3W7DA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-5-170
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Trypanosoma cruzi
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-5-170
rcsb
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7dA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7dA01
3EX1A 3LERA 4MOZA 4Y90A 3L2IA 2CZ5A 2P1FA 4IUOA 3S42A 1QMLA 1OFQA 5AYZA 5D2TA 1A53A 3P80A 3OHIA 1YXDA 2C14A 3L0NA 4YL2A 4OBTA 3L67A 5LKYA 3TUUA 1P0NA 1G4TA 5AHIA 3ABSA 1UUOA 4U28A 3H55A 2J9ZA 4WQ6A 3RLUA 1QPQA 2E5CA 4BI5A 3CB8A 1KM0A 3L66A 5AFDA 1GTHA 3QJAA 3N19B 4RZ5A 1XXXA 1OFAA 4O0ZA 3UWVA 4ZMGA 4NXKA 1GVQA 3EWWA 4XKYA 4NX0A 3W7MA 4H4IA 1DQXA 3HG2A 5I3FA 4TMCA 5C2XA 2G97A 3JR2A 3TROA 1JUKA 3UXAA 3S9YA 3P84A 1YTEA 3SGZA 5D38A 1OX4B 3LCWA 4AEOA 1QO5A 3GIYA 3MWAA 3PR2A 4Z0SA 5FF7A 2DJLA 4MFEA 4RZ6A 4UMBA 4JYDA 1VCGA 3L0GA 4XBKA 5LNRA 4MFDA 4CNNA 3O1NA 1WBJA 3LCLA 5DY3A 5EMUA 1PHWA 5U7SA 5AHMA 3EX3A 2ZRUA 1I4NA 5CKSA 3VNDA 3W75A 5L6UA 3CEPA 4FX8A 3N2XA 1JCNA 3IVTA 3TV8A 3QSTA 1HUVA 1ICQA 2NXGA 1ZALA 4UTUA 1FDYA 1TPDA 2QF7A 3P74A 1VPXA 2QJHA 2NV2A 4UFLA 1R47A 5BNKA 3MW7A 1R2RA 4YLWA 3IRDA 4AH7A 3U6WA 3QM3A 3M6YA 1UBSA 4IX2A 4WJEA 5CPMA 5DCBA 3T44A 5AC6A 3RMJA 4IOTA 4MKNA 3BK0A 2JGQA 2WNQA 1G4PA 3LI0A 1D9EA 5G4WA 1WXJA 3G0SA 3NR0A 1KLYA 1KW1A 3FOKA 4JX6A 1OFRA 4LY8A 2X1RA 1XDLA 3HGSA 4IPIA 3NVTA 1MXSA 1VCVA 1ML1A 2C6QA 3VKJA 1F7BA 5KZMA 2W0UA 1EIXA 1T0OA 3NM1A 3PBYA 3Q58A 5BOOA 2FLIA 2YZRA 3TK7A 4TMBA 1I2NA 4HNNA 1LLWA 4IXXA 3G1VA 1OYAA 3B03A 3W86A 5HUPA 3QW3A 5LNUA 4JTFA 5EL1A 1JR1A 3EKLA 1SZNA 3W7DA 5ABTA 1FWRA 1SPQA 3HQ1A 3S5YA 4NJHA 5DXXA 3QPZA 4KWVA 4UMCA 2AQWA 2JKAA 3PM6A 4GWEA 1FQ0A 3W1PA 2GOUA 4OE7A 3NQEA 3STCA 3I68A 4HPJA 1XCFA 2QAPA 5EKYA 4IXHA 4M19A 3EXSA 2RFGA 2ZA1A 4NZJA 4PC8A 1AW5A 3DZ1A 2D73A 3R8RA 4MVAA 4W9TA 1SSDA 3NG3A 1LLZA 2Y63A 5D33A 4Z0JA 3UPBA 3TFXA 3FS2A 3N9RA 3CPRA 4UC5A 3W73A 4I7UA 2ZDRA 1JRBA 1LRNA 3Q37A 3IGSA 5F1UA 3TDFA 3TSMA 2AAMA 3GVGA 2CLHA 2A6LA 4GJ1A 3TJXA 3NZRA 3NQCA 4YCPA 2DZUA 2YFNA 1JRCA 3CLMA 5DXYA 5EA9A 1EUNA 3I65A 1SU5A 3DFQA 4M7SA 1LBFA 1SZEA 1A5CA 4HNVA 1F6KA 2X1TA 3PVFA 5A5WA 2V2CA 4M6PA 4RV8A 2DZTA 4NNCA 1GYNA 2HS6A 1ZAHA 3M5ZA 5DCEA 1DOSA 1XBZA 3GNNA 2VEKA 1K8YA 4ONVA 3GYEA 1KA9F 2ZZ2A 3BARA 4LW7A 1S5VA 2X2GA 3QZEA 3PB2A 3A5VA 4E0CA 4Q4KA 1GVSA 1VYPX 1GZGA 3LHZA 4JIPA 2B7OA 2WKJA 1XBYA 3NO5A 1TPFA 4GUJA 5AYXA 2C19A 3SJ3A 1H63A 3FYOA 3W2JA 1JCMP 1XDMA 3QF0A 4ZQNA 4POCA 4PH6A 2XN2A 3B8DA 1E51A 1XFBA 3BG9A 5F2GA 1WYIA 4O53A 3UNDA 3V75A 4O4WA 3NA8A 1QR7A 3DKJA 3KVLA 4L4MA 2YYTA 2DP3A 3PUOA 2CLIA 3NL3A 1NAL1 1OK6A 2JBMA 3R12A 2F7FA 4WZHA 2QUTA 3TNOA 2PRHA 3E02A 3QPYA 1PCWA 1LP6A 3QW4B 3FLUA 1TQJA 3N9SA 3N34A 4R53A 3I7SA 4ML9A 5GVJA 3TJLA 1X6UA 2NUYA 3PS7A 3OG3A 2V5BA 1H1YA 1A5SA 5EBUA 3EWBX 1KM6A 4OT7A 4ADTA 2HS8A 1TQXA 4IJBA 1YTDA 4N4QA 3TU9A 3HGOA 4N02A 4LS2A 3R2GA 1TPH1 1Q6LA 4N6EA 3C52A 1I2PA 2A21A 3HBLA 4Q33A 1OK4A 4LS0A 1MEIA 2FFCA 5K9DA 4OGZA 3PG9A 5AB3A 5BRBA 5F2MA 5HWJA 4RK8A 4JTHA 2E6AA 3HG5A 2B0MA 3HPSA 4ZQMA 4DF1A 3CTLA 4LVDA 4ZQOA 1IIHA 3OVRA 1VS1A 4NJJA 1GT8A 2OT0A 3PWAA 1OFBA 3NPWA 4TX9A 3IIVA 3IIXA 1TYGA 2VFHA 1TV8A 3EX2A 3ZFHA 4DO5A 2A1YA 3QYQA 2ZZ7A 1TPWA 1KLZA 3M5YA 1B4KA 2J88A 4EF8A 1SFLA 1CW2A 5LHFA 3P82A 1J4EA 4AWSA 4WUIA 1CI1A 3TR2A 1QO2A 2E1DA 4Z1AA 5D2XA 1IXNA 1OYCA 2IQTA 1PHQA 1I2QA 2QCNA 1K8ZA 4CLMA 4HKPA 2NXHA 5HNRA 1R2SA 3UY8A 3PSWA 4Z1DA 3WJYA 1WOAA 3ABRA 1S5TA 5T26A 2VEIA 2B7PA 1ZFJA 4QNWA 2FB2A 3EWYA 3QQ1A 2QDHA 4GBUA 3PC0A 2BSLA 3LI1A 5KZEA 1W5QA 4X22A 5DELA 1VH7A 5G2WA 2C18A 1JVNA 2BTMA 1D3GA 2GVJA 1IXOA 4NZFA 4RZ4A 3TQKA 4KFNA 3A24A 3IIZA 2BLEA 3NQ2A 2CFFA 2EAWA 2V82A 3W1MA 3S6DA 3GAKA 4KFOA 1MSSA 1KFKA 3H54A 3TC6A 1A50A 1SO3A 3EWXA 2CZFA 1PS9A 4WY0A 4P2VA 1YPFA 4XQ6A 1C29A 3LBMA 4JGDA 5BMWA 1YDVA 4MZYA 5D02A 1K7EA 3GLCA 5I3GA 4OU1A 2O7QA 3UZ5A 4ZQCA 4UNKA 2WNNA 4MZ8A 4NU7A 1Z42A 1TPC1 3O06A 3PULA 3LBCA 2OT1A 1JQVA 2QCDA 5K7JA 3EKZA 4NJIA 4DO4A 4YXGA 5CG7A 3S1XA 4O54A 1W3TA 4LRTA 1GVFA 3G1XA 4XUGA 5D37A 1AW1A 1I2OA 3VE7A 1QDSA 3O8AA 1KBJA 4JNMA 1VHNA 2ZRVA 1X1OA 4DO6A 5TIMA 2Q3OA 3U2OA 4RR4A 1F05A 5BMXA 4O12A 4NX5A 3SIZA 3LCIA 1QAPA 1XI3A 1YTKA 3P62A 4D2JA 3L5MA 1SQ7A 2ABAA 1H7RA 3VCRA 3W7OA 3B4UA 5LSMA 2V0TA 1ZY9A 1JULA 3NQVA 2RDWA 1DKWA 5IBXC 4L4LA 3E12A 1JUBA 3GDMA 3Q2DA 2QKFA 3BGJA 5D09A 2ISVA 1H62A 5CPNA 2FJKA 2KZHA 3M44A 2V9DA 1DQWA 2RH9A 3OVPA 3RLVA 5TQLA 4OV4A 3GR7A 2VEPA 1EEPA 4C1LA 3UXDA 5FF0A 4UTWC 1IGSA 3DI1A 4OQVA 3ABOA 1Z44A 3T78A 1TJRA 5KINA 2E6FA 2Z0IA 3W7GA 1F5ZA 3TMQA 3CU2A 4HIBA 2ZRYA 4UCGA 3B06A 3MYOA 3LHTA 1KM3A 2VXNA 1L6SA 2ALDA 4O14A 3S1VA 1HFBA 3STGA 4O0KA 3O16A 2YPIA 1NSJA 4S2CA 3D0CA 3PAJA 5HMSA 2VENA 3FJLA 2C13A 5SWUA 4FNTA 4K7VA 3F4NA 1KBIA 5D30A 5K9CA 4DF2A 4LUIA 2E5DA 4OHQA 3NQFA 2ZCGA 2CLKA 2CZEA 3NL2A 3DH7A 4XZ9A 4U4MA 5CGQA 2Y6ZA 1DORA 3QMSA 4XBSA 3W1QA 5HR6A 1QCWA 4JTTA 2FPVA 1O4UA 3W1AA 1HG3A 1NVMA 2PC4A 2QCCA 2VELA 3FA5A 3P5ZA 3G1HA 2WQPA 1FXQA 4P61A 1VRDA 4X9SA 3A9IA 1DV7A 1ZJIA 4JEQA 4MLRA 4JY8A 4Y6GA 1FBAA 4DXVA 3W23A 5AHNA 1O60A 3Q94A 4M5PA 4X2RA 5F2IA 3QEZA 2A5HA 3LCXA 3A5FA 2H8XA 4N4PA 4AWTA 3KXQA 4K38A 1B3OA 2DJXA 3L65A 3PSVA 5F2LA 1FWNA 3G1FA 4MY8A 4A2SA 5D2VA 1U5JA 3CEUA 3C3NA 4TU1A 4CCEA 3KVMA 3LHVA 2JK2A 5AC7A 3W2KA 5LZLA 2ZRWA 4ZQRA 4O4VA 2WSQA 5DBTA 3SGUA 2ZTJA 4AVFA 4FF7A 1YXCA 1SW0A 2QUUA 1M6JA 3B04A 3QC3A 3NQ6A 3DU0A 1OFPA 4LT9A 1R46A 3DKLA 1H7OA 4HSOA 5G5IA 3M5XA 3O05A 3W1TA 3NDOA 5FF4A 3VE9A 3THAA 2QJGA 1LBMA 3FFSA 2QCHA 3C2VA 4FNRA 4GXMA 4PEKA 3FYPA 5HQEA 1OX4A 4CQAA 4MJZA 3MJYA 2QUVA 3G8EA 1EP3A 3W2MA 2NV1A 2RHGA 1EX5A 4AAJA 1THFD 3DFOA 3UWZA 1RV8A 4Z1CA 3OIXA 1F2JA 2YW4A 4RX0A 4M6VA 4O57A 1SUXA 1Q6OA 1K02A 3MHGA 3MBFA 1IXQA 3C2EA 3WJXA 1VGAA 4JTUA 1XBXA 2QCFA 4WY0B 1J2WA 1TV5A 3QSRA 1LRTA 5CZ0A 3W1XA 3G22A 4PL1A 1SW3A 1QPRA 4QISA 4I9AA 4O18A 3WK3A 1YDOA 4N9CA 5CPOA 1M5WA 3MP5A 4JYEA 2ZQ0A 5TBOA 3BO9A 3C8FA 1H50A 2CW6A 3G18A 4JY9A 5HWNA 5HUOA 2CLLA 4O17A 1XC4A 4N2YA 2GVGA 1P5BA 1HL2A 5IM51 4Y96A 5CPLA 1K7XA 1T96A 2ABBA 1G67A 1VYRA 2GQ9A 3W70A 3O07A 5I3JA 2VFEA 1YYAA 1PV8A 2VKZG 2JKEA 3IEBA 3FIGA 1TMHA 1RQHA 5C6MA 2P0OA 4DF0A 2I14A 1V7YA 3HGJA 3GXPA 6ALDA 4K6AA 1VR6A 5AHFA 4LNYA 1OG0A 3BLEA 2YYUA 4GUIA 2PCQA 4EF9A 4HNTA 2V2DA 4HT3A 1ZNNA 5F4SA 3LCHA 3TCEA 3G1AA 3RU6A 3CIWA 4MZ1A 3W83A 5FEXA 4FNQA 2NUWA 4IQLA 3W85A 3B05A 1LOLA 1EA0A 1VJIA 4DBDA 3MO7A 1ICPA 1LOQA 3NQ8A 3CT7A 1D3HA 4MLJA 6TIMA 3GR8A 3WK2A 4EWND 4BF9A 3UWUA 1TTJA 3INPA 4N9EA 1LDCA 1GQNA 1G4SA 3NNTA 1ONRA 1W3IA 5H91A 3M7WA 1RZMA 1B4EA 5A8GA 2QCEA 3W07A 5HULA 5KMYA 4MYAA 4UTIA 1L9WA 3SECA 2OMAA 5HR7A 5KTLA 4NJKA 3ELFA 3A23A 3QMRA 5J5DA 4QSHA 1AG1O 1OJXA 5K9XA 1TPUA 5G4EA 3W1UA 1TCDA 4LVBA 1KM5A 3KRUA 4HNUA 5F4WA 5G1TA 3G8RA 2R8WA 1R2TA 1W0MA 3TW7A 2WSRA 1IIGA 5E1QA 4O15A 1X8FA 1TV7A 2WSYA 2A2IA 2EGZA 1EP2A 3C4UA 5K3VA 3W7CA 2WPBA 2A4AA 4JTSA 3E9AA 2ZRXA 3G0UA 3NEVA 4ALDA 1LBLA 1W3NA 2AGKA 2H3DA 1TTPA 2NX1A 1V5XA 3GB6A 3B0VC 3LHWA 1P0KA 2G96A 5DCDA 2ISWA 2C1HA 3EX4A 3IGUA 4JD4A 2Q8ZA 1VCFA 4NUWA 3CHVA 4JXCA 4XWUA 1BEUA 3NOEA 1IF2A 4HSNA 1N7KA 3NQMA 1SFJA 3JS3A 2FB3A 1O5KA 4G1KA 2NZLA 3EXTA 4NNAA 4JTKA 5FEWA 4ZL1A 1W5MA 1H51A 3C2FA 3GDKA 4NXSA 2VEMA 3T7VA 4M6QA 1GVRA 3L68A 1KV8A 1TIMA 2C15A 4QITA 3EB2A 4GRSA 4XTIA 3WFAA 1F6PA 3CC1A 4JTGA 3NYZA 5AYYA 5FEZA 1G6CA 2TMDA 1IXPA 1FCUA 5G2HA 3TFCA 4E38A 3OEXA 4O50A 2NX3A 3DFSA 3HB9A 4O52A 3TXZA 3K30A 3NPUA 4FHAA 3G0XA 3BVJA 2B4GA 1JCYA 2ZZ4A 4EOUA 1TSIA 1UB3A 1LROA 3KAOA 1LTDA 1YPIA 3MHUA 3EWUA 3W72A 4YWIA 5LGZA 4JDYA 3UYCA 3LXAA 2Z6JA 1QWGA 1KTCA 4O16A 1QFEA 3QMTA 3OA3A 4I7WA 3SSJA 2EKCA 2TSYA 4A22A 1SR9A 3NL6A 3AJXA 3NXFA 3NPVA 3NQDA 4Q32A 1CX9A 1SSGA 5HINA 1KFBA 2P10A 2E6YA 1YDNA 4JN6A 2A7NA 3EXRA 1JCJA 4WXYA 3G24A 3MBDA 3N73A 2VOMA 1JQXA 4EVZA 4XKYB 4A29A 5LGXA 3R13A 3TX9A 2B7NA 5K2ZA 5G1YA 1WV2A 3S0CA 3DFNA 3PUEA 2TRSA 3BW4A 2ATMA 3NL5A 4LV4A 4O10A 4UUIA 1H7WA 3MI3A 3GDRA 4K39A 1ZAIA 2X16A 3ATZA 4ICNA 1XUUA 3NAVA 3RNDA 2YR1A 1WA3A 3W9ZA 5G2IA 3C6CA 3LCGA 1FDJA 3W7HA 3CIXA 1XL9A 4LU0A 3W7EA 2BXVA 1W1ZA 4R34A 4Z08A 3P61A 3M16A 4CNOA 3THQA 1HO1A 4JS3A 4K36A 2XFWA 1K8XA 3W7JA 1EB3A 3STEA 3HOJA 2R14A 1AL7A 2B7QA 3UD6A 1SZGA 4FIQA 4AMAA 1GVOA 2YGYA 5DLCA 1Y0EA 2VFFA 5D2WA 3L0KA 3TKFA 3RFAA 3TSBA 3S5OA 2ZA3A 1LORA 1X7FA 3OVQA 2YX0A 4FIRA 1OHLA 1AW2A 3GKFA 4E2BA 1ADOA 3HO8A 4QAIA 1W5OA 2NXIA 2ZA2A 3GXNA 2CU0A 4DEFA 2DZVA 1QOPA 2W79A 2DZWA 1FWTA 1WQ5A 4IWWA 3NQAA 4IMEA 4FEZA 2A7RA 3F1QA 4WX2A 3LXCA 2EF9A 1VZWA 3G3MA 1H7XA 4FB7A 3FEMA 5FF2A 1NFBA 4O1CA 2J27A 2E09A 4IMCA 1FCVA 5LNVA 4PFMA 2DZPA 1JJKA 3P67A 4O11A 4R33A 2V5LA 3SI9A 4ORIA 3GX9A 1MEHA 3G1DA 1AL8A 4UFMA 2A6NA 3DHFA 2PURA 3LV5A 3NQ7A 3DFPA 2C16A 4WOZA 5KZDA 2W6RA 3G1YA 1DL3A 1YADA 3LTPA 3LXBA 2YCEA 2CLFA 4AF0B 1NEYA 5LNSA 4ADSA 3PG8A 2UV8G 5J5RA 4ORMA 3TIMA 1G7VA 3LRLA 4BI7A 4LWWA 2NLIA 1OX6A 1W31A 3MUXA 7TIMA 4JYFA 2PRMA 3PBUA 4HN4A 3WJSA 1H60A 3W7QA 3GXTA 4MUZA 2FPYA 2A7PA 1PIIA 1ICSA 1R30A 2X30A 4PODA 2OZ0A 3VFLA 3BGGA 1SO4A 2ZZ1A 1T8XA 2O7SA 3ANYA 1I45A 1B9BA 3N2MA 3W76A 5AOUA 3FKRA 1OABA 2FTPA 3C56A 1NF7A 3HG3A 3ZWTA 4DPPA 1TO3A 3H53A 1ME8A 4LV9A 1KM1A 3O6YX 1RR2A 4LVAA 5LNWA 1TRIA 3QRHA 4HHPA 3L5LA 2ATSA 3W7IA 1K03A 4MJMA 4TR9A 5HWMA 4OWGA 4WD0A 1GG1A 3S5NA 3V1PA 3IV3A 5AN7A 5KITA 3GNDA 1A5BA 1EUAA 2GQAA 1BTMA 4BFAA 3TMLA 4QM1A 3NGJA 3STFA 3ATYA 1VYSX 4DELA 4QQ3A 2YFOA 3UZJA 1AK5A 3MP4A 1K7FA 5H2ZA 1ZAJA 2DU2A 5CSSA 2RDTA 3ZWSA 1H1ZA 5MHBA 1WOBA 4NVTA 4FNPA 2Y88A 2PE4A 1RVGA 2Z6IA 3FKKA 3QQ0A 1GOXA 4JX5A 5CZSA 3G3DA 4DBEA 1K3UA 4UR7A 2QCDB 3W2NA 2C0AA 3WJZA 2HSAA 3PBWA 4Y8FA 1PCKA 4C1KA 4JTIA 2HTMA 3C61A 2V8ZA 3TQVA 1O5XA 3N3MA 1DJNA 3PY2A 2EPHA 1ZHAA 3HGRA 4AHPA 4UFHA 5C55A 3SZ8A 4UNLA 4PTNA 2FQIA 4N6FA 2Y70A 4UTKA 2QCGA 4MY1A 4IPJA 4JTEA 1O95A 3HPXA 4NJGA 4A2RA 5I3HA 3L9CA 2X1UA 1Q6QA 3S5ZA 3UQNA 3LV6A 3TXVA 1W37A 1G7UA 5C5YA 1JUEA 1SW7A 1DVJA 2GJLA 2ZZ3A 1WBHA 4EIVA 3W7NA 1T99A 3TE9A 3B0UX 2Y7FA 3W88A 3WK0A 3UWWA 4WXZA 3LCFA 4UR8A 1X1ZA 2WNZA 4LC8A 2V2HA 2J24A 3UY7A 5BW6A 1H7NA 2TYSA 3LRMA 3E49A 1I8JA 4ZZ9A 4O19A 1KTBA 2H6RA 3M1ZA 3BG3A 3NM3A 4MYXA 3KFTA 1G69A 3MHFA 1DJQA 3LGEA 4UFKA 4K7YA 2A85A 2R94A 1OFEA 8TIMA 5D32A 2WOQA 1YXYA 3LHUA 3IVUA 1TPEA 3C2RA 3G1SA 4RLIA 4UTJA 3P5YA 1S5WA 4X3ZA 4M7TA 2JKPA 1FWWA 3F03K 3NZ1A 1WX0A 3I7RA 2BX7A 2H90A 3ZR4A 2Y85A 4UTLA 3W7KA 3W7PA 1TRDA 4O8RA 1OF6A 2NUXA 3HMJG 3EWZA 4S2BA 4CCCA 1Q6RA 1KV5A 3NPXA 4K8HA 3R5EA 4UFIA 3O6CA 2I1OA 3GZ3A 1OFOA 3P60A 2ZZ6A 4JICA 1LZOA 3O63A 5CZJA 3TAOA 3TQ0A 2GQ8A 3P8IA 2NWSA 3W74A 3ZS4A 4IMFA 2Q8LA 2QAFA 4IGHA 3RF9A 2H8ZA 4S1FA 1LCOA 3DAQA 3LX9A 2YW3A 4AF0A 4I7VA 1U83A 3LOTA 1TREA 4LVGA 3TC7A 2OJPA 3OBKA 1QPOA 4R7JA 5F1VA 3W7RA 4UTWA 3CWNA 1ME9A 4NT0A 1Q45A 1FCQA 3EX6A 1Q3NA 4JTLA 2VFGA 3W22A 1EP1A 2LLEA 2ZFAA 2Q3RA 5FESA 4PL2A 5I3IA 3CM4A 1FWSA 3DHDA 1OX5A 4BR1A 2OX1A 3T40A 3GAYA 1L6WA 4RJEA 4LC6A 4WOQA 3MI6A 2XN1A 4TO8A 1MO0A 3L21A 2WV8A 1N55A 4LVFA 5DY2A 3W1RA 2ZRZA 3KVKA 3BW2A 2BWGA 3C0JA 1PE1A 3B0PA 3DXIA 2BZNA 3O6DA 2ZYFA 1KM4A 5FEPA 5F4XA 3TAKA 3TSDA 3NQGA 3F4WA 1TPVA 1KFCA 3KVJA 3N14A 3W2LA 4LTSA 3S1UA 4BI6A 5E0KA 1P4CA 3BV4A 3O15A 4MIMA 3T55A 3BLFA 2I9EA 3GK0A 2H3BA 3BG5A 3EEGA 2J9XA 1QOQA 1EPXA 1N8FA 1TTIA 4UTMA 3E0IA 1F76A 2A0NA 3LLFA 3GDLA 5U4NA 3KOFA 4RXGA 3A22A 3AO0A 4KFPA 3M47A 1RD5A 1LYXA 2R91A 2E5BA 4JIQA 4PA8A 1KFLA 3LDVA 3LM7A 1SO6A 3LLDA 3M9YA 4IMDA 4GUHA 2DZXA 4J9JA 4WY0F 2Y7GA 3SY5A 4AWUA 4UTHA 1Z41A 1VLWA 2JGYA 3SW6A 1BKSA 4BWLA 2E6DA 4Z1BA 2Y61A 5FF3A 5LHEA 3IGXA 3TA6A 2GVLA 4PCFA 1DBTA 1L6YA 3FJ6A 1C9DA 1G4EA 3CWOX 2Y62A 3M43A 3USBA 3S1WA 1ALDA 3PUDA 4FX7A 1RQEA 2VFDA 1MEWA 1AMKA 1JCXA 3IVSA 3PF3A 3DBPA 2VC6A 3BW3A 4IX0A 1W56A 3ABQA 4UTTC 4N9BA 1GTEA 2J9YA 4RCXA 3KRSA 4JR5A 1JCLA 2ISSA 4KWWA 3KRZA 3PB0A 4YMZA 3P8JA 4GE8A 4BWLC 3HJZA 1J5TA 1W5PA 4AB4A 4H3DA 1ZCOA 4CQ8A 4CCDA 3QFEA 3JRKA 1ZENA 2RKXA 3A21A 3W7LA 4LOCA 1FCBA 2CWNA 1EWDA 1LRQA 1WAUA 2E68A 3LB0A 1TJPA 4OV9A 1H5YA 1GPWA 4TIMA 4FNUA 5EYWA 5AC8A 2DZSA 2GUUA 3VI2A 4KKXA 4FO4A 1LM1A 2FPTA 1OFDA 1UASA 3I6RA 1TPB1 4O1DA 3W71A 1B57A 5K4ZA 3LTSA 2YXGA 4GFSA 4XTDA 4LRSA 1OVDA 3MYPA 1UJPA 5KSWA 3PBVA 5DBUA 3UWYA 1O94A 1FUYA 3LRKA 1OF8A 2ZBTA 4RKAA 3MI2A 3P81A 3M5VA 4K8EA 2FDSA 4UXDA 1KFJA 1S3HA 5I3KA 4NQ1A 1XM3A 4CQ9A 5AHLA 2Y7DA 3M0ZA 5L9FA 5FI8A 3DFTA 4Y9AA 2WJZA 4LUJA 5K4XA 4MPQA 1UUMA 1QPNA 4RXFA 1YLVA 2HMCA 2F84A 1BWKA 1SZFA 4UTTA 1ME7A 2XN0A 2GPTA 4BK9A 1P1XA 4GC4A 1XBVA 1W5NA 4LS1A 1VHCA 4O13A 4CNPA 1TTQA 2J6XA 3MMTA 4DQWA 3WJWA 4ZQPA 1HTIA 3IIPA 5CSRA 2NX9A 2ZTKA 2FIQA 1DHPA 3SR7A 1GWJA 2CLOA 1OYBA 1W54A 2QCMA 2ZZ5A 1XKYA 1L2UA 1GG0A 3L5AA 3RK8A 3LHYA 1UCWA 1FY6A 3W1LA 2RDUA 2EHHA 3WK1A 4QNEA 1VC4A 1WDWA 3SFKA 3KX6A 5IBXA 4AXKA 3HG4A 4MY9A 2WO5A 5D05A 4FX6M 4ADUA 4JDBA 3YPIA 1NF0A 2NWRA 4GNJA 3TH6A 2Z1BA 3UWQA 5DN1A 2CLEA 1H7PA 2QEZA 2TPSA 4AHOA 5D2YA 3IIOA 1KM2A 1RPXA 4A3UA 4K37A 2E77A 1SO5A 4QIUA 4GUGA 1KTNA 1PVNA 3HIJA 4UMAA 1LOSA 2G5WA 3LTYA 5HJLA 4HPXA 5E93A 4FNSA 4JTJA 1GYLA 3HPZA 4A21A 1VLIA 3DGRA 3W6YA 3M41A 5AHEA 1F73A 3GKAA 1RQBA 2YDAA 1C8VA 1PL9A 3UPWA 1W8SA 5C54A 3BPWA 3DENA 2X1SA 2QDGA 4O1BA 1HO4A 1EWEA 1GJPA 4E2DA 1BWLA 1MZHA 3C2OA 4O28A 3W87A 2Z2UA 4N9DA 2VFIA 2DORA 1I2RA 3W3OA 3QH2A 1M7OA 2QCLA 3R89A 3P7YA 5CZTA 1FXPA 1KFEA 2V30A 4JX4A 4QJ1A 1FX6A 3S8HA 2GJNA 1GEQA 1TB3A 5EY5A 4ZVJA 3HF3A 2PRLA 1F74A 3I7QA 3W84A 1QNVA 4O1AA 3W1NA 3W2UA 3U8GA 1H61A 2YSWA 3GDTA 4GUFA 3MP3A 2Y89A 2Y7EA 4IMGA 3TW6A 1A5AA 3BLIA 4B5NA 4DPQA 1FDZA 2V81A 5D04C 2G95A 3KHJA 2QJIA 2CZDA 2QR6A 4FXSA 4NNBA 4AHQA 1M7PA 2C3ZA 1VQTA 3CQ0A 5D03A 2OCZA 1Z48A 4H6KA 4YCOA 1XUZA 4UFJA 3T4CA 2CLMA 5EPDA 4FXRA 3DI0A 3E96A 4UIOA
chains in the Genus database with same CATH superfamily
2J7DA 3LERA 4MOZA 3CUIA 4IUOA 2PDUA 3B8TA 5A69A 1UD3A 3N29A 2J7GA 4C1NB 1OFQA 3DIPA 5D2TA 4YTQA 5I23A 3E74A 3AOFA 4N42A 3UNTA 1XIMA 3L0NA 2XZ7A 1G4TA 5AHIA 4DVOA 5CJ5A 1JXKA 1UUOA 1QW7A 3H55A 4LAUA 5FJJA 1J9YA 1IYXA 3W81A 1R3YA 3CB8A 1KWGA 1GW1A 4Y9MA 5AFDA 1GTHA 2PDKA 3QPEA 4IH3A 3NZPA 1OFAA 3UWVA 1LJYA 3EWWA 4XKYA 4NX0A 2HNEA 2V67A 4NZCA 1KCLA 3W7MA 3KLKA 3WD1A 5GNYA 4FALA 3P84A 3CTTA 5AYBA 4GVHA 1RLDA 1YTEA 3WDJA 3BDKA 3HV9A 4G9PA 1V0LA 4OTKA 1TV3A 5D8ZA 2VWSA 4MFEA 2EPKX 4UMBA 1U1HA 4JYDA 2XINA 3A4AA 3NSNA 4DI9A 4XD4A 4W7VA 3RLGA 5BXPA 1SMAA 3QSTA 1ICQA 2NXGA 1ZALA 2OG9A 2ZUTA 1NY1A 1Z3NA 4MB4A 3K1DA 3M0LA 3A13A 3PJUA 2GOKA 3P3BA 3WQ6A 2OLSA 1R2RA 1U5VA 4YLWA 2HZGA 5DT7A 3M6YA 4H83A 3GXIA 3HU7A 4IX2A 3T44A 1J0YA 4H9TA 3RMJA 4FR6A 4IOTA 1DQUA 2WNQA 1D9EA 1KW1A 3HGSA 4IPIA 1BGAA 2BP1A 1EJWC 1TZZA 4GVFA 1ML1A 2C6QA 1YIXA 2NLYA 1V6UA 3PBYA 2VVNA 1MRAA 1R85A 2CERA 1GOWA 4F40A 4LEQA 2WKLA 1UZ4A 1TWDA 1SMDA 4LAMA 5FJTA 3S83A 4UB9A 4GH3A 4HOWA 4JTFA 5EL1A 3VABA 3EKLA 4YS1A 1F3EA 1SPQA 4GBDA 3USZA 1B54A 4KWVA 1U22A 2QUNA 4ZSUA 2AQWA 4GWEA 1FQ0A 3NQEA 1BG4A 4ATLA 1VBUA 5HBFA 4WK9A 4PMYA 2P0IA 1XCFA 4O1EA 2VOTA 5EKYA 5JUVA 1EKOA 1FVPA 2ZA1A 1AQHA 2GGIA 3GC2A 1W1B1 4Z2KA 5A6AA 4YN5A 5CBBA 3PTMA 4Q8TA 3F4CA 1ZS2A 5D33A 1EIBA 2NT1A 3TFXA 3FS2A 3CPRA 4W8AA 3W73A 4LALA 5CC5A 2HK1A 3CS2A 1JRBA 4H8VA 4BQ5A 4ZA0A 4AZCA 2R82A 3TSMA 3GVGA 3K8LA 1UROA 4YCPA 2DZUA 2YFNA 1JRCA 3CLMA 5EA9A 5E70A 1SU5A 3DFQA 2VR2A 2XVPA 4HNVA 5A5WA 2WMIA 4M6PA 2GJXB 2DZTA 3BAKA 1GYNA 2ACUA 1ZAHA 2HS6A 3PTQA 4MWAC 1XBZA 1K8YA 4AX7A 2DH3A 3BARA 2XG9A 4LY4A 1S5VA 4V28A 3A5VA 4E8DA 3W4RA 4DJEC 1QK0A 1WE5A 3LHZA 3MKVA 2YIHA 1GQIA 5CC7A 4AUBA 1H63A 3FYOA 2P3ZA 2DGAA 5TAOA 2PGFA 2R1MA 4HP5A 1W2VA 1T8QA 4O53A 3N2CA 5ABGA 3WMLA 2OFJA 2J66A 3NA8A 4REQA 3C0QA 3DKJA 5I7GA 4L4MA 4Q8WA 2RJHA 1NAL1 3IACA 1OK6A 6CGTA 3R12A 5M17A 2VX5A 2QUTA 4NAEB 1VFLA 1EGZA 2BFGA 3UA3A 2OYLA 1PCWA 1NTHA 4J27A 4GK8A 2VM8A 4C7DA 1RALA 4B3KA 5I6SA 2ALRA 1IZKA 3H4XA 5CH9A 2W27A 1J96A 4KRUA 1A0CA 2OZTA 3PJWA 3HGOA 3TU9A 3K2GA 1K70A 2VX7A 3GSMA 3OB8A 4LS0A 1A80A 2A3AA 3CMFA 2FFCA 5AB3A 1FTXA 1PPIA 4JTHA 2E6AA 3ME3A 1KC7A 3HG5A 4ZQMA 4LVDA 1IIHA 4NJJA 3KBSA 2BVDA 2OT0A 4CN4A 2ACQA 5I79A 3ZFHA 1BSLA 4QAWA 2ZE3A 3PJXA 2ZZ7A 3NEHA 1TPWA 3B9OA 3H2CA 3OQEA 1B1YA 1PX8A 3P82A 6TAAA 3TYBA 4PRTA 3FK4A 2PDPA 3ISIX 3R0UA 4GGBA 4GI4A 1XD0A 2PODA 5HDRA 3ZJ7A 3ITXA 2PP3A 2QCNA 3NSXA 3GC4A 3D47A 3S9IA 1PIGA 4KS0A 7ODCA 3VD5A 2OR2A 1DIDA 1VBRA 2VEIA 3SUTA 2B7PA 4U33A 4QNWA 2YZ5A 1EZ2A 3SCUA 5IXEA 1OIMA 1J0IA 1VENA 4GBUA 4GMEA 5KZEA 1UQZA 4X22A 2Y5EA 3QVQA 4IGMA 2OODA 4CKQA 4KF1A 3AXHA 3TQKA 4RZ4A 4ECLA 2BLEA 3OBEA 4BEQA 1IV8A 1XW8A 4BQ3A 3KRBA 2BVYA 1MSSA 1UPPA 2D2GA 3EPMA 3CPUA 3H54A 4V1YA 2A3HA 3LPGA 4A6GA 4K1GA 3SGGA 4JIHA 3LBMA 4KCTA 4JGDA 1YDVA 1QW9A 3WQCA 3GNPA 4CEUC 3UPMA 4FOJA 1CGUA 3EOUA 4GQBA 4OU1A 4TTGA 1KRAC 4RDZA 4DZHA 4NU7A 1Z42A 3O06A 2XSBA 3PULA 2YLLA 4W84A 1LT8A 3A12A 3V1HA 3GE7A 1TZ9A 4RUBA 4DO4A 3ZM8A 5T91A 7PTDA 1W3TA 1GVFA 3FSTA 1LL6A 4DUVA 4XUGA 1XV8A 5D37A 3VE7A 1QDSA 1KBJA 4KEZA 1VHNA 3L2LA 3MSDA 3MMDA 1PZ3A 2VD8A 1XLJA 3GFXA 1B9ZA 4UCFA 3S47A 1HF6A 5DMLA 3LCIA 1CXHA 4DN1A 4D2JA 4XSMA 2ABAA 1KRCC 3NGFA 3VCRA 5LSMA 2V0TA 1JULA 3KCOA 3NQVA 2NT0A 1DKWA 1ECEA 1IEVA 3GH7A 4DZIA 3QHMA 1MUCA 1JUBA 3WD4A 1XP3A 1R7AA 4HMNA 5CPNA 3QV9A 3M44A 5I24A 2V9DA 4ZTXA 3SJNA 3OVPA 2PB1A 4OV4A 1XLFA 1EEPA 1YQ2A 4KRZA 2HNHA 4U3CA 1WKYA 2OSWA 2E8ZA 4H7VA 4OQVA 3B9EA 3ERPA 3WBWA 5C9UA 1TJRA 3VU2A 3WQ4A 4XISA 4AIBA 4G2DA 1YE6A 3IS4A 3CQIA 4X63A 3L4ZA 4JIEA 2ZRYA 4UCGA 5EMMA 3LHTA 1KGWA 2GJRA 4O14A 4A35A 1BRLB 1NSJA 4AZGA 4KESA 3T8QA 5HMSA 1B3WA 3SCTA 3ZT7A 3SIMA 4RE4A 4US5A 2CCRA 4ZE4A 3BZGA 1EH9A 1EJTC 3QMSA 1JAKA 1H0IA 3W1QA 2YL6A 1UZHA 5HR6A 4QG9A 4DWSA 2NQ5A 3FA5A 4MNJA 4XZLX 1UR9A 3CH9A 1DV7A 2AKZA 6ENLA 1ODZA 3QGVA 1CWYA 4Y6GA 4PTWA 2V5KA 1FBAA 3W23A 1R5YA 4M5PA 5F2IA 4ROQA 3LCXA 1AZ2A 3A5FA 1JG9A 2JE8A 4DYJA 3LA4A 4HTBA 3KXQA 5C9RA 2V38A 1Q63A 2PDXA 2CHNA 4K38A 2W4XA 3CZGA 1FWNA 3G1FA 2EPOA 5E0FA 4A2SA 4RW5A 4CCEA 3WD2A 2JK2A 3F4DA 5LZLA 4H8UA 1JFHA 3KBVA 3WG6A 2VEGA 3AZRA 1R9YA 4ZQRA 1MXDA 2OX4A 2WSQA 3SGUA 4AVFA 4EACA 2ZUMA 1NWUA 4C6IA 1YXCA 2FVKA 2ZUVA 1M6JA 5LA2A 4OUEA 2A3EA 5A8MA 1OCBA 3M5XA 1TG7A 1VP5A 4O1FA 4U10A 2C1GA 1VB9A 3THAA 2QJGA 4JHOA 1SFSA 4CQAA 4MJZA 3MJYA 1C9WA 3LN3A 1EP3A 1H41A 3P2VA 2RHGA 4AAJA 1RH9A 4CD5A 4AD0A 3B97A 4LYRA 4Z1CA 4OOUA 3ZSSA 2YW4A 4RX0A 3QOKA 1IZCA 1EC8A 2WM0A 4PUUA 1NJJA 1E1EA 3FA3A 2PLCA 2QCFA 4WY0B 4PTXA 5EFDA 1JYWA 3QSRA 2F6XA 4PL1A 4PUWA 1REQB 4I9AA 3WK3A 2BGQA 3KTXA 1M5WA 1OC5A 1FWAC 3B9NA 3RN6A 4BHYA 1OINA 1ODUA 3RPDA 3PPHA 1XSKA 1OCQA 3UJFA 2E28A 2CLLA 4PMVA 5IM51 5CPLA 3GTXA 3IJ7A 1VYRA 1WP6A 3W53A 2GQ9A 2CKSA 3O07A 2DV0A 1PV8A 3U7BA 4PZVA 2JKEA 3UGVA 1TMHA 4E6MA 2Y8UA 2FZDA 4GY0A 4DF0A 1FHDA 4WEVX 4RDYA 5A1AA 3JZEA 1NDWA 4K6AA 3R94A 1C90A 4GUIA 4UNIA 1YW1A 1ZNNA 1TZ7A 3LCHA 1MVYA 3G1AA 2DW6A 4JNZA 3CIWA 4MZ1A 1WCGA 3RILA 3S2MA 3MCMA 4W93A 3W85A 4PN2A 1KGXA 1LOLA 3CUHA 4I5UA 2WHJA 1VJIA 4DBDA 4CVUA 3MO7A 1LOQA 1FRBA 3WH8A 4MLJA 2IPJA 3WF4A 3K5XA 1WAWA 4BF9A 3AU2A 3UWUA 3WFZA 1TWSA 3VNLA 1RCQA 1GQNA 4V27A 3WBEA 3BCDA 3DHUA 3RO6A 2ZX9A 5D9NA 1NIUA 2WHKA 5JIPA 1JD9A 2IW0A 4PCPA 1A3WA 4W8LA 4CNSA 3Q67A 2WC4A 4QSHA 2YOCA 3CHDA 1OJXA 5G4EA 1TPUA 1UA7A 1TCDA 4F79A 2D2HA 3CUXA 3TJ4A 4HNUA 4JIIX 3CMJA 3FY1A 1EJVC 3EPOA 3SRKA 1W0MA 5CBIA 5I78A 4H1ZA 2WMGA 1X8FA 2ZXDA 3SM0A 4BZYA 2ADAA 1EP2A 3SCRA 2A4AA 2ZRXA 3PN8A 4ALDA 3GXFA 4GNKB 4KCWA 1TTPA 2NX1A 2QLYA 3W29A 2DSKA 1YEYA 2Y1HA 3B0VC 2G96A 5HNTA 1H0GA 1JZ3A 4V33A 2UWFA 4JD4A 2PBGA 4IPLA 4NUWA 1C8YA 3CHVA 2QYGA 4YWSA 2QGYA 4XWUA 3NOEA 1IF2A 3QV7A 3NQMA 1OWQA 4IM4A 1W17A 1O5KA 3V36A 2J4GA 3GDKA 4NXSA 2FGLA 1JDDA 2VEMA 4IFOA 4Q6JA 1E6XM 3CPGA 4H8NA 1DWFM 1KV8A 1TIMA 4QITA 5BROA 1EFZA 1W9VA 3WFAA 4ZO8A 1NDYA 4GPNA 5G2HA 4O50A 2NX3A 3HB9A 2NVCA 4QLKA 1F4AA 3VX1A 4FHAA 2GQ3A 2B4GA 1TSIA 1UB3A 1LROA 5CLWA 1JD7A 1YPIA 2BOFX 3W72A 4PB3A 2Z6JA 4OFCA 1KTCA 3WBYA 3KDNA 4U2ZA 3SSJA 4A22A 1SR9A 1DJXA 5A2AA 2WAGA 1E0TA 1XX1A 4HJFA 3SCWA 5T9BG 3NQDA 1VFUA 3CZEA 1CX9A 1SSGA 1KFBA 1V3KA 2P10A 4BQ4A 2E6YA 1VBJA 1CXIA 3EXRA 4TOQA 1GPFA 3N73A 2PU1A 3WFLA 1JQXA 3AXKA 4XZIA 4XKYB 2VJXA 1EC7A 2B7NA 2J74A 3MT1A 3WNLA 5A6BD 3DFNA 4CD8A 1XLGA 1EOMA 3FJNA 2VR4A 4KERA 2BVWA 4JQAA 3VUSA 2VUNA 4K39A 2PDGA 4AXNA 1DWGM 1W3KA 5C8BB 4HOXA 2HBXA 2GUYA 5ABFA 3W9ZA 3CZLA 1FDJA 2DVXA 3VKAA 1RJQA 1XL9A 3GM8A 2OYMA 3AXXA 1W1ZA 4Z08A 1OT1A 3MDUA 1UHVA 1DEDA 4UQCA 1FHLA 5FL0A 3P61A 2OOFA 1TWWA 3THQA 1HO1A 4K36A 2DVTA 4LYKA 1K8XA 4GI6A 3W7JA 2XFRA 2YA2A 1GQLA 3C86A 4AY7A 4I8YA 5DLCA 3L0KA 2OWXA 3U57A 5I06A 1J5SA 3WL0A 4L9YA 1ADOA 9CGTA 4QAIA 2ZA2A 2HJPA 1UWTA 2DZWA 5HPOA 1FWTA 2E7FA 3C5QA 2WMKA 4IMEA 1CGXA 2UZ9A 2A7RA 3UZYA 3EA3A 3LXCA 3R1ZA 2EF9A 4NY2A 3G3MA 2Q01A 1WDDA 2PDIA 1H7XA 4FB7A 4KEVA 5FF2A 4O1CA 1FWGC 5T8GA 4IMCA 3W6LA 5LNVA 1HP4A 4Q8PA 2C79A 2V5LA 4Y9NA 3A3XA 1M01A 1Q2RA 3B4YA 2QW5A 1MEHA 1KB3A 2GZXA 4W5ZA 4GACA 2W6RA 1DL3A 1YADA 3ENLA 3OLIA 1VBHA 5D9MA 2QXWA 1Q8AA 3PG8A 5FJRA 1TE1A 3OODA 3LRLA 3TIMA 4LWWA 3MUXA 1R8LA 2QPXA 2PRMA 1X96A 1PZ2A 5GNZA 3GXTA 1KXTA 4MUZA 1EDGA 2A7PA 4LX4A 4PODA 1R30A 3SBFA 4QGCA 1E9ZB 3WF2A 1EBHA 3BURA 1T8XA 3ANYA 4CN1A 2JEPA 3FKRA 1UOKA 3QR1A 4I6KA 2FTPA 2GJPA 3PZOA 2BOGX 4LV9A 2GK1A 3ZSTA 1HKWA 1TRIA 2E9LA 3QRHA 1T7LA 3N4AA 3UESA 2ATSA 1KFWA 3KTCA 4OWGA 3OIHA 3IV3A 1EUAA 2GQAA 1BTMA 4G56A 3B0XA 4GJJA 4PBGA 3ZMRA 3STFA 1MYRA 4DELA 4YIWA 4QDWA 4WGXA 4FZIA 4QQ3A 4QS6A 3G77A 3V0TA 1FKXA 1ECQA 2Z28A 2Q8XA 4FNPA 4BY3A 2PU0A 1GJWA 4L80A 4DBEA 1K3UA 4DXXA 3VGFA 3W2NA 4QDPA 3SCVA 2XH2A 2HTMA 2OELA 3TQVA 4B15A 3N3MA 3GNOA 3SEPA 5LIUX 1ZHAA 1DE5A 2Z25A 3CLWA 3HGRA 4A8IA 3CO8A 3T0BA 1JZ8A 2XGIA 1X39A 2FMNA 1JGMA 4N6FA 2D1ZA 4IPJA 3SRHA 1J11A 4A2RA 2X1UA 1Q6QA 3S5ZA 3QV8A 5CBJA 1AODA 1ISVA 2IXVA 1YNYA 3VC5A 5CCZA 3VKBA 3W7NA 1T99A 1XGDA 3TE9A 2WK2A 5A6BA 2HPMA 1FWFC 4WXZA 4UR8A 1X1ZA 3UY7A 5BW6A 3P6LA 2QF8A 1I8JA 3ARTA 3AYSA 1S1PA 4AD2A 4ZZ9A 3FX4A 4EXBA 1I1XA 3PZIA 1QU4A 5JMUA 1US2A 2PDBA 4MYXA 4H19A 5DRCA 1G69A 2Y2WA 4LSBA 2PZ0A 3IJIA 4X2PA 3ABZA 4XB3A 3P0XA 2G3NA 2R94A 5BCAA 3S46A 4GVIA 3LHUA 3IVUA 4HD5A 1S38A 3P5YA 4R7OA 1XC6A 3UP8A 1ELSA 3NZ1A 4GY1A 3PZVA 1XSJA 2H90A 3H7UA 3W7PA 1NWRA 1OF6A 2ESCA 1XLCA 3LG3A 3WH7A 1XSIA 3UXIA 3L7RA 2ZZ6A 3BUVA 3O63A 4GZJA 3WEOA 2INZA 1BYDA 4OUIA 5CZJA 1Q65A 3TAOA 3TQ0A 1V7AA 2GSHA 3W74A 1BPLB 3DCPA 2VRKA 3WQ8A 3ZO9A 4KGJA 2G3MA 4QE5A 2VRQA 4S1FA 3KEHA 3DAQA 4IUGA 4AF0A 4I7VA 4G8TA 3LOTA 3KBNA 3HV8A 4I9TA 1TREA 5CC3A 3TC7A 3T81A 3LLXA 1E43A 3FGCA 5I2UA 3E2QA 1JF5A 4DY1A 1ME9A 1XHGA 1PKLA 5CZKA 1FCQA 3EX6A 3H7VA 2VFGA 1EP1A 4JZ5A 2ZFAA 3KS5A 1FWSA 4BR1A 2OX1A 4PSPA 2XIOA 1DWIM 4RJEA 1BYCA 2HK0A 4PRRA 4TO8A 4ZODA 3L21A 2WZHA 3CQHA 1XR2A 4B5UA 3LQGA 2ZRZA 3KVKA 3B0PA 1AVAA 3DXIA 3O6DA 4ZOBA 4HA0A 1CPUA 2ZYFA 5FEPA 3GRIA 3NQGA 3F4WA 3KVJA 1XYCA 1IT7A 3FGCB 4BI6A 3EWDA 3T55A 3BLFA 3BOFA 4C6FA 3EEGA 2J9XA 1ITCA 3E0WA 1IT0A 4H9ZA 1TTIA 1TR9A 2V3GA 3E0IA 1F76A 2OOGA 2PTZA 3ZQ9A 3TONA 4GI8A 2ZICA 1WPCA 1ISWA 4GINA 3KOZA 1UP0A 4QS5A 3M07A 3L23A 4WY0F 1XPYA 3VOHA 4LGXA 1KNWA 2XIQA 4AWUA 3AYVA 1Z41A 2X0HA 3SW6A 4YTUA 1BKSA 3OTRA 3WLHA 4HU8A 2VHLA 1G4EA 3CWOX 3USBA 1B3ZA 5E5CA 3PUDA 1NFGA 3ITTA 4JKKA 3TZNA 4J3UA 3AALA 3DBPA 4IX0A 3T2QA 4E8GA 1XISA 2J9YA 1EX1A 4JR5A 1JCLA 1A0EA 3WMBA 3P8JA 4GE8A 1M03A 2VI0A 3CYJA 4FLRA 5REQA 1E6NA 2BXYA 3LMYA 2PD5A 1BGGA 3OYXA 3KE0A 4NP7A 2RKXA 3SCPA 3U4FA 2CWNA 2F8QA 3TC3A 3OZYA 3APTA 3OLGA 3LB0A 3GW3A 4C6NA 2VZUA 5LA1A 2GUUA 3VI2A 1X6LA 3MO4A 5BXTA 4HA4A 1F9CA 2J6VA 4XTDA 4I90A 4PCSA 1OVDA 1E5JA 4ZB2A 5DBUA 3JZUA 3UWYA 1VEMA 3WLNA 1AA1B 1PKMA 4IIGA 3Q65A 2O4QA 1OM0A 1S3HA 5I3KA 1V4YA 2VEFA 3KUMA 4IF2A 3GZAA 5AHLA 4ZCWA 4XAYA 4W4QA 5L9FA 3M0YA 4Y9AA 2WJZA 5K4XA 3UG4A 1QPNA 4W89A 1SZFA 3AIWA 4UTTA 4GC4A 2R9RA 4LS1A 1HJXA 2V3EA 2HQAA 4CNPA 3GWQA 4DQWA 1HP5A 1CGYA 1S2WA 2NQJA 2FIQA 3ALGA 1P0EA 1AH3A 2DSZA 3CAVA 3L4XA 1U2YA 1L2UA 1UCWA 8A3HA 2YCLB 1VC4A 1WDWA 3SFKA 2E40A 4B4HA 2IPGA 3LPFA 3BE7A 1ENUA 3DDMA 4LUSB 3YPIA 2J47A 4L1XA 3T9PA 3A64A 3GH4A 2FJUB 3BWWA 2E1WA 3TH6A 2CXEA 3KL3A 3EOEA 2PUZA 3WDRA 3LGDA 4AHOA 3BCFA 1FHUA 3IIOA 1D8WA 3EB3A 4K37A 3ITVA 3PHAA 2G5WA 3P14A 5HJLA 2PWGA 3R6IA 3ITYA 1GKPA 4JKLA 3N1AA 3WLQA 2YDAA 1C8VA 4H6RA 2P50A 4D8LA 2X1SA 3F2DA 1WKFA 4E4FA 1GJPA 1MZHA 3OG2A 5TD4A 5A2CA 3OP2A 5G4HC 4N9DA 2VFIA 1I2RA 3QH2A 4UTFA 4PBEA 5CZTA 4C6KA 1RPKA 1FX6A 4L5ZA 2X05A 2GJNA 1TB3A 2PWFA 5EY5A 3WNMA 9XIAA 3HF3A 3WDPP 4QR6A 1XLHA 2OSXA 3QTGA 1IT8A 1QNVA 3WL1A 2UY4A 1UR3M 1H61A 2FDMA 2YSWA 3GDTA 4GUFA 3J7HA 3LENA 1OD0A 2Y89A 4IMGA 4IFRA 4PUMA 2ZVRA 1PEZA 2PPGA 1PXGA 5A6KA 1VFOA 1F61A 3UR5A 1XIEA 2BHUA 5HOSA 3MKKA 2QJIA 2CZDA 3T07A 3WQOA 2X1IA 4DX3A 2Y0FA 1QOXA 3GTIA 1Z48A 1K6WA 4H6KA 2WCGA 1PJ9A 4MB1A 1TMQA 3I10A 4ZFMA 4NZ5A 1E71M 1IEIA 4J3WA 3CV6A 1XIGA 3MDWA 2CZ5A 3QN3A 1QMLA 2I9UA 2WVTA 4AFYA 2KX9A 1XCWA 3OHIA 4WDXA 4Q3MA 3PFMA 1C7SA 4OBTA 3L67A 5EGRA 3ABSA 4TV5A 5B80A 3NDYA 1BXCA 3RLUA 2OWWA 4XUYA 4D8AA 4BI5A 3ANUA 3P93A 1KM0A 1BQCA 4QHRA 2Z7GA 2XVKA 3QJAA 3N19B 4AYSA 3QYSA 4ZMGA 1NM9A 1V02E 3AXIA 4AD4A 4H4IA 4LUTA 1UWIA 5C2XA 3GR4A 3JR2A 3TROA 1JUKA 3DGBA 3A47A 1QBAA 4GJIA 4QG8A 3SGZA 1V3LA 5D38A 1ZSXA 3OLEA 5DF0A 4R7WA 3GIYA 4Z0SA 4NAEA 2DJLA 2V5DA 2WM1A 3AFBA 3L0GA 5GJNA 4MFDA 4CNNA 2WKGA 7TAAA 3LCLA 5DMMA 2O9PA 1PHWA 3ICJA 4IGSA 5AHMA 2ZRUA 2FZNA 1I4NA 4CQCA 1DJIA 5L6UA 1H11A 3IVTA 3TV8A 2XUCA 3RRAA 1M68A 3VIKA 3GO2A 4MDOA 1R6WA 1TPDA 1W1A1 2Z1WA 5BOEA 3KLLA 1E0UA 4RPQA 2W9MA 3LD5A 3ARYA 5BU6A 3SQMA 3UJ2A 5HMEA 1B5TA 1VAHA 3QM3A 4MKSA 2QS8A 1NFPA 5DCBA 5CPMA 2FTYA 3CV2A 1DJYA 1S5MA 1UZDA 2JGQA 4QQUA 1V02A 3SUWA 2WMIB 1UR2A 1BVNP 2PA6A 3WEMA 4GD0A 2O9TA 3T2PA 1VCVA 4LYQA 4PUNA 3VNZA 1VFHA 1GJUA 3AXMA 1TELA 4CU7A 2W0UA 1T0OA 3Q58A 5BOOA 2FLIA 1GONA 3E1F1 3TK7A 4JCMA 4Z2HA 1I2NA 1HVQA 5E0CA 1SGJA 4PE8A 4XD6A 5HUPA 2F2KA 1JL8A 1M7JA 5JIWA 1XQLA 3QW3A 1TWZA 1Z9AA 1Q6DA 3RPTA 3WLOA 3K4DA 4INFA 4D1JA 2OZ8A 1PZ1A 4JTDA 5CEWA 5DXXA 4UMCA 5I5RA 4TTUA 4A05A 3G6LA 2GOUA 1RBOB 2HCVA 3STCA 3TLQA 4RNJA 3ZT5A 1X97A 3RIKA 4RNHA 4WKFA 3AU6A 3RUBL 3VIPA 1R3QA 3EXSA 2DT0A 1E73M 2DFAA 5M1TA 4PC8A 5CG0A 3H70A 4DNMA 2DZBA 2ZDSA 3TOYA 1RY0A 3NG3A 5A6SA 1LLZA 4IJRA 2Y63A 3UPBA 4FSAA 2J7FA 3N9RA 3VXGA 5A94A 3FXYA 4US6A 3IGSA 4F2TA 4GJ1A 4J3SA 3TJXA 4PULA 5DXYA 2WQDA 4M7SA 3V18A 4JFSA 1LBFA 1A5CA 1F6KA 3C2YA 3PVFA 3VZZA 4HHMA 4RV8A 4NNCA 3CZKA 3M5ZA 5I02A 2ZUNA 2DDXA 3GNNA 3GYEA 4DJDD 3PPCA 2B31A 3QZEA 3VNJA 4RDVA 4PBFA 3AMDA 4S39A 3N18A 1RLCL 1VYPX 4LANA 4LEFA 1E0XA 4JIPA 2B7OA 2WKJA 1PDZA 1EF3A 1UYQA 1TPFA 1E4NA 1UH2A 1JCMP 4ZQNA 3B8DA 1WYIA 1AQFA 4I5XA 4H7CA 4XG1A 3NURA 3S2CA 5HQLA 1OEPA 1E6RA 3MA8A 1UD6A 1CGWA 2JBMA 1CLKA 4QJ3B 1DIEA 4CQDA 4WZHA 3W27A 1TJ0A 1V0NA 3TWBA 4ZOEA 3F2CA 3N9SA 1TQJA 1CGVA 3N34A 4ML9A 4GKTA 4ILSA 3WQ5A 2OPJA 5GVJA 3TJLA 1X6UA 2Z29A 3NIYA 3OG3A 2V5BA 3IK4A 4ENLA 1H1YA 1A5SA 5EBUA 1PTGA 4E4PA 3FEQA 3GW0A 4P7OA 4ADTA 1TQXA 1J0JA 3PP7A 3KS6A 1SM9A 4HCLA 4N6EA 4KT2A 4DJFA 2A21A 3HBLA 3T6CA 1E70M 4L9ZA 5BRBA 2RJGA 3HPSA 4DJDA 3KP0A 3CTLA 4ZQOA 2ZX8A 4F9JA 2QVHA 1GT8A 1MDRA 3NPWA 3BMXA 1TYGA 3MJMA 1TV8A 2ON3A 2XWDA 3WLIA 1C3FA 4PMZA 3FN9A 4PUKA 4LBSA 1M9HA 1SFLA 1QHOA 3WIJA 5LHFA 1CI1A 4ICCX 3H12A 3BAWA 1QO2A 2E1DA 3E0VA 1IXNA 2PDFA 3OO2A 3ZJ6A 5HNRA 2POZA 4C6MA 1BYBA 3KHDA 4JPGA 3PSWA 3WJYA 1WOAA 4QROA 4WIWA 3GFZA 4IZGA 1TV2A 1RSCA 3ZXWA 3I6TA 5XINA 3T0TA 3PC0A 5HJYA 4PMOA 1RJRA 3LI1A 5CAKA 1WB0A 1XPGA 5DELA 3EAUA 4QXIA 1JVNA 4LJ3A 1LWJA 1IXOA 1X8CA 3UZZA 4KFNA 4AY8A 2QT3A 2EAWA 1K8CA 4K68A 2V82A 3NZGA 3S6DA 3GAKA 4MB3A 3DG6A 3BICA 1SO3A 5G1MA 4TXEA 3R25A 3EWXA 4GISA 3K8MA 4K3ZA 3W38A 3G2GA 4P2VA 3E2VA 2VR5A 4ASTA 5C2CA 1TJ2A 1BXBA 4MZYA 5D02A 4GXWA 3LPOA 2Z7KA 4ZQCA 4PUDA 5FAJA 4KWUA 3LBCA 5BZAA 2OT1A 2QCDA 5K7JA 4YVVA 2J25A 5CG7A 3S1XA 3OQ8A 1U1UA 4OIFA 3DN5A 3G1XA 4AYGA 4LAOA 1AW1A 5TF0A 5HXMA 4Q8MA 2E25A 2ZRVA 3AHXA 1E6ZA 2WHLA 1X1OA 2HE8A 4DO6A 4ERAA 2X42A 5TIMA 3WQPA 5I77A 4B9ZA 4RR4A 1LQ2A 1OCJA 2EJ1A 3SCQA 5AC5A 4HHHA 3TYUA 3U3HA 3MSYA 4ICMA 1JZ5A 1FA2A 3V5CA 3W7OA 3B4UA 2WBGA 3IJQA 2CEQA 1I6NA 3MSRA 4L4LA 4H00A 3GDMA 2QJMA 2ISVA 1S2UA 4JL1A 1VEPA 1XRTA 1LL7A 4CGTA 2RH9A 3RLVA 4ML4A 1XYBA 5FF0A 3UCCA 1DWHM 3DI1A 4DBWA 3AWNA 3CWHA 5LYRA 3M0VA 2E6FA 1YNQA 3GBEA 1GQJA 2EJAA 3TMQA 3CU2A 5HNNA 2OQYA 1IE7C 3A3HA 4H9UA 3S1VA 1HFBA 3SQSA 3FV9A 5H8PA 3T8LA 3WN6A 5FSDC 1JXJA 3BAXA 4XO7A 3EGJA 2INEA 3EB4A 4KCUA 1Q66A 4J1OA 4FNTA 5SWUA 3BZJA 4LNCA 2E5DA 3EA2A 1XKJA 3NQFA 2ZCGA 4AD3A 2CLKA 3NL2A 3DH7A 3MS8A 1V0MA 1DORA 1IGWA 3VOIA 3LY0A 4A8RA 4JTTA 1KBBA 2FPVA 1W8GA 4FA3A 1S1RA 3G1HA 3ALFA 3JVAA 2QV5A 4CD4A 1VRDA 1W91A 4X9SA 5I0DA 2XIIA 3A9IA 5C9ZA 4JEQA 5REQB 3PAOA 4MLRA 4JY8A 2PDQA 4DXVA 4XZHA 3Q94A 4X2RA 2VCCA 2A5HA 1IEQA 2H8XA 4FLSA 4N4PA 1LQAA 2EBNA 1DE6A 1B3OA 2DJXA 4JTQA 4KW2A 7A3HA 3C3NA 1TIWA 4ACZA 3SQLA 3DX5A 3SCOA 3KOWA 1DP0A 2XFFA 4YVXA 4L6DA 4UQ9A 2BXZA 4XSLA 2IS7A 1BXNA 4BA0A 1PUDA 3B04A 1O5RA 4PGLA 5ABFB 1A5UA 5J8LA 4F2UA 4QJ4B 2BOEX 4FXJA 1EZWA 2FVMA 4QEHA 2QCHA 3C2VA 3FYPA 3TYAA 2VO5A 3W2MA 2PGRA 1EX5A 1DJGA 1MQRA 2Z1KA 1RV8A 2EEXA 4HA1A 1ZJHA 1XF0A 3XIMA 1Q6OA 4AIOA 1IXQA 4EK7A 3WJXA 3KW3A 3UVIA 3CHCA 3UR7A 1LRTA 3E38A 3W1XA 1CT5A 1R9ZA 3G22A 1V0KA 3QKZA 4IQEA 2VQUA 3MP5A 4IP7A 5DQPA 4PB4A 1KQZA 2RGMA 3BO9A 3QBUA 4GG9A 1T5AA 3BXWA 1E56A 1HL2A 3LPPA 3BCJA 2ABBA 3EMQA 3N6JA 2QDDA 1YYAA 5IDZA 3WF0A 2VKZG 1E1CA 5A6JA 4M6UA 1E6QM 3FIGA 4K8GA 5C6MA 1V7YA 1VR6A 5AHFA 2YYUA 4HZ6A 1M53A 3QKEA 1BVWA 2V2DA 2OLAA 2Z26A 5F4SA 3E0FA 3TN4A 1Q6CA 4FNQA 1F8MA 3MV11 4FPSA 1EA0A 5HQMA 2WVSA 2XYLA 3XISA 4L6HA 4KH2A 3CT7A 1D3HA 3T2OA 2BDQA 1S2CA 5FD0A 1XIJA 3GR8A 3WK2A 1TTJA 3AYTA 1LDCA 4BKNA 1DTNA 3NNTA 2XZ9A 5DEZA 3TZFA 5H91A 1H09A 3A4JA 2F38A 4UTIA 1L9WA 4V15A 3N12A 2JALA 5KTLA 3ELFA 4ZEPA 1Q5MA 2ZXBA 3VCNA 5J5DA 2PTWA 2A3BA 4H9MA 4I9JA 1HN1A 2IKIA 2OKTA 4US5D 1KM5A 3KRUA 5FJUA 1Q4WA 4W87A 2J8GA 2AMXA 5G1TA 3RXZA 1PWLA 3G8RA 2WC7A 4PTDA 1R2TA 2WSRA 2GSEA 2A2IA 4C6PA 5K3VA 3W7CA 2WPBA 4JTSA 4P8XA 3NEVA 2H3DA 5IHSA 1O5QA 1P0KA 3CUJA 2XVLA 3VDCA 3IGUA 2Q8ZA 3N04A 4RZBA 1T41A 1BEUA 3LS9A 4A8NA 1UH4A 1IR2A 3JS3A 3FVMA 2IKHA 3W24A 1YNPA 2NZLA 3EXTA 4GZIA 4NNAA 4KETA 1TVNA 2VNCA 4XD3A 3C2FA 3DEQA 3T7VA 1YKWA 1LF1A 3MZNA 1PKNA 2WB5A 5ENLA 3FHAA 2CBVA 2VZVA 3H2NA 3NWRA 3D5HA 3NYZA 5AYYA 5FEZA 1G6CA 3FDGA 1GOQA 3OBAA 1TX2A 1EXPA 1WXYA 3OEXA 2RGLA 5AY7A 1MZRA 3NPUA 4NIRA 3QY6A 4AD5A 3VIJA 1LUCA 4IFKB 2PI6A 4H6QA 1ZTVA 2BVTA 4DWSC 4CNUA 4I8DA 3VCCA 2KAUC 3SAZA 4DWSD 4O16A 1QFEA 3OA3A 2EKCA 4HZMA 5HATA 3SUVA 3NL6A 4LUTB 3NPVA 1GVYA 2YL9A 1BVZA 4Q32A 4QEEA 2FH6A 1JZ2A 5A3HA 3MB9A 3CMGA 1WZKA 2OGYA 2DUXA 4JQ4A 2VOMA 4EVZA 2RUSA 1H49A 3N15A 5K2ZA 1JGIA 5G1YA 2VT0A 1EHAA 3LSCA 4JTAA 1QNSA 1UMYA 1Q6EA 2TRSA 3BW4A 3PUEA 3TQPA 4J3ZA 2BODX 4AIUA 3NL5A 4AQLA 1AJZA 1H7WA 2JIEA 4XZMX 2X16A 1JPDX 4GQ0A 1DYSA 1D2KA 1ZJAA 1WA3A 2YJQA 1O1ZA 1XLLA 3C6CA 4HK7A 3CIXA 3B8UA 2PP1A 5BWAA 1N8WA 3M16A 4CNOA 3B8WA 1XYZA 1DTUA 1A4LA 4M0XA 1MMFA 3HOJA 2R14A 4AMAA 3KBMA 2VGGA 4CQBA 2YGYA 2VFFA 4ES4A 3S5OA 3B8IA 4QE1A 3OVQA 1CLVA 4IGNA 2PS2A 3UW6A 5E9XA 2V69A 2A3CA 3HO8A 1BF6A 5HAOA 1TE6A 3BSMA 2V68A 4DEFA 1CLXA 2DZVA 2ZUWA 5ABHA 3C0LA 1WQ5A 3RG6A 2AQOA 1Q7ZA 2CITA 2NSOA 4WX2A 2Z2BA 1VZWA 3ITCA 4CU6A 2ZADA 3HPAA 4IIEA 1IWBA 2X40A 3XINA 2DZPA 4M80A 3U4AA 3LYEA 4XZWA 2QULA 4PMXA 2IQDA 4Y7EA 1BFNA 4HK6A 4J3VA 4ORIA 1P6BA 2BGNE 3IGHX 3WUBA 2A6NA 2VTFA 3G5EA 2C16A 1HXJA 3LTPA 2YCEA 4ZO6A 3AC0A 1W9DM 1YE4A 2VC7A 4S23A 4BI7A 2NLIA 4B2DA 4NI3A 3F2BA 7TIMA 4HQVA 4JYFA 3WBXA 1TCMA 1F07A 3ZR5A 3PBUA 4HPHA 4RPPA 1H60A 3B0YA 4YYFA 3VOFA 3BANA 3SN1A 2PLJA 6XIMA 4FAMA 4JQ1A 4L4OA 4R3UA 3BGGA 1XIDA 2Z24A 1ONWA 4C6JA 1GGOA 4D6IA 4N7QA 1UWSA 5AOUA 1UKSA 4GHRA 3ARQA 3V5OA 3I3BA 1GK8A 1OABA 3R43A 4GOAA 4D6CA 3C56A 4DPPA 3HG3A 3ZWTA 2X0YA 2PTDA 1TO3A 1KM1A 1ZRQA 4LVAA 5LNWA 1JYXA 5D8WA 2YCJA 3W7IA 1K03A 1WDQA 4MJMA 4TR9A 5HWMA 2ZXQA 2WJEA 1FWEC 2Y8VA 5JVLA 4BFAA 2W63A 4QM1A 1VYSX 5CJMA 3SN4A 1JYNA 3THDA 1AK5A 3MP4A 1ZPTA 3DC8A 2PF0A 2DU2A 3H21A 1JIBA 1Q85A 5MHBA 2UBPC 2X41A 4XAPA 2PE4A 2PCEA 3RR1A 3FKKA 1G5AA 3HTWA 1EYEA 3CB3A 3ORWA 1EOKA 3EDFA 3PBWA 5IFTA 1J12A 1PCKA 4DNHA 1UA3A 3C61A 1O5XA 1XGEA 5HPCA 2J7BA 5CSUA 3PY2A 2EPHA 5EBAA 4AHPA 3AHYA 3SZ8A 1TMLA 2GDUA 2QCGA 3II1A 2FGZA 1O95A 1F3WA 1QNQA 3C3UA 1M1BA 1YX1A 3LV6A 4JAWA 1G7UA 2HE5A 1SW7A 4B5TA 5AECA 2VGBA 4PMQA 2ZZ3A 1ITXA 3S2LA 4OJYA 2WZTA 2WNZA 1H7NA 4TVDA 5FL1A 4PFHA 1R3RA 2V6AA 4O19A 4B91A 2D0FA 1QWKA 2QHAA 2DVUA 3UZXA 4MWAA 3ONCA 3KFTA 1DJQA 3ZT6A 4ZFCA 2XH7A 3H2FA 5D32A 2WOQA 1YXYA 2D2OA 2JF7A 3MC5A 4RLIA 1Z7AA 3KP1A 3VKKA 3ZLHA 1FWWA 4IICA 2OZ3A 3EDEA 1P1MA 3VDAA 4ZB5A 4UTLA 3KWSA 4PSRA 1JZ6A 1IR1A 2NUXA 3HMJG 4GI9A 2J7HA 4CCCA 1Q6RA 3NPXA 4K8HA 3R5EA 2I1OA 4GYPC 5LXEA 1WO2A 3M0MA 2XHYA 4P8WA 5A95A 4V2XA 1S46A 3N9KA 2GQ8A 3W01A 4DB7A 3OPSA 3BMWA 2QAFA 3N2BA 2YW3A 2QMJA 1Z69A 4D6HA 3AMCA 2OJPA 4R7JA 1EO5A 4KWOA 1E9YB 2IKGA 3CWNA 2XIJA 2TODA 1TWIA 4NT0A 4HU3A 4JTLA 3W22A 4MWAE 2LLEA 5I3IA 5FESA 3VKCA 3CM4A 3DUGA 4S3BA 4TX8A 2YCKX 3ZZ1A 1PTAA 2FZBA 3GAYA 1QI4A 1KRMA 1L6WA 4LC6A 3WMSA 1MO0A 3GBDA 1CGTA 4A3HA 2BWGA 1PE1A 3GG0A 4NILA 4GA8A 3ZYZA 2VCBA 3PBMA 4L65A 1KFCA 3W2LA 4EE9A 3AYRA 4EKJA 3KZPA 4I6VA 4MIMA 1JI2A 2I9EA 4WJ8A 1XLIA 2VURA 2H3BA 4GO8A 5LIXX 1A3HA 4J5NA 1EPXA 2QVNA 3POHA 3LLFA 3CQKA 3KOFA 2CWXA 2OQHA 3A22A 4KFPA 3M47A 4DAIA 4TVCA 1LYXA 2I5IA 3MCOA 4JN7A 2E5BA 3UT0A 1GOKA 1TVLA 3L12A 3LM7A 4IMDA 3M9YA 4J9JA 1KRBC 4G6CA 2Y4SA 3O0FA 2WCSA 2JGYA 4H9XA 1PX3A 3M0KA 5BRQA 5FF3A 1Y8BA 3TYCA 3GXDA 3FJ6A 4NG3A 3MUAA 1EF2A 3BH4A 4WLCA 2EPNA 4FX7A 3ARXA 4M1BA 4IQJA 2VUYA 1AMKA 1JCXA 3ARSA 3IJ9A 3PF3A 1UR0A 4UTTC 3OU8A 3RLHA 3UG5A 4RCXA 3KRSA 3PB0A 1MW2A 4YTSA 3TOPA 1J5TA 1W5PA 4H3DA 3AZTA 4CQ8A 3D6NA 4GCXA 2O92A 1R7OA 3W7LA 4H6EA 4LOCA 1LRQA 3NXLA 2E68A 3T42A 1GPWA 1C8QA 4Q7IA 1L0PA 5AC8A 3C8NA 3R7MA 4Q8VA 1UASA 3GG1A 3W71A 5JXQA 3LTSA 1PDYA 2FHCA 2AMGA 4GFSA 2BY1A 3KOYA 4LRSA 3MYPA 5KSWA 3LUTA 1CXFA 1FUYA 3LRKA 1ESWA 5BU9A 3M5VA 2GLKA 4K8EA 2FDSA 2QDEA 4NQ1A 1XM3A 1XRSA 5ECUA 2PMQA 3WZ0E 3AS1A 2VWTA 3HPFA 3DFTA 3UWEA 4LUJA 1YLVA 2F84A 4ZGYA 4P7LA 1ME7A 4TQTA 2XN0A 2PDYA 4LF2A 1VHCA 3MMTA 2AGTA 3M0XA 3NZQA 5FJIA 4M24A 2ZTKA 3EBVA 2ZWYA 4R5EA 3SR7A 2CLOA 1OYBA 1W54A 2QMKA 2ZZ5A 1J0ZA 1EL3A 3L5AA 2ODOA 3RK8A 3W25A 1OBAA 3W1LA 4PRWA 3DERA 3ARUA 4UQEA 4JFWA 2FZ9A 3GYCA 3WY1A 4MY9A 4ATDA 1M65A 2E8YA 1BKHA 3FA4A 3GDBA 2PWEA 4WKHA 5D05A 2DT3A 2QPSA 4ADUA 3U2ZA 2DPEA 1H1NA 1RBAA 3BSGA 4W7UA 3KCJA 2Z1BA 3EKGA 2WVVB 5HK4A 1UR8A 1NARA 4ATWA 2JQXA 1MFUA 1UP3A 4HN8A 4E2VA 1MDLA 1KM2A 4LB3A 3THUA 1SO5A 3O0KA 2YBTA 5H6HA 1IHIA 1G94A 1S3TC 4FNSA 2DY3A 3HPZA 4M56A 3TJIA 3DGRA 4OBSA 4YU1A 4FLQA 5AHEA 3O7UA 1RQBA 3UPWA 2WHMA 5C54A 4J35A 3HQPA 2QDGA 3VGBA 2G4JA 1EWEA 3GNXA 1BWLA 1J8VA 5BRPA 4MF4A 4O28A 3W87A 2VQTA 3QR3A 1CXLA 3CXOA 4FOKA 2DORA 3W3OA 5DFAA 3WMCA 1TR1A 4QJ1A 3CYVA 4CEXC 3C0SA 3S8HA 1GEQA 4IHCA 4ZVJA 3STPA 1RA5A 4UWMA 3W84A 3W2UA 4LB4A 3VNMA 2AOSA 2Y7EA 3OA5A 4Q8UA 3BLIA 1JDEA 2V81A 5XIMA 1UD8A 3W82A 2QR6A 4FXSA 1FH8A 4FLOA 2PFHA 1IWAA 2EPLX 3GVRA 4F66A 1VQTA 1RK5A 3CQ0A 1CBGA 1U1JA 3UERA 1V93A 3MVIA 1XUZA 4UZSA 3URBA 3T4CA 4QCFA 2B81A 4U5IA 4HNOA 1E9LA 2C7FA 4F0MA 3TR9A 1YBQB 3DI0A 3THCA 2WW5A 3L2IA 2P1FA 3RCNA 4F8XA 3S42A 2C1IA 5AYZA 3P80A 1YXDA 3M0JA 5DMNA 2P3EA 3D3FA 4YL2A 3TUUA 1R9XA 3RPMA 1JF6A 2VGFA 1J01A 4JFVA 2J9ZA 3PWGA 4WQ6A 3LSBA 1QPQA 4AZIA 2E5CA 1QJWA 1WNOA 4AG0A 3FW6A 4XVDA 4O0ZA 4NXKA 1XYFA 4W8BA 4XIAA 3EZ4A 3RM8A 5FA5A 4PB5A 2G97A 3BV7A 2REQB 1UG6A 3LCWA 4AEOA 1EJ7L 1J0HA 4MDPA 1OC7A 3MWAA 3PR2A 1PSCA 4RZ6A 4AZHA 4CD6A 5LNRA 3O1NA 3EEZA 5DY3A 1B90A 3WLSA 5IFPA 5U7SA 3EX3A 3VNDA 1EC9A 3W75A 3S2JA 3IJ8A 3CEPA 4FX8A 3N2XA 1JCNA 1OCNA 2VC9A 4UTUA 1BAGA 4JNYA 1FDYA 3GVQA 1IEWA 2YXXA 2QF7A 1OADA 1I0DA 2OKOA 2OWCA 1CYGA 5C0QA 2O55A 2NV2A 4UFLA 1R47A 4JKMA 4AU0A 5BNKA 3SUSA 2PGWA 4Q7BA 4AH7A 3U6WA 1JDCA 1UBSA 4WJEA 1VJZA 4BS0A 2W92A 4X61A 2OU4A 2BHYA 3HFTA 3BK0A 3LI0A 1WXJA 2ICSA 1KLYA 3FOKA 4LY8A 3KBWA 1U5HA 2UY3A 1A4MA 2YBUA 3VKJA 5KZMA 3VD9A 2GGGA 1EIXA 1X6NA 1L8PA 3NM1A 4F3HA 5H8UA 2V3DA 2DSUA 4WDTA 4HNNA 2CHOA 4IXXA 1OYAA 3IUHA 1NP2A 4F0RA 2MUCA 3HA1A 1JR1A 4UZUA 3W7DA 5ABTA 3HQ1A 3H2AA 4GZEA 3S5YA 3VDGA 4MKVA 1YPXA 2PDHA 5GPRA 3QPZA 3RX4A 2JKAA 3IJLA 4WR3A 3PM6A 1A5LC 3TN5A 3H2MA 2OQLA 4IT1A 4J3TA 1PYFA 5A8OA 4IXHA 4M19A 2F2HA 1PZ0A 4NZJA 1AW5A 3AQUA 3B40A 3DZ1A 3N4FA 3ARRA 3QZAA 1V77A 3VGEA 3RDKA 1SSDA 5EMYA 3GVWA 1E0WA 3WD3A 1XLKA 7CGTA 4UC5A 2ZDRA 1LRNA 1Y5WA 1JEZA 3UYIA 3QXBA 2CLHA 4Q4SA 4OKDA 4HZ7A 2A6LA 2CNCA 3UFYA 2GYIA 3NQCA 4QLJA 4P7RA 1IEXA 1EUNA 3I65A 4GYPA 4W7WA 2V2CA 2YDRA 4KIEA 4LAKA 1N8IA 4LBRA 1VPQA 2VEKA 4ONVA 3AAMA 4MWAD 1KA9F 4LW7A 3N11A 3R8HA 4E0CA 4Q4KA 4QSFA 4ERGA 4MNLA 1XBYA 3ES7A 3NO5A 5AYXA 2C19A 3N2TA 3SJ3A 5I07A 3W2JA 1XDMA 3QF0A 5DO8A 2PDMA 2XN2A 4PH6A 1E51A 3BG9A 1BF2A 5F2GA 2WMJA 3WLKX 3UNDA 3V75A 3VAVA 2VCAA 3VTRA 2GUBA 4O4WA 2HROA 1R3WA 1O1HA 3S6OA 3PUOA 3NL3A 3SCNA 2F7FA 3FDKA 4F48A 3M0IA 3TNOA 3E02A 4B16A 1ZBCA 3MMUA 3QW4B 5E6YA 4HMDA 2NUYA 2R1NA 1UUQA 7ENLA 1Q2SA 3L4UA 4KIRA 1KM6A 3VD3A 4M81A 4IIFA 5C9XA 4N02A 3R2GA 1TPH1 1Q6LA 3C52A 4FR1A 4Q33A 1VD6A 5M03A 5KEZA 2HISA 1JDFA 1MFVA 4H41A 4MAVA 5F2MA 4RE2A 4GIRA 1FWIC 1QATA 3GIPA 4PMJA 1VS1A 2Q09A 1OFBA 4TX9A 3IIVA 2VFHA 3WDQA 3QHNA 3M5YA 4AWEA 1XICA 4EF8A 3ZOAA 1J4EA 4AWSA 4GLEA 4BEUA 5D2XA 1OYCA 1PHQA 1I2QA 1P48A 3AZSA 1GKQA 3S1GA 1R2SA 3UY8A 1S5TA 5T26A 1MUWA 1W2PA 2FHBA 2FB2A 1BQGA 3EWYA 1SR0A 3CV1A 2WYSA 2CETA 5B7YA 1SVDA 1RAKA 1UC5A 3FSUA 4ZXOA 1VH7A 2C18A 4F0HA 3GFYA 4NZFA 4G1NA 3A24A 4LH8A 2CFFA 2DEPA 1R3VA 4GQGA 2ZC8A 2AAAA 4MGGA 5FJPA 1KKRA 1KFKA 3TC6A 2WZIA 1RCOB 1VIZA 3H6OA 2DUAA 1A50A 4Y9PA 2CZFA 1PS9A 2Y24A 3TYZA 2AL2A 1XH0A 4XQ6A 2G3JA 1C29A 1XIFA 3EMZA 3PZGA 1Y5XA 1K7EA 3GLCA 2O7QA 3UZ5A 1SJCA 3TCSA 2BGSA 3IV8A 2WNNA 1QK2A 1TPC1 4UOQA 1JFXA 3MSGA 3EKZA 3SDOA 4PYSA 4O54A 3R0KA 4EPKA 3COTA 3N13A 3H26A 5E6ZA 2CIPA 1I2OA 7REQB 3VPLA 1PYMA 1UR4A 1VFFA 3U2EA 1XYLA 4C5YA 4NSBA 3VZYA 3KM8A 3RX3A 4P7NA 1NU5A 2Q3OA 3U2OA 3GC5A 1F05A 1G1YA 5BMXA 4NX5A 3SIZA 4D72A 1P7TA 1QAPA 1QTWA 1XI3A 1YTKA 3MPGA 1M7XA 3WDIA 1SQ7A 1UKTA 4IG2A 3ZJKA 3ZLGA 3W6MA 2C8NA 1T6MA 2OVLA 3UXLA 3E12A 2ZOXA 3Q2DA 3QQWA 1KXQA 5I09A 4G7EB 1H62A 1XS2A 2FJKA 3LNMA 2KZHA 3G6MA 4V1XA 1DQWA 5TQLA 3BLOA 2C91A 3LMZA 1XLMA 4D6FA 1JI1A 4C1LA 4FXFA 4E2OA 1K9FA 2PDLA 3T78A 3R8GA 5KINA 4TUFA 2Z0IA 3EDDA 4KCVA 4S3GA 2XGZA 4HIBA 3B06A 1DJHA 3MYOA 1KM3A 1L6SA 1EGVA 3STGA 3AMKA 4O0KA 3O16A 4O0QA 1LG1A 2YPIA 1FFQA 3T0CA 4S2CA 4CNTA 4DUXA 1GOMA 1EXBA 3D0CA 3PUGA 3PAJA 3FJLA 4HHLA 1A5OC 3F4NA 5D30A 4JEJA 4LUIA 3KTSA 3AS2A 4OHQA 2XU2A 4XZ9A 5CGQA 3N25A 1W32A 3L4YA 2CZVA 4XBSA 3T1GA 2ZX5A 1QCWA 2OTDA 2XWEA 1O4UA 2P8BA 3W1AA 1NVMA 2QCCA 4XZNX 1A47A 1FXQA 4P61A 4GX9A 4RDWA 2YB1A 1QVBA 4X60A 3QLLA 5AHNA 1O60A 2XSAA 2P53A 4YVPA 2VP8A 4UQDA 4Y9OA 1HJUA 5A6TC 2JEQA 3WQWA 4L61A 1KXHA 3RU8X 3PSVA 1F4HA 1AD4A 4MY8A 1UZ1A 5D2VA 1HKMA 4TU1A 1ADSA 3KVMA 4D8ZA 5AC7A 4QG6A 1Q6GA 2ZRWA 3CZ8A 4HJWA 3FVDA 3BJFA 4O4VA 3NTYA 1TVPA 2I5GA 2ZUUA 3VINA 3ITOA 8RUCA 3AUOA 1FWCC 3MCNA 2HRWA 1Q7QA 4GH1A 1OFPA 3RM4A 3DKLA 7REQA 3DYPA 1H7OA 4GKLA 1UR1A 4HSOA 5G5IA 3WLJA 1XDJA 3O05A 4E4UA 3W1TA 3WNKA 5FF4A 2NQHA 1HJSA 4C6EA 2GFTA 3FFSA 4GXMA 4PEKA 1XH2A 2PZNA 1O7AA 4ZENA 5HQEA 2YCIX 1UH3A 2QUVA 1F3TA 1E4IA 5AKQA 1HQTA 2NV1A 1GUVA 2O9OA 1L6FA 1THFD 2FGBA 5DRIA 1V3HA 4D71A 1K9DA 3QY7A 4O57A 1SUXA 3T0AA 3MUIA 4W85A 1K02A 5IRPA 3UJRA 3C2EA 5A8PA 4JTUA 1XBXA 1BRLA 1YHTA 3VOGA 1DHKA 2D3NA 1FH7A 3NO1A 1W9BM 5CZ0A 4AC1X 3CUFA 4IMAA 2XIMA 2QGHA 3TTOA 1SW3A 3SY8A 1C7TA 2PGEA 1UWRA 4N9CA 5CPOA 3QFWA 5AVNA 2PTXA 1BHGA 2YA0A 4IIDA 5TBOA 3WQDA 2NQZA 1H50A 2CW6A 3G18A 5JU6A 5LA0A 5HUOA 4O17A 4DJFD 4AZBA 3UGRA 4N2YA 2GVGA 4RNFA 1YBQA 2W3ZA 2GL5A 3UJEA 4DXKA 2BHZA 1KO0A 5EMKA 2WJDA 3MVTA 4DBUA 4B3LA 5ECVA 1C91A 2HDJA 4C6QA 1ITUA 1GVIA 4C90A 3ARVA 5HMDA 4ZOAA 4HK5A 3GXPA 4E5TA 1FOBA 3HQNA 4LNYA 1OG0A 2PCQA 2D20A 4HNTA 1WZAA 3TCEA 3RU6A 4K2SA 1Z8AA 3A9BA 3ES8A 3W83A 3WDHA 8CGTA 5CQ1A 5DX7A 3H8AA 3U2CA 4ZBCA 1ISZA 1KCXA 3EWCA 5JBFA 3NQ8A 3BL3A 3A3WA 4A4AA 2HXUA 6TIMA 1HJWA 4EWND 4E8CA 3RGTA 1P6CA 4N9EA 4NRSA 1G4SA 1V6YA 1UJQA 1EQCA 3M7WA 1RZMA 1B4EA 2V5JA 4RW3A 2E9BA 4HU0A 3WSUA 4DYEA 1JYVA 5KMYA 4BQ2A 4MYAA 2QJJA 2IPWA 4JCLA 1VFMA 4NJKA 4URIA 5HR7A 4UOZA 3A23A 1JDAA 4WCJA 3QMRA 1G0CA 4S3EA