3W7EA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-5-179
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-5-179
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 107
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7eA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7eA01
2DZPA 4UFJA 4I7UA 4UTLA 3MBFA 2A4AA 4U4MA 5D2WA 3C4UA 4IMDA 1TV7A 1Y0EA 5F2IA 3UXAA 4A22A 4MPQA 1K7EA 2HS8A 4FNQA 3TDFA 4E2DA 3C3NA 4UR8A 1VQTA 4AMAA 2VEKA 3KHJA 5EL1A 2H3BA 4HPXA 2DZWA 1VC4A 4JYDA 2CLIA 1SSGA 3TJXA 3HPSA 2YDAA 4BI6A 3BARA 1EWEA 2J6XA 5AN7A 5D2TA 3TX9A 1MSSA 8TIMA 3L5MA 3ABRA 3TMLA 5KTLA 3HMJG 4RV8A 3A5VA 5HUOA 1GG1A 3PBVA 2EAWA 5LGXA 2TRSA 2W6RA 1SW7A 2LLEA 4IX0A 1TPUA 3LHZA 3IIXA 2Q3OA 2ZRXA 1YPIA 1H7OA 1TPC1 3KRSA 1SZGA 5IBXA 3FYOA 3HF3A 1SO3A 3TAKA 1GYLA 3QYQA 1BKSA 2Y89A 3UXDA 4UNLA 2PRMA 2ZRYA 3BO9A 1H7WA 2YCEA 3A5FA 2VEIA 4Y9AA 4O13A 4O0KA 5CG7A 3RK8A 1B9BA 3EWUA 2E6AA 1GG0A 3MHUA 1W5NA 1PE1A 2V82A 5I3IA 3TXVA 1DV7A 1NF0A 1P1XA 2QCLA 1QWGA 4QISA 2GVLA 3SIZA 1M7OA 5E0KA 3W1RA 4JTGA 1EX5A 3L0NA 4WX2A 1FWRA 2GUUA 1Q3NA 1G4SA 4EIVA 3T55A 1RR2A 2FQIA 1H60A 5AC7A 4E2BA 3QMRA 2DJXA 3NL3A 5EKYA 3S1VA 1D3HA 2BX7A 3LTSA 1OFQA 3M5YA 3NPUA 1EP2A 2F84A 1GYNA 3NR0A 1IIGA 3LGEA 1VJIA 1X8FA 3UPBA 1JUBA 2PE4A 5KMYA 3UZJA 4TX9A 4GC4A 3W7JA 1F76A 1SSDA 3TCEA 1VYSX 2Z6IA 2ZDRA 4I7WA 1N7KA 3LI1A 3R5EA 3NPVA 3IIZA 1FCQA 1ZALA 4FXSA 5D05A 4CCCA 2QUVA 4JTTA 3N2XA 1KBJA 2B7PA 3DZ1A 3BLEA 4WZHA 2DZTA 3ATYA 3ABQA 1T96A 4S1FA 3C2RA 1TMHA 4JTJA 1HO1A 2ZTKA 3G1VA 5H91A 3TE9A 2FDSA 3S5NA 3OA3A 3GYEA 3W74A 3W22A 1VR6A 1VYRA 1DOSA 3P84A 3A21A 2VELA 3N2MA 4N4PA 1XDMA 3UY7A 4NJJA 3TV8A 3GIYA 4MVAA 4WQ6A 5KITA 1L9WA 3ANYA 3NGJA 5CZJA 3WFAA 2V5BA 4MOZA 3CM4A 3BK0A 5F4XA 4BWLA 1S5TA 2WQPA 1LBFA 1LOSA 5TQLA 3E49A 3C2FA 2PRHA 1K8YA 3ZS4A 4O17A 2ISVA 2G95A 3HQ1A 1G4PA 4HKPA 2HTMA 4LT9A 1IIHA 1T0OA 5F1VA 1FY6A 1W0MA 3NQCA 3C6CA 3DENA 4Z0JA 5CSRA 3DFNA 1QAPA 1F74A 1I4NA 3SJ3A 1LOQA 4LS1A 3DKLA 1QR7A 4NJKA 4FX8A 3W1QA 3NZ1A 4N6FA 2YPIA 4O4WA 2JGYA 3B03A 5LHEA 1H7RA 4ZZ9A 4M5PA 2I9EA 2W0UA 3O1NA 1OYBA 3MHGA 2WV8A 1VZWA 3DAQA 4OGZA 3U2OA 2HMCA 3HOJA 3U6WA 4XTIA 1CI1A 2DZVA 4IXHA 4LTSA 4OE7A 4WY0A 5AYXA 1UUMA 4K8HA 4O18A 2VEMA 5AYYA 4NQ1A 1WQ5A 1UBSA 3TU9A 4HHPA 5H2ZA 2WSQA 1GT8A 4RR4A 3NQ6A 1WA3A 1FDYA 1S5VA 1XFBA 2A6NA 4ADUA 3T44A 1OYCA 1O60A 1T8XA 1LORA 3FEMA 3UQNA 2V2DA 3W7GA 2CZDA 1JCXA 3LBMA 2Q3RA 1OFBA 3NVTA 1WV2A 3MO7A 3KRUA 2CFFA 4FNRA 2NZLA 1ICPA 2NXIA 2G96A 3TK7A 2QAPA 4AWSA 3NL5A 3P81A 2DZXA 3B06A 4NJHA 5HWJA 4AHPA 3PB0A 1C29A 4GUFA 3PAJA 3EX6A 3BGJA 5F2LA 4FF7A 1YXDA 1DQXA 4KFPA 3HJZA 4XZ9A 2XN2A 3UNDA 4MY9A 1EUAA 3LV5A 3W7OA 1FWSA 1TPB1 3GK0A 1R2RA 4M6QA 1IGSA 3LERA 3M5ZA 2RDUA 2QJHA 3EXSA 1LZOA 3L9CA 4TR9A 3CIWA 1ICSA 1I45A 4JTHA 1ZENA 1FWTA 3WJSA 3LCIA 4ZQOA 3QMTA 3L66A 4JIQA 4Q4KA 1QOQA 4NZFA 2RHGA 3I68A 4YL2A 2ZRZA 4JICA 5C6MA 3L67A 4IMGA 4RK8A 5A8GA 2WJZA 3UD6A 3RMJA 2ABAA 5AB3A 1KV8A 1YTDA 4LV4A 1XXXA 5DN1A 1F05A 3T7VA 1SW3A 4AH7A 1DHPA 3LX9A 5CZSA 4IUOA 4O4VA 2ZBTA 2CW6A 3FYPA 3R89A 3EKZA 4R7JA 3QQ0A 2DORA 3QSTA 2JBMA 1R30A 5FI8A 1YDVA 1W54A 4PFMA 5F4WA 2JKEA 4JS3A 3LV6A 5EPDA 2I1OA 4ZL1A 3BPWA 2QCGA 5CPNA 1W37A 3STEA 4C1LA 2I14A 1VYPX 3O8AA 1A50A 3HG3A 1T99A 3NPWA 4CNNA 1SW0A 4LVFA 3G3MA 3TUUA 3QZEA 3ABSA 5FEXA 1SUXA 2YFNA 2V2HA 2Y7FA 1KBIA 4I7VA 3W07A 5CPMA 2UV8G 4IMEA 3UWYA 1LRNA 3GDKA 1Q45A 5G1YA 4L4LA 3YPIA 3TC7A 3HO8A 2A21A 4Z08A 3A9IA 1QO2A 5DBUA 3IIPA 3QW4B 2WPBA 2JKAA 5AHLA 5C55A 1ME9A 1SPQA 3CWOX 3FKRA 1PHQA 3LHTA 4LY8A 1HG3A 3I7QA 4IX2A 1PCKA 2ALDA 4XUGA 2NUXA 3WJXA 5EA9A 2A1YA 3L68A 3B0UX 5TBOA 1KM6A 1LLWA 1ICQA 2NWSA 4Z1AA 5KINA 4DQWA 3KRZA 3QRHA 1HFBA 1FCBA 2P0OA 4KFOA 3UYCA 2ZZ1A 3QW3A 1WX0A 4AB4A 3OIXA 1GQNA 3TIMA 2E6YA 5F4SA 2NXHA 4QNWA 1A5SA 1LRTA 4UC5A 4UFHA 3C0JA 4LWWA 4H3DA 4JXCA 4GXMA 1MO0A 1B4EA 1VHCA 3MWAA 3R2GA 1YLVA 1KTCA 1WAUA 4N2YA 1ZFJA 1XBZA 3MYPA 4RCXA 1QOPA 1TSIA 2Z6JA 4UTUA 4X2RA 3MP4A 2Y7GA 4AF0A 1VCVA 2H6RA 2WSRA 1W1ZA 4RZ5A 2E77A 1W5OA 5CZ0A 2YZRA 4IXXA 1OFOA 1TTQA 1ZY9A 3EXTA 3LXCA 5G2WA 3N3MA 3GDMA 5LSMA 5BW6A 3P60A 4YWIA 1JRBA 2GQAA 3PVFA 7TIMA 1GTEA 1VGAA 1GZGA 4NZJA 3HBLA 3W2MA 4XQ6A 3NQ7A 2B7QA 4EOUA 1QPOA 4UTTA 3KX6A 3MUXA 3CC1A 3OVQA 3BW2A 2YX0A 2HS6A 2QCMA 3O16A 3OVPA 2GPTA 3B05A 3G1XA 2Z1BA 3W2JA 1H5YA 2BTMA 5CPOA 4DF0A 3NM1A 3NXFA 4N02A 1IXOA 1RZMA 2CLFA 5CPLA 3KVKA 4AWUA 4O1CA 3M41A 1TPEA 3MYOA 3F4WA 1DJQA 3CWNA 3MJYA 3GXPA 4CQ9A 2PRLA 3QH2A 4OWGA 1H63A 1M6JA 3SECA 4O52A 2RDWA 1LRQA 1H7PA 3PULA 2J27A 2ISSA 1W56A 2GQ9A 3IVUA 5CKSA 4GJ1A 1RQEA 3BW4A 2ZA2A 4UTWC 3V75A 3I7RA 3M6YA 5LHFA 1HUVA 1V5XA 1W5MA 2Y88A 4Y96A 5DXYA 1OABA 3UPWA 3EX4A 1MEWA 4ADTA 4EWND 2J9YA 1K7FA 1MEHA 3P8IA 3ZWTA 5C2XA 1TPH1 1XKYA 1BTMA 3GR7A 5HUPA 1VLWA 3Q94A 1K02A 5FF2A 3STFA 3UZ5A 3QQ1A 3WK1A 1OFDA 4LVDA 4TMCA 3LB0A 3TNOA 3PY2A 4WJEA 1TRIA 4FEZA 5HR6A 1ZAHA 2A7PA 1LLZA 1H61A 1H7NA 1TTJA 2QDGA 2V30A 4Y90A 3W7CA 3SFKA 5FESA 2VFEA 1KV5A 1ML1A 3N9RA 1FXPA 2E6FA 3W1UA 5F2MA 3BG9A 4YXGA 1Q6RA 1OX4A 3STCA 1VH7A 5D04C 3G3DA 1KFKA 5D2XA 4MYAA 2A0NA 3NNTA 1TJRA 1W31A 4DBDA 4XKYA 3PUOA 3QFEA 4FO4A 1YXYA 4OV9A 1ZHAA 4JR5A 1VRDA 3ZFHA 4BI5A 3R12A 4WY0F 5CSSA 4LUIA 1QPRA 2NX9A 4KFNA 2O7QA 4FHAA 5K9DA 4IWWA 3NEVA 4TU1A 4UMAA 5HULA 3PUEA 3BVJA 1KM5A 1TV5A 4JX5A 3IIOA 1G69A 1M5WA 5AYZA 1JUEA 2RKXA 4S2CA 4CLMA 4J9JA 4MZ1A 5FEWA 4GUGA 3GB6A 1LM1A 1TPWA 3Q58A 5EY5A 4DF1A 1TB3A 3KVMA 5I3GA 3WJYA 3DFPA 5C54A 5FF3A 3W2KA 4HT3A 3TR2A 5C5YA 4QNEA 2QCDB 2CLLA 5HWNA 1LBLA 4KWWA 4RXGA 3W7PA 4RZ4A 1OHLA 2V81A 1B57A 3TA6A 2E6DA 3LCFA 2NV1A 1KFCA 2WKJA 3TW7A 3C52A 4X22A 3OVRA 5HMSA 2QEZA 1K8ZA 1KM1A 3W85A 2ZZ7A 2C16A 5D30A 3MW7A 2IQTA 4LOCA 3M9YA 1SQ7A 1CW2A 4RKAA 1GVRA 2FPYA 4PA8A 4LVGA 3MMTA 1BWLA 1OJXA 4IJBA 4R53A 3QM3A 3LDVA 3LTYA 5DY3A 4ORIA 2TMDA 3RLVA 3NO5A 3W23A 3MI6A 1UUOA 4JY9A 1DQWA 1JRCA 3W1LA 5L6UA 3G1SA 1QMLA 1TO3A 2QAFA 2BZNA 3ELFA 4MKNA 1D3GA 2YW4A 4AWTA 3HIJA 4DBEA 1JCJA 3IGUA 4GUHA 1YDNA 3LBCA 3WJZA 4JEQA 3CPRA 1B3OA 3C61A 4GUIA 4Y8FA 1Q6OA 2ZRWA 3EX3A 3VCRA 1KFEA 2GQ8A 1W3NA 1WDWA 3GAYA 2V5LA 2WNZA 2FPTA 3GKAA 3F1QA 2A6LA 5D03A 3EB2A 5LNRA 1SZNA 1W3IA 2CLOA 3W83A 1R47A 3SGZA 1G6CA 4LC8A 4O10A 3GX9A 1KM3A 3L21A 2EF9A 3RU6A 4DF2A 1QCWA 4HNNA 3IIVA 1WBJA 1A53A 2QUTA 4RX0A 5LNSA 2GVGA 3RLUA 3GXNA 3W2UA 4P2VA 4UCGA 1H7XA 3UWUA 3G24A 3NAVA 4HNVA 1FDZA 3TQ0A 3QSRA 4JTFA 3S5YA 3MP5A 2A2IA 2W79A 3S1XA 3W71A 2AQWA 1ZJIA 3IGXA 4WUIA 1I2QA 1CX9A 4JTIA 4YCPA 3LM7A 4G1KA 1HL2A 2NV2A 2X30A 3LHYA 3LCGA 3LCHA 3HB9A 1XUZA 1H62A 5I3JA 1Z48A 4UFIA 2Y61A 3INPA 3NA8A 2EGZA 3W7KA 2X16A 4Z1CA 4JTEA 5TIMA 4UFMA 1NVMA 2QJGA 3CTLA 5FF4A 3LHUA 4NXKA 4LW7A 1N55A 4CNOA 4QJ1A 2EKCA 3IVSA 3A23A 4JDBA 4M6PA 3PBWA 2ISWA 3QMSA 3L5LA 3G22A 3S5OA 2FTPA 3W6YA 1K7XA 2J9XA 4O15A 1JCLA 3L2IA 4RLIA 3SW6A 2AAMA 1B4KA 2RDTA 5DLCA 3VE7A 5LGZA 1VLIA 3NQVA 3IV3A 3W7IA 3DFSA 5IBXC 1XBVA 3GR8A 2NUWA 3S0CA 1GJPA 1KFJA 2GJNA 5G1TA 1GPWA 1I2OA 5LNVA 1S5WA 1W3TA 2WSYA 3DHFA 4ZQMA 3SI9A 3V1PA 2P1FA 4YLWA 4NNCA 3QC3A 3M5VA 3M47A 3EKLA 3ZR4A 2Y70A 1LBMA 3E12A 3DU0A 2NX3A 2Z0IA 2VC6A 3HGRA 3S8HA 4WY0B 4NUWA 4LUJA 3M0ZA 2YW3A 4XBSA 3T40A 1TPVA 3PG9A 3FFSA 3NM3A 2CZEA 3GDRA 1Z41A 4AVFA 4XTDA 5FF7A 1TV8A 3VFLA 2DJLA 1U83A 2OZ0A 3FJLA 1GOXA 4RJEA 4ZQNA 1F6KA 4P61A 3QPYA 3BV4A 4PL2A 4MUZA 2KZHA 3LXAA 2ZCGA 2CZ5A 3P74A 1VS1A 3GKFA 3G8EA 4LRSA 3PWAA 2JGQA 1OF8A 3E02A 2Z2UA 3W2NA 5D02A 3TQVA 3RF9A 2ZZ4A 2A85A 4CQ8A 2BLEA 3W1AA 2C14A 1VCGA 2VFFA 1JQVA 2Y7DA 2GJLA 4EF9A 4AHQA 1Z42A 3G1DA 4BF9A 1RPXA 1SO5A 3P5YA 3W88A 3C2VA 3RNDA 2GVJA 4ORMA 3W9ZA 3LCLA 4O28A 2R94A 2R91A 3KOFA 3QF0A 4CCDA 5G4EA 1SR9A 5AHIA 5LNUA 2H3DA 3BLFA 4FNUA 4OT7A 3P62A 3HGSA 1NAL1 4JIPA 4O8RA 3H53A 2ZA3A 5A5WA 4BWLC 1SO4A 1OG0A 1FX6A 5J5RA 1L6YA 4O53A 1IXPA 3LRKA 1OF6A 3I7SA 1A5BA 1PCWA 3DXIA 4GRSA 3W7LA 5DCEA 1ZAJA 3LLFA 1I8JA 2BWGA 5G2HA 2XN0A 5G2IA 3M1ZA 4M19A 4HNUA 4M7SA 1P5BA 3P82A 2ZRVA 2Y85A 3M43A 4FNTA 2G5WA 1QPNA 1G67A 1G7VA 3I65A 3P67A 4LVAA 4QM1A 2QCHA 3T78A 1RQBA 2DP3A 3IVTA 3QEZA 1Z44A 1JUKA 3NYZA 1KTBA 5K3VA 3D0CA 3PG8A 3GAKA 5AC8A 2VENA 4N9CA 4LNYA 4ZQPA 5K4XA 2ABBA 2Q8ZA 2RH9A 1F2JA 3LTPA 4PODA 2OJPA 1W5QA 1UASA 4IPIA 1FCUA 3TSBA 5K7JA 1JULA 4O54A 4YMZA 3I6RA 4MFEA 4CCEA 1JJKA 3CIXA 4YCOA 3HG4A 3NZRA 1YYAA 2BSLA 2QDHA 3KVLA 1F5ZA 3FA5A 3IRDA 4PCFA 4FXRA 2E09A 2HSAA 3N9SA 3W7DA 1UJPA 3EXRA 4PEKA 5D38A 2D73A 1EA0A 2JKPA 1G7UA 4U28A 3SZ8A 3VKJA 4UUIA 4ZVJA 1SFLA 3M16A 5T26A 3EEGA 2E5CA 4K37A 1I2NA 5ABTA 2Y6ZA 3PUDA 3N19B 2YFOA 3L0GA 3UWQA 1IF2A 1M7PA 2VFDA 3C56A 1KLYA 6TIMA 1XL9A 2TSYA 4WXZA 2J24A 3H55A 3GXTA 4HSNA 1Q6LA 2ATSA 1H51A 1LOLA 4FNPA 4BR1A 1OFAA 5AOUA 5HR7A 3DH7A 5BNKA 5BMWA 1HO4A 1G4EA 1PL9A 4MJMA 3EWXA 3QJAA 2BXVA 2OT0A 2C15A 3AJXA 3E9AA 3WK3A 1SFJA 2V2CA 2WOQA 4DXVA 2NWRA 4AF0B 1VHNA 3LI0A 4A2RA 2QCEA 5D2VA 1SU5A 4RXFA 1PIIA 2NX1A 3GNDA 3ZWSA 5EMUA 3TROA 3TJLA 2WO5A 3W1TA 1KW1A 2XFWA 4IQLA 4EF8A 4UFKA 2WNQA 3S1UA 4EVZA 4DO4A 5LKYA 1ONRA 3WK0A 5HNRA 4O19A 5D2YA 4A29A 5F1UA 3TC6A 1EEPA 2A7NA 3IGSA 2Y7EA 2Y62A 3P8JA 4K7VA 1KM2A 3RFAA 3W7RA 1JVNA 3TFXA 1FCVA 3HGJA 5SWUA 1K3UA 2TYSA 3AO0A 2XN1A 1H50A 3N73A 2VFHA 3LRLA 2ZZ5A 4R34A 5AHNA 4UXDA 1ME7A 2EHHA 1D9EA 3SSJA 3WJWA 1XBXA 3OHIA 5U7SA 1O4UA 3O63A 3B0VC 3NQ8A 4UFLA 4FNSA 2X2GA 2FIQA 3UWWA 2E5DA 4JX6A 3TKFA 1AK5A 1AW1A 3G0SA 4ML9A 3JRKA 3NQAA 5J5DA 3STGA 4HN4A 3PS7A 3TAOA 1DVJA 1K8XA 3OG3A 2A7RA 3LCWA 2QCDA 1P0NA 2X1RA 4O1AA 3NQEA 2CZFA 1FWWA 4PC8A 1TCDA 2QJIA 1ME8A 3P5ZA 3MBDA 5I3FA 2C18A 3GVGA 3PR2A 3ATZA 1TQXA 3BLIA 2PC4A 1AMKA 1C8VA 4FIRA 1LCOA 3PBUA 5KZDA 4X9SA 3P61A 1TREA 4MFDA 4C1KA 2FB3A 4MIMA 1ADOA 4AHOA 2ZZ6A 4JGDA 1FBAA 3PSVA 2FFCA 4DEFA 2X1UA 3W1PA 5AFDA 3EX1A 4K36A 5FEPA 2C19A 1YPFA 2JK2A 2OT1A 5HQEA 1OYAA 1THFD 1F73A 4ALDA 3DI1A 1JCNA 4LU0A 3MI2A 2H8ZA 4O14A 1OX4B 1X7FA 2R14A 3JR2A 4N9BA 1WXJA 2RFGA 5I3HA 4MJZA 3TW6A 4JTUA 4IOTA 4NX5A 1EPXA 2EPHA 4UTTC 4XKYB 3CT7A 2GOUA 3MHFA 4QSHA 1H1YA 4N9EA 3S42A 3L0KA 3CLMA 3S9YA 3NQGA 3W1NA 1K03A 1XBYA 2NXGA 5FF0A 4O1BA 3N34A 1A5CA 4LS2A 2C3ZA 3F03K 4Q32A 5I3KA 3W75A 4LS0A 1XCFA 1O5KA 4WOZA 3TXZA 4A3UA 3PBYA 2PURA 4M6VA 2DZSA 3DKJA 3N14A 2YYUA 3GNNA 3C8FA 2VFIA 4RZ6A 1FQ0A 4OU1A 1V7YA 4WXYA 3O15A 3UY8A 4NXSA 4LC6A 1BEUA 1TIMA 2O7SA 3DFOA 5HWMA 1X6UA 3PC0A 4Y6GA 4AEOA 4JTSA 1KA9F 3SGUA 1MZHA 4KKXA 1Q6QA 1PHWA 5LNWA 1QPQA 3BG5A 1KM0A 4DO6A 1FUYA 1O5XA 4A21A 1QDSA 3EWYA 3C2EA 3W70A 2B4GA 4GNJA 1QNVA 3DFTA 4WOQA 4GWEA 1GTHA 5BRBA 5G4WA 3P7YA 3CB8A 2Q8LA 2QKFA 3CEUA 1PV8A 3DI0A 3O6CA 3THQA 4CQAA 1PS9A 2CLHA 4IGHA 4MZ8A 3E96A 3KAOA 5DBTA 4DPQA 4K38A 3K30A 2V9DA 1NEYA 4H4IA 4HPJA 2YXGA 4NVTA 3TMQA 1FXQA 3USBA 4UNKA 4O1DA 1FWNA 1OFPA 4NX0A 3P80A 2ZZ2A 5D33A 5HINA 2FPVA 1LP6A 3S6DA 2VFGA 4NU7A 1PVNA 5KSWA 1SZEA 5AC6A 1RVGA 4LV9A 2ZZ3A 4BK9A 3E0IA 4OV4A 1YDOA 1JR1A 4W9TA 1R2SA 3B8DA 2YR1A 3W73A 1LDCA 3MP3A 4JY8A 2VXNA 3A22A 3TQKA 4GBUA 1YXCA 3EX2A 3HG5A 4JD4A 4N6EA 3M5XA 3LLDA 1DL3A 5L9FA 1WYIA 2V8ZA 1AW5A 1AL7A 3FKKA 3H54A 3NDOA 4X3ZA 3BG3A 1O95A 4I9AA 1F7BA 1R2TA 1HTIA 2C0AA 4XBKA 4POCA 3G1YA 4R33A 5DCDA 3S5ZA 3LXBA 4MY1A 1RV8A 3PF3A 2B7OA 3NQFA 3HPXA 1IXQA 1UB3A 4QITA 1XDLA 3W72A 5GVJA 4Z1BA 4MY8A 1IXNA 1LTDA 1X1OA 3PSWA 1TRDA 4NT0A 3G8RA 3G0UA 1EP1A 5EYWA 3W7QA 3KXQA 3T4CA 5E1QA 2FLIA 1AG1O 3B0PA 1YTKA 3W3OA 1LYXA 2C1HA 4K6AA 1TPFA 4AXKA 1KM4A 3W1MA 1XUUA 3PM6A 3O6DA 3F4NA 3DHDA 1SZFA 3W1XA 2VKZG 2FB2A 2YSWA 1NSJA 1KFBA 1XC4A 5K9CA 3THAA 4O11A 3A24A 1FDJA 4FIQA 4JNMA 3ABOA 4BI7A 4TIMA 1W8SA 1J5TA 3DFQA 4IMFA 3EWWA 4JYFA 1OK4A 3QPZA 1TJPA 2P10A 1ZAIA 4JYEA 4HSOA 3LHWA 3NPXA 1EIXA 3GZ3A 1DKWA 3JS3A 4NNAA 3R8RA 2QF7A 5AHFA 2V0TA 4UTJA 1O94A 3NL6A 1GVQA 3HPZA 3HG2A 4O12A 3L65A 4O16A 3BGGA 3SR7A 1BWKA 3NOEA 4ZQCA 4FB7A 2X1TA 1TTIA 3TSDA 4IPJA 4UTMA 1NF7A 3OEXA 4UIOA 2TPSA 5LZLA 5K9XA 4QAIA 1EUNA 5DY2A 3KVJA 2ZA1A 3NQMA 5BOOA 4B5NA 4AAJA 1J4EA 2A5HA 4JTKA 2E5BA 4BFAA 3W7NA 4O50A 3UWVA 1C9DA 2CU0A 2VEPA 1QO5A 5FEZA 4NJGA 3W86A 1H1ZA 4D2JA 2H90A 1S3HA 1KLZA 3NQDA 4UTKA 1DJNA 4S2BA 4LVBA 5E93A 5K4ZA 3UWZA 4E38A 3W76A 3GLCA 3NG3A 4OBTA 2ZTJA 4UTWA 4Q33A 3B04A 2PCQA 1I2RA 1L2UA 4QIUA 3VE9A 2CLEA 3DBPA 3SY5A 1OFRA 4GFSA 3L5AA 4GUJA 1XI3A 5HJLA 4MLJA 1AW2A 3R13A 3O6YX 3O07A 2C6QA 1I2PA 1SO6A 4JTLA 3LCXA 4DELA 3Q37A 3MI3A 2YYTA 2CLKA 2CLMA 3EWZA 1VPXA 1P4CA 4O57A 3M7WA 3W2LA 4KWVA 1JQXA 6ALDA 3M44A 4PL1A 5DCBA 1TTPA 4PH6A 1L6SA 4UMCA 2E68A 5F2GA 4H6KA 2NLIA 2ZFAA 2CWNA 2Y63A 1WOAA 4QQ3A 1DBTA 3LHVA 3W7EA 4N9DA 3G1FA 5MHBA 3FJ6A 1QFEA 1XM3A 2E1DA 1VCFA 1TYGA 4UR7A 4JN6A 3PB2A 1GWJA 1OK6A 4A2SA 4UTIA 3C2OA 3W7MA 4CNPA 2QR6A 3W87A 2J9ZA 1W5PA 1P0KA 3IEBA 4TMBA 3G1HA 4DPPA 1UCWA 1E51A 4GE8A 1NFBA 3GDLA 1YADA 1OX6A 1KFLA 2AGKA 1ALDA 2OX1A 3VI2A 5D09A 4JDYA 1GEQA 2QCFA 4LRTA 1EWDA 5DELA 1WBHA 2DU2A 3NQ2A 3O05A 3WK2A 3FS2A 5DXXA 1EP3A 1TPDA 3FIGA 4ONVA 5D32A 1DORA 4HIBA 1OX5A 2FJKA 1LROA 3FLUA 2OMAA 1KTNA 4N4QA 4ICNA 4PTNA 4K39A 2QCNA 5AHEA 1EB3A 3CEPA 4MYXA 1JCMP 2F7FA 4K7YA 5AHMA 3KFTA 2QCCA 3W7HA 2NUYA 3W84A 2DZUA 3LOTA 3O06A 4OHQA 4TO8A 4ZQRA 3TFCA 2C13A 3HGOA 3DGRA 4M7TA 1RQHA 3G18A 4WD0A 1OVDA 4E0CA 4Z0SA 3GDTA 2WNNA 4Z1DA 1R46A 1J2WA 1YTEA 4FX7A 4DO5A 5K2ZA 4MLRA 4UMBA 4ZMGA 5D37A 3G0XA 1GVOA 4JX4A 4XWUA 2VOMA 3FOKA 1MXSA 1ZNNA 3B4UA 4K8EA 1RD5A 5BMXA 1AL8A 2ZRUA 4O0ZA 1X1ZA 3CQ0A 3G1AA 4MZYA 1L6WA 5KZMA 1A5AA 3OBKA 2OCZA 4FX6M 3NL2A 5U4NA 3U8GA 1N8FA 3BW3A 3EWBX 5G5IA 3VNDA 3CHVA 1GVFA 5CZTA 1JCYA 5IM51 3TH6A 2H8XA 1MEIA 3Q2DA 1OFEA 2YGYA 2G97A 2J88A 2B7NA 5EBUA 1F6PA 2ZQ0A 4NJIA 5KZEA 4IMCA 4ADSA 2QUUA 3TSMA 1TQJA 1ZCOA 4UTHA 4HNTA 3CU2A 4OQVA 5CGQA 2ZYFA 3S1WA 4NNBA 1G4TA 1GVSA 1U5JA 4L4MA 2X1SA 3LRMA 2R8WA 2B0MA 1WOBA 2ATMA
chains in the Genus database with same CATH superfamily
2O56A 4UFJA 2A4AA 2BFGA 4U4MA 2EPLX 1TV7A 3UXAA 2PDWA 1HJQA 3VKAA 2VT0A 5JBEA 3C5QA 5IXEA 3ORWA 4I5XA 3EWCA 3VOHA 3C3NA 4AMAA 1CLKA 2VEKA 3E0VA 3NSNA 2ZX7A 1NDWA 4HPXA 2DZWA 1EGVA 1VC4A 2OSWA 2WJEA 1TR9A 2YDQA 3VFCA 4BI6A 1EWEA 1J6PA 1Z8AA 5AN7A 3WQEA 3L5MA 3TMLA 2GUBA 4QHRA 5LGXA 2J7BA 5EMJA 3MCMA 4E3TA 1DXEA 2J77A 2LLEA 3OLDA 3KTCA 2OO6A 3XIMA 2ZRXA 4JKKA 3WNPA 3BC9A 5I03A 1H7OA 2FFIA 3KRSA 1SZGA 3HF3A 1SO3A 1CTNA 4GQGA 3UXDA 4UNLA 3BO9A 3A5FA 2D0GA 3I3BA 4O13A 5CG7A 2BGSA 1Q8JA 3EWUA 3UR8A 1NF0A 3M0JA 4X0NA 1QWGA 3WLHA 2ADAA 1UD3A 3B0XA 1YMYA 6REQA 3LK6A 1E0TA 1G4SA 4GACA 4EIVA 3PZIA 2FQIA 3AALA 4E2BA 1X8CA 3QMRA 1QU4A 3S1VA 5DMMA 5I6SA 1D3HA 5CPTA 3GY1A 4XZBA 3NR0A 4LBUA 1J96A 4TX6A 1VFMA 1F8MA 4GC4A 1NU5A 3IUDA 4PCSA 2PTZA 2P8CA 2Z6IA 3NPVA 3NSMA 3VKKA 3IIZA 4YS1A 3FDKA 1P6WA 4JTTA 1VRXA 3LYEA 3DZ1A 3BLEA 2DZTA 1IYXA 4CVWA 3ABQA 3SN0A 4GQ0A 1T96A 4S1FA 3RCMA 2HVNA 1BPLB 1HO1A 2ZTKA 2FDSA 3AYVA 2WWDA 3GYEA 1SZRA 3W22A 3PJWA 3P84A 3N2MA 4N4PA 1XDMA 1DE6A 1UH4A 3UY7A 4D8AA 2BASA 4GD0A 3OLIA 1GOQA 1L8NA 5EFFA 3CWHA 3KE0A 3RU8X 3NGJA 5CZJA 3F5KA 1YDYA 3CM4A 5F4XA 4BWLA 4XX6A 1Q63A 2WQPA 1LOSA 4P7LA 5TQLA 5GJPA 3TZNA 2QYGA 1K8YA 3ZS4A 1E72M 1MUWA 2YCKX 1R38A 2G95A 3FDGA 1IIHA 3AHZA 5F1VA 3ARRA 4GZIA 2HV5A 2C7FA 4Z0JA 1QAPA 1F74A 1I4NA 2X0YA 4LS1A 3DKLA 4NJKA 3U7VA 2YLAA 3NZ1A 4I9MA 2JGYA 5I09A 2I9EA 5IRPA 1YPXA 3LN3A 1OYBA 5JUVA 2WV8A 3DAQA 1UWAA 2HMCA 4W84A 2X42A 3WMLA 3ENLA 3C3UA 4LTSA 1I1XA 3UZWA 2W27A 4BQ3A 5AYYA 4L6HA 5H6HA 4MG4A 4GNKB 3S2CA 5H2ZA 4EAYA 4ADUA 1N8IA 3T44A 3W7GA 2I9UA 2CZDA 1JCXA 2Z25A 4L4OA 4AZ5A 1OFBA 3NVTA 3MA8A 1YX1A 4IFRA 4K8GA 3CASA 2BHUA 3GFYA 2Z2BA 1V6TA 2G96A 3NL5A 4BCEA 3N17A 3PZOA 3P81A 5HWJA 4GY1A 2HK0A 3PB0A 4A8IA 3THCA 3QYSA 3EX6A 4B16A 3LZ3A 1X6NA 1DQXA 4GGHA 3A4WA 3KL3A 2XN2A 3UNDA 1EUAA 3LV5A 1V02E 3CIVA 4C6DA 1LL6A 1FWSA 3AC0A 1K1DA 3GK0A 2W67A 1CGTA 1HVQA 3VIJA 3PPFA 3L9CA 4TR9A 3CIWA 4JTHA 1I45A 1ZENA 4H9MA 3WJSA 4FOUA 3VNLA 3AIBA 2PMQA 1QOQA 4NZFA 4HJFA 4YL2A 5C6MA 3M0KA 4J2PA 1O5QA 3K5XA 1XGDA 3IANA 1E6ZA 1L2QA 4HCHA 4LV4A 4XO7A 2FZ9A 3O3RA 2VM8A 3FYPA 2D23A 2J7EA 4Z42C 2DORA 3QSTA 1R30A 1XPGA 4PFMA 5F4WA 3UESA 1XC6A 1AVAA 2QCGA 1W37A 5REQB 4IISA 3O8AA 3WQ4A 1WDQA 3HG3A 4YTQA 4IJCA 3TQPA 2Q8XA 1H3GA 3NPWA 4CNNA 4WF7A 1CPUA 1SW0A 3ITTA 1KBIA 4I7VA 5E09A 4DWSD 3W07A 4CNUA 2UV8G 4PUMA 3YPIA 3HO8A 1E0XA 2G41A 3SCRA 3SQLA 1X38A 3B9EA 1W9PA 3GC5A 3AUJA 5C55A 3IK2A 3SCWA 1SPQA 3CWOX 3VVGA 1OC6A 1PHQA 2NT0A 4KQNA 2R1PA 3AJ7A 3BLDA 1MXGA 1KXQA 3I7QA 4IX2A 1UR2A 3GSMA 2OQYA 4W7WA 3R6IA 4DN1A 3WFLA 3ZVHB 1KGUA 5TBOA 3AROA 5I0DA 1GPFA 3UR7A 4C60A 3QW3A 1WX0A 1GQNA 2E67A 3VO0A 1XCXA 4GQBA 5CQ1A 5F4SA 2NXHA 4L1GA 5CC5A 3VNJA 3C0JA 1HKIA 3MWAA 3VMOA 1QT1A 2HE8A 3F7JA 1YLVA 4UOQA 1R3WA 1SJBA 1ZFJA 1DIEA 1RCXB 1QOPA 4UTUA 5A69A 2I16A 3OPSA 1KRMA 4KBXA 5CZ0A 2E9MA 2YZRA 1TTQA 1ZY9A 3GDMA 2P50A 4YWIA 4FR1A 3U4AA 2VZUA 3WNNA 2NV9A 3KBVA 3LPGA 4HPNA 3KZSA 4M1BA 5A2BA 2B7QA 3TZFA 4EOUA 4UTTA 4LGXA 3UJEA 3USZA 3MUXA 4WEVX 3CC1A 4FLSA 3F5JA 3EA3A 1W1PA 4RL3A 2HS6A 2J78A 3ALGA 5RUBA 4GYJA 2GPTA 3B05A 2P3EA 2GK1A 3DHUA 1HP5A 2YIHA 3UP8A 3NXFA 1IXOA 2PU1A 5CPLA 1MNZA 1GONA 1UKTA 2EPKX 4C5ZA 4O1CA 3M41A 1TPEA 3F4WA 3CO4A 1DJQA 4H6EA 2WMKA 4EXAA 4MAZA 1WZAA 3CZGA 1ISYA 3SECA 2RDWA 1M68A 2QW5A 2ISSA 2V3DA 3NO1A 4GIYA 4MB1A 1RQEA 2DEPA 3V3WA 1QI5A 1H0GA 4UTWC 2VDIA 1BF2A 4C7GA 1PKYA 3I7RA 5LHFA 4TV6A 1HUVA 4BEQA 1XICA 5HA7A 3WQ8A 3UPWA 3GU9A 3MCNA 4G7EB 2ISFA 3JUGA 1Y7VA 4MNLA 2J9YA 1PIGA 4DUOA 4B5SA 3CGTA 1EL3A 4QLKA 4QROA 3Q94A 1GW9A 3DG7A 1G5AA 2PFHA 5HANA 4J2MA 2VURA 2VDHA 1GOWA 1OFDA 4LVDA 3SCUA 3TNOA 4FEZA 1YIXA 4HCLA 4F48A 1KGWA 1OEPA 3QV6A 1CWYA 1LG2A 2BVTA 1KV5A 4H41A 1FXPA 3W1UA 4G5DA 4CEXC 1Q6RA 1VH7A 5D04C 5D2XA 4MB4A 1R85A 2A0NA 3WEZA 3CJPA 3MWCA 5E6ZA 4D1IA 3R12A 3OA5A 4LUIA 5E6YA 3GYCA 3QC0A 4G56A 3AZTA 4S3DA 1XIFA 2OYLA 3W6MA 1X96A 5AZ1A 1E6RA 3PUEA 4DB7A 1TV5A 2ZUVA 1E6PA 3L12A 1M5WA 5AYZA 1GQLA 1JUEA 1W3JA 3WLLA 4NILA 2RKXA 1JZ7A 5T9CE 4IPLA 4CLMA 1TPWA 1ZP3A 3DEQA 4AZCA 1R3SA 3DFPA 3T2OA 3TR2A 3M0IA 3RRXA 5HWNA 4KWWA 4MAVA 1OHLA 4EPBC 2E6DA 2WKJA 3TW7A 3C52A 3U2EA 1ISZA 4AMCA 3CL6A 3N2OA 4LOCA 3GG1A 1LL4A 1GVRA 4DJEA 4PA8A 4LVGA 2VEGA 2BGQA 4IJBA 3QM3A 5BRPA 3LDVA 5DY3A 4H01A 4MTVA 3WLNA 1OY0A 3W23A 1GVIA 3VU2A 5CC3A 1JRCA 3W1LA 4FMVA 1TO3A 2EPMX 3CHCA 5DFAA 4PSRA 1VP5A 3E74A 4DBEA 1JCJA 3IGUA 4XIAA 4XB3A 2WHKA 3CPRA 4XSLA 4W93A 5AVHA 3EX3A 1NP0A 1KFEA 4B4FA 3CAWA 1UP0A 1W3NA 1WDWA 1YBQA 2FPTA 2WNZA 3OZMA 3EMCA 2A6LA 4KF1A 3WUGA 1MI3A 4GYKA 3UR2A 3L21A 1NOUA 3RU6A 1QCWA 4KERA 2PLMA 3IIVA 5ENLA 2QUTA 5LNSA 3LPFA 1RD6A 1SJDA 2GVGA 3W2UA 4XAYA 1MW3A 4E2VA 4PB3A 4UCGA 2VDGA 4BKNA 2J74A 1SMAA 3G24A 4P8VA 2CERA 4HNVA 1FDZA 3SFWA 4S3BA 5DMYA 3K1DA 3ZR5A 4V27A 2VJXA 4KCVA 3PJUA 2NV2A 2X30A 4Q4PA 2FJUB 2J79A 2UY4A 5I3JA 5I24A 3INPA 3NA8A 2EGZA 5HATA 5CLTA 4URIA 2Y24A 2Y5SA 4Z1CA 5TIMA 3VABA 2D22A 4NXKA 2WJFA 4QG9A 5I00A 1ZBKA 4OFCA 2EKCA 2WHLA 4JDBA 5IFTA 1UA3A 3SY1A 4E5TA 3PBWA 4ATLA 2ISWA 3L5LA 1HJSA 2J9XA 3AU6A 2WBKA 3ANVA 3SW6A 4LUTA 1J01A 3H8AA 4PE8A 3DFSA 3VGEA 4WSJA 2NUWA 3S0CA 1CB7B 2GJNA 1VB9A 2O0TA 1W3TA 3RXZA 3GH5A 1BGAA 4CD8A 4NNCA 2ZUUA 1M1BA 1DJXA 3EKLA 3ZR4A 3U0HA 4P7OA 1AJ2A 1WE5A 3GU2A 4US5A 3SDOA 4W8BA 1BLIA 3AFBA 1EJXC 4QXIA 1C90A 3WDRA 4XTDA 1MQQA 1TV8A 4L9XA 4QQUA 2OZ0A 1KRAC 3QGVA 3AWNA 4IGSA 4ACZA 3QPYA 1AJZA 4MUZA 1OC7A 2ZCGA 2ZC1A 1GKQA 1NDZA 4TTUA 4FR6A 7ODCA 4LRSA 3ITYA 1OF8A 4U3CA 3UXIA 4DJFA 1Q8AA 5DO8A 2YL5A 1S2UA 1RH9A 1YE4A 4JIEA 2Y7DA 3GFZA 4LPCA 4BZYA 4UQAA 4EF9A 4GJIA 3GHRA 4B91A 4K1WA 3P5YA 3C2VA 3RNDA 3BV7A 5IOBA 1ZRQA 4O28A 1ZP4A 2POTA 3A13A 2DQWA 1QW7A 1UUQA 4B90A 1B90A 5G4EA 5HNNA 5LNUA 5MKGB 3BJTA 2IPFA 3GG7A 4JIPA 5CJNA 4UNIA 3H53A 2G3NA 2DPEA 3NUKA 3PUGA 1SO4A 2PD9A 5CBBA 5I77A 1RBOB 3S4TA 3QXBA 3AIRA 4UR9A 1V6YA 4CCZA 1IXPA 2PTXA 1A5BA 2DW6A 3N04A 3V5FA 3DXIA 4ZB0A 1AH0A 1H4PA 5DCEA 1O5RA 4FS9A 3LLFA 5M2FX 1QW9A 5G2IA 3OZYA 3M1ZA 4HNUA 3T8LA 2E7FA 4LBSA 2Y85A 3M43A 1R9ZA 4FNTA 2G5WA 1G67A 1G7VA 3I65A 1VFHA 3BZJA 3N2TA 2QCHA 1RQBA 1UR9A 3VK5A 2HQAA 1JUKA 4CN1A 4F0HA 5EMMA 3WLJA 3S5SA 3LTPA 3WBYA 2VR4A 1X97A 2GGGA 4S39A 1IR2A 4HA0A 4GG9A 3I6RA 4OECA 4B9ZA 1Q4WA 3GVWA 3TYAA 2J7HA 3HG4A 1UBPC 1YYAA 2QDHA 4GY7A 3FA5A 2XGIA 3AIEA 3JVAA 4FXRA 2E09A 4J35A 4H9TA 1G7UA 1E1EA 1UR1A 2XVNA 3SZ8A 2IPWA 3VKJA 3CZLA 2DV0A 2H9AA 3U48A 3IAPA 1V3LA 1I2NA 1UQZA 3LNMA 4HK7A 1R9YA 2Y6ZA 3PUDA 2W3ZA 1XRSA 1IF2A 1QK2A 2X1IA 3CQJA 3BURA 3GXTA 2CXEA 3RX3A 3WEOA 1LOLA 4Q7BA 4FNPA 1REQB 3OTRA 1B30A 3GHTA 5BMWA 3K4WA 1X98A 2YB1A 1MFUA 4MJMA 2BOEX 3QJAA 2OT0A 1SFJA 2V2CA 3L23A 2WOQA 2G3JA 4HBKA 2NWRA 1EJWC 2AL1A 2YXXA 3LI0A 2QCEA 1HGYA 1E55A 3ARPA 3C8NA 5EMUA 4L6OA 3H4WA 3WUEA 4ZXLA 1B0IA 4IQLA 3M0VA 1FFQA 3HV8A 4DO4A 1ONRA 2HNEA 4KH2A 3MVIA 4A29A 1CB2A 5F1UA 1P1MA 5J8LA 5BOFA 2Y62A 1Z7AA 1FP9A 5CPQA 3EMZA 2BMBA 4P8XA 5ABFA 5SWUA 3EAUA 4GK8A 3AO0A 1MRQA 1H50A 4AX6A 3N73A 4L80A 1U1JA 2D2GA 4CNTA 1ME7A 1J79A 1QK0A 2FVKA 4S38A 3UG4A 1O4UA 4IHCA 1GOOA 4FNSA 4QCEA 4H8HA 1EO5A 3UWWA 4F66A 3WLPA 1AK5A 3T0CA 5B7ZA 3STGA 3ARYA 1Y5XA 3RCNA 4IM4A 2A7RA 4XO6A 4O1AA 1TCDA 2ODOA 3P5ZA 2OWWA 3UU0A 3MBDA 1RSCA 2PC8A 3M6DA 1NQKA 1AMKA 3V5OA 4DUWA 2PGEA 1OB0A 4PUUA 4C91A 3PBUA 4YVVA 1M3UA 5D9MA 4X9SA 3NTYA 1TREA 4MFDA 2QUMA 1OCNA 2Y0FA 3SBFA 1ADOA 2VZTA 4AHOA 3PSVA 3MQTA 2BG5A 3EX1A 2C19A 3QV7A 1TZ9A 2JK2A 4AY1A 1THFD 4DM1A 2WHMA 4ALDA 3DI1A 1JCNA 1IEXA 3MI2A 4WSHA 1JZ2A 4F2BA 1CENA 3CTTA 4LCRA 5I3HA 4JTUA 4NX5A 2GGHA 3EOLA 4AC1X 1V02A 4LUYA 4YTRA 1H1YA 4MNMA 1VEPA 3S9YA 1PSCA 4CN6A 5FF0A 1MQRA 4O1BA 1XQLA 1A5CA 4LS2A 4LS0A 1O5KA 4WOZA 4ERGA 1L6FA 2YYUA 4RZ6A 4L1XA 1FQ0A 4OU1A 4IP4A 4WXYA 1AQFA 4NXSA 1NWSA 1TIWA 4LC6A 1BEUA 4PMDA 3DFOA 3PZVA 4D6GA 2PDKA 4Y6GA 4HK5A 2IKIA 1KA9F 1DWAM 1QNRA 4S3KA 3PNZA 1QPQA 1KM0A 3BTNA 4MADA 1QDSA 1V3JA 1HKWA 3H7VA 1K77A 2B4GA 5HPCA 2JFEX 1Q7ZA 4HU3A 4GWEA 3VIOA 2YA0A 3VZXA 4DWSA 3DI0A 3O6CA 4HK6A 4PB4A 1JNEA 3KAOA 4DPQA 2YXGA 2PP1A 4ASTA 3TMQA 3USBA 4UNKA 4YN5A 3AXHA 2ZZ2A 5D33A 5DF0A 2FPVA 3S6DA 4NU7A 1E0VA 1LF1A 1PVNA 1RVGA 4LV9A 4Q4SA 4OV4A 3SN1A 1Q6DA 1PKNA 1W1B1 1R5YA 1QHPA 3W73A 1LDCA 2AL2A 3TQKA 2DIJA 4GBUA 2IPJA 3IJLA 4KS0A 3O2LA 4JD4A 4N6EA 1ZTVA 2WZIA 2Z4GA 1DL3A 1FH8A 1WYIA 2R9RA 3WLKX 1XDJA 3CB3A 3TCSA 3SIMA 3KWSA 1AL7A 4ATWA 3M7SA 1UMYA 5XIAA 3GE7A 3NDOA 2BY2A 2C0AA 4POCA 4ZE4A 1MW0A 2PA6A 4Z2HA 4MY1A 1KXTA 5M1TA 1WUFA 3PTDA 3LS9A 1IXQA 1XDLA 2OX4A 3BANA 1XLIA 2DZBA 1X1OA 1EP1A 1P7TA 3W7QA 3KXQA 4GYPC 1YTKA 3W3OA 1BWVA 4K6AA 3V4BA 1GJWA 1KM4A 1S3TC 3F4NA 1JZ4A 1UR3M 4D6FA 1SZFA 3W1XA 5FJIA 4GI6A 3KP1A 2YSWA 1NSJA 5K9CA 2AGTA 4H04A 3A24A 1FDJA 3BLLA 1W8SA 4L4PA 1OK4A 4M80A 3QPZA 3WH5A 2WK2A 3GVVA 4XUYA 1OQFA 5JQ9A 1SMDA 4NNAA 3R8RA 2V0TA 4UTJA 3WD2A 1GVQA 3HPZA 2DY3A 4O12A 3L65A 4C6LA 4O16A 4HN8A 3SR7A 2V3EA 1BWKA 4ZQCA 3CMGA 2X41A 1KO0A 1TTIA 2J4GA 3TSDA 2YJQA 2MNRA 4J27A 4DWDA 3ICJA 5DY2A 3NQMA 4AAJA 3MMDA 4HTYA 4JTKA 2E5BA 4EE9A 4BFAA 2PLKA 3UWVA 2Y8VA 2CU0A 2VEPA 4NJGA 4DM2A 1H1ZA 3B9NA 1BRLA 5A8MA 4S2BA 2XSXA 2W62A 2DSKA 1XWYA 2INZA 3GLCA 4GX9A 4OBTA 3GIPA 2PCQA 2JF6A 4QIUA 1UD4A 4QE1A 4A4AA 2Y2WA 1OFRA 1J0ZA 1PPIA 2WQDA 3PZMA 4BQ4A 2XH2A 8CGTA 1LWHA 4GUJA 1J0IA 3O6YX 3DUGA 1SO6A 3KS5A 4P7RA 4DNMA 4HZ6A 1BVZA 1XISA 3EWZA 1VPXA 1XIDA 4U5KA 1JQXA 4I6KA 1TTPA 1A4MA 5BWFA 2VX4A 3W81A 4H6KA 2QV5A 2WMIB 3C2YA 3PZNA 3VD7A 4H2HA 1VIWA 3N1AA 4HHMA 3BLOA 1A0DA 3CH0A 1DBTA 3E2SA 3T0BA 3NYDA 1KWGA 1W9XA 2GGIA 2J13A 1OCQA 1XM3A 1VCFA 1Z9AA 3GH4A 4QE4A 1M9HA 3T8QA 2TODA 2A3BA 3NOYA 3T0TA 3WH9A 2RGMA 1SGJA 3FAXA 1TVNA 1Q6GA 5CXPA 1H11A 3OZOA 4XVDA 2J9ZA 4D6DA 3G1HA 2CNCA 1UCWA 3APTA 1E70M 3SUUA 3PNUA 1OX6A 1ALDA 2QLYA 3WL0A 4PMYA 3S3GA 1GEQA 2QCFA 3ITLA 4JFVA 3G2GA 2ZE3A 3GM8A 5DELA 1KGXA 3O05A 3URQA 1OT1A 5DXXA 3UZYA 1NIUA 3JW7A 3FIGA 1NTHA 4JL2A 3HFTA 1TVLA 4MDPA 5D32A 1OX5A 1C93A 4DLFA 4A6GA 3FLUA 3F4VA 1IE7C 4K39A 4Q8OA 5AHEA 1EB3A 1GZJA 4CD4A 2JIEA 4RDYA 5AHMA 3KFTA 2NUYA 3W84A 1EO7A 2IQ0A 4OHQA 4CQDA 1S2VA 3AHYA 3M0MA 2PDYA 4DZ5A 4Q6XA 4BF5A 1QWKA 2PP3A 5J04A 2WNNA 2NVCA 4P8WA 2BB0A 1R46A 1CGXA 1J2WA 4FX7A 2RJGA 4MLRA 4PGLA 3KW3A 5C9RA 4NG3A 4ZMGA 3U2ZA 1XD0A 3S1GA 3G0XA 2H9AB 1EGMA 4EPDC 3IJDA 5HOSA 2VOMA 3FOKA 1ZNNA 3B4UA 2ONEA 2WZMA 1AL8A 2G37A 2ZRUA 5GPRA 2CZVA 1P6BA 3KTXA 2OEJA 3G1AA 1BVNP 3CHFA 3NZGA 3OBKA 2OCZA 5CSUA 2ZX6A 3CUZA 1KFWA 1N8FA 3MDWA 1WDSA 1E9IA 4AEFA 3FEQA 3CHVA 3VNDA 5IM51 3TH6A 2H8XA 3ITOA 2YGYA 4MWAE 3V1HA 2J88A 5EBUA 4K2SA 4A8NA 2ZQ0A 4NJIA 3APYA 4IMCA 3UCQA 3AXXA 4ADSA 1JGIA 1UG6A 2QUUA 3OJGA 1FHDA 1ZBWA 4UTHA 2W63A 4F40A 1WDRA 4ZGYA 1AQHA 2X1SA 5EFDA 4LY4A 1QTWA 4DLMA 1I1WA 3LRMA 2OB3A 3AS1A 1WOBA 3LA4A 2DZPA 1UWTA 3REQA 1J10A 4IMDA 1S5NA 4NASA 4A22A 2ZIDA 4MPQA 1DQUA 1V6UA 4UR8A 4IG2A 1VQTA 1ADSA 3VNZA 3EPNA 3HQOA 1IWAA 3KHJA 2H3BA 4XD4A 4TV5A 4ES4A 3HPSA 3VOGA 2D2JA 5A2CA 5D2TA 3AIUA 3W25A 2QUNA 3ABRA 2YA1A 3A5VA 4D6CA 2XFYA 1U1HA 1RUSA 1SW7A 3VAVA 3E5BA 3QBUA 1OIMA 1TPUA 1E4NA 3LHZA 4Z2IA 2Q3OA 3OGVA 3TYEA 1XR2A 3VCNA 1TPC1 5IBXA 5A94A 3TAKA 1GYLA 4C5YA 3QYQA 4ZSUA 2PRMA 2ZRYA 4MNKA 2VEIA 4AVNA 1B9BA 1AD1A 3HURA 3MHUA 1W5NA 5I3IA 1DV7A 3H21A 1P1XA 1E9LA 1JD7A 1CIUA 2XIJA 3PZGA 1DXFA 3STPA 1JPMA 1RBAA 1RP8A 5E0KA 3W1RA 3L4VA 3GD6A 2WCAA 4LB3A 1UJQA 1DTUA 1RR2A 4GBDA 4AIUA 5DANA 3V0UA 3V5CA 5EKYA 1GQJA 1E40A 3WF1A 1WZKA 5AYBA 4F0KA 2F84A 1JUBA 2GVYA 3UZJA 4TX9A 6XIAA 1NOFA 3LI1A 2EPOA 2EKGA 5D05A 1HJUA 1KBJA 4NZCA 3C2RA 4PMNA 1C91A 1ZLPA 3G1VA 5B80A 1JPDX 3S5NA 4KESA 3DC0A 1VR6A 2EXOA 1XSKA 3TV8A 2I57A 3GIYA 2G50A 4WKHA 2PI6A 3WLQA 4MB3A 1FWGC 5BROA 5EBAA 3FN9A 1S5TA 1GZ1A 3N9KA 1BKHA 4B5UA 4D72A 3C2FA 2PRHA 3EOOA 2YB4A 1RK6A 5KZ6A 4V28A 4P8UA 3HQ1A 3WY1A 5FJTA 3RAOA 3B4YA 1ZJBA 2J7GA 2ZUTA 1FY6A 1W0MA 3C6CA 3AHVA 4IIFA 3UJRA 1XH2A 4E8DA 2R1KA 5CSRA 1LOQA 1W32A 4PRWA 4FX8A 4N6FA 3NIYA 2YPIA 3B03A 4ZZ9A 5FSEC 4M5PA 2W0UA 1UKPA 3HFYA 3OYXA 4HU8A 3PJTA 4TQTA 4NKCA 3KL0A 2ACUA 3RHGA 4ZENA 1DE5A 2NQJA 3OIHA 2DZVA 3KZPA 4WY0A 1MQPA 4K8HA 4Q8NA 4L56A 3GH7A 4NQ1A 3A9BA 1BVWA 3TU9A 1KBKA 1VBUA 2INEA 2WSQA 3RR1A 4NI8A 4JIHA 4LB4A 1S5VA 1XFBA 1ADDA 3NQBA 3FEMA 3LMYA 3UQNA 1WV2A 4AIEA 4NAEB 2CFFA 4NZ3A 3RJXA 2NZLA 3WN6A 2NXIA 4PMXA 3TK7A 4M24A 4PMOA 4AWSA 4P7QA 2VEFA 1WUEA 4Q6JA 3B06A 3O0FA 4NJHA 3E2RA 7CGTA 3PANA 2BV9A 2Y5EA 4FF7A 5DQPA 3LZ5A 4KFPA 3HJZA 4XZ9A 3MUAA 3TJ4A 3PZTA 4MY9A 3FYYA 5C71A 1TPB1 1R2RA 1IGSA 3LERA 2IXUA 4OUEA 3W26A 3EXSA 2QJHA 3QQWA 1LZOA 4AYSA 5CC7A 1FWTA 3LCIA 2I56A 4S3EA 3ECQA 3L66A 5HK4A 3I68A 5LXXA 2ZRZA 3U9IA 5CGTA 3L67A 4IMGA 1JAEA 5A8GA 2BDQA 2P5NA 4AZHA 3RMJA 2ABAA 3W01A 4Y7EA 1KV8A 3MUIA 2OGYA 1F05A 2O4MA 1DHPA 6A3HA 1QRQA 4IUOA 4O4VA 2ZBTA 3M0HA 4KT2A 3N6JA 3GXIA 4J1OA 4R7JA 3QQ0A 4TVUA 4ATDA 2WPGA 2JKEA 4JS3A 3LV6A 3VOJA 5CPNA 1X7IA 1QBAA 4XZNX 1VYPX 1SM9A 2WXDM 3AOFA 1NM9A 1HN1A 4XZIA 1S38A 3ARVA 2Y7FA 5CPMA 5JBFA 1N2VA 1Q5MA 1KXVA 2XPKA 3GDKA 4M82A 2ON3A 4L4LA 3M07A 2R1MA 4U2ZA 2UBPC 1RVKA 1DIDA 2A21A 1F9CA 4Z08A 2XH7A 1FWBC 5DBUA 1HP4A 3EZ4A 5A6BD 3UETA 3LHTA 1HZYA 3WKZA 1PCKA 4C6NA 2POZA 2A3HA 4FOJA 5EA9A 2QPXA 1KM6A 1ICQA 4DQWA 3KRZA 4DJDC 5I2UA 4W89A 1FCBA 4DXKA 4GQQA 3IJ8A 1UD8A 3VIPA 2OEMA 2ZZ1A 4AB4A 1B54A 1EJVC 3OBEA 1XF0A 3IRSA 1Z3NA 1LRTA 4UC5A 3R1ZA 4LWWA 3P93A 1L8PA 1MO0A 1B4EA 1VHCA 1BG9A 1O1ZA 1WAUA 2OOFA 4N2YA 1XBZA 4X2RA 3S47A 4Q7NA 1XSIA 2Y7GA 4B92A 4RZ5A 1E1CA 1OFOA 4J7RA 5DRIA 5G2WA 3N3MA 4GIAA 5BW6A 1KNWA 1BXNA 3PVFA 4HA3A 5IHSA 1VGAA 3DBNA 1NELA 3NQ7A 1XSJA 4CD5A 3B40A 1A3XA 2OFJA 3VIKA 3WQ6A 1TWWA 3WQGA 4LEFA 3AHXA 1XINA 3GRIA 3OVPA 1VJZA 4GISA 4P7NA 5E5CA 3DCPA 4M56A 2BTMA 3OLGA 3VZZA 2BVDA 4FI4A 4OUIA 4DO7A 4DHGA 2CLFA 3FXYA 3KVKA 6PTDA 4XD3A 2ICSA 1W9UA 6ENLA 2DDXA 1UD5A 4MJ2A 1XIHA 2J62A 3L4WA 3MJYA 4GIRA 4CQ9A 2GJRA 3N4EA 1W91A 1RAKA 2FHFA 1H63A 4J3TA 4O52A 1XCWA 1H7PA 2EO7A 1JYWA 3PULA 2J27A 4B4HA 4YPJA 5A6KA 2OWCA 3H4GA 4MWAC 2XH0A 1UZHA 4A35A 3ZQ9A 2ZA2A 3RM9A 3OGSA 3DECA 2GFTA 5DXYA 1C8XA 1AD4A 1PIFA 4H6RA 4EPKA 1MEWA 4B15A 4ZO8A 2XU2A 1US0A 3NZQA 1MEHA 5C2XA 1ECQA 1TPH1 1UH2A 2ZX5A 4OKDA 1JCTA 3EA2A 1O7AA 3STFA 1BYAA 3QQ1A 1W1YA 3WK1A 4GXPA 4WKFA 1EBGA 3WD3A 5T8GA 3PY2A 5FJPA 1TRIA 7REQA 5HR6A 1ZAHA 2ZVRA 4UCFA 1L0PA 1KCZA 2V30A 3AWOA 3W7CA 3SFKA 3RMEA 4AY7A 2FH8A 2VUNA 5F2MA 2E6FA 4YXGA 3B8SA 4ZFCA 3HM7A 3ARWA 3F5LA 4FA3A 2V68A 4DBDA 3PUOA 3WF4A 1JXJA 4KGJA 4IQEA 4ZFMA 2VO5A 1VRDA 4WY0F 3OQ8A 1QPRA 2NX9A 4KFNA 2Y5JA 3SCSA 4IWWA 3CUFA 4LAUA 3UXLA 2E40A 3ZIZA 5HULA 1Q2RA 3BVJA 3H7RA 1KM5A 1IZCA 2PZ0A 4JX5A 3IIOA 2P3ZA 1S39A 3CHDA 1W1A1 1LWIA 5TD4A 1HGWA 4LX4A 4MZ1A 1LM1A 5EY5A 4U2YA 4WDXA 3KVMA 4NAFB 5I3GA 3TW9A 5C54A 1FOBA 3SURA 4QNEA 2QCDB 2CLLA 3VGFA 1DHKA 1FWIC 4RXGA 5LIYX 3W7PA 2XISA 4RZ4A 3H6OA 2BP1A 4U10A 2A3EA 1KFCA 4X22A 1TKKA 4BS0A 3OVRA 4D6EA 1KM1A 1E6NA 2ZZ7A 2C16A 5FOOA 4KEZA 4RKAA 4L6DA 1OJXA 2WKGA 1ESWA 1DQWA 1PO9A 1R86A 3G1SA 1QMLA 2FGZA 3OZPA 3CS2A 1UWSA 1D3GA 4XD6A 4UQBA 3T1GA 4AWTA 2IKJA 4JIIX 3HIJA 3KM8A 4GUHA 1YDNA 3LBCA 3TYUA 1A4LA 3WJZA 1ZU8A 1UMLA 2J7DA 3BQ6A 2ZC8A 5LIUX 1MYRA 3C61A 3VCRA 1Q6OA 4AIBA 2GQ8A 3KCJA 1EC8A 3GAYA 3W37A 2V5LA 5CGMA 4NF7A 3WDQA 5HBFA 3EB2A 3N6HA 5LNRA 2CLOA 3BOFA 1XLFA 1KQZA 4O10A 1E6QM 4H8UA 2EF9A 1AUSL 4ICCX 1U5HA 2C1IA 3RLUA 3KBNA 2PDCA 2XJ7A 4P2VA 4R85A 4AWEA 3WUBA 4HZ7A 1H7XA 3KOXA 3NAVA 2GDVA 1HIZA 5CJ5A 3TQ0A 4JTFA 3QV9A 5I5RA 3S5YA 3VOFA 1IWPA 3WIJA 2AQWA 1ZJIA 1CX9A 4JTIA 1P0DA 2GVEA 3LM7A 4JOMA 3DG6A 1TCMA 4YYCA 3LCGA 4LF1A 4FXJA 1XUZA 1H62A 2WNWA 4YWSA 6CGTA 2KAUC 5FIPA 3L4TA 1ZL1A 4JTEA 1NVMA 2PAJA 2QJGA 3KCOA 2OU4A 4W4QA 2HISA 5A6LA 4CNOA 3RUBL 4HOZA 3MO4A 4LANA 3E38A 2E9LA 5LIWX 4XZLX 2GL5A 5A6MA 4TVCA 1US3A 1JCLA 1XIMA 2I5GA 3Q45A 4CN4A 2AAMA 3MZNA 1F3EA 4EAMA 3SADA 1VLIA 2FVMA 3NQVA 3S2LA 3UZXA 3B8WA 4WDUA 4GO9A 2D3LA 3UR5A 1V93A 1HL9A 1I2OA 4LCSA 3V7PA 3ES8A 1ITUA 1DYSA 1NFGA 2PWFA 1U33A 3V1PA 2P1FA 1S46A 3QC3A 2EJ1A 5CAHA 3W00A 1FHVA 2Y70A 2RAGA 2JEQA 4XK2A 3W6LA 1YEYA 3DU0A 3HGRA 3TC3A 3S8HA 4WY0B 1JZ3A 1PEZA 1V6VA 3T40A 1TPVA 4AVOA 3NM3A 3OG2A 1HKMA 1U1UA 1TJ0A 1C92A 1QHZA 3VYLA 1I0BA 2CZEA 4HOXA 3GDRA 1VJSA 1Z41A 4AVFA 5REQA 4KGLA 2ZDSA 4E4PA 2WC3A 3FJLA 1GOXA 3NDYA 3WNKA 1F6KA 2REQB 4P61A 3BV4A 3EKGA 5A6SA 2CZ5A 3VC5A 3VM7A 2GQ3A 1BHGA 4IJRA 1OIFA 2ASHA 4L64A 5A6TC 3W2NA 1TUFA 4YVPA 3H2OA 4N0RA 3E2QA 4CQ8A 3UG3A 2A3LA 2BLEA 1J18A 2C14A 2VFFA 4Q8QA 1ITXA 9RUBA 4A3HA 1SYTA 3GG8A 3GUGA 4XG1A 1KWKA 4BF9A 4CVUA 3QV8A 4YYFA 2OZTA 2GVJA 1D2KA 4BHYA 1PTGA 1Q85A 2R91A 2ZUMA 3OGRA 3BQ5A 4QG6A 3QF0A 1WXYA 3WYZA 4YIWA 5AHIA 4FNUA 3BLFA 4OT7A 3H2CA 3P62A 2EJAA 3QGAC 4O8RA 1JAKA 4F79A 3D46A 5C9XA 1CZ1A 4GJJA 4BWLC 3CYJA 3QLLA 1OG0A 2JALA 1A5OC 2ZXAA 4PZVA 3WLRA 2OKOA 3I7SA 1PCWA 5GNZA 2CHNA 1P0BA 3LQGA 1I8JA 5G2HA 2XN0A 3AYRA 3ZLFA 3P82A 2OQLA 1GQIA 3KHDA 4Q8WA 1EJTC 1QPNA 1VBRA 4M8UA 1TV4A 1XLHA 3TTSA 1DJWA 1H1NA 3IVTA 4GKLA 2NQLA 3D0CA 1XX1A 4QS5A 1IGWA 2AAAA 1KRBC 4KWSA 1UKOA 2ABBA 1UR4A 1TWIA 2RH9A 4PODA 5HQMA 1UOZA 2A79A 4DJDD 4A05A 5K7JA 1FCUA 4OOUA 2CHRA 4AD0A 5C2GA 4GO8A 3CIXA 1DIKA 4V15A 3NZRA 2OYKA 1G94A 2BSLA 4H8VA 4AZBA 1GYMA 3WQWA 3ONBA 3W7DA 2GZXA 3C0LA 3EXRA 5D38A 1BSLA 2JKPA 2WCGA 4UUIA 1SFLA 3VGDA 3M16A 3IJQA 2PDPA 5T26A 3CNYA 1I75A 1JYNA 4RE3A 5ABTA 2QS8A 1OSEA 4NYUA 1J0HA 2YFOA 1H2JA 3UWQA 1JXKA 1XL9A 4HSNA 4GVHA 1Q6LA 1RJQA 3ITCA 1XLGA 1H51A 3POHA 2VQTA 4HP5A 5HR7A 4PUWA 5BNKA 1PL9A 2HWGA 2WVSA 4G7EA 3EPOA 5JH2A 2C15A 2QF8A 3WK3A 1GHSA 4PRTA 4D6IA 4BJHA 3GNPA 2QV4A 4A2RA 2ZX9A 1E1CB 1OZMA 1J93A 1SU5A 5D8WA 4RXFA 3RITA 1PIIA 2NX1A 3GNDA 3ZWSA 2XDFA 5CBIA 1J8VA 1PX4A 1TV2A 1T8QA 1KW1A 2XFWA 4UFKA 2ZE0A 3S1UA 2L5HA 1VFTA 1EJSC 2PCEA 3IGHX 3ME3A 1KKRA 4JHZA 5A8OA 3TC6A 1EEPA 4MWAD 2PZNA 1IHIA 3S2MA 2D24A 3PFRA 1V4YA 2Y7EA 4JHOA 3P8JA 4CU6A 4H00A 3RFAA 3KBWA 1FCVA 3HGJA 1K3UA 2E0PA 2Z7KA 3RDKA 3CPGA 3LRLA 4R34A 4XZHA 3BZGA 2PDJA 4UXDA 4ZCWA 4PTXA 3U57A 1D9EA 3WJWA 1JYXA 1XBXA 4PUKA 1QXLA 3M46A 4AEEA 3B0VC 1E9ZB 3H2MA 3ZJ7A 2X2GA 2FIQA 4GKTA 3M0XA 1XH1A 4LQ1A 3LSCA 4JX6A 3TKFA 1DWHM 4ML9A 3LGGA 3NQAA 4AD3A 5FJJA 3UG8A 1K8XA 1DEDA 3OG3A 1UH3A 3WDPP 3E6EA 4AXNA 4KRUA 1XYMA 3BLPX 1ZS2A 4PC8A 2D1ZA 2P8BA 2QJIA 3ZZ1A 3N25A 1UP2A 5EMYA 3A4JA 3DIPA 2PC4A 2V5DA 4GYPA 3IPWA 1CGUA 5CPSA 2FTYA 4C90A 4PMQA 4Q8UA 3SEPA 1Y5VA 1J9YA 4AD4A 4DEFA 3W1PA 3DYOA 7REQB 2EBNA 5ECVA 3RO6A 1AQMA 1DIOA 3CH9A 5HQEA 1S2AA 4YU1A 1F73A 3GW0A 3ZJ8A 2J6VA 2F2HA 1W2PA 3QZAA 4C7DA 4ZEPA 1R3TA 3P2VA 1JPHA 3JR2A 3ARTA 4Q4OA 4IP5A 3TW6A 1VF8A 4IOTA 4UTTC 5G4HC 2GOUA 3MHFA 4QSHA 3P3BA 4N9EA 3AAMA 4PTWA 3WLOA 3L0KA 4V1YA 1M53A 3NQGA 2DT2A 1K03A 4F4RA 1Q13A 3N34A 2C3ZA 1XCFA 1TZ7A 2DZSA 3DKJA 2V5CA 4KEVA 2PDHA 3QTGA 3L7RA 1WZLA 4MUPA 3MUZ1 3DFYA 3UWEA 2EQDA 3O15A 3UY8A 1DWIM 1TIMA 2O7SA 2GWNA 1NFPA 5FL1A 1GOIA 2WMGA 5A8NA 3H24A 4KKXA 1Q6QA 5BCAA 4N42A 4GMEA 3RO8A 2I5QA 4DO6A 4IIGA 2PGWA 1FUYA 4A21A 1DTNA 3GDBA 3EWYA 1A0EA 3WF2A 3DFTA 4KW2A 4WOQA 2JE8A 4HU4A 1GTHA 3D5HA 1J6OA 5GJMA 3KLLA 3VKCA 4RNJA 3QOKA 3URNA 3RCYA 4IGHA 1P43A 4MZ8A 1EF2A 1MNSA 2YKKA 3E96A 1YRRA 3K30A 4H4IA 2PBOA 4NVTA 1DPMA 5D4YA 2WLZA 2OSXA 1FWNA 3ZVIA 4QJ5B 1OFPA 2Y8UA 4NX0A 3P80A 4J3WA 1TWZA 1NWTA 5A6BA 3H12A 2OQHA 2CESA 1EEXA 5KSWA 1CLVA 3CL7A 4YNGA 3E0IA 4BK9A 5HJXA 1B3VA 2VX5A 1TX0A 2PLJA 4M81A 3MP3A 3QZ6A 4XSMA 4JFUA 3A22A 2GUYA 4RPPA 3HU7A 3HG5A 1FKWA 3M5XA 3FGCB 4MM1A 4Q4QA 1MDRA 5L9FA 4GH3A 1ZGDA 4YJ5A 3VPLA 1AW5A 1JDFA 3FKKA 1QPKA 4YTUA 2QGHA 1R2TA 1XD1A 4J3UA 4DBWA 5DCDA 3S5ZA 1B31A 1FVPA 4IGNA 4IIBA 1TFVA 1RV8A 3PF3A 3NQFA 4L9ZA 3CXOA 2PBGA 3LM3A 1TRDA 4DUVA 1KBLA 5XINA 3T4CA 2FLIA 1A3WA 2FDMA 4ZO6A 3RR4A 3RPTA 4B3ZA 1TPFA 1ODUA 3W1MA 3PM6A 3O6DA 3K4AA 1WNOA 1PZ3A 1E4LA 1W3LA 3MS8A 2FB2A 4GYFA 3EB4A 2DSWA 4O11A 2PGRA 1K9TA 4FIQA 4JNMA 1UC5A 2E25A 3ABOA 4QJ3B 2CHOA 2VC9A 5E9AA 3AXIA 1K70A 1TJPA 2P10A 1H5VA 3NO3A 4HSOA 1PWLA 3LHWA 1ZPTA 3BDKA 3XINA 3U2CA 5CLWA 2FVLA 2JQXA 1TMLA 1K9EA 3BGGA 2OEKA 4DJEC 5MKGA 4IPJA 4UTMA 1I6NA 1LJYA 3OEXA 3BMVA 5K9XA 2DSVA 1EUNA 3KVJA 3HJEA 4MPKA 4PUNA 1F61A 2IPGA 4O50A 5FEZA 3W86A 3WNMA 2PLCA 4D2JA 1FHLA 1S3HA 2XIBA 1V8EA 2HXUA 4HGXA 2YCLB 4HVXA 4LAZA 1XJBA 3W76A 4Z2GA 1I2RA 4DZAA 3R10A 4M1RA 2CLEA 3DBPA 3KP0A 2NT1A 4HZ8A 3B9DA 3ANUA 2X09A 4MLJA 3R13A 1RA5A 2C6QA 3GU1A 1DJIA 3LCXA 2VTFA 1EYEA 4O57A 3M7WA 3W2LA 4KWVA 1XGZA 6ALDA 4PL1A 4PH6A 1L6SA 1RBLA 5F2GA 2DT0A 2ZFAA 4X9YA 2CWNA 4JPGA 3VD9A 4QQ3A 1JDCA 4H9UA 3G1FA 3CV6A 1QFEA 3WDIA 4EACA 2FTWA 4GOAA 3DN5A 2JF7A 1ONXA 1GWJA 4QSFA 3C2OA 2VNCA 3QVQA 3ABZA 5TAOA 3W7MA 5I02A 2QR6A 4CQCA 1W5PA 3PP7A 1QI0A 3EEZA 2WAGA 1REQA 3WQVA 1R0MA 1BYCA 4GE8A 4F2UA 4KWUA 1KFLA 2AGKA 4W5UA 2PWVA 4LALA 1ZZMA 2DSZA 4RDWA 4LRTA 2CBVA 3NQ2A 3SUVA 3WD0A 2XFRA 3FS2A 1EP3A 4PMZA 4NSBA 3R7MA 4HIBA 1P0EA 2FJKA 3SAZA 1LROA 4ZXOA 2OMAA 4G8TA 3R0DA 3LG3A 3HQPA 4RW5A 4ICNA 5ECUA 2QCNA 3GXDA 4XIMA 4JQ1A 3CEPA 2G3IA 3R0KA 4FPSA 2BHYA 2YOCA 3LNPA 2QCCA 3W7HA 3WZ0E 5JU6A 4TO8A 1BQGA 4JBRA 1IQ8A 4WDTA 3HGOA 1RJPA 4RW3A 2VCBA 3G18A 2GGEA 4WD0A 1OVDA 4E0CA 4W7UA 2VCCA 5KETA 2ZXDA 3GDTA 3WF3A 1K9FA 4Q8TA 4DO5A 4UMBA 2FZNA 4WHBA 5D37A 4IFKB 1LUCB 1KBBA 2G4JA 4K8EA 5BMXA 4DJFC 2XSAA 1QUMA 1IR1A 5FACA 3TJIA 3FCPA 3CZEA 4ZODA 4U3AA 5KZMA 5U4NA 4BY3A 3WF0A 3BW3A 3EWBX 3FSTA 3SO7A 5G5IA 3H2EA 1GVFA 1PXGA 1RK5A 2DSUA 5HMDA 4IPPA 5FSDC 2UY2A 4PBFA 3QHNA 3GNXA 1UPPA 2J25A 1ZCOA 3WEMA 4OBRA 1YW1A 1FWDC 4OQVA 2ZYFA 3GVRA 4R5EA 3UCCA 4NNBA 3N12A 3E2VA 4NY2A 1J5SA 4L4MA 2HJPA 4H9VA 2B0MA 4X2PA 4I7UA 3MBFA 1UWQA 3M0LA 3C4UA 1X6LA 4NZ4A 2X8RA 4FNQA 3TDFA 4GI8A 4E2DA 1PZ1A 3A3HA 3WSUA 1DJGA 1E5JA 2HBXA 3LGDA 2HZGA 4C6EA 2PODA 2X05A 1TJ1A 4JYDA 4NI3A 4C6JA 2V3GA 3TOYA 5LIXX 4OZOA 1A47A 3HMJG 4JCLA 1JG9A 1GG1A 2EAWA 3PBVA 3WD4A 4OBSA 4IX0A 4UZUA 1TWSA 3IIXA 1EJUC 3PZQA 4ERAA 3SUWA 3ZO9A 3C0QA 1HKKA 4BQ5A 2HROA 4KPLA 3FYOA 3EDKA 1OC5A 1BKSA 1ENUA 5G1MA 3ZLGA 1H7WA 4Y9AA 4WGXA 3MJMA 4O0KA 3RK8A 3CK5A 2V82A 1CT5A 3TXVA 3AICA 2QCLA 4QISA 4GABA 2RUSA 2GVLA 1VIZA 2WZTA 3RX4A 2VRKA 4JTGA 1EX5A 1UD2A 1CXLA 1FWRA 2GUUA 2XUCA 4WX2A 4GI9A 1Q3NA 3MUY1 3AIVA 4GINA 5AC7A 2UZ9A 2DJXA 1GCYA 1S1RA 3NL3A 2IKGA 3J7HA 6XIMA 3GTNA 1OFQA 1UPMB 2WVVB 3NPUA 5I7GA 3CAVA 2WC7A 1EP2A 3FK4A 2V38A 4Q7IA 5BOEA 1GYNA 4D9PA 2NVAA 2V69A 1X8FA 4ILSA 4ZOCA 4AISA 6TAAA 2HCVA 3DX5A 3W7JA 1F76A 3G6LA 3V16A 1EXPA 3TCEA 3GBDA 1NP2A 2ZDRA 1N7KA 4J40A 1FCQA 4FXSA 2QUVA 2C91A 3N2XA 4R7OA 4RNIA 4HSHA 3IV8A 8XIMA 3TE9A 1DXIA 3EB3A 3W74A 2BY0A 2CWXA 4JTQA 5HAOA 1DOSA 2XG9A 1A0CA 2VELA 2WMFA 4ZTYA 1CLXA 3EOSA 2CBUA 1GK8A 3VDAA 4MVAA 2ZUSA 3WFAA 1VEMA 4YHEA 3ZOAA 4IGMA 3VTRA 4MOZA 3ISIX 4WRHA 3E49A 5GNXA 1JYVA 1T0OA 3NQCA 3H26A 2I17A 3DENA 1UA7A 4AG0A 3DFNA 3K13A 3SJ3A 4HU0A 3GQYA 3POCA 1H7RA 2ACSA 4ZSTA 1UIOA 4DJDA 2V5KA 5PTDA 1VZWA 3QY7A 3EDEA 3HOJA 3U6WA 3W82A 4AD5A 2PB1A 1B3ZA 4JFTA 1UUMA 3GUWA 3V18A 3VNMA 2HBVA 4Y9MA 1PZ0A 1WQ5A 1XLCA 1UBSA 3P0WA 4PSPA 1F4AA 4HHPA 1GT8A 4LJ3A 2XIIA 1FDYA 4GVGA 4PMJA 3RYSA 1OYCA 4HYRA 1GW1A 2V2DA 1UWUA 2Q3RA 3M64A 3KRBA 1EH9A 2DZXA 1V6XA 3FJ4A 4DBUA 1XFCA 4GUFA 3KBJA 2ZVIA 1RY8A 3BGJA 4G9PA 1JFHA 1YXDA 1UD6A 3IS4A 2VWSA 1GVEA 1BD0A 2Z24A 3WLTA 4ZO7A 2UY5A 3W7OA 1A5UA 1XKJA 1V51A 3M5ZA 1LG1A 1Y65A 4A3RA 4ZQOA 1KC7A 1V08A 2NQHA 1AJ0A 5IDIA 4Q4KA 3A4XA 4RK8A 3QR1A 1SJAA 3P0XA 3CMJA 5AB3A 2TAAA 1YTDA 4H83A 1XXXA 3VIGA 2QGYA 5LA0A 1K4GA 3LX9A 5CZSA 2QJMA 2WMIA 3CUIA 1RALA 2CW6A 2E1WA 3BAJA 3EKZA 2CKSA 1YDVA 1JF6A 1W54A 4E3VA 3LEPA 2VD8A 2I1OA 3SCNA 4KMQA 1UR0A 3SCVA 3VUPA 4NIRA 3STEA 1W1IE 4NZ5A 4DWSC 2I14A 1WB0A 2VWTA 1EC9A 3N2BA 4C1NA 4X0VA 2FZ8A 3TUUA 1Z6KA 1SUXA 1DP0A 3UWYA 1LRNA 1PUDA 3AMGA 5G1YA 3TYZA 3KCLA 1EPVA 2BBFA 1VBGA 3GNRA 3A9IA 2OLSA 3D3FA 1EBHA 3WO8A 3IJ7A 5JVLA 2XVGA 1QO2A 2WPBA 2V67A 3IARA 2JKAA 1ME9A 3H70A 3FKRA 1O1HA 2QVNA 3TR9A 1AZ1A 4J28A 1HG3A 3NWRA 4QJ4B 1UZDA 2ALDA 1QNOA 4FXFA 4QLJA 4XUGA 2NUXA 1EZ2A 2A1YA 3U5UA 3L68A 3B0UX 1PKLA 1YKWA 1LLWA 1XRFA 2NWSA 2WM1A 4Z1AA 5KINA 3UF9A 2NVDA 2P0OA 4KFOA 1YQ2A 3CBWA 4HCDA 3UYCA 3OIXA 4IIHA 3TIMA 2E6YA 5HJYA 3DG3A 4UFHA 4JQ2A 3QPEA 2WVTA 3ZR6A 4H3DA 4JXCA 3R2GA 3I4KA 1JZ5A 3HV9A 2QPSA 4I3GA 3CO8A 2Z6JA 3MP4A 1NWUA 4AF0A 1VCVA 2H6RA 2QT3A 5HNTA 1W5OA 4IXXA 4XISA 4DRSA 1UOKA 2G0WA 4HA4A 1M41A 3EXTA 5LSMA 3QR3A 3P60A 1JRBA 3MSGA 2GQAA 3T2PA 3ZT7A 1GTEA 2XFFA 1GZGA 4NZJA 3W2MA 3N6QA 1QPOA 4F8XA 5FJRA 3H2AA 3S9IA 3KX6A 5DMNA 3OVQA 2PDFA 4W85A 3SJNA 1LT7A 2YX0A 1WKEA 8XIAA 2QCMA 3A3WA 3CAKA 3BSHA 2Q02A 4HD5A 3G1XA 3CZKA 2Z1BA 3W2JA 3AMDA 4XAGA 1H5YA 4US5D 3WLSA 5A8PA 5CPOA 1KRCC 3D3AA 4DF0A 5AYIA 3NM1A 1XH0A 4N02A 4PULA 2Y8KA 4AWUA 1GHRA 2BXZA 1Z69A 1XYLA 5BYWA 1VAHA 3CWNA 2F6KA 2EG6A 4CD7A 3SQSA 1XHGA 2DVXA 1Q66A 1M03A 2AQOA 4IF2A 2GQ9A 1FP8A 2IMRA 4DJFD 1V3HA 4GJ1A 4AW7A 1QASA 3BW4A 4PMUA 1T41A 4I9TA 1J12A 2ZX8A 1V5XA 1G01A 1W5MA 1IZKA 2BOGX 1WCGA 3VMPA 3EX4A 2XSBA 3ZLHA 4ML4A 2F6XA 3ZWTA 2E28A 3GR7A 4O8AA 2VVNA 3HPFA 1K02A 1GGOA 3EA1A 4IIDA 3OW1A 4TMCA 1E1FA 1XLKA 3MKVA 1ISVA 4W7VA 2XVLA 2A7PA 1H61A 5CEWA 2QDGA 4LBRA 3VKDA 3U4FA 1ML1A 4JL1A 3T0DA 3RJYA 1XIBA 3G3DA 3ES7A 4MYAA 2DW7A 2D0HA 3QFEA 1YXYA 1ZHAA 1ZB5A 2DZAA 4JR5A 1OG6A 3DHPA 3O7UA 3ZFHA 4BI5A 3O9NA 5CSSA 2O7QA 5K9DA 5I23A 3AZSA 4PTVA 2Q71A 1ITQA 4TU1A 5JXQA 2VQUA 1HKVA 3KOZA 2VC5A 1IT0A 3WH7A 3ITVA 8RUCA 1U30A 3RG6A 3WJYA 5FF3A 3W2KA 4LUSA 2VZVA 5C5YA 1LQ0A 1E4MM 1LBLA 4PFHA 4ZTXA 2O4QA 3VIMA 1B57A 4LF2A 3R4IA 3BCJA 2NV1A 4EX4A 2VZOA 5HMSA 2QEZA 4WKAA 1D3CA 1K8ZA 3W85A 5D30A 4PMRA 4IUGA 3MW7A 2IQTA 3L4ZA 2QXWA 4IICA 4GZJA 3M9YA 1XLDA 3T0AA 3MMTA 4C6KA 3V0TA 5BWAA 1BWLA 5B7YA 4R53A 5FJUA 2J7CA 2DT3A 3MI6A 1UUOA 4JY9A 4D8ZA 4NL1A 5GQBA 1CXFA 4EPEC 3LQLA 2BZNA 3TOPA 2YW4A 1FA2A 5I07A 4L65A 3O0KA 3QTPA 4IPNB 3OP2A 1NY1A 4Y8FA 3RN6A 5F7UA 3ITGA 1XPYA 3GKAA 5FAJA 2WMHA 5D03A 1SZNA 1W3IA 3OU8A 3H22A 1R47A 3SGZA 4LC8A 2GDQA 3GX9A 5AZ0A 4DF2A 3LY0A 4HNNA 4R27A 3TTYA 3VD3A 1O12A 1A53A 2ANUA 1ECEA 2JEPA 3B9OA 1S1PA 5BU6A 2QHAA 1GVYA 1EX1A 3UWUA 3W28A 2OODA 2B31A 5HNUA 3QSRA 4WJ8A 1GUVA 3MP5A 2A2IA 2W79A 3AXMA 3R25A 4JCMA 3W71A 2HPIA 4JQ4A 4R9OA 4WUIA 4AY8A 4G1KA 3QY6A 3ERPA 4NAEA 3T2QA 1VPYA 4Z2KA 4HNCA 1XV8A 5D8ZA 3TYDA 4UFIA 3RLGA 2Y61A 4QE5A 3UEQA 4F0MA 3VGBA 3FJNA 3DDMA 2Z1SA 3GFXA 3VOIA 4H7ZA 5AECA 3CTLA 4XV0A 2R1LA 3LHUA 1A3HA 2X40A 4LW7A 4QJ1A 3UJFA 1VBJA 3FVDA 3IVSA 3OBAA 5E9XA 3A23A 2ESCA 4S3GA 4M6PA 4JKMA 3NFUA 4QAWA 3S5OA 2FTPA 1K7XA 4O15A 3VNYA 3ZT5A 2BGNE 2VVSA 3L2IA 3S9ZA 1GORA 5C9UA 3PZ9A 2RDTA 1E0WA 1DWFM 2NSXA 3OOQA 3AU2A 3VE7A 1E4IA 5LGZA 3T08A 2GOKA 3VKBA 4PMVA 4UWMA 1IT7A 1EHAA 5IBXC 1XBVA 2PTYA 1GJPA 1KFJA 3L2MA 5G1TA 3GVQA 2Y1HA 1S5WA 2WSYA 5C0QA