3W7DA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-5-170
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-5-170
rcsb
molecule keywords Dihydroorotate dehydrogenase (fumarate)
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7dA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7dA01
1OFAA 5AYXA 1PS9A 4BI5A 1JUKA 1OX4B 5IBXA 1VCVA 2DORA 4ZQOA 1L6YA 3NQCA 2E5CA 1HFBA 1TCDA 2KZHA 1K03A 1Q6LA 5BRBA 4JX4A 5KITA 3GDKA 2BSLA 1ZAIA 1FBAA 2VC6A 4YWIA 4UCGA 4TIMA 3EKZA 3Q58A 3P80A 1B4EA 2B7OA 3TDFA 2Z6IA 1SW0A 3W86A 3P61A 3C56A 3UWQA 2H8XA 2I14A 4IWWA 2C13A 3VFLA 2OZ0A 1XUUA 4NJJA 1O60A 1KTNA 4FNSA 3W7IA 5D33A 2YYTA 1QOQA 3EWUA 2ZFAA 2P1FA 4IPJA 2ATSA 4LY8A 1G69A 3TMLA 1TV5A 3C6CA 2X2GA 1DJQA 4M6VA 5LZLA 3TAOA 4AHPA 3NL3A 3N9SA 2R94A 2CLIA 3F4WA 3BG3A 3W7DA 3OA3A 1KFBA 3W7OA 3BO9A 4JX5A 4N6FA 5BNKA 4FNTA 3C2RA 3OEXA 4ADSA 4IX0A 4ZQCA 3CTLA 1FCQA 2X30A 3L2IA 4RV8A 2WV8A 3NGJA 4QSHA 5F1UA 4ZZ9A 2ZRVA 4WY0F 4LS2A 2YFNA 2GJLA 3FYPA 4XKYA 1J4EA 3UZ5A 2CZEA 4KFNA 1DJNA 1LBLA 2VFFA 2X1RA 5DCDA 3CQ0A 1XKYA 2A2IA 2V5BA 1GEQA 3EWWA 4QNWA 3N2XA 3L0NA 3NYZA 4XBKA 4BFAA 1SPQA 1F76A 2ABBA 1KM6A 3W1AA 4NJHA 4ZQNA 3EWZA 4WJEA 1AG1O 4Q4KA 3UNDA 3UXAA 2PC4A 5A5WA 1GVOA 3DU0A 4BWLA 2FFCA 2EGZA 4EF9A 3WK1A 4CCCA 2DZUA 2J6XA 4DELA 1W5NA 4GWEA 2WQPA 1IXOA 2ABAA 2YW3A 2A7PA 3Q94A 3CEPA 3T55A 4FIQA 3UY7A 3MJYA 1P0KA 4LUJA 3VE9A 1RR2A 1F2JA 3B05A 4K7VA 1KTCA 3S5OA 3KRUA 2E77A 1IXNA 1A53A 3I68A 3UY8A 1Z48A 4C1KA 1LZOA 5DXXA 3TROA 3VNDA 4YLWA 1R47A 2NXHA 2RDWA 2QCCA 3LCLA 3B0UX 4M5PA 3KOFA 3GAYA 3LOTA 3LXCA 4HT3A 4EOUA 3LI0A 5T26A 3T7VA 2TPSA 4RCXA 4NNCA 5EL1A 1V7YA 2YR1A 4MY9A 4MZYA 2ZA2A 1R2RA 3GDTA 2VXNA 5DXYA 4NXKA 1AK5A 4Y96A 5BMWA 3RMJA 3O16A 4NVTA 2NXGA 5F4XA 2VEKA 2VEPA 2Y6ZA 3G0XA 1BEUA 5G4EA 3O6DA 3ZWTA 2J9YA 2BX7A 3NG3A 3TJLA 1G67A 2EAWA 5CG7A 5KMYA 3IVSA 3TFXA 2QAPA 4UTWA 3WJXA 1M7OA 2YX0A 4EF8A 3KVJA 1SFJA 4MVAA 1AMKA 4ADTA 4MFEA 1DHPA 1WOAA 4O12A 2FIQA 1F74A 3TQKA 2ISWA 3PF3A 4LV9A 3FKKA 2YFOA 2TSYA 4CNOA 1LROA 2H3DA 5D38A 4AAJA 3ABOA 1GTEA 4C1LA 1K3UA 4A3UA 3W88A 3G1SA 4GUJA 3R8RA 4PA8A 3O6YX 2GVJA 3IGUA 3O1NA 1H1ZA 4N6EA 5J5DA 3NVTA 3W7HA 1SW3A 4JDYA 1NVMA 3G8RA 3O05A 2C6QA 2EHHA 4M7SA 2ZA3A 3QPZA 1P0NA 2A5HA 4JTGA 4ORMA 4QQ3A 4YMZA 3S9YA 3G1HA 2QCDA 4KWVA 1XFBA 1I2NA 3S1UA 5FESA 3T40A 1C9DA 4FXSA 1F5ZA 3O15A 2Z6JA 4LWWA 1GT8A 3LI1A 5LHFA 1Y0EA 3TA6A 1HG3A 1QCWA 4YL2A 3H55A 1QPNA 4MIMA 5HULA 1G4EA 1SUXA 2YYUA 2OX1A 4G1KA 4GBUA 3BGGA 3E96A 4N9BA 4O10A 5AYZA 1QFEA 1VH7A 2CW6A 4LVGA 3LHTA 2Y61A 2NLIA 4L4MA 2W0UA 3QMSA 3W7EA 2ZZ1A 5AN7A 1N8FA 3UYCA 3DHFA 4UFHA 3DFOA 4MZ1A 4LRTA 1FY6A 5C2XA 1F05A 2WOQA 1UB3A 1DL3A 3G0SA 4CNPA 3KVKA 4FNUA 4LC6A 3WJZA 1LYXA 1XC4A 2ZBTA 3HOJA 3THAA 3EXRA 2ZQ0A 1LRQA 1GZGA 1L2UA 2NWSA 3FOKA 4UMAA 4HNNA 4R34A 1H7WA 5HINA 1S3HA 1W3TA 4WZHA 3I7SA 1ONRA 5U4NA 3CIXA 1WYIA 3R5EA 5D2TA 3HG2A 3L5MA 1QWGA 4DPQA 5LNVA 1YDOA 3E12A 4DXVA 2RH9A 1F6PA 2WNZA 2E5DA 1BWLA 1EB3A 1W5QA 2OMAA 2ZTJA 1KLZA 3HMJG 3STGA 3S5ZA 3TXZA 3W84A 1KM5A 1ZFJA 2B7QA 3W1QA 1X1ZA 5HWJA 3BV4A 5EYWA 5K4XA 3T44A 2JGYA 4NNBA 1UUOA 1DORA 2PURA 1TJPA 1LBMA 1TREA 3LLFA 2YCEA 5KINA 3IIZA 3VCRA 3CEUA 4O14A 3W7PA 2QCMA 2WO5A 1OFRA 3MI2A 1ZENA 3BG9A 3NQ7A 2ZZ2A 4LC8A 1RQBA 1WBJA 4JTSA 4HN4A 1IXQA 3LERA 3LCHA 3PY2A 4L4LA 2YW4A 2JKPA 3IIPA 3YPIA 5D2XA 1JCMP 1O95A 3DH7A 1OFEA 1LORA 3LCWA 1JUEA 1W3IA 3ANYA 3FFSA 3GXPA 5AOUA 3W1LA 1EP1A 3R13A 1W1ZA 1X6UA 3ELFA 4RZ4A 2J24A 8TIMA 1G4PA 2CLMA 4LRSA 3W22A 4IPIA 3EXTA 1W56A 2V2CA 4NT0A 1T96A 4JYFA 1A5BA 5H91A 4FX6M 1H50A 2A7NA 4JY8A 2ALDA 3L5AA 3TUUA 4JTEA 3UPWA 1QPOA 3IIVA 1U5JA 1VRDA 4KFPA 2Y63A 2QCNA 4PCFA 1PHQA 3TX9A 3MO7A 3LX9A 3W9ZA 3L9CA 3A21A 2C1HA 3ZR4A 2XN1A 4M6PA 4JTFA 1XBYA 3G1DA 1KM1A 3QSTA 4JYDA 1DKWA 1ZCOA 1PVNA 4NUWA 2QAFA 5F4SA 2VFHA 4LOCA 1VLIA 2NWRA 3G1AA 3PWAA 3TE9A 2DZVA 4WXZA 1H51A 3RLVA 1TMHA 3GK0A 1TV7A 2HSAA 3O63A 3LRMA 5D2WA 5EMUA 5D05A 4O54A 1HTIA 3M5ZA 3TC6A 1X1OA 3C2FA 1JRBA 3N14A 1SW7A 4CCEA 1B9BA 3T4CA 2PE4A 1OK4A 3C3NA 4MLRA 3IEBA 4CCDA 3DAQA 4O13A 1I2OA 3JR2A 3TSMA 3C8FA 3TJXA 5G2IA 5K9DA 2G95A 2QUTA 3W2KA 2A85A 2GQAA 3W1XA 4LVDA 3NQ6A 3HGRA 3R2GA 4EVZA 1H7XA 3V75A 2E1DA 2H8ZA 3QMRA 3M43A 4O1AA 5L9FA 4RZ5A 1YTDA 4PL2A 1XDLA 2BLEA 3HG4A 3S1VA 4CQAA 4Y9AA 3ABQA 2PRHA 3MHGA 3OVPA 4GE8A 4HKPA 3HGOA 3OHIA 3L68A 1OX5A 3MI6A 3GDMA 5AC7A 4JICA 4LTSA 5C5YA 1P4CA 5DBUA 3SFKA 3GNNA 3SZ8A 4GC4A 3VE7A 3LHZA 3NDOA 1C29A 4JX6A 5HNRA 5EY5A 4MUZA 1NSJA 1W8SA 2JK2A 1WXJA 1JQXA 2WNNA 5AYYA 1KLYA 3TNOA 3NQMA 5HR6A 1KM4A 1GPWA 3PS7A 2VELA 4IMGA 3GDRA 3EKLA 3Q37A 4GUHA 2JKAA 3MBFA 2QJGA 1KW1A 1TPC1 2C0AA 3BLFA 3NQGA 1ME7A 4BK9A 3A22A 2BTMA 4UR7A 2AGKA 3DENA 4OU1A 4JD4A 2RDUA 4JY9A 3LHUA 1JRCA 2Y70A 2QCDB 3A9IA 4QJ1A 1R46A 5CKSA 2CWNA 3LRKA 1F73A 1WV2A 2DZTA 5ABTA 5LNUA 1GOXA 4O16A 4UFIA 2ISVA 3LTYA 4O1BA 4MYXA 1XCFA 2H6RA 5LNRA 4JNMA 3W1NA 3QJAA 1LCOA 1Z41A 3W3OA 2CFFA 3USBA 3FKRA 1O4UA 1KFJA 3B0VC 1GVRA 1SO6A 4IMCA 3W71A 4H6KA 1O94A 1KFLA 3W74A 1OHLA 5FEXA 1ZJIA 3VKJA 2H90A 3M5YA 2CLFA 2YPIA 4AF0A 3N2MA 3WK3A 2QEZA 2NX9A 2V8ZA 3STEA 5K2ZA 4XBSA 1GYNA 2I1OA 3M9YA 1OK6A 1YDVA 3IGXA 2QDHA 2Z0IA 3P8IA 1JCLA 4O17A 3TCEA 3CT7A 4HPJA 1Q45A 1R2SA 4S2BA 1UASA 1VLWA 3QC3A 3E02A 2QJIA 1I2QA 1JR1A 2RDTA 3E49A 3W1RA 7TIMA 3NQFA 4LS1A 1CW2A 3TH6A 3W2UA 3UWYA 4N4PA 3LTSA 1MZHA 2GQ9A 4RXGA 3W72A 1X7FA 3GR7A 3W70A 4RZ6A 2WKJA 2B4GA 2E6DA 2EKCA 3S0CA 1VC4A 2Q3OA 5LHEA 3BGJA 2Y89A 2QDGA 5K4ZA 1A5SA 1UCWA 4BI7A 1OF8A 3UPBA 1WQ5A 3DFSA 2OJPA 3F4NA 5HJLA 3NL2A 5GVJA 4FX7A 3L21A 4OV9A 2A4AA 1S5TA 2VENA 2X1TA 2DZXA 3B0PA 2J27A 1M7PA 3HPZA 1BTMA 3NEVA 1YLVA 4XZ9A 1LOQA 2V81A 1D3GA 2GPTA 5EA9A 5I3IA 1FWNA 4DBDA 3NPXA 1VR6A 2E6AA 1QO5A 2TMDA 3DGRA 2X1UA 1LTDA 5U7SA 1SZGA 2E5BA 4O53A 4U28A 2NX1A 1HO4A 3MW7A 4AH7A 4XTDA 3P84A 1KFKA 3PM6A 4AHQA 4JTLA 3BLIA 3G22A 1FWRA 4CNNA 4N2YA 4MFDA 1OFQA 1GG1A 2Y85A 4JGDA 3OBKA 4AB4A 4BI6A 3G1XA 5DELA 2QUUA 3EX3A 2V2DA 4O0KA 3L67A 4MYAA 4HNUA 3FJLA 2Q3RA 1THFD 1JCYA 4A2SA 1YTEA 4Z1CA 4U4MA 3DXIA 1FXPA 4S2CA 4ZVJA 3B4UA 3PB0A 3I7RA 4UFMA 3W7LA 1TQJA 4K39A 3M5XA 4UTTA 5F2IA 5AHIA 3PUEA 1VHCA 4GRSA 3RK8A 5FEPA 1MEWA 4GUFA 5CSSA 4DO4A 5LKYA 4B5NA 5LSMA 5HWMA 3MYOA 5CPMA 1FWSA 4I7VA 1KBIA 3VI2A 3KXQA 2FLIA 2TYSA 5A8GA 4DQWA 1OJXA 2GOUA 3L5LA 2NXIA 5D2YA 1HUVA 1NF0A 3RU6A 4UC5A 1LRNA 2PRLA 4WUIA 2A6LA 5HUPA 4FEZA 3LDVA 4JTTA 3QMTA 2HMCA 4FXRA 3NZ1A 4OBTA 3PBYA 3BW2A 1H7PA 1GQNA 3E0IA 5D37A 3NO5A 1EP3A 2V5LA 1L6WA 5LNWA 4AWTA 2GJNA 1KA9F 1I8JA 1XL9A 2Z2UA 2CLHA 4QISA 3C2OA 2ZRZA 1SO4A 3GYEA 4N9EA 3M44A 1Q3NA 1JCNA 1M5WA 1OFOA 1H5YA 5TQLA 2QR6A 1VPXA 5G5IA 1SZEA 3EX2A 3NQ2A 3LBMA 1T99A 2FB2A 4P2VA 1QOPA 1P5BA 1GG0A 1FDJA 3LXBA 4FO4A 3UQNA 1KM0A 3LCIA 1BWKA 3LHVA 3NNTA 2HS8A 5G4WA 1TPWA 3IGSA 4OHQA 5CPOA 4MZ8A 2ZRYA 3H54A 4RXFA 1JCXA 1YYAA 4UTMA 3DKLA 5D03A 1DQXA 1ZHAA 2O7QA 2YZRA 2DZPA 1ZNNA 2C15A 4O57A 1VYSX 1GJPA 4MY1A 3C52A 4A22A 1G7UA 3S8HA 2FPVA 3NM3A 1CI1A 4LUIA 4N9CA 4UTLA 3G8EA 1I4NA 1JVNA 5K3VA 3BK0A 5LGXA 4UTUA 5H2ZA 1GVSA 4TU1A 3MI3A 5CPNA 1MO0A 2C19A 2DU2A 4UTIA 3HQ1A 1R30A 4GUGA 1CX9A 3OG3A 1TV8A 2ZRWA 2DZWA 3W75A 3PBUA 2JGQA 5TIMA 4JIPA 2LLEA 4Y8FA 4AF0B 4O15A 1SFLA 3NQAA 3G24A 3P62A 1I2RA 2YGYA 3SSJA 1DBTA 4GJ1A 2C16A 1SZNA 3NL6A 4IOTA 2YSWA 4IMFA 4S1FA 4Q33A 4POCA 3NQ8A 3DI1A 3SY5A 4BR1A 5DY3A 4JEQA 3S1WA 3LM7A 1PCKA 3MP5A 3ABSA 3HGJA 2J88A 3I65A 1TTQA 3JRKA 3P8JA 2ZA1A 3MWAA 3UWVA 2V30A 1TJRA 3O06A 1IIGA 3HG3A 3KHJA 5C6MA 4JTUA 1H7NA 1O5XA 2CZ5A 4YXGA 5AHNA 3NXFA 1TIMA 5BW6A 1KBJA 1ME9A 3SR7A 2PRMA 1FCUA 2V9DA 1AW5A 1SO5A 4WY0B 3W83A 2OCZA 4QIUA 4WOZA 5K9XA 4N9DA 4ZMGA 1F6KA 3C61A 5I3GA 4UR8A 2WJZA 3SGZA 3C2VA 1XBZA 2G5WA 1FXQA 3B8DA 1KFEA 3I7QA 4LVFA 4K8EA 3PSVA 3PVFA 1ZY9A 2B0MA 5HQEA 3GXNA 1ZAJA 4I7WA 3NPWA 3GX9A 4AWUA 4CQ9A 3CPRA 4DEFA 1VS1A 1W31A 1K7FA 2G97A 3ATZA 4PH6A 1K7EA 4ONVA 4TMCA 5AB3A 4AHOA 3DZ1A 1A50A 4DF0A 5IBXC 2ZZ7A 3LXAA 2Q8ZA 3PC0A 3TXVA 4O1DA 3GR8A 2FB3A 1TPB1 2UV8G 1XDMA 3LRLA 3TIMA 3WJWA 3T78A 3BPWA 4NX0A 1WA3A 3FLUA 2VFIA 2QF7A 2ATMA 4O4WA 2BXVA 4O1CA 5CZSA 3I6RA 3S5NA 1K7XA 2RFGA 2A21A 3NQVA 2CU0A 1Q6OA 3IIOA 1OX6A 2ZZ5A 4ALDA 1LRTA 4FNQA 2FPYA 4Z1AA 3W1UA 4GFSA 1XUZA 1IGSA 3FA5A 3GB6A 4CLMA 3GAKA 3CLMA 1TYGA 3QFEA 4IXHA 5HWNA 1YXDA 1NEYA 3ZS4A 2R14A 4Z0JA 3UZJA 3L65A 5KZDA 1YXYA 1QAPA 4QAIA 1TRIA 4PC8A 1O5KA 3PB2A 3RF9A 2R91A 3W7MA 3B03A 2QCGA 4HPXA 5FEWA 4K36A 4UUIA 4ZQRA 3M5VA 3L66A 1ZAHA 2A6NA 3UWWA 3HO8A 3QF0A 2YDAA 4Z1DA 4AXKA 2IQTA 3LTPA 1U83A 3G1VA 1WX0A 1Z42A 1QR7A 3QW4B 1SSDA 5TBOA 5C55A 3RNDA 3EWXA 3A5VA 3LCFA 4LS0A 3CB8A 2B7PA 1H60A 4HIBA 3KRSA 3W7RA 1IIHA 1W3NA 4NJGA 4O11A 5DCEA 4IMDA 3EB2A 5E0KA 3RLUA 2WSRA 4TO8A 5EKYA 1W5PA 1JQVA 3LHYA 5IM51 2OT1A 4BWLC 4WX2A 3PR2A 5F4WA 4Z0SA 3A5FA 4JTJA 4UTKA 4AWSA 2ZRUA 1TQXA 4ICNA 1S5VA 4JYEA 1YTKA 1YXCA 4IXXA 1OYAA 5DY2A 2XFWA 4E38A 2RHGA 3PSWA 1KFCA 5K7JA 4HHPA 3P60A 1EIXA 2CLKA 3O8AA 2FDSA 4FIRA 2PCQA 1GVQA 2Y7GA 3LGEA 4Z08A 4ML9A 3STFA 4X22A 1XM3A 5FF4A 3W76A 4MJMA 3N9RA 1B57A 5FEZA 4R7JA 4X9SA 3KVMA 3M41A 1V5XA 3BARA 4WOQA 2O7SA 2X16A 3GKFA 2AAMA 1DOSA 1K02A 3MP4A 1N7KA 3F1QA 3IV3A 3WJSA 4IGHA 2ZDRA 3IRDA 2NV1A 1SSGA 2CZFA 4RKAA 5HUOA 3SJ3A 1ME8A 1OFPA 5J5RA 3G1FA 1K8ZA 1T0OA 4TX9A 4UMBA 1JUBA 5F2GA 1DQWA 3ABRA 1QMLA 4JTHA 2QCLA 4J9JA 2E09A 3KFTA 5SWUA 2NUYA 1H1YA 3NPVA 3IIXA 3P81A 4UTWC 5D2VA 1EPXA 1OFDA 3TSDA 5BOOA 4O19A 2NUXA 4IMEA 4K7YA 3GIYA 3E9AA 2GVLA 2GQ8A 2A7RA 4AEOA 4Q32A 3ATYA 3P67A 4NZFA 1FWWA 2F84A 1RV8A 1NAL1 1B3OA 4GUIA 4JTIA 2QCHA 4A2RA 2DJXA 2Y7DA 4N4QA 4K8HA 1DV7A 4FNRA 3U6WA 4OE7A 2Y7FA 3NA8A 1TPFA 4JR5A 3IVUA 3TKFA 1EP2A 4Y6GA 4FHAA 1QNVA 4KKXA 4AMAA 1TTPA 4ORIA 4WY0A 1FUYA 1T8XA 4O52A 2VEMA 4IQLA 1K8XA 1RD5A 2WSQA 1VQTA 4FB7A 1EUAA 3S42A 2Y88A 2QKFA 1EWEA 3QSRA 3W2MA 1UUMA 5I3KA 4ADUA 1VHNA 2JKEA 3CIWA 3HF3A 2YXGA 1TSIA 4RJEA 1L9WA 4GNJA 1W5OA 4HNVA 3BW4A 2DZSA 3QM3A 3S6DA 2VFDA 3QEZA 4CQ8A 3QQ0A 2Y62A 2ZZ6A 4Z1BA 4O0ZA 3W87A 3P74A 5D02A 3GVGA 4JDBA 3CHVA 1TPVA 5KZEA 3L0GA 3TSBA 2V82A 5CSRA 5E1QA 2QCFA 3W73A 3TW6A 1TPH1 1TPDA 1ICQA 1YADA 4ZQPA 3THQA 5FF7A 2CLLA 3MUXA 1EUNA 2J9XA 1TRDA 4WXYA 3NPUA 4DBEA 2ZRXA 3R89A 1RZMA 3GDLA 1W37A 1IXPA 4UFKA 4O28A 1UBSA 1TO3A 3SW6A 4LU0A 3F03K 3D0CA 3C2EA 2BWGA 3K30A 2E68A 1H7OA 3O6CA 2A1YA 1OFBA 5AFDA 5D30A 3G3MA 3SIZA 4O18A 3MP3A 4E2BA 2TRSA 5G1TA 4GXMA 4UNKA 5D09A 5KSWA 1X8FA 1ZALA 3HBLA 4XQ6A 5AHFA 3W1MA 2H3BA 4MLJA 2FJKA 3FJ6A 3G3DA 4OQVA 1HO1A 4W9TA 3FYOA 5I3FA 1H7RA 2CLEA 3LCXA 1WDWA 2C18A 1G4SA 1GVFA 4KFOA 1EEPA 3N34A 1KM3A 4TMBA 3TC7A 2WSYA 1XBVA 3QZEA 3MHFA 4WQ6A 3W7CA 4IUOA 1OYCA 4FX8A 1QO2A 3S5YA 1H63A 5HMSA 1ML1A 2EF9A 3DHDA 2Q8LA 1PE1A 5D04C 1PHWA 3HIJA 3EX4A 2D73A 3NL5A 2VFEA 3WK2A 1RVGA 1W54A 3NZRA 5FI8A 4KWWA 5F1VA 1GYLA 2FPTA 3G1YA 3AO0A 1NFBA 5AC6A 2NZLA 4UTJA 1LOSA 3TV8A 1JCJA 1H61A 3PUDA 1YPFA 3A24A 3S1XA 3DKJA 3NM1A 4ZL1A 3JS3A 2CLOA 2HTMA 2QCEA 1Q6RA 5F2MA 4DF2A 1VCFA 1KTBA 2RKXA 3CU2A 3C4UA 3HPXA 3DFTA 3OIXA 1LLZA 3EX1A 2NX3A 5DLCA 4N02A 3SI9A 1AL8A 3EX6A 1KV8A 1WBHA 5CZTA 1ICSA 2F7FA 1MEIA 4MPQA 3EXSA 4RR4A 5KZMA 1FDYA 1D9EA 5BMXA 3W23A 3PBVA 1TPUA 1A5AA 4LVAA 1PV8A 2P0OA 4UMCA 3W2JA 4LV4A 1VZWA 3QYQA 3R12A 1K8YA 4MY8A 1EWDA 2C14A 3WJYA 3NQDA 1TPEA 4LVBA 2FQIA 4IJBA 1VCGA 3CC1A 1SQ7A 5HR7A 4WD0A 1A5CA 5F2LA 4NZJA 3GXTA 3MBDA 4I9AA 3M16A 2Z1BA 3PBWA 3M0ZA 3DFQA 2ZCGA 3CWOX 3P5ZA 4JIQA 3C0JA 1IF2A 1I2PA 3LB0A 1J2WA 3G0UA 4IX2A 1XXXA 1ALDA 1J5TA 2A0NA 1FWTA 1OF6A 3LCGA 1KM2A 4AVFA 3TU9A 4UIOA 1N55A 5DCBA 2P10A 3EWBX 3KAOA 3B04A 3P7YA 3TQVA 5FF3A 3BG5A 1OX4A 1RQHA 3HG5A 1RQEA 4UFLA 3W7QA 1G4TA 3V1PA 1PIIA 1MXSA 2Y7EA 2FTPA 3TK7A 1QDSA 4QITA 4O8RA 3NR0A 1RPXA 2W79A 4NU7A 4DO6A 1G7VA 3EWYA 2DJLA 3PULA 5FF0A 4OT7A 1S5WA 4NJKA 4NNAA 6ALDA 1L6SA 3L0KA 3INPA 2EPHA 3TR2A 3HJZA 3W2NA 3SECA 3W7GA 4O50A 4MOZA 3UWZA 3QQ1A 4NX5A 5C54A 4HSNA 5DBTA 1UJPA 1TB3A 1LM1A 2GUUA 3BLEA 5FF2A 3Q2DA 4JXCA 3PAJA 1W0MA 4OWGA 5I3JA 2X1SA 3NOEA 4R33A 1G6CA 4Y90A 4K6AA 3KRZA 4NQ1A 3DI0A 1MSSA 4PL1A 1VJIA 3GZ3A 1HL2A 3DFPA 2QUVA 1MEHA 2VEIA 3AJXA 3CWNA 5AHEA 1AW2A 1XI3A 1VGAA 3GLCA 3U2OA 1Q6QA 1F7BA 3B06A 3MHUA 1R2TA 1TTJA 1FQ0A 2V0TA 4PFMA 4UFJA 1ICPA 5AHMA 3W07A 1H62A 3W1TA 1P1XA 2W6RA 4MJZA 4HNTA 5DN1A 4PTNA 4M7TA 4DO5A 3KVLA 5D32A 6TIMA 3W1PA 4NXSA 1VYRA 2WPBA 2JBMA 2VOMA 1B4KA 4PEKA 2DP3A 3W6YA 3M1ZA 1AW1A 4XKYB 4D2JA 3GKAA 2ZZ3A 3LV6A 2E6YA 3HB9A 3KX6A 3MYPA 4DF1A 4EIVA 1SR9A 1SO3A 4LT9A 2C3ZA 1GTHA 2BZNA 3HPSA 4X3ZA 1E51A 3PUOA 3RFAA 4YCOA 1TTIA 5G1YA 3W85A 1M6JA 4X2RA 3U8GA 2B7NA 4DPPA 1OABA 4JN6A 5EPDA 4XWUA 2HS6A 1LOLA 3N73A 1LBFA 3M7WA 3QH2A 3H53A 1EA0A 3N19B 4RX0A 4YCPA 3TMQA 4R53A 2ZTKA 3PG9A 4FNPA 3O07A 5CPLA 3MMTA 5CZJA 3NQEA 1Z44A 3M47A 3UWUA 5E93A 1WAUA 4UTHA 2J9ZA 1PL9A 2VKZG 2AQWA 4H4IA 3P5YA 4RLIA 3GNDA 4QNEA 1W5MA 3LBCA 3TQ0A 2I9EA 3LV5A 1GWJA 3FEMA 5CGQA 4UXDA 3UXDA 1BKSA 4MKNA 4LNYA 4M6QA 4A21A 5G2HA 3M6YA 1I45A 2GVGA 4I7UA 3TW7A 5L6UA 2QJHA 5KTLA 1QPQA 2XN0A 1PCWA 2ZYFA 2E6FA 3QPYA 3EEGA 1WOBA 3G18A 4FF7A 4XTIA 2OT0A 1C8VA 4OGZA 3STCA 3N3MA 5G2WA 2V2HA 1AL7A 3QRHA 4OV4A 1KV5A 5AHLA 1LDCA 1QPRA 2NV2A 4QM1A 4E2DA 4PODA 1OG0A 5MHBA 1FCVA 2ISSA 2VFGA 1VYPX 4TR9A 1LLWA 3ZWSA 1SZFA 3BW3A 5LNSA 1JULA 3DFNA 2WNQA 1FCBA 1YPIA 4XUGA 3DBPA 3CM4A 1OVDA 4E0CA 5K9CA 5AC8A 4JTKA 3WK0A 3LLDA 5EBUA 1D3HA 3TAKA 1SU5A 4M19A 4BF9A 2G96A 1ADOA 5CZ0A 1DVJA 1YDNA 4O4VA 3ZFHA 3WFAA 1FDZA 3FS2A 2XN2A 4ZQMA 3W2LA 1OYBA 5I3HA 3FIGA 4RK8A 3W7JA 1JJKA 4HSOA 4H3DA 3IVTA 1LP6A 4UNLA 4UTTC 3W7KA 3A23A 3BVJA 4LW7A 2R8WA 3NAVA 4K37A 4P61A 1NF7A 3TFCA 3W7NA 4A29A 3OVRA 3SGUA 3UD6A 3P82A 2ZZ4A 3HGSA 1FX6A 2NUWA 3QW3A 4EWND 3PG8A 1EX5A 2CZDA 4K38A 4NJIA 3LHWA 5LGZA 3OVQA 4JS3A 1XBXA
chains in the Genus database with same CATH superfamily
1OFAA 2C8NA 4S38A 2VRJA 5IBXA 3HQOA 4US5D 2KX9A 4Z2HA 3DUGA 2V3GA 4LB4A 1KR0A 2XHYA 3PZVA 1YW1A 2V3DA 2KZHA 1CLKA 1Q6LA 2ZIDA 5EFFA 4Q8TA 2VC6A 3QV9A 3L7RA 3OBAA 2GVYA 2Z28A 1I75A 5HMFA 3IGHX 3W81A 1OADA 1GZJA 1DWIM 1G5AA 3P61A 3UWQA 2I14A 2WANA 4IWWA 2FZMA 3VFLA 4NJJA 5CC6A 1O60A 3R8HA 1YX1A 4Y9MA 1KTNA 3W7IA 1QNQA 3EWUA 2P1FA 1ISWA 1TV5A 4V1XA 3VABA 4AHPA 2GQ3A 3NL3A 2POZA 3BG3A 5JMUA 2UY2A 3BO9A 4JPGA 4ZTXA 5BNKA 2ON3A 1EJTC 3FXYA 4Z1YA 3VKKA 2WMIB 1DTNA 3C2RA 4IX0A 4ZQCA 1FCQA 2ZUWA 4AX6A 4ZZ9A 2DW7A 2ZRVA 4WY0F 3WLHA 3CHDA 2REQB 3QLDA 3LNMA 3FYPA 1OM0A 1JNEA 4KFNA 4H8NA 1DJNA 1M65A 5DCDA 4LEQA 1B0IA 1Q63A 2A2IA 1XCXA 3L0NA 2CKRA 3R58A 3SUSA 4MJ2A 4NJHA 4ZQNA 1XIBA 3ZR5A 1EOKA 3LZ3A 2OWCA 1FHLA 3ZVIA 2VGGA 1P7TB 2Z7KA 4EF9A 4CCCA 5HJYA 4H8HA 4GWEA 2SFPA 2WQPA 5BXSA 3U2EA 2YW3A 3TC3A 4DAIA 5HA7A 1UA3A 3A4WA 3WQDA 1E70M 4GCAA 4KETA 1RK5A 2QULA 3UY8A 4WF7A 1TJ1A 3OP2A 3B0UX 2WKLA 5FAGA 1I0DA 4EOUA 3SFWA 1FH7A 3P3BA 3T7VA 3CUXA 4JFWA 4NNCA 4HA0A 1R3QA 1R2RA 3M46A 2ESCA 3WBYA 4IIFA 5M03A 1BYCA 1Q6CA 1KXVA 4ERAA 2VEPA 4F8XA 1DIEA 3ZWTA 4PEEA 1G67A 3MZ2A 5KMYA 3IVSA 4F0KA 1CDGA 2YX0A 3RITA 3FHAA 1CBGA 1R6WA 1S2UA 1YNQA 4MFEA 4C6NA 1DHPA 3I4KA 1F74A 4Q7NA 4MWAC 1LROA 5D38A 3BE7A 1GTEA 3TN4A 4M80A 1KCXA 1AJZA 1JDDA 3MZNA 4IJRA 4LH8A 1CB7B 2ZE0A 3O1NA 3IGUA 4N6EA 3EOEA 3VFCA 3CMJA 3W7HA 1SW3A 3UR7A 5HOSA 4LBRA 8CGTA 1XIGA 2P88A 3WNKA 2V5CA 4ENLA 4YMZA 3U57A 3CNYA 4WVXA 1QUMA 2P53A 3V5OA 3VOGA 3TW9A 2HBVA 4LF2A 1XFBA 3S1UA 3T40A 1C9DA 2C7FA 4FXSA 1F5ZA 4LWWA 1EO7A 2C91A 2VX7A 4UOQA 4GX9A 1QCWA 4NZ4A 4K1WA 1QPNA 1SUXA 1S3TC 3CQHA 2V5JA 3BGGA 3FYYA 3NJ3A 4O10A 1OC5A 3B8IA 4U31A 4QXIA 4I90A 3RPTA 2NLIA 4LYQA 3QN3A 1X39A 2ZZ1A 1WDDA 3FAXA 1EYEA 1N8FA 1JFXA 3DHFA 3RAOA 3WBAA 4C7DA 3T81A 4LRTA 5C2XA 2WOQA 1UB3A 1Q13A 2Z2AA 3G0SA 4CNPA 2DQWA 3MMDA 1IEIA 3KRBA 3SURA 1E6PA 3EXRA 4PUKA 1LRQA 1GZGA 4QGCA 3SCNA 3NGFA 3BLLA 4UMAA 3II1A 3CB3A 4IPPA 1S3HA 4B5UA 4UQAA 5CSYA 3R5EA 1GCYA 3L5MA 1QWGA 1YDOA 3E12A 1E6RA 4HNOA 4DXVA 2E5DA 1BWLA 3PPGA 4GQQA 3WDRA 4F48A 3P0WA 2ZTJA 3LMZA 2D0HA 4XZIA 4RW3A 1KLZA 5D9MA 3TXZA 2BY0A 2B7QA 3W1QA 5HWJA 1E43A 3BV4A 4PBGA 1XINA 4NNBA 4EKJA 2DZBA 3SRFA 2YCEA 5KINA 3VCRA 5I0DA 3W7PA 4NYYA 4V1YA 3H2FA 2QCMA 1CXFA 3JVAA 3BG9A 3NQ7A 4NI3A 1V79A 1KQZA 1TELA 4LC8A 2GSJA 4HN4A 4JTQA 2A3AA 5HJXA 3OGSA 1X1NA 2YW4A 5FJOA 1TV3A 3I6TA 3DH7A 2OG9A 1BYBA 3R0DA 1RJRA 3HPFA 1VAHA 4C6IA 1NH6A 1BYAA 5AOUA 3A9BA 4YVVA 3CPGA 2CLMA 3EKGA 2OQLA 3AU6A 1UR0A 3RN6A 4GABA 4FX6M 2A7NA 2HE8A 1EFZA 4JY8A 2PWUA 2ALDA 4P5UA 4LEFA 1Q7MA 2X2YA 4JTEA 2R1LA 3UPWA 4PMOA 4KFPA 2VDHA 4I3GA 4E3VA 4F4RA 1XIMA 1NP2A 3MO7A 3QOMA 3A21A 1KM1A 3IWPA 2HROA 4JYDA 4C6PA 1E1CB 2QAFA 4XX6A 5DO8A 3AIBA 4Z2LA 2ACUA 2NWRA 3TE9A 3PWAA 2DZVA 4Q4MA 1TMHA 1UOKA 4MM1A 1TV7A 2HSAA 1UR2A 4O54A 4JAWA 3MKKA 4Q8UA 1W1VA 1C93A 1B9BA 4GO8A 1RY8A 4I5UA 3C3NA 4QR6A 2WVSA 4HN8A 4GVIA 4GI8A 4O1EA 3C8FA 2VZVA 3UBPC 1XG3A 3WH7A 1S2CA 3NQ6A 2BP1A 1JYNA 4F0HA 3MV11 3BLKA 3GTXA 1XH2A 3T0BA 2WZEA 1EPVA 2VDIA 4U5KA 4RZ5A 4WCJA 4LNCA 4TUFA 3S1VA 3QHNA 4Y9AA 2PRHA 3OVPA 1UR1A 4E8DA 4CD5A 3L68A 4JHMA 1P1MA 4NAEA 3MI6A 3GDMA 1FWBC 5C9UA 1P4CA 2FH8A 3L2MA 4DZIA 1C3FA 4GC4A 1VIZA 1OINA 5LXEA 4FP1A 3LHZA 1ZB5A 1GUVA 1R9YA 3ZJKA 4MUZA 3GYCA 5IDIA 1W8SA 2EJAA 1JQXA 4CCZA 2XZ9A 1I1XA 3KCOA 2DT0A 3NQMA 5HR6A 1KM4A 3Q37A 4Y9NA 1EGMA 2JKAA 3GIPA 3ARSA 2OVLA 3C0QA 4AVNA 1ME7A 4BK9A 2J74A 4UR7A 4E8GA 2RDUA 5CJMA 2BDQA 3OQEA 1UKTA 1WV2A 4TQTA 1GYMA 9XIAA 4NY2A 2ZVRA 2VO5A 1UC5A 1DJZA 4ZOBA 4K68A 5CH9A 3UERA 5LNRA 1L6GA 4XSLA 5B7YA 3W1NA 4B5SA 5IRPA 3QJAA 5CGTA 3PZTA 2BVTA 3GHRA 4IQEA 3SCRA 2PLMA 1G9HA 1LG1A 3SCOA 3VO0A 2CLFA 2GOKA 3N2MA 2XU2A 2V8ZA 1SM9A 1PYFA 1YDVA 4WR3A 2CHRA 4PB3A 3CT7A 2WB5A 4HPJA 1GQKA 1B9ZA 2R1PA 2DPEA 4HA3A 3W0KA 3OYZA 2JF6A 2DVTA 2XIJA 3S2JA 3E02A 4YYCA 4XV0A 3GG1A 3NSMA 1QW9A 2XG9A 3B8VA 7REQA 1MZHA 2GQ9A 1C92A 4XZNX 3W28A 1JNDA 1X7FA 2Y2WA 1LWHA 4B5XA 3WMLA 3W70A 4RZ6A 4Z42C 3RX4A 3AWNA 3LENA 2OYLA 5GNXA 3S0CA 2Q3OA 5LHEA 3BGJA 4W7UA 1AQFA 2XIQA 5K4ZA 1F4HA 1UCWA 2PPGA 3UPBA 2OJPA 1PDZA 1EIBA 3NL2A 1J2BA 2A4AA 2HVOA 2R1KA 2KAUC 1M7PA 1LOQA 1V3KA 1D3GA 3WMCA 4MGGA 3SM0A 1XRTA 3BZJA 1FWNA 4JFVA 3VGDA 3PAOA 4BEUA 1ZJBA 4HJFA 4C90A 1QO5A 3F5JA 1WDPA 5U7SA 4J3SA 1HJQA 1SZGA 3MKVA 2Y24A 2VGBA 4O53A 4U28A 1HO4A 4J1OA 1C8YA 5E6ZA 4CNNA 2F2KA 1S5MA 4HYWA 2CZVA 1KXHA 4XZWA 3OBKA 3KWSA 4GINA 1F3TA 1XDJA 3G1XA 3OODA 1PX3A 1WP6A 1MFVA 2DUXA 4HNUA 3NIYA 4Z1CA 1M04A 2XIMA 1FXPA 1V6XA 4MHBA 2ZC8A 3B4UA 2VL4A 1JXJA 4H2HA 1IZCA 1MUMA 1WCGA 3V5FA 1KD0A 1X7IA 1DIDA 5AHIA 3PUEA 4JCMA 3AI0A 1VHCA 4MAZA 5GJMA 3NURA 3RK8A 1XRFA 1W3KA 4H9ZA 4Z2KA 1SJCA 5LSMA 1ODZA 4Q8WA 3MYOA 5CPMA 1FWSA 4CEXC 2TYSA 4DQWA 2WC4A 3L5LA 2MNRA 1HUVA 4MKSA 1PO9A 3VOHA 2I17A 2YBTA 3H2NA 4LAMA 2OTDA 3NZ1A 3FVMA 1H7PA 4IMAA 2EBNA 1MXDA 3IK2A 5XIAA 1IWAA 2V5LA 5M17A 4NAEB 2ADAA 1L6WA 1V0NA 1W8GA 4A4AA 1I8JA 2AKMA 1OC6A 1EXBA 2QYGA 2ZRZA 3GYEA 3T6CA 1M5WA 5TQLA 3VNJA 1SZEA 3A12A 3EX2A 3SDOA 2FB2A 4P2VA 2X0HA 4NILA 1SMAA 3LHVA 3NNTA 1S2WA 1BLIA 4MZ8A 3CV1A 4ZCWA 4QCEA 3S46A 1CGUA 5IXEA 1JCXA 1YYAA 4DIAA 3DKLA 3T2PA 3ARTA 3GS6A 3H24A 3JU2A 4L6HA 1YRRA 4O57A 2VRQA 2HVMA 1M3UA 1XLGA 3IJ8A 4E2VA 3NM3A 2X42A 1PPIA 3TYDA 1I4NA 3GFYA 3U7BA 2WXDM 4UTIA 4GUGA 3OG3A 3KP0A 2ZXQA 3W75A 5HPOA 1TV2A 1UQZA 5TIMA 2ANUA 1GW1A 2FVMA 2LLEA 4OOZA 3NQAA 1XRSA 2XIBA 7A3HA 1XR2A 1F8IA 3M0LA 1UZHA 3LN3A 4IMFA 3NQ8A 3AS3A 3ITGA 3AALA 3WD4A 1A80A 1VFFA 4NRRA 3ARYA 2VQTA 3ABSA 3HGJA 1K77A 4MWAE 2DSKA 1TR1A 3UWVA 2V30A 3O06A 1XWYA 3WLTA 4F0LA 2HCVA 3N18A 3SCWA 3NXFA 5BW6A 3SR7A 7REQB 5DT5A 4WY0B 2WNWA 1U5HA 3KDOA 4NSBA 1F6KA 4KEZA 4PMYA 1BVWA 4NG3A 3ANVA 5EMKA 1S5NA 2RDXA 3I7QA 1BKHA 3JW7A 3PSVA 2B0MA 5HQEA 4PMDA 1RD6A 4I7WA 2IUZA 5CLTA 4JQ3A 4AWUA 3N4AA 1K9TA 3S6TA 3ENLA 5LYRA 1OB0A 3V0TA 3CXOA 3ATZA 3SIMA 4AHOA 3O0KA 4NI8A 2XSXA 1CT5A 3D46A 2FB3A 2UV8G 3H23A 3WJWA 3T78A 1WA3A 3FLUA 3WQCA 2VFIA 1JCTA 2OZTA 2QF7A 3K46A 3RDKA 3EB4A 2VZOA 5E0FA 2FZ9A 2PDJA 2CU0A 3KE0A 3GNXA 4IIBA 1LRTA 4Z1AA 1UP0A 1KBLA 3SQLA 3H4GA 4GFSA 3BSGA 3B9OA 1IGSA 3LS9A 1CGVA 3AIWA 4CLMA 1DYSA 1E72M 1EEXA 3CLMA 4G1NA 1YXDA 1FWFC 2FKPA 1J6OA 4Z0JA 3L65A 4DWSD 3GO2A 3OIHA 5J04A 4DUOA 1F3EA 3RM4A 4DI9A 5I78A 2QPSA 4RDWA 3USZA 4UUIA 3RCMA 2Y5EA 2EQDA 3TEVA 2YDAA 2J7DA 1RP9A 4GVFA 3LTPA 1HKIA 3UFYA 4LS0A 3WLLA 4YVPA 1V6UA 2F8QA 4D8AA 2B7PA 1H60A 3RIKA 1QHZA 1ESWA 4NJGA 5E0KA 4GQRA 4HK7A 2FTWA 1W5PA 3CAQA 5IM51 4F2BA 3I3DA 4BWLC 4WX2A 4Z0SA 3ID7A 5F4WA 4KWSA 2I5GA 5XIMA 1A5NC 3GE7A 4AWSA 2Z1XA 1D8CA 2JF7A 2YXOA 5DY2A 4E38A 2XFWA 4JOMA 1PKLA 3D5HA 4ERIA 3WKZA 1VEOA 2FDSA 1VFMA 3SO7A 3GU2A 1YDYA 2O0TA 4B5VA 4Z08A 4LUSB 3STFA 5FF4A 3W76A 2Z27A 1S2VA 3N9RA 1B57A 3KVMA 3T9PA 3M41A 4W88A 3FNDA 3BOXA 2VX4A 2D22A 2JEPA 3LPOA 3IV3A 2NQZA 2ZDRA 2NV1A 5HUOA 1ME8A 3SQSA 1OFPA 4UMBA 1A47A 4GLEA 1QI3A 1DQWA 3H7RA 4R9OA 3VUPA 5SWUA 2WMGA 2DUZA 4UTWC 4GZJA 3TSDA 4H9VA 1NOFA 4JZ5A 4HCHA 4IMEA 4CNUA 4K7YA 2GVLA 1QOXA 3M6DA 2A7RA 3C86A 4Q32A 5REQA 4NZFA 1FWWA 1RV8A 3LPGA 1B3OA 4GUIA 3CHCA 4A2RA 1DV7A 3U6WA 3RU8X 1P48A 2PU1A 4OE7A 2G41A 1E6ZA 1VJSA 1QNVA 4AMAA 4PMQA 1TTPA 2XYLA 3N3TA 4O52A 1HT6A 4IQLA 3BUVA 2Q8XA 3WH6A 3TTSA 3HFTA 2Y88A 1OY0A 3N25A 2W9MA 3MMUA 1EWEA 3QSRA 1UUMA 3UG4A 5I3KA 1VFOA 4ADUA 4ZSUA 3HF3A 3OBEA 3MA8A 1TSIA 2VM8A 4P8WA 5EBAA 3QM3A 1C91A 6REQA 4D6CA 3VGFA 1LJYA 2PAJA 3EZ4A 2Y62A 2ALRA 4AEFA 4ECLA 2Z1VA 5C70A 1WDQA 3B8WA 3CHVA 1UD5A 3F7JA 2V82A 4B3KA 1TJ2A 3GY1A 3TW6A 3LA4A 1TRDA 4WXYA 4Q8PA 1W2VA 3U0HA 1W37A 4UFKA 1W1PA 1UBSA 3L4XA 1TO3A 3SW6A 4YHGA 1O68A 2J7CA 3H2MA 5AY7A 4DJDC 3H4WA 4GI9A 3K30A 1E55A 1EDTA 3O6CA 4OVXA 1E5JA 1A4LA 2A1YA 4L64A 3G3MA 3VOFA 4GMEA 4O18A 3WLSA 5BXRA 3ONCA 4E2BA 4KGLA 1CXIA 1HXJA 4E5TA 2J8GA 5KSWA 3HBLA 1ZALA 3A3XA 1IYXA 3NXLA 4MB4A 2WWCA 3G3DA 4L4PA 3WH9A 5I3FA 1EJVC 5A6LA 3LCXA 3APGA 1TE6A 4KFOA 1MWOA 3RJXA 4JNYA 2VD8A 3TC7A 1BGGA 3MHFA 4XSMA 2GVEA 4FX8A 4GK8A 1U1JA 2NSOA 2PP3A 3KOYA 3EX4A 3PNUA 3NL5A 3BAWA 3WK2A 3UEQA 5I00A 1V93A 3KBSA 1R38A 3ARRA 4X9YA 1J8VA 1D7FA 2A3BA 4D6GA 4KWWA 2E3ZA 2BOFX 1LQ2A 2OR2A 3TWAA 4UZSA 1RJQA 3M0HA 1H49A 4MB1A 4KPLA 4AYGA 2VDGA 4JQ2A 1XYCA 1YPFA 4DXKA 5GNYA 3A24A 1IR1A 1GZ1A 1PBGA 3DKJA 3JS3A 3KOWA 3W26A 3H7VA 3DECA 5F2MA 1EQPA 1HGWA 1RLCL 1MZRA 4EPEC 2CLPA 2BY1A 4DF2A 2VCBA 3HPXA 3QR3A 4QTGA 3BQ5A 2GSEA 3BJTA 2NX3A 2D23A 4N02A 4JCLA 2WSKA 3EX6A 1KV8A 1WBHA 5CZTA 2F7FA 1C7TA 1TZ7A 3EXSA 2VWTA 2C0HA 1FDYA 3V18A 1JYWA 1D9EA 2YCKX 1XIDA 3PBVA 4Y9OA 5AYIA 1TPUA 2PDNA 2HWGA 2P0OA 4L5ZA 2UY5A 4LV4A 4O1FA 3QYQA 3R12A 1K8YA 1EWDA 2C14A 3NQDA 4ZO7A 4LVBA 5AVHA 4R9XA 1VCGA 4QQUA 5HR7A 3K4AA 4WD0A 1IEVA 4NZJA 1UD4A 2UY4A 3OZMA 4EXBA 3PBWA 1RLDA 1V02E 3P5ZA 4JIQA 4HVXA 1POJA 4MNJA 1EX1A 1CLXA 1J96A 3EWBX 1G94A 4MDOA 2OWXA 4WHBA 3WX7A 2XIOA 4YN5A 4E4UA 2EPLX 4J3WA 4XZLX 3TLQA 4GX8A 2NV9A 2FTPA 3A4XA 3RJYA 3AIQA 3E0FA 4AY8A 1JYVA 2W79A 4DO6A 3EWYA 3PULA 4OT7A 6ALDA 1L6SA 3L0KA 3INPA 3UXKA 1MQQA 2W63A 3W7GA 3VIMA 5REQB 3WLIA 2QMKA 3Q67A 5I24A 3UWZA 3QQ1A 4NX5A 1BPLB 5LA1A 1JZ5A 2OZ3A 4F2UA 1UJPA 4KQNA 2GUUA 3OZOA 2VVSA 1F6YA 3T42A 1PTDA 2X1SA 3NOEA 1XX1A 2EPMX 3KRZA 4NQ1A 1QI4A 3M4HA 2CERA 1JIBA 3ALFA 1ZL1A 2GDQA 1S39A 1RSCA 1MEHA 4FLOA 1AW2A 1XI3A 4AIEA 3U2OA 1G01A 5A8QA 2XVLA 2L5HA 2VWSA 4UFJA 2XDFA 3RO6A 1ICPA 5AHMA 3W07A 2XVKA 2V69A 4X0NA 1LL7A 1W9UA 3CQKA 3RYSA 2E8ZA 3W1PA 4NXSA 1UROA 2Y5JA 1NP0A 4BZYA 3RCNA 4QROA 2DSWA 4ATDA 1GVYA 3N15A 2VR2A 4ACYA 3HB9A 5CJ5A 5LA0A 2WZHA 1SO3A 3GTIA 4CD7A 5LIWX 4GI6A 1GTHA 3RO8A 2WHLA 1NOWA 2CPUA 3HPSA 3PUOA 1TTIA 2FMOA 2QVNA 4X2RA 3G5EA 2FGLA 2B7NA 2IS7A 2VOTA 4IISA 1OABA 3BAJA 5EPDA 1LOLA 4I9TA 3M7WA 1JF5A 4LCSA 1EA0A 3N19B 1HN1A 5CPLA 3MMTA 4DZHA 1EBHA 1GJUA 3FY1A 1XYMA 4ZA0A 1PL9A 4FOJA 2WAGA 4HOXA 1KGXA 2VVNA 4QNEA 3VK5A 5FOOA 3LBCA 1JZ3A 2AQOA 5FJJA 1EH9A 2XH7A 3VIHA 3PP7A 4LNYA 4XD5A 3UP8A 3QGAC 3SBFA 2GVGA 5HK4A 3TW7A 2UBPC 4L9YA 4XAYA 1PCWA 5H8PA 4Q8OA 2BMBA 3MUCA 1BWVA 3QLLA 2VZSA 4MUPA 1SJBA 5G2WA 1V0KA 1KV5A 3ZSTA 4KF1A 4E2DA 3ECQA 1OG0A 1AQ0A 2ISSA 1W17A 3G6MA 4QE4A 3HJEA 1UH2A 3A3HA 1SZFA 3BW3A 3VGBA 1XLAA 1JULA 1Q6FA 4DXXA 5TAOA 4HPNA 4XUGA 4AD0A 3TNBA 2A3EA 5I23A 4F9JA 1P6CA 2WYSA 4JTKA 1B30A 1CTNA 3WMBA 1K1DA 3PTQA 2Z29A 3Q4DA 1CNVA 3S2MA 4BF9A 2CESA 1UOZA 2HZGA 1A0CA 1EJXC 1VBRA 3WFAA 2R1MA 4CQBA 1OYBA 4OUEA 3LMYA 3KOXA 1DJIA 3AXIA 3K1GA 3CZEA 4F3HA 4NASA 2FYMA 2VYOA 3A23A 3LPPA 2FVLA 3DHPA 1VBUA 3ARWA 1WZAA 3P2VA 2R8WA 2ZC1A 3WQ8A 3H21A 3SGUA 2XVPA 3UD6A 2ZZ4A 3KLLA 3QYSA 1FX6A 2NUWA 4EWND 1W2PA 3PG8A 3SSZA 5FL0A 1LT8A 2CETA 3BJFA 4JS3A 4C7FA 1MW2A 2QS8A 4EWJA 4ZR8A 4ZFCA 3H6OA 5J8LA 1WUEA 1VCVA 1ITQA 2ACSA 3VNMA 2QIWA 3W6LA 1TCDA 1K03A 3VIJA 4JX4A 4HZMA 1ZAIA 4L56A 1S38A 1J18A 2RJGA 4LCRA 3AMKA 2ZKMX 3GU1A 5IHSA 3TDFA 3R7MA 3TJ4A 2XINA 3C56A 2H8XA 1ZS2A 3H2OA 2HRWA 2OZ0A 1FWGC 1RAKA 4GYPA 1SYTA 2J7EA 1GGOA 4C5ZA 4IPJA 2ATSA 4LY8A 3T08A 3PJUA 2X2GA 2DSZA 2BVDA 4M6VA 2R94A 1E73M 3W7DA 1KFBA 1UWQA 4P7RA 3PJWA 4JX5A 1SJDA 4DM2A 1Z3NA 4FNTA 3OEXA 1Z8AA 2WV8A 5E9AA 1GKPA 3WFZA 2YFNA 2GJLA 1YE4A 4TXEA 5DRCA 4XKYA 1J4EA 3UCCA 4Q4SA 5CPSA 3O9NA 1LBLA 2VFFA 3GNRA 3CQ0A 1QI0A 1XKYA 1FKXA 3NYZA 4BFAA 4AIOA 3W38A 3A64A 5I06A 1K9FA 2R24A 5LXXA 2PBGA 1UZ4A 3EWZA 4Q4KA 4DWSC 5A5WA 2DFAA 2EGZA 3MCNA 1W5NA 2YA0A 2A7PA 3VMPA 2PZ0A 3UPMA 4FIQA 3OG2A 3UY7A 3MJYA 1P0KA 3BLOA 3VE9A 3TR9A 2QJMA 4K7VA 3UCDA 1Z48A 5FAJA 1LZOA 1W1A1 5DXXA 3VNDA 3W25A 2D1ZA 2NXHA 3LCLA 1SR0A 2J62A 4M5PA 3KOFA 3WY1A 5FA5A 1JDFA 3LOTA 4ATWA 2VHLA 1V7YA 1J01A 4MY9A 4MZYA 2ZA2A 2JEQA 1KRCC 1PZ0A 1PKMA 2VXNA 3K4DA 1HGYA 3O16A 4JKLA 3CTTA 4A3RA 4IUGA 3TLLA 5C9XA 2YDRA 1EGVA 2OFJA 1TWDA 5A6KA 4ZO6A 1S2AA 4S23A 3OYXA 2BX7A 2EAWA 3XISA 4K2SA 3CUZA 1M7OA 9CGTA 3KVJA 1SFJA 1NWTA 5DF0A 1OGGA 4QG8A 1ZZMA 3SCPA 3TQKA 3ARUA 1JZ2A 3FKKA 4AVOA 1TJ0A 1CECA 1QNSA 1CGXA 4A3UA 3W88A 3NSXA 3G1SA 5BZAA 2GVJA 1A0DA 4ATLA 1NVMA 2C6QA 4ORMA 1P0NA 2A5HA 3W24A 1EJSC 3HURA 5CCZA 3S9YA 2QCDA 4KWVA 1TVLA 4XBJA 5FESA 3ARQA 5MKGA 1GT8A 4F0SA 3BAKA 3LI1A 5AYBA 3TA6A 3S3GA 1XLHA 3CV6A 4S3JA 2BHUA 4MIMA 4N9BA 2G3MA 3E96A 3VNYA 4RDYA 3UR2A 1VH7A 4LVGA 2PP1A 5FJUA 3H7UA 1NDZA 3KBVA 3LHTA 3WF2A 4AWEA 1JPIA 1QXLA 2Y61A 2OWWA 2W0UA 3QMSA 3FVDA 5CSUA 1V3LA 2ZX6A 4G7EB 3M0YA 4UFHA 1DL3A 5BOFA 2FFIA 3VGHA 3KVKA 1UR4A 3OGVA 1XC4A 2ZBTA 4W85A 3AYSA 2EO7A 2Q71A 5ABGA 1L2UA 1V0LA 4GY0A 5HMEA 4FAMA 3D3FA 1ITCA 1TVNA 3FV9A 1H7WA 4WZHA 1ONRA 2QDEA 3GXMA 1WYIA 4H41A 5D2TA 3HG2A 4C6OA 3F5KA 4DPQA 2J66A 2RH9A 4M1RA 4OBRA 4D6JA 1EB3A 3UZZA 3M07A 2J7GA 3AC0A 1E1EA 1O1HA 5FJPA 3HMJG 3STGA 1XSKA 2YB4A 2GLKA 2DW6A 4GPNA 1KM5A 1ZFJA 1VBGA 4XAPA 1UPPA 2D0FA 3CZLA 5EYWA 3T44A 2JGYA 3ZLGA 1UUOA 2PURA 3B3DA 1TJPA 1LBMA 1XICA 1IGWA 4AC7C 4INFA 4YVXA 2YXXA 2WO5A 3M0MA 4XAZA 5PTDA 1HP5A 2PGWA 3ANUA 2ZZ2A 4JTSA 1GOMA 1MW3A 2AMXA 1IXQA 5JIPA 3PY2A 4HHMA 1OEPA 3YPIA 4CU8A 5D2XA 4ASTA 2IPWA 8A3HA 4LYPA 5H6HA 1FWEC 3CYVA 2YJQA 1Q8AA 4DJED 3EDEA 3ANYA 3FFSA 4HCLA 3AYRA 3TYEA 4RZ4A 3TONA 8TIMA 1G4PA 3W22A 1W56A 3KZSA 2Y8VA 4NT0A 3EOOA 3UR5A 1MYRA 3L5AA 1TIWA 3TUUA 1QPOA 3UGVA 4IPNB 3EYPA 3QY8A 1QI5A 3NEHA 1O5QA 4PCFA 1PHQA 1IT0A 1JGMA 3L9CA 4YTSA 3ZR4A 5H8MA 4M6PA 5HNNA 5I77A 3G1DA 3UNTA 3VOIA 2QT3A 4N0RA 2VFHA 3SN1A 3RX3A 4LOCA 2XTKA 4TTGA 5M2FX 3CK5A 2E9BA 4WXZA 1I60A 4IGMA 3GK0A 5A69A 2J7FA 4HOWA 1E1FA 5D2WA 5D05A 1BFNA 4PUUA 1ADDA 4W8AA 2D3NA 4GISA 4D1IA 3AJ7A 1OWQA 5A6JA 5I07A 1RK6A 4MLRA 2XVGA 1RHCA 1W1IE 4O13A 3TSMA 5G2IA 2Z25A 2ZWZA 2QUTA 2EXOA 4BJHA 2A85A 1UBPC 3R2GA 4EVZA 1PKYA 2J8FA 4DAFA 4J27A 4O1AA 5L9FA 4AX7A 5D8WA 4PL2A 1XDLA 2FH6A 3HG4A 1BAGA 3MHGA 3VOJA 4HKPA 3T2QA 4FR1A 6XIMA 3OHIA 3RR4A 1OX5A 4W5UA 5CEWA 1YE6A 3CHEA 2B31A 4AD2A 3CUFA 4HCDA 2XFYA 3MU7A 3SFKA 1OBAA 3M0XA 3SZ8A 3DG6A 3H4XA 2WJEA 4KEUA 1C29A 1XISA 4A8NA 3VA8A 2JK2A 1NOUA 1WXJA 4MSSA 3UG3A 2WNNA 4I6VA 5AYYA 3W6MA 3DDMA 1BD0A 3PS7A 3SCTA 3GDRA 3EKLA 3MBFA 2QJGA 2C0AA 1GW9A 3BLFA 1E6XM 4CQDA 3TYAA 1FRBA 2BTMA 4JN8A 3PK7A 4AC1X 2QCDB 2DUAA 1R87A 1LLOA 4A6GA 3B9AA 5CKSA 5AC4A 3CASA 2CWNA 3ARPA 3EDJA 3AQUA 2VC5A 4YWSA 2DZTA 1PIFA 3CAKA 5MKGB 1GOXA 3POHA 3I3BA 4ZBCA 2XGZA 3ICJA 2ISVA 4MYXA 4MWAD 3A4JA 1FH9A 5DX7A 2H6RA 3ME3A 1ZJAA 4PCSA 1EZ2A 4HHLA 1JDAA 4L7ZA 3W3OA 3XINA 1QATA 3FKRA 5CXPA 4IMCA 4H6KA 3AROA 2QDDA 1HJXA 5JIWA 1JPDX 4Q8QA 4P7NA 5TNVA 2FJUB 3REQA 3WBXA 4AF0A 3MSRA 2WHJA 4C6CA 1L8PA 5K2ZA 1GYNA 2I1OA 1OK6A 4D72A 1R7OA 1W91A 2QDHA 2WC3A 4S3EA 1JCLA 1Q45A 1R2SA 1KCKA 5E70A 4S2BA 1HJSA 1UASA 3BURA 3QC3A 1JPMA 1ODUA 1UZDA 1PTGA 2V5DA 3W1RA 1CW2A 3TH6A 3UWYA 1X97A 4QDWA 4S39A 4N4PA 1EF3A 5D9OA 4GY7A 1S2TA 3LTSA 3V5CA 5LIXX 4L6OA 2WKJA 4U33A 2E6DA 3UWEA 4QJ4B 5A6BD 4PCPA 3TYUA 1EHNA 5A94A 1UR9A 1OF8A 3DC0A 1WQ5A 1XIFA 4QSFA 1XQLA 8RUCA 4W84A 1O66A 4UZUA 1A3WA 3L21A 4AISA 3BLDA 2VENA 1NQ6A 2DZXA 4F0RA 3HPZA 2EG8A 1BTCA 2V81A 5T9CE 3G6LA 2GGEA 1YBQA 4PTWA 1BHGA 3UJ2A 5I09A 6CGTA 2QV4A 4G5DA 4Q4QA 4DBDA 2DT2A 2O9RA 2VTFA 4YU1A 3U2CA 1LTDA 9XIMA 1DWJM 1BG4A 2NX1A 3WN6A 1WZKA 3P84A 4XTDA 3CQJA 4JTLA 3G22A 4MFDA 1UQYA 1GG1A 2Y85A 1KC7A 3AISA 4AB4A 2GWGA 1UKOA 2BY2A 1SGJA 1MDRA 3EX3A 2V2DA 4O0KA 2INEA 4MYAA 3E74A 4XZMX 1VBHA 1JCYA 4FI4A 4U4MA 6PTDA 3GSMA 4S2CA 4CD8A 3GUWA 3VM7A 2VP8A 3GW0A 3I7RA 3W7LA 4MADA 3TWBA 1PXGA 3RPDA 4UTTA 3BLPX 3WBEA 3GBEA 1YPXA 1XF0A 4PTDA 4GGBA 4GUFA 4FR6A 2BHYA 4IL2A 5CSSA 4R3UA 2ACQA 4J3TA 5LKYA 5I3DA 3AYVA 3VI2A 2FLIA 1QHPA 4UBPC 1OJXA 3E0LA 1RXOB 3EPNA 2Z1SA 2CHNA 4KGJA 3RU6A 2G8ZA 3QGKC 4UC5A 1LRNA 1GOOA 2XSBA 5HUPA 4EK7A 3QMTA 3EPMA 4FXRA 4Z2JA 3E0IA 2BXYA 4QHRA 2R1NA 2WMFA 5LNWA 4AWTA 1LQ0A 1XL9A 5A3HA 4QISA 3N04A 4WLCA 2Y1HA 3EB3A 3PTDA 2PU0A 4MB3A 1JCNA 1HVQA 1VPXA 5G5IA 2Q09A 2IXUA 1MRQA 1GG0A 5JH2A 1A5OC 4KWOA 1FWHC 1KM0A 1J12A 3WUGA 1TPWA 4DJFD 1XLCA 4OHQA 1RA5A 4D8ZA 3L4WA 1HW6A 2ZRYA 1PZ1A 1GPFA 2D69A 4UTMA 1XPGA 5D03A 1RUSA 3MANA 2O7QA 2YZRA 1ZNNA 2OEMA 2C15A 4XG1A 1XIIA 1GJPA 3LEPA 3HMCA 3R1ZA 3S8HA 5C7VA 3S6OA 1CI1A 4LUIA 4N9CA 4O8AA 3G8EA 2J47A 4R27A 1TV4A 5K3VA 1GVSA 3V7PA 4TU1A 2NT0A 1MO0A 2DU2A 4OUIA 3GTHA 2YOCA 1WKYA 2ZRWA 3GG7A 3N11A 3A13A 3AS0A 5CG0A 3N2TA 4Y8FA 4AF0B 1SFLA 2JFEX 1I2RA 3NSNA 4PMXA 2OPJA 1SZNA 4M6UA 3URNA 2YSWA 2HXTA 3QV6A 1GONA 1XYZA 4JEQA 1FWJC 1CGTA 1LG2A 3HU7A 1PCKA 2D0GA 3B4YA 2J88A 3P8JA 2ZA1A 4K1GA 3HG3A 3KHJA 1ZP4A 4LUYA 1O5XA 3S47A 4I5XA 1KBJA 1ME9A 2D20A 4PMUA 4GC3A 2Y8KA 5DMYA 2I7GA 3W83A 2OCZA 3M0IA 5I3GA 4ZGYA 1UR8A 3ABZA 1JGIA 2G5WA 3E2RA 3WBWA 5E0CA 1AA1B 1FXQA 1F8MA 3S9ZA 1R3SA 2PWGA 1BXBA 3H2AA 4WKFA 3ITLA 4PSPA 3NPWA 4GVHA 4BF7A 4C5YA 1XRVA 3ERPA 4CQ9A 4OOUA 1W31A 2G97A 1U1HA 1OZQA 4ML4A 5JH1A 1K7EA 3HV9A 3U4FA 4TOQA 4ONVA 4QEHA 2PDCA 1YBQB 3WQFA 4HU0A 4PRWA 4MWAA 1K70A 1UH4A 2Q8ZA 1JZ8A 3TXVA 2BGSA 3VYLA 1FKWA 3VDBA 3SQMA 1XDMA 1UC4A 3WYZA 4G6CA 2G37A 3DN5A 1N8IA 4DB7A 2W62A 2BXVA 1GHRA 1ZPTA 4O1CA 3I6RA 1OX6A 4ALDA 2FPYA 2YCLA 4YPJA 1FOBA 2QNEA 2OB3A 3GB6A 3IJQA 3GAKA 2PTYA 1TYGA 3QFEA 3VIPA 3UZJA 3EMCA 3GZAA 4QAIA 2Y5SA 1TRIA 2GL5A 4PC8A 4QLLA 3IJLA 1KFWA 4JFUA 3B03A 3W7MA 1YMYA 4C1NA 1UWRA 5FEWA 1ISVA 5BWFA 1E0TA 4L4OA 2A6NA 2PDPA 4JHOA 4AXKA 3VD9A 3WQWA 3BTNA 3BMVA 3OLIA 1U83A 5A6BA 2YZ5A 1QR7A 3QW4B 5TBOA 1E4IA 4XD4A 5C55A 3RNDA 3A5VA 3UJRA 3LQLA 4TVUA 1V03A 4HIBA 2O9TA 4O11A 4MPKA 4PYSA 4XO6A 5DCEA 4PRRA 2DIEA 3LHYA 2OT1A 5A8MA 2GGIA 4PUEA 1JD7A 2BOGX 4D71A 3O6AA 4DY1A 4ICNA 1REQB 2YL8A 4JYEA 2NQJA 3DCPA 4H04A 5EGRA 1XLKA 1ZBCA 1KFCA 3WZ0E 5C0QA 4HHPA 3CH0A 4FIRA 1F3WA 3EA2A 1YEYA 1ADSA 1GVQA 1C8QA 2VR4A 4B15A 4S3FA 1P6WA 1XM3A 4LQ1A 4MJMA 5FEZA 4R7JA 1OT1A 2WQDA 3WSUA 1PEZA 3VD7A 2X16A 4PMVA 7TAAA 2GSHA 1DOSA 3F1QA 3LSCA 2F6XA 3DG3A 4FLRA 4IGHA 3UJEA 4QP0A 2OELA 4CVWA 1H09A 3G1FA 3UA3A 1K8ZA 2PMQA 2BFGA 1UH3A 3EOUA 3FA4A 5F2GA 1YIXA 4JTHA 3ZT6A 4J9JA 2E09A 3LUTA 5D2VA 2I9UA 1EPXA 1W9PA 2OYMA 3AXMA 1XLEA 2NUXA 3OLGA 3UVAA 4F0MA 1ENUA 3L4YA 4ZXLA 4AEOA 2C71A 3ATYA 2F84A 2AAAA 4FA3A 2D2GA 4S3AA 2WLZA 2QCHA 3T8LA 1QVBA 4LBSA 3QKZA 1I1WA 4G9PA 2BVYA 1E4NA 1TPFA 2EKGA 3IVUA 4DJEC 4V33A 4YTRA 3O7UA 3TKFA 5FJTA 4FHAA 2YLLA 2MUCA 4R5EA 3UZXA 4IQJA 1KR1A 1M68A 4PB4A 1V08A 3T0AA 2DIKA 3EDDA 1K8XA 2WSQA 3APTA 1WKDA 3G77A 4H8UA 1XH0A 4FB7A 1Q7ZA 1BXNA 4W86A 2BY3A 3E2VA 4EANA 4WGHA 5GJPA 3CIWA 2YXGA 2FGBA 4HNVA 3BW4A 4YTTA 5A2CA 1ECEA 5DT7A 3QEZA 4PUMA 4CQ8A 3QOKA 2WZMA 4LYRA 4I9MA 3WDIA 5KZEA 2HPMA 5HQMA 3IRSA 1HP4A 2UY3A 1QT1A 3EEZA 1F07A 2QCFA 3SRKA 1TPH1 1TPDA 1YADA 4ZQPA 1UW9A 4LF1A 3WUEA 3THQA 5FF7A 4KRUA 5EFDA 2J9XA 1X6LA 3NPUA 2F61A 2E7FA 5CBIA 2X09A 4X0VA 4XD6A 3FXGA 2OZ8A 3F03K 4KIRA 2BWGA 1HQTA 2E68A 3H8AA 3QZ6A 1JI1A 1H7OA 2BB0A 1OFBA 5D30A 1CGWA 3V3WA 1ISXA 3CUHA 2XFRA 1IT8A 1KB3A 1KGWA 3MDWA 3GVRA 3Q45A 2NLYA 5AHFA 2H3BA 3APYA 2F38A 2FJKA 4XISA 2ONEA 3FJ6A 1W1YA 3WF1A 4W9TA 4BQ5A 1FVPA 4OKDA 2YCLB 1GVFA 5HMDA 4LALA 1CXEA 3DGBA 2FGZA 3IJ7A 1IHIA 2OX4A 1EOMA 3E38A 3W7CA 2DSVA 4IUOA 3ITTA 4L9XA 3WQEA 5HMSA 3ZVHA 4NRSA 2WCSA 5FSEC 1E3XA 4FSAA 1RVGA 3NZRA 4BA0A 1AZ1A 1GYLA 2NQHA 3G1YA 5EU9A 4GZ7A 4QAWA 1LOSA 4PB5A 2CCRA 1RCQA 1H61A 3ALGA 2OO0A 3ZT5A 4B92A 3S1XA 4ZB0A 3NM1A 1B3WA 3VIFA 3GH5A 1Q6RA 4MKVA 4XAGA 1IT7A 4LAZA 3MV01 3R8GA 3GVWA 5DLCA 2JQXA 3SADA 1VJZA 1ICSA 2WM1A 1MEIA 4MPQA 3PPCA 4RR4A 3CO4A 5BMXA 3W23A 3KTCA 2I5QA 3KEHA 3KL0A 4GBDA 1E5NA 3LZ5A 3AAMA 2G3NA 3P0XA 3SCSA 1OC7A 4IJBA 1UPMB 1A5CA 1LL6A 2XJ7A 3GXTA 3MBDA 4C6KA 4DNMA 2XFFA 3M0ZA 5G1MA 3CWOX 4EXAA 2E28A 3LB0A 3MVTA 4IX2A 3KHDA 1J5TA 1J6PA 2A0NA 2QJJA 2YLAA 3CUIA 1BQGA 4DYKA 5I79A 2BGNE 2QUNA 4UIOA 1N55A 3VZXA 4PBFA 1H4PA 3WEZA 2F9RA 1OX4A 4KRZA 4IP4A 1G4TA 1H0IA 1PIIA 2W91A 1MXGA 3WL0A 2PLJA 3ABXA 2PDXA 4US6A 3GXFA 2F6UA 1AMYA 4D6EA 1G0CA 3NR0A 4NU7A 1G7VA 3BCJA 4W4QA 5FF0A 5FJIA 3HJZA 3SECA 4O50A 1XLJA 3MKCA 1AFSA 1TB3A 3GC4A 4GZIA 3POCA 1UWSA 4HU8A 1W0MA 5I3JA 2DVXA 1NWUA 2WKGA 1NY1A 4PL1A 3GZ3A 3DFPA 2WC7A 3IUDA 2QUVA 2HJPA 3EMQA 3RUBL 3EA3A 4ZODA 4C6LA 5KEZA 1H5VA 1R2TA 1TTJA 4CNTA 3DEQA 3VUSA 1FQ0A 4PFMA 3WIJA 6XIAA 3R10A 3CV2A 1J0JA 3UYIA 2QIIA 4ZFMA 4HNTA 1Z6KA 2W92A 4NIRA 4M7TA 1I6NA 4H2CA 3WNNA 3KVLA 4NZ5A 4DO5A 2WLYA 6TIMA 1QASA 3SCUA 3VIKA 2PDIA 1MUWA 4NZCA 4H6RA 4HA1A 3MO4A 1B4KA 1AW1A 5LIUX 4D2JA 1R86A 3KX6A 2OODA 4DF1A 3VNKA 1ONXA 2W5FA 1SR9A 2TODA 3ZYZA 4HU4A 3TP4A 3WDJA 4TX8A 1Y5VA 1RPKA 2DEPA 4FALA 4AYSA 3I4EA 4X3ZA 2J79A 5BXPA 5IFPA 2WMHA 5JBFA 4YCOA 2VRKA 3VDHA 3CJPA 1V6TA 4P8XA 1L6FA 9RUBA 1D3CA 4PTMA 2MANA 4JN6A 2C1GA 4CKQA 4XWUA 3AICA 5GJNA 2AQVA 3N17A 4RX0A 1KKRA 3C0LA 2X0SA 3BAIA 4US5A 3TMQA 4R53A 2ZTKA 3PG9A 4FNPA 3QR0A 3CZGA 1HKKA 2XZ7A 2PGFA 3OVGA 3UWUA 3NZPA 3FSTA 4UTHA 2J9ZA 3OPSA 2AQWA 1CB2A 3H2EA 4M8UA 3P5YA 4RLIA 3AHXA 3BICA 4WJ8A 5FJRA 3NWRA 2PDUA 1B3XA 2PDQA 5CGQA 3UXDA 4MKNA 4DJDD 5I2UA 1ZQ5A 3A3WA 4M6QA 3I3EA 1V3MA 3URBA 3M6YA 4I7UA 3CZ8A 1M03A 4RE4A 3ZVHB 5KTLA 1QBBA 3RRXA 1I0BA 5A8OA 1PZ2A 3WLMA 1WOBA 1EJRC 4OGZA 1C8VA 3L4TA 4WRHA 4B3LA 3L4VA 1AL7A 3QRHA 4PMZA 5AHLA 4DJFC 1HNYA 4PUJA 1KWGA 2NV2A 4P8UA 4PODA 3N4EA 2J78A 4AZBA 1FCVA 1GOQA 5BXTA 3PZIA 3FW6A 4TR9A 3N2CA 3VCCA 3ZWSA 1QK2A 1TG7A 2G4FA 3DFNA 1SMDA 4BS0A 4YTQA 4KEVA 2NVAA 1W32A 3QV8A 4E0CA 3CH9A 5K9CA 5AC8A 5DMMA 3UR8A 1VKFA 3C5QA 3DOPA 1U33A 2WCAA 4M19A 5CZ0A 1DVJA 3S4TA 2XN2A 3W2LA 4GIYA 4RK8A 4HSOA 2X7VA 3QY7A 4J28A 2PSNA 4LCQA 5D8ZA 1PX8A 1LP6A 3HQNA 3W7KA 2PDYA 2ICSA 5KZ6A 3WLQA 3OTRA 1IEQA 2WHKA 1NF7A 1XCWA 4H7CA 3VIOA 3OVRA 4KMQA 1B3YA 4UR9A 1EZWA 3P82A 1WO2A 3BXWA 1A3XA 5HXMA 4YYFA 3LHWA 4E8CA 2G3JA 1T5AA 3FK4A 5DMLA 1OGSA 3KBMA 1JUKA 4BI5A 1OX4B 1QBAA 3TYCA 1LQAA 4ZQOA 1XSIA 1L6YA 4Y7EA 2QQ6A 1HFBA 3N13A 2VUNA 5BRBA 1IZKA 3CBWA 3BAXA 5KITA 4KIEA 5JBEA 3IARA 4OBSA 2VI0A 3TTQA 3MSGA 3EKZA 3R4IA 3Q58A 2A3LA 3IAQA 3LG3A 1Q6GA 1A0EA 2C13A 3VNLA 1W9DM 1G69A 2J75A 1DJQA 3HN3A 2OQYA 5E5CA 4FF5A 3F4WA 3AXXA 3MCMA 3WQPA 3W7OA 2ZVIA 1DEDA 1HKWA 5IOBA 1GVIA 4N6FA 3ZOAA 5C9RA 5DRIA 4BEQA 3CTLA 1Q8JA 2X30A 4E2OA 4QSHA 1ZLPA 4S3DA 1KRAC 1P43A 5HANA 3IS4A 4ZSTA 3MUY1 1T41A 3UZ5A 1DHKA 4WKHA 4HNLA 2X1RA 5AVNA 3CAWA 4QNWA 4P7LA 1XIHA 3PJTA 4XBKA 1W9VA 1SPQA 1F76A 2ABBA 1KM6A 3R25A 3AUOA 2Q6ZA 1P0EA 2CIPA 4GKTA 3UXAA 1M7XA 1GVOA 2ISFA 3DU0A 4H6QA 4BWLA 3ITYA 3WK1A 5A95A 2J6XA 3UJSA 2JALA 4DELA 1IXOA 2ABAA 3DG7A 2HNHA 3Q94A 3CEPA 2FHBA 1CXKA 3FGCA 3V0UA 1WKFA 1F2JA 1NFGA 1GQLA 3FN9A 1R3YA 1KTCA 3S5OA 1EA9C 5HATA 2E77A 1IXNA 1A53A 3I68A 3HQPA 1M9HA 4HPHA 3TROA 1R47A 2RDWA 1Z69A 3BOLA 4AD1A 3K8LA 2GDUA 3CMFA 4FK9A 3GAYA 4UCFA 1V51A 3MTWA 4Y9PA 5T26A 4RNHA 4D6HA 1K4GA 4RCXA 4DHGA 3GFZA 5EL1A 1ZGDA 1UJQA 3RR1A 4ZENA 3GDTA 4NXKA 2GUYA 1AK5A 2XH0A 3OA5A 5BMWA 4XO7A 4NVTA 4GIRA 4BQ4A 2VURA 5F4XA 2VEKA 4PMNA 2Y6ZA 3FCPA 2G3IA 3CL8A 4W5ZA 2WVUA 4F9DA 2VEFA 3TFXA 4QFUA 2V3FA 4UTWA 4EF8A 1HKMA 3PBGA 4MVAA 4ADTA 1WOAA 3V1HA 4F2TA 2ISWA 4LV9A 2AKZA 5MF5A 2YFOA 4YNGA 2IMRA 2TSYA 1DJXA 2H3DA 4CNOA 4AAJA 3ABOA 1B90A 1MRAA 4C1LA 3AOFA 3GVQA 1KWKA 4GUJA 3R8RA 3LM3A 2IXVA 3O6YX 1H1ZA 3TYZA 5J5DA 3NVTA 1L2QA 3UA4A 2YL6A 3OGRA 5AKQA 5CJNA 3VMNA 4QBXA 2PD5A 3O05A 2EHHA 4M7SA 4QQ3A 4A3HA 1ECQA 4GNKB 2RAGA 4XVEA 1K4HA 3NYDA 1BRLA 3O15A 4J2MA 3AU2A 3BJSA 2CBIA 1OCBA 2OLHA 4AD5A 4WDUA 4DVOA 1NIUA 3CT2A 5LHFA 3BC9A 3C0SA 3H55A 2Z1KA 1NTHA 3ZT7A 2YYUA 2OX1A 4FLSA 1YKWA 4G1KA 4KBXA 2J7HA 5LIYX 5AYZA 1QFEA 3SN0A 4M56A 2PEVA 2CW6A 2GUBA 1ZP3A 8XIMA 4L4MA 3UF9A 3W7EA 5HAOA 5AN7A 1LUCA 3UYCA 3DFOA 3S5SA 2O4QA 1F05A 2DZAA 2ISDA 4AU0A 1E0WA 4LC6A 1K9EA 3WJZA 1Q6DA 3SAZA 4RNIA 1P6BA 4E4PA 4GOAA 1KXTA 3HOJA 3THAA 4WSHA 2BS9A 2ZQ0A 4M29A 2NWSA 4DJDA 1OSEA 3N9KA 4HNNA 4RE3A 2VGIA 3I7SA 4IFRA 5U4NA 3CIXA 3D3AA 3TZNA 4LX4A 1F6PA 1IV8A 4GG9A 2OMAA 1UKQA 2NQ9A 1PB0A 2OO6A 1OCQA 3VDCA 1TE1A 1FFQA 1UWAA 1UMYA 2YKKA 4C6EA 1DORA 3TVAA 1TREA 3LLFA 1X38A 1N82A 3IV8A 2Y8UA 3TJIA 1QNRA 4IL0A 3MI2A 1E4LA 2REQA 4A05A 1PKNA 4I5RA 4HZ6A 1RQBA 1ZBWA 1J0HA 4EPBC 1IEXA 3T05A 4L4LA 2PA6A 1RA0A 5T91A 1HKVA 4AY1A 1JCMP 1OFEA 4BQ3A 4W8LA 3LCWA 1W3IA 1PX4A 2PD9A 3KCLA 3B40A 3KS6A 3GXPA 4IHCA 3R13A 1W1ZA 1X6UA 1QTWA 2J24A 2QHAA 2XWDA 2PTXA 4IPIA 2OYKA 3F5LA 4Q3MA 4U2ZA 4H9TA 4JYFA 5H91A 4GH1A 4ZO9A 4CU7A 1HIZA 3L4UA 4C6FA 1CCWB 4IP5A 1XGZA 2Y63A 1UP2A 5XINA 3W9ZA 3OLDA 2X41A 2XN1A 3QSTA 1DKWA 1ZCOA 1PVNA 1A5MC 1U5VA 5F4SA 4Q22A 4LUTA 3CO8A 2J77A 1H51A 7XIMA 3RLVA 1XD1A 4RE2A 3NDZA 2BODX 3JZUA 4U2YA 4MF4A 4NAFA 3TC6A 3C2FA 4R88A 1JRBA 1SW7A 3T4CA 4GNVA 1OK4A 5I03A 1Q2SA 4NZ3A 3IEBA 3WO8A 3A4AA 4CCDA 5B80A 1I2OA 3JR2A 1X6NA 3TJXA 5K9DA 3VX1A 4HTBA 2G95A 3WQ5A 4IFKA 2GQAA 3NCOA 1H7XA 1S1PA 1UZ1A 4QJ3B 2H8ZA 3RX2A 3WLRA 3M43A 1B3ZA 1E3ZA 2NT1A 3PUGA 3F4DA 4CQAA 1PDYA 4RZBA 3PZNA 3HGOA 2YA1A 2PDHA 2E9MA 4UWMA 2DVUA 3U5YA 3WQ4A 1F9CA 5AC7A 4JICA 4LTSA 5C5YA 5H8UA 5DBUA 3GNNA 4PN2A 3W37A 3SY8A 3TTEA 3VE7A 4D9PA 3WMSA 2VJXA 3NDOA 3PJXA 4JX6A 5HNRA 3SGGA 1NSJA 3PTKA 5E09A 4OTKA 1KLYA 3VD4A 4IFOA 3RM9A 3WH5A 4ZOAA 1CZ1A 1GPWA 2OEKA 2VELA 4GUHA 2PB1A 3Q65A 1EHAA 3P6LA 1KW1A 3V16A 3NQGA 5I6SA 3A22A 2D24A 2AGKA 3DENA 1VPQA 1XYLA 3B8TA 4JD4A 4JY9A 3LHUA 2Y70A 1DWFM 1R46A 3ZXWA 1Q4NX 3LRKA 3OLEA 1F73A 1BRLB 4O16A 1WKEA 1QNOA 1GOWA 1H1NA 4UFIA 3WD1A 4UQBA 1VEPA 1MI3A 3LTYA 4XK2A 4O1BA 4PRTA 1NELA 3USBA 1O4UA 3GR4A 3B0VC 1GVRA 3W71A 4WDTA 4CD4A 5M5DA 1RY0A 1O94A 1C7SA 1KFLA 1LUCB 1NU5A 3B9EA 1OHLA 2HDJA 5FEXA 4CUCA 4LFYA 3RMEA 2YPIA 3JUGA 2FZBA 1DXEA 3WK3A 1R8LA 4DRSA 4O17A 2E1WA 1XH1A 3UW6A 3GXIA 4KH2A 1XLBA 1CENA 1JR1A 3GTNA 3CV7A 2RDTA 7TIMA 7CGTA 1Y7VA 3IJIA 4HQVA 4LS1A 4B4FA 3VZYA 3W2UA 2P50A 2WBKA 5BCAA 4YTUA 1GHSA 1S46A 4RXGA 2J8TA 3W72A 3COTA 1XLLA 3DERA 4C91A 4J7RA 1FFRA 4AZ5A 3LU2A 2B4GA 2ZX7A 4PSRA 4EPDC 4MMWA 1VC4A 4PBEA 1TA3A 4ZOEA 4BKNA 2DH3A 4W7VA 2G4JA 3IAPA 3KOZA 1A5SA 4BI7A 5FCZA 3GXDA 1S1RA 3DFSA 3FDKA 3ISIX 3WD2A 3WENA 5JVLA 4IM4A 1J0KA 4AD3A 2GWNA 4ACZA 1T40A 4XIMA 5A1AA 3VDAA 4OV9A 1S5TA 1ZCCA 3LYEA 2X1TA 3EMZA 2J27A 4KEMA 1BTMA 3NEVA 2I5IA 4YHEA 3WQGA 3B9DA 4X60A 1R85A 5EA9A 1JZ6A 1JDEA 2H9AA 3NPXA 5JU6A 3B0YA 1VR6A 2PWHA 2ZE3A 2E6AA 2P5NA 2TMDA 3DGRA 2E5BA 1ZTVA 1O7AA 4GYFA 4Q8MA 3PM6A 3UXLA 4AHQA 1E1CA 3H2CA 4HGXA 4H9MA 3W01A 1OFQA 4AZHA 2YA2A 4FS9A 4IZGA 4JGDA 1M53A 4BI6A 1RBLA 3RM8A 4WDWA 5DELA 2YDQA 3OW1A 1PJ9A 3FJLA 2W3ZA 1C8XA 3NVDA 4JTDA 1UA7A 4ZVJA 3BL3A 3BSMA 4LUTB 3KCJA 5FACA 2ODOA 1BF6A 1I9CB 1M01A 3M5XA 3AWOA 5F2IA 3THCA 4GA8A 5FL1A 4J35A 1DWGM 2QF8A 4NAFB 4GRSA 4KS0A 1MNZA 5A8NA 3GHTA 1XD0A 2PDGA 4B5NA 2OGJA 3KP1A 3U5UA 5A8GA 3W02A 4KW2A 1VBJA 3MUAA 5D2YA 1LWIA 4IFKB 1LL4A 3KDNA 3OJGA 4MJ4A 4ZO8A 4IQDA 1XPYA 2A6LA 2DT3A 3LDVA 3T2OA 3VIGA 4JTTA 1VF8A 3CZJA 1GQNA 3NO5A 4BF5A 2PDKA 2VGFA 3FX4A 2XM1A 2IKJA 2Z2UA 4IH3A 4IP7A 2ASHA 1N8WA 3MS8A