A 3SIZA 1ONWA 3NR0A 3RU6A 1TJ1A 2A2IA 1X1OA 3W7JA 4H7CA 1X8FA 2YFOA 4EXBA 2ODOA 1RLDA 4RNFA 4LOCA 3E2VA 3P62A 3I7QA 1G0CA 1V03A 5HMDA 2VT0A 1GQKA 1W32A 3AUOA 1LYXA 1QPRA 3R43A 1P5BA 2ISWA 3TYEA 1VCVA 5LGZA 2WZMA 4UNKA 2ASHA 1S5NA 5BYWA 2Q3RA 4H4IA 1B9BA 1UYQA 1XYBA 4E4UA 2Z2UA 4F48A 1VB9A 1C90A 1XPYA 4UTWC 1TWIA 3TR9A 1RQHA 2HS6A 2MANA 4YCPA 1N82A 3UWVA 1B3XA 4FA3A 3OBAA 3EMQA 3BLPX 2V0TA 3PJUA 3CHCA 1ZRQA 2JIWA 2DH3A 3EB4A 5AYIA 4KH2A 4GYPA 2Y7DA 1A50A 1EWEA 2XH2A 3K4WA 3NOYA 4WY0F 1BWVA 5I02A 5HDRA 3BLLA 3IS4A 4ZFMA 3ZWSA 2IXUA 4KMQA 3WMLA 1VBUA 3WLKX 2IQDA 5LGXA 4EVZA 1O95A 1RR2A 3WBAA 3IGSA 5HBFA 1G4TA 3HV9A 2P76A 2Y85A 4GG9A 3WLHA 4MDOA 1V3KA 4LTSA 4UXDA 2WANA 2Y8VA 3ARZA 4UFIA 4YVXA 2A4AA 4DWDA 2V5KA 3THUA 2VDGA 3UVAA 1AH4A 2IPJA 3VD9A 3DHPA 5DBTA 1IIHA 3VCNA 1ZSXA 3T0AA 4OU1A 1OGSA 1CB2A 5HJLA 2BXYA 3W87A 4MYAA 4A3HA 3PSVA 4DIAA 4ERAA 1TZZA 3TONA 1PDYA 3UWZA 4CNUA 4IZGA 2WWCA 3EOLA 1R87A 2P8BA 4FNPA 5TF0A 5G5IA 1X7IA 1TZ7A 2BGQA 2VENA 3PB2A 4HK5A 2FDSA 4C1LA 2Q71A 4ZEPA 2BVWA 4JTSA 1QO2A 3QM3A 4P7LA 1JZ3A 4AHPA 1S2UA 3MMUA 3CUJA 3WNMA 1IF2A 3O6CA 4IGHA 5AHMA 2Z7GA 3R58A 5AHLA 1MXDA 7TIMA 1O5QA 2YW3A 1E6ZA 1E15A 2CBUA 1X96A 1NWUA 5PTDA 2BHUA 1LCOA 2W5FA 4K36A 5AZ0A 4O4WA 5AOUA 2QULA 2V2DA 4IQLA 3OGSA 5C5YA 5D2YA 2ZWZA 4JTEA 4LUSA 1W9BM 4LGXA 1HW6A 5JH1A 3NQDA 5FCZA 3NQFA 3RCNA 1BF6A 3CAVA 4QDPA 4YYCA 1SW7A 1D8CA 4M5PA 3II1A 2XUCA 5A6KA 2QPXA 4C65A 1M7XA 2GUBA 1DIKA 3WDRA 4Y2WA 3Q58A 2CLLA 1V51A 5GNXA 1ZNNA 4DXKA 3F4DA 3BLIA 1ML1A 1NH6A 3NTYA 4LCQA 2BG5A 5A8GA 3AHXA 3B0YA 3AIBA 1JZ6A 3OVQA 1TMHA 2VEKA 1H41A 5DRIA 3E9AA 3RNDA 5D33A 1XD0A 4MTVA 3O1NA 3W85A 2Z26A 1FH7A 1OC7A 2VFGA 1EJ7L 1TPWA 3VMNA 1UWUA 1GOIA 3MO7A 3GM8A 1TWDA 4I5UA 3GDBA 4LUSB 1SO4A 4LVBA 4IUGA 2A3AA 2DDXA 2OEJA 2YFNA 3C56A 2P5NA 1ONEA 4AY7A 2OSYA 2WJEA 4HU8A 1KV5A 3QKEA 1HKKA 1TPB1 2PP0A 4P5UA 1S46A 3W7GA 2VVNA 1WZMA 1J0IA 7ENLA 3N25A 1E6XM 3N12A 2VVSA 1EPXA 3QQ1A 4D2JA 2D2GA 4HYRA 1ITUA 2DW6A 1GG0A 1E55A 1DP0A 4O1CA 3AYRA 3KZSA 1OIMA 4PH6A 2W63A 1POKA 1R5YA 3USZA 4C6CA 2VDHA 4DO4A 1MNZA 4L64A 1YRRA 5LIKX 1UMLA 2VI0A 3IJ6A 4ZO9A 5CPQA 2VEFA 4PEKA 3RXZA 1TPEA 2Y5SA 4ZXLA 4DBDA 5I06A 3LX9A 3BW2A 7CGTA 1XW8A 5C9ZA 4GKLA 1LLOA 1VIWA 3UXLA 3N9RA 3ZQ9A 4IQDA 1J93A 2UBPC 2C13A 1OADA 3E02A 4MIMA 3A12A 4Z1DA 3KCLA 3GZAA 4YTRA 4AC7C 3CAQA 3MMDA 5FJOA 3C2EA 3UZJA 1R9YA 3B40A 2V82A 2Q09A 3BCDA 2ACUA 5HWMA 3BCFA 2ANUA 3WK0A 4JXCA 1NM9A 3AO0A 3K5XA 5DLCA 3BQ6A 3MANA 4Q32A 2BB0A 3VIPA 2PU0A 2QCGA 1EDGA 3UP8A 4XBKA 3CHEA 4JDBA 4JYFA 3BICA 4JYEA 2IPGA 1LWHA 2PWEA 3CZGA 4AEEA 4BHYA 4J3UA 4I7UA 2OTDA 5FF4A 5JIWA 1SGJA 1RCOB 4JZ5A 3W02A 5AC8A 3ORWA 4C7DA 1B57A 3LNPA 1YDVA 4IX0A 3RFAA 1A4LA 4N42A 2FFCA 3LI1A 3WEMA 2WKJA 4HZMA 4WD0A 1QW7A 4FOKA 1XCWA 4NVTA 3VCCA 1TUFA 4H1ZA 4ZQNA 3W73A 4EANA 1R3SA 4HSNA 4JR5A 1OFDA 3ARVA 4IMDA 2TRSA 3EWXA 5B80A 4XAPA 1E6SM 2PWUA 4K8EA 3GDMA 4B4FA 1IZKA 4O11A 4B3ZA 3S6OA 1YE4A 3GLCA 3QYSA 1ZJHA 1HXJA 3MI6A 1BAGA 3ARXA 2QIWA 2Y70A 4EXAA 3PHAA 1XLBA 2XM1A 1XRVA 3I6TA 4L5ZA 1I2PA 3OYXA 2PRLA 3F4NA 1NDYA 2OFJA 3DI0A 2NV2A 4N0RA 3NO1A 2YA1A 3T07A 1OF6A 1CEOA 1CZ1A 1VC4A 2JEQA 5A6LA 2V9DA 4D6JA 1W1VA 4DWSA 2R24A 3VUPA 1JGMA 3WDPP 1GTHA 1S1PA 4L7ZA 4XZMX 1JCYA 5I3DA 3W1LA 5REQA 3GNOA 3KBWA 1D7FA 3CC1A 1Q4NX 3INPA 4XIAA 4HT3A 2CIPA 4JNYA 3BSMA 3GG7A 4JNMA 5D09A 5FF3A 4IF2A 4EWJA 5A8PA 4AZ5A 4FMVA 1NF0A 1BQGA 3TZNA 2Y63A 3LM7A 3S47A 1Q45A 4PMJA 3GH5A 5H8MA 1H4PA 2DJXA 3FNDA 2PFHA 3W28A 1E0UA 1ISXA 3RPMA 5F4WA 4MNLA 1NP0A 3WD1A 3NQVA 3SDOA 3OLIA 2HRWA 2GQ8A 4XD3A 4YHEA 2VX7A 3AFBA 2VEPA 3PWAA 2NSOA 5C55A 4LRSA 2WZIA 3DEQA 3K8KA 4DWSB 2YDRA 5A8OA 2JKAA 5ECUA 1R9XA 2C3ZA 2ZCGA 5REQB 1O5KA 5AY7A 1LL6A 2E4TA 3GH7A 2B4GA 3IWPA 4FLRA 5F2LA 2NQ5A 1HL8A 3E5PA 4H7VA 4D8ZA 3MSYA 3MWAA 5M03A 2E6AA 3RO6A 2FHBA 4N6EA 4A22A 3E6EA 1KRAC 2G3MA 3GW3A 1EQPA 1P0DA 2VZUA 1UW9A 3F7JA 1I75A 3DIPA 3E38A 4DAIA 4DBSA 4GPNA 4N7QA 2A3HA 1YTKA 1EC9A 3S42A 1UD3A 4GK8A 1PEZA 3V3WA 2F6UA 3IVUA 3L4YA 2CLFA 4AZHA 3BMVA 4DO7A 4S38A 1UWTA 5LNRA 4UFKA 2BY0A 3Q4DA 1KBIA 4J3ZA 4PB3A 1OY0A 1B31A 4ZSUA 4IGMA 1C93A 3M0HA 2PP1A 1EXBA 3FYPA 1LRNA 4RE0A 3JUGA 1DJQA 3H54A 5C7HA 4EKJA 1P48A 4PEEA 1T6MA 3PPGA 5I3FA 2WKGA 3D46A 3JRKA 4FAMA 5T9CE 1TX2A 4DJFC 2OKOA 4PTXA 1WUFA 2GJLA 3M16A 1OM0A 1OC6A 2EPKX 5AKQA 4XKMA 3T08A 3VO0A 1PZ3A 4CKQA 4ORMA 5LA2A 3IVTA 1NFGA 1PX3A 2QDGA 1MZRA 1A5SA 1HL9A 2FZDA 2LLEA 4BF7A 2EO7A 4NILA 3VFLA 2FPVA 4TMBA 3RM8A 4Y9NA 1FA2A 4H6QA 1Q6LA 1Q4WA 4NASA 1DJWA 3M0IA 4XZBA 5LA0A 5CCZA 3A3XA 3OIXA 3BOFA 2Z2AA 2WQPA 2DSVA 1UH3A 2QHAA 3N6HA 4PMOA 4XD4A 3O6YX 1UUQA 5GNYA 1VYSX 2Y89A 4IQJA 1SYTA 1CT5A 3MPGA 1IYXA 5ABGA 4BY3A 4F9DA 4LFYA 1HNYA 1Z89A 4HA4A 4FZIA 1FKWA 1O5RA 4I8YA 3TSBA 4M82A 4DPPA 2D1ZA 2WCGA 4C7GA 4HOWA 3H26A 2Y6ZA 4NZ4A 4W84A 4ES4A 4IPNB 2YIHA 3NO5A 4H6RA 1V79A 5D9OA 2Z1SA 4F0HA 4GC4A 1W3KA 5LNVA 2PRMA 1R3QA 1OGBA 3CYVA 4H9MA 4OGZA 1W9VA 3KTCA 4LUTA 1P4CA 4K8GA 5I6SA 1FDYA 1UJPA 3BLEA 3M0XA 2DVUA 1TV3A 3G8EA 1Y7VA 1FWJC 3ES8A 4PMVA 1S2TA 2UY4A 2F8QA 1ENUA 5G4WA 5A8QA 3DYPA 2D23A 1XGDA 3W26A 2PB1A 3SRFA 2F2KA 4Z2GA 2XU2A 5EKYA 4KIRA 1MEIA 1ODZA 1RP9A 2JEPA 3GTFA 1AW1A 1KFEA 3UVIA 5ABHA 1JRBA 1F4HA 4AZBA 3B04A 4P7NA 4O14A 2VFIA 3C3UA 3DFTA 4NRSA 1B3YA 1KM1A 4D71A 3SCTA 1ZP4A 4DBUA 4NF7A 3N1AA 3N04A 2PLMA 1WZKA 4PL1A 3T9PA 1F3TA 2B81A 1DOSA 2PURA 4F40A 1CNVA 3NM3A 2PTZA 4K8HA 4H9XA 2FZNA 3NXFA 3T7VA 4PBFA 4HMNA 1I0DA 1XKYA 2IPWA 4LUTB 2WK2A 3SUVA 1FHUA 3CGTA 1EBGA 1V6XA 4XUYA 3U7BA 3QV9A 1CB7B 2V5BA 4WSJA 3T78A 2QJIA 3LS9A 2I9EA 2VCAA 2B31A 3VNZA 3MBFA 2NZLA 4CNSA 3VDGA 2WZHA 2C71A 3G1RA 2CLPA 1H3GA 4GUGA 3QTPA 4NZFA 1H5YA 3FV9A 3G6LA 1IZJA 2RDWA 4NJGA 3KS6A 2I7GA 1YPXA 3QFWA 4E4FA 4FSAA 2MNRA 3AAMA 3QV7A 1BYDA 3BG3A 4TU1A 4MG4A 3TMQA 1RA0A 2DH2A 4HHHA 4URIA 3V4BA 3CK5A 2ZZ1A 2I56A 3HZ3A 2CZ5A 4MJ2A 4DXXA 3THCA 3TYCA 2INZA 2XFFA 5DQPA 1NDVA 5HNRA 4F0LA 3QVQA 4YL2A 4GY1A 4GFIA 4ZB2A 1W5MA 3A24A 4B91A 1R3TA 1T41A 4NNBA 4TVUA 1S5TA 3W37A 1BSLA 3WL1A 1X6LA 4L61A 3PTKA 2VYOA 3P61A 4PMQA 3LHUA 4AMCA 4DJEA 3N4EA 1V77A 4Q4SA 1W91A 2AKZA 4QLJA 1QXLA 1MQQA 2YCEA 3IEBA 4IJBA 6REQA 2X1UA 4CCEA 3SCWA 4A3QA 2NV9A 2J8TA 3A4JA 4PTNA 3MSRA 4HNNA 1E43A 3LZ3A 4J27A 3K30A 4OT7A 3SCVA 3QMRA 2VOMA 1KKRA 2VFEA 3CS2A 2EPHA 2QCDA 3CNYA 3UESA 3OLEA 3BGJA 1XLLA 4RE3A 2A79A 1MWOA 4KCUA 4O13A 3P93A 4HK6A 3PWIA 3QBUA 3T09A 4JDYA 4HA0A 4B15A 2I1OA 1Q6OA 4Q4KA 3APYA 1X8CA 2WBGA 4XV0A 5C9WA 1QHOA 4QE1A 2BS9A 3LK6A 4L9YA 1XUUA 1A5BA 5HPCA 4RZ5A 3LRKA 2FDMA 3CIXA 2ZUMA 1BXBA 4GJIA 3HPFA 1JR1A 4E8GA 1H11A 2QS8A 3U8GA 7ODCA 3KOWA 6REQB 4BR1A 3GYCA 1TX0A 3WNNA 3WQ6A 2WVTA 3WDIA 1EHNA 1H7RA 1JULA 2Z24A 3LTYA 4O52A 2FJUB 4C6NA 3B0VC 2Q8ZA 1MMFA 3EKLA 3IACA 3I68A 3GVQA 3RN6A 4JY9A 5AECA 2QCDB 4PMYA 3E0IA 1BTCA 1A5CA 3VNKA 1Q13A 4FHAA 4JX5A 1W3LA 5I78A 2YBTA 3K13A 1NIUA 4IWWA 5A6MA 4RXFA 2EGZA 1JXJA 2I5GA 1EP2A 1GCYA 4I9JA 2IKJA 3CAWA 4DJDA 3REQA 4UTFA 3AYVA 2PODA 4B92A 1OFAA 5I3JA 3GIQA 3UERA 2FGZA 2ZXDA 5HA7A 1VFTA 2P53A 2QZRA 1EP3A 2VD8A 3IV3A 1DJGA 5LHFA 3WLTA 2RFGA 4F2UA 3NZGA 3DYMA 4XBJA 1ME9A 1CW2A 4BS0A 4XBSA 3FSUA 2CWNA 3HGOA 3OYZA 2VC7A 1GVSA 2NQJA 3BOLA 2FVLA 4FXFA 2OQHA 1XLKA 4UTJA 3IIPA 3FAWA 1NF7A 2PPGA 5HOSA 4NXSA 2GQAA 2XVNA 5LIYX 5I3HA 4DI8A 4OVXA 2WVSA 2OLSA 3GNRA 3T2OA 1WKFA 1BYBA 1GOWA 4GNVA 4ZQRA 1O1ZA 1XGEA 1C8XA 2DSWA 1XIHA 4FPSA 2FKPA 1J5TA 4P7QA 1RV8A 3REQB 1HO4A 1KA9F 1GQNA 3N13A 3T1GA 5AHIA 4Y90A 3AXMA 3E0FA 5HWNA 1EZWA 5TIMA 1A49A 3LPFA 4F0RA 5AZ1A 3LM3A 4U2YA 4UQBA 4IMEA 4LAMA 4A21A 5G1TA 3RITA 4BK9A 2OJPA 1QNQA 5CG7A 4F2BA 3H4GA 1K3UA 4I6VA 2ZC8A 4MDPA 3NQCA 5E5CA 2WSKA 4DBEA 3C86A 1AL7A 3OGVA 3MV01 1M7JA 4F9JA 1Q6RA 4JTTA 3G0UA 2WNWA 4AISA 5JMUA 3G77A 2ZIDA 1TREA 5BRQA 4J2PA 1R85A 3ARPA 3GB6A 1UH2A 4QG8A 1JXKA 2GGGA 3UWQA 2EG6A 4ASTA 5FJJA 2ZRZA 5GQBA 3UG4A 3IAPA 4LRTA 1UD4A 1MFUA 4E3VA 4HA1A 3G1XA 5BOEA 2RDTA 4UTLA 2C0AA 5AN7A 3RPTA 3UNTA 3DC8A 2X7VA 3H2OA 3LHYA 3L0KA 3LV5A 5BROA 3NDYA 3A9IA 3EXSA 4UTIA 1HF6A 2RAGA 3VOHA 1SMAA 3T4WA 4YWIA 2BVTA 5HNTA 4LYKA 1XXXA 3G1VA 4PMXA 4ADTA 1XS2A 3UPBA 3EGJA 1XC6A 2W61A 1Y0EA 3KXQA 1VBJA 2IMRA 1M65A 3Q67A 2VFFA 4UQEA 3ZLGA 4DM1A 5A2CA 2WLZA 1QI3A 2BZNA 5I00A 4C60A 2QV5A 1E5NA 4Q7IA 3ZJ8A 1XG4A 3N29A 5D03A 3VYLA 3VKBA 1UROA 3TTYA 3NNTA 3OLGA 5CQ1A 3FIGA 3FA4A 1JUKA 1A5AA 1GONA 4KFNA 1RJQA 2TYSA 3QH2A 1F2JA 1NEYA 1FWGC 2QDHA 2QJGA 1V0MA 1H7WA 2VUNA 1G9HA 3UZ5A 1ICQA 3PPHA 5DEZA 3T0DA 4CQDA 1UG6A 1KM5A 4OOUA 3GHTA 4QNEA 3P0XA 2ZRUA 1KRMA 3WD0A 4XZHA 1I2NA 3A23A 1O60A 3CL6A 1ADDA 1U33A 4YN5A 3RHGA 1ICPA 1KO0A 1YXDA 3M0LA 1JZ2A 1VFLA 4NZJA 1ZP3A 4KCWA 4IXHA 3T05A 4LNCA 2WZEA 3WLMA 1DEDA 2GDVA 3TAKA 3WQDA 3CHFA 1MI3A 2OOFA 4LBSA 3RAOA 1AL8A 3L4UA 4HOZA 3VNIA 2BTMA 2E8ZA 2ZTKA 4D1JA 2W91A 2CLHA 1JPMA 1FCBA 2BX7A 3IIOA 1B9ZA 3KVJA 1BG9A 3KHJA 2PA6A 3L4XA 2WVUA 5HQEA 1PHWA 4RZ6A 1R3RA 3PUGA 3FN9A 1VFHA 2Z6JA 3UQNA 1E70M 1R0MA 3ANYA 1UIOA 3WFAA 1GWJA 4IOTA 3DYOA 2EBNA 1WXZA 5A6AA 2D73A 5TBOA 3UW6A 1KR0A 4REQA 4PA8A 2QV4A 5DY3A 2E1DA 5EBUA 3JW7A 2XPKA 1RBAA 4NP7A 1Q7ZA 3BARA 1LT8A 1O66A 3AIQA 1DBTA 1UKQA 2CESA 3N2BA 3IRSA 1J6PA 3T0CA 4FF7A 4M6UA 1XLDA 1IXQA 2PDKA 3QW3A 4O8AA 2O7SA 5FD0A 4P7OA 3GHSA 4KEVA 4S3CA 3WKZA 1VRDA 2OWWA 4CEUC 2QCHA 3ABRA 3A3HA 2QUVA 1U5HA 3MCOA 3CQIA 1BVWA 1V93A 3M46A 3FDGA 1W54A 3CL7A 1HO1A 2Z28A 3T40A 4HPNA 4DF0A 4V27A 4WJXA 2NQ9A 2XSBA 1EC8A 3MU7A 4RPQA 1TWSA 2OODA 4M24A 4TVCA 4S3KA 2WMIA 2AL2A 4Q8VA 4REQB 1LQ2A 4GYPC 4WHBA 4H8UA 3CQKA 1PYMA 4FB7A 1OSEA 1OK6A 2PAJA 1BXNA 4TX9A 2NXHA 3MYPA 1JQVA 3M6DA 1IWBA 3PANA 1N2VA 5IHRA 1AQMA 3UZXA 2OXNA 4LSBA 4OUEA 4FS9A 4DB7A 1CPUA 1W9XA 1TKKA 1A47A 3GR4A 4IGSA 4X2PA 3BDKA 1AD1A 3APGA 5TD4A 3P81A 5AC7A 3IK4A 2PCQA 4I5XA 2X05A 1QNRA 1TCDA 4QE4A 4GFSA 4PRRA 4QJ4B 1BPLB 1QASA 1CDGA 3AQUA 4G6CA 4ACYA 3W9ZA 3NDOA 2QCEA 3QGAC 2WMIB 2AL2B 3ABZA 4LC6A 1AW5A 3M07A 1RJRA 1G7VA 4HCLA 4N9BA 1B3ZA 1TZ9A 2OO6A 3USBA 2DUXA 1E0TA 4R9XA 3SY8A 5D8ZA 3S1UA 1BF2A 5ENLA 3CMFA 4B90A 2GVEA 1VBGA 3H2AA 3SBFA 4A3RA 3AIEA 3VD7A 4AZ6A 5DCBA 4O8RA 1GHRA 1UB3A 3HJZA 3VGBA 1OZMA 1QATA 4BQ5A 1U30A 1WP6A 3P82A 3PSWA 1QPQA 4RPPA 3E2RA 4AVFA 1NDZA 4FLSA 1XISA 1E0WA 3QC3A 1ZBKA 3M5YA 3UCCA 1EA0A 5CZTA 3TROA 5EFFA 3KBMA 3G3DA 4YTTA 3E12A 1QOPA 4JFWA 2ALDA 3AALA 1V6VA 2GGJA 1KFCA 3SSZA 1SO6A 2XH7A 4HNOA 5BNKA 4AG0A 1TVPA 2RH9A 3MUCA 1DTNA 1H60A 4L1GA 2VEMA 2R6OA 2AMXA 3TC6A 3QGVA 1M9HA 2CLIA 1KB3A 4UOQA 4B5WA 4GBDA 3S2MA 2ZZ4A 4ICMA 4XQ6A 3ONBA 1MW0A 1SJCA 1MVYA 3KOXA 3T55A 4AWTA 3KHDA 2Q8LA 4DLFA 2Z6IA 3OBKA 4JIRA 3TYBA 3U6WA 3ARRA 2DW7A 4P8UA 3W7OA 1W1IE 4WK9A 1H7XA 1QBBA 1TJRA 3AIRA 2VUYA 1KFLA 3EDJA 4HSHA 2RJGA 3LBCA 3O15A 2A6NA 3ZFHA 5D2XA 4UOZA 4IMCA 3VIIA 1K8ZA 4MJ4A 3SUSA 3AHYA 1FQ0A 1WA3A 1HJUA 4UFHA 2QJMA 4WSKA 3RMEA 2PDXA 3CO4A 2XWDA 3B0UX 9XIMA 4PULA 4L6HA 4DZ5A 3BXWA 1HJQA 4F8XA 2NXGA 4GCAA 4CCCA 2P0OA 3ANVA 1Z6KA 1UR8A 1PX8A 1EJXC 2R1PA 1XRFA 4EP8C 2A3LA 2ZYFA 1QRQA 2Z2BA 1A3HA 5DXXA 5D37A 5A8MA 1EO7A 4FX8A 2BGNE 1WZAA 4ACZA 3WLRA 1OCNA 4HCHA 3CQHA 4K2SA 3GU2A 2CPUA 2WYSA 2GSHA 3QPEA 3H55A 4BZYA 2QVNA 2YXGA 4MY1A 4I6KA 4CUCA 3TDFA 4DEFA 2E5DA 3DAQA 3KE0A 2PDLA 4O0QA 3G0SA 4DELA 1VBHA 1TIWA 4A8RA 1EC7A 2GSJA 5I79A 3HGRA 1W1B1 3W7EA 2VWSA 1XL9A 2DSUA 1TPH1 1KCLA 4PYSA 3CZEA 4RDVA 3GS6A 1KW1A 2WSQA 1W5NA 2D24A 3ARWA 5IDZA 3AS3A 3RLHA 1L6WA 3ZJKA 4BI5A 3VTRA 2OELA 3U9IA 3PBUA 4HU3A 4BI7A 3RO8A 2J6XA 3NPWA 1TJPA 4RZ4A 2J4GA 4ZZ9A 4Q8QA 1ITXA 1E6PA 1WKEA 4ACZB 4LBRA 2A7PA 4C6JA 4FX6M 4D6FA 5CC5A 1PKLA 5E0FA 4AD0A 4TO8A 1J2WA 3P80A 5FEZA 4N4QA 3VZXA 8A3HA 3PJTA 2X0HA 4YTQA 4N9EA 4ZE5A 4ZE4A 3HQNA 1WAUA 2QUUA 4LS1A 3SRDA 4GC3A 2OQYA 1X7FA 2OWCA 3RJXA 3H2NA 3TN5A 2G97A 1XIGA 1VLIA 1MYRA 4X9SA 1UQZA 2HCVA 4IPIA 5I23A 3EOOA 4QAIA 4EAMA 3TW9A 1OQFA 2PF8A 4CN6A 2FB2A 4HNUA 5F1VA 1XBXA 3VDHA 3PPCA 4S3FA 3W7KA 4U10A 4IGNA 5G1YA 3ONCA 4JL1A 4NAEA 4O12A 1LBMA 2GJRA 4AZIA 3TK7A 4B2DA 2UY3A 4B16A 3WQWA 4QSFA 3AXHA 2XH4A 1XUZA 2X2YA 4AHOA 1V6TA 3V1PA 3GKAA 1UMYA 2YB4A 3MI2A 1BVNP 3WEOA 1W3JA 3J7HA 1XPGA 1JZ8A 2NLIA 3B8WA 4DWSC 3L4ZA 1W9PA 5H6HA 2ZUWA 1XG3A 3NQEA 3C2VA 4OTKA 3WNPA 2O9RA 4LAOA 3G5EA 3WLPA 3EMZA 4R7OA 1MUWA 4AQLA 3H21A 1BSIA 4P61A 3MYOA 3TTSA 2C1HA 3PZTA 3CO8A 4FO4A 1DORA 3C2RA 1J18A 4ZMGA 4AXNA 3E2QA 1FFQA 3P67A 4KBXA 3CV1A 4Y96A 1N55A 5BZAA 2P1FA 1NY1A 4NAEB 3WENA 2ZC1A 3VMOA 3W84A 3H8AA 4XZIA 3N2OA 3FOKA 4FR1A 4AD2A 1FRBA 2OGYA 4UCFA 3YPIA 2WO5A 3FVMA 4V33A 4DJFD 4EPEC 3U2CA 3HQ1A 1O12A 5EA9A 6XIMA 2Q01A 3M5XA 2FTYA 1ZAJA 1QPNA 4O15A 4CU7A 5H8PA 3MP4A 9XIAA 4I3GA 1JIBA 2NXIA 1WOBA 3PZQA 4NJIA 2JFEX 1VEPA 1EYWA 2ZOXA 3AZSA 3VE7A 3QSTA 1IE7C 2WNZA 2X1RA 4PC8A 4QP0A 2XIOA 4GINA 1KXHA 4WDXA 5FESA 3N17A 4M19A 1M7OA 1PPIA 5LHEA 4L9ZA 1TUXA 3SQMA 2D0HA 4A6GA 1KBJA 4QJ5B 3NVDA 3KL0A 2FGBA 2OQLA 3UR7A 3E96A 4QFUA 4M80A 5HPOA 3CWOX 4JQAA 4AVOA 4IMGA 2AAMA 1UH4A 1UP0A 4HPXA 4BI6A 1EZ2A 1AMYA 2ZBTA 2OZTA 5I09A 1KM2A 1AJ0A 3R10A 1EFZA 2Z1BA 4DUXA 2PI6A 2FZ8A 2XIBA 3MWCA 3KRSA 1XIFA 3LZ5A 2B7PA 1LG1A 4N9DA 4GKTA 3DH7A 1U2YA 4GACA 1VFMA 1UCWA 3EA3A 1B3WA 3N4FA 1K9FA 4ICNA 5D32A 3QXBA 3H4WA 3WMBA 1E51A 4GYKA 3VILA 1EDTA 5AHNA 1E6QM 1F76A 3QHMA 5I7GA 3ZLFA 4JTGA 3UBPC 3B9OA 4AU0A 3O0KA 4NJHA 2ACRA 2F2HA 1MW1A 4JBRA 2Y1HA 2NVDA 1JF5A 2KX9A 3VCRA 3BJFA 4NI3A 4EPBC 1VD6A 4JFSA 3VIJA 4NX0A 1SMDA 1X1ZA 2QR6A 4NAFA 2EHHA 2W66A 3A6OA 1OFEA 2IQTA 3KRBA 3GTHA 1YTDA 3LMYA 1AA1B 3S3GA 3L4WA 4KEUA 3ZJ6A 3EAUA 2XIQA 1QOXA 2GJNA 3QOMA 2X16A 4GHRA 1OG0A 4H7ZA 3V1HA 3ZSSA 4MHBA 1V3IA 1Q8JA 2PDGA 3T4CA 3N73A 1DYSA 2FIQA 2OX4A 4CNPA 3LN3A 1IIGA 1V3JA 4W5UA 3R6IA 1SFLA 4S3DA 3STFA 3CB3A 3GHRA 4ZTXA 3WNLA 4GX8A 2HXUA 5A3HA 4B9ZA 2POZA 4L4PA 3CIWA 4O53A 3B8IA 1C3FA 1TV5A 3B0XA 5AC6A 4HTBA 5T8GA 2WSRA 4B5NA 2JF7A 4R85A 4D8AA 2YB1A 4PTWA 1PDZA 4ALDA 2I16A 3R1ZA 1V7YA 1EHAA 2V38A 4LAKA 4LS2A 5TNVA 2DQWA 4NAFB 4A3UA 4MF4A 3ARSA 2Y24A 4Q3MA 4JTAA 3DFSA 3V0UA 4YJ5A 1E3ZA 3UA3A 3SW6A 2XZ7A 1CCWB 3ZS4A 2B7NA 3U2OA 3R7MA 5A2AA 5E9AA 2E28A 2X0SA 3WCZA 1H50A 2YXXA 1EX5A 1X97A 1XYCA 5GNZA 5A8NA 4Z08A 5CGTA 3IJLA 2QAPA 3CLWA 4CQCA 2QEZA 4IIEA 2YBUA 1J0ZA 2ZUUA 2Y7EA 4PZVA 2X1SA 4HN8A 4G5DA 2QDDA 4NZCA 1EIBA 3MHGA 4D6DA 5H91A 2AGTA 2W4XA 4LYRA 5AYXA 3U5YA 4M0XA 3N18A 3BZJA 4E2BA 1NOUA 2NVCA 3SEPA 4JIPA 3S1VA 1TTQA 4PUWA 2YDAA 5CZSA 7REQA 2G3FA 1QI4A 2ICSA 3DGBA 3PBGA 3HGJA 2BGSA 5KZ6A 1O1HA 4M1RA 3RX4A 3NDZA 1T7LA 1VPQA 2VGFA 3EYPA 3GXIA 4J40A 1KBKA 3VGFA 2ZE0A 4S3JA 1BEUA 3MJMA 2OB3A 3GG1A 2O55A 3VKJA 3B8SA 3GTXA 5T91A 2EF9A 3MI3A 2HSAA 2X1TA 2CBIA 1DJZA 1PZ1A 3W7MA 1WDDA 5BMXA 4DZIA 3LG3A 1V08A 2WSYA 1VJZA 3RUBL 1YXCA 1H5VA 1JGIA 5A69A 5EGRA 4CQBA 1SM9A 4LC8A 3QEZA 4B9YA 3ITCA 1C7SA 3EOSA 2TMDA 3KDOA 4FXSA 4ZODA 5M5DA 2NSXA 4K37A 1KXQA 1NQKA 3UETA 2C16A 3VIMA 5LA1A 2I5QA 2DVXA 4Q6XA 2AGKA 7XIMA 2CNCA 2WHKA 3WY1A 7REQB 4US5A 2J7BA 3L0NA 3SCQA 1RCQA 3W6LA 3DHDA 1KWKA 1FWDC 3CLMA 4EF9A 1AJZA 1ISZA 5FEPA 4Z1YA 4Q4RA 1A5UA 2C1GA 3CQ0A 3P3BA 4MB1A 3FX4A 1GJUA 2VZSA 4XVEA 3K1GA 4BEUA 3SFKA 1UP3A 1PE1A 1WV2A 1L6GA 5GJMA 3AWOA 2E8YA 3WBXA 1W1PA 3KM8A 4NNCA 1RLCL 4Z2KA 4NQ1A 1F5ZA 2A6LA 4RV8A 1DKWA 3KBVA 4MSSA 4IISA 4X60A 5K4ZA 4FIRA 4AIEA 3L5AA 4PN2A 1JD7A 3VNJA 1R6WA 1A5MC 3R12A 3L65A 5K9XA 1R9ZA 3MVTA 2YCLA 4PUUA 2YSWA 1ZTVA 8TIMA 4BCEA 5CZKA 1OCBA 1XYLA 3BMXA 4HPGA 1W2PA 3AXXA 4S3BA 2NX3A 4RXGA 4QJ3B 1KCKA 3W2KA 3PTDA 3GU9A 1OB0A 2XFWA 1XI3A 4DJEC 3T8QA 2GLKA 3NVTA 4ZQCA 3F5KA 1NTHA 4TIMA 1KCZA 3W83A 5HINA 1M3UA 3K4DA 1FX6A 1GVIA 3W53A 2XGBA 3RCYA 1S5VA 3JR2A 2PTDA 4LBUA 3GD6A 1DXIA 1PSCA 3MUAA 3TKFA 4WJ8A 4L6DA 1QU4A 1I2QA 3VGHA 3OVPA 4O57A 1IXNA 1U1UA 1VCFA 5CGMA 1Y5WA 1R47A 3LD5A 3I4KA 3S5SA 2DT0A 5AC5A 1F74A 3FHAA 2Y4SA 2J6VA 2OZ8A 7PTDA 2YCLB 1FDZA 1EJRC 4R27A 4HJFA 1FTXA 1CXHA 4JEJA 2PEVA 4PB4A 1DXEA 4X2RA 3G1HA 4LJ3A 1WUEA 5E0KA 4C5YA 2DV0A 1RBOB 1TCMA 4NUWA 1JDCA 3BW4A 2XGIA 2C91A 1WDSA 3E5BA 3HU7A 4W7WA 5CLWA 1M01A 3NA8A 2Z1XA 3LQGA 4XZWA 1QI5A 4E38A 2OEKA 4W4QA 1ZHAA 2JIEA 3L5LA 4ORIA 3M0VA 3CQJA 1TFVA 3NZRA 1HP5A 2W62A 3AC0A 3VX0A 5J5DA 4TX8A 1M5WA 1KBLA 2HJPA 1NU5A 4K6AA 4DYKA 3HOJA 2ISSA 1FDJA 3LUTA 4BQ4A 5EMMA 1O7AA 2CBJA 4UTWA 3H2CA 4CQ8A 4DM2A 3TWAA 4DJDC 3LPPA 1R46A 4XAYA 3W7PA 1Q7QA 2J8FA 1B2YA 2XH0A 4C5ZA 5ABFA 3R8HA 3W6MA 4KQNA 1EEXA 1VHNA 2ZXAA 1DHPA 1EIXA 3N2MA 4R33A 4MKNA 1JYWA 2VQUA 4AEFA 1MDLA 3W29A 1NARA 4W89A 3GSMA 1OYBA 1W2VA 4W9TA 3XISA 2WJDA 1FVPA 2C1IA 3GFZA 2QPUA 3UEQA 2J47A 1G7UA 3NOEA 3NL5A 4P2VA 4I7WA 4QSHA 3S6TA 2J8GA 4C6LA 4N4PA 4KIEA 1OFRA 3EB2A 5CPMA 2XN1A 2C6QA 5K3VA 2VCBA 5DF0A 1TYGA 2OZ3A 1YTEA 2DUZA 5GJPA 2E77A 3W7NA 1J5SA 1S2CA 2PDJA 3O9NA 4G7EA 4Q4QA 4GVGA 3VK5A 2QMKA 3F4CA 5FF2A 4HHPA 3WH7A 5ABFB 3BLDA 3TJIA 3EXTA 3NEHA 2CFFA 3B9EA 4ATWA 3TAOA 3IIXA 4ZQMA 5CZJA 3RGTA 2VR5A 2EPMX 3QY6A 4Z42C 5MF5A 4DUVA 2MUCA 1AH0A 1MO0A 1O6IA 3L2MA 2JGYA 4Z1CA 1THFD 4MFEA