3W7EA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-5-179
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-5-179
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 107
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7eA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7eA01
4AHPA 2VFEA 3HB9A 4FXSA 3DKLA 3DHFA 4M7TA 2Y70A 4DQWA 2WSQA 2NX9A 5A5WA 3KRSA 3AJXA 1G69A 3DGRA 3HG3A 5HJLA 4AEOA 3MJYA 2V81A 4JX6A 1XDMA 3R89A 2H3DA 3NQ2A 5T26A 3NNTA 3QM3A 1OHLA 2C3ZA 1UUOA 3S1XA 5D37A 2BLEA 3W7OA 4A21A 4JTUA 1IGSA 1G6CA 3MP5A 2E6DA 3G1FA 4DF1A 5DY3A 3TU9A 4LVDA 5KTLA 4UNKA 3S5YA 5LNSA 1XC4A 3M1ZA 1FDYA 5D2VA 5FF0A 1F05A 3NZ1A 1Q45A 3GYEA 3EX2A 3HOJA 2RFGA 4WJEA 3NR0A 2AQWA 3MI6A 5HUPA 4O1CA 5DXXA 1XBVA 3B06A 5K3VA 1FWNA 3G1AA 1F7BA 3QQ0A 1SW7A 3MHUA 2VFIA 4FNSA 3TROA 1SSDA 3W2JA 4UFIA 1ME7A 3ATZA 1GOXA 4YCPA 5CZJA 3IIXA 4L4MA 3BARA 3FYPA 4PTNA 4DO6A 4IXXA 3PSWA 2CZEA 4OU1A 4WY0F 1M7OA 3I7SA 1S5VA 2H8ZA 4AH7A 1QAPA 2C1HA 4A2RA 3WK2A 2J9YA 4Y90A 5BMWA 1WA3A 4MVAA 2YGYA 1NSJA 4JTHA 2FDSA 3NL2A 3QMTA 3M5YA 3NL6A 1BKSA 2GQAA 1K8ZA 4MZ8A 4U4MA 3KRZA 2QCCA 4I9AA 4IXHA 5IM51 2BXVA 3GLCA 3LX9A 3C56A 1YDNA 4XBKA 1SO3A 1SSGA 3NGJA 1CW2A 2DZUA 3STCA 4NZJA 5HWJA 3S6DA 3P5ZA 5AYXA 3MI2A 3OBKA 1VH7A 2EF9A 3W70A 4S2BA 3SZ8A 4MFEA 3SSJA 4CCCA 1X7FA 3NQCA 3G1YA 1V5XA 2YXGA 1O4UA 1L6YA 2KZHA 3W75A 1G7VA 1OX4B 3HGOA 2E6AA 1R2SA 4DELA 3N9RA 3CEUA 4LVGA 1FXPA 2ZZ4A 1GVSA 3EB2A 3OG3A 4QIUA 2AAMA 3L9CA 5H2ZA 2ZZ5A 1VGAA 1KFEA 1ALDA 3MO7A 5CPMA 3UWZA 2GQ9A 4IGHA 3ELFA 1W5MA 1BTMA 5J5RA 3HF3A 2DZVA 3MYPA 4RK8A 2XFWA 4FO4A 4LC8A 3P80A 3GDTA 3JRKA 4EWND 2EPHA 4L4LA 5KZDA 4W9TA 2NUWA 1FDJA 3F1QA 3S5ZA 3GAYA 3FIGA 1ZAHA 4HHPA 4B5NA 3E0IA 1HFBA 5LKYA 3JR2A 3TDFA 1M6JA 4NNCA 4HPJA 3HG2A 3W7MA 3R12A 1E51A 1H60A 2QAPA 1OJXA 1I8JA 4POCA 1TPDA 1O95A 5SWUA 1IXPA 1GVRA 2YR1A 1FCQA 3TXZA 5G2IA 3LLDA 1XBZA 1PHWA 3QSTA 3WFAA 2Y61A 1J2WA 1ME9A 1DOSA 3HG5A 4O57A 4IMDA 4WY0A 2EGZA 1ONRA 3W83A 1WQ5A 3W73A 3W7GA 1OFRA 1JCLA 3I7RA 2V82A 2C15A 2VEKA 4DO4A 4Y6GA 4N9CA 3PSVA 3SW6A 3THQA 4MPQA 3CU2A 1QFEA 2OT1A 1W31A 2H6RA 4NNAA 3UWQA 4NJHA 3OVPA 5FF3A 1OYAA 1X6UA 2YCEA 4WY0B 5KINA 1Z41A 3P60A 3W7PA 1TJPA 1W8SA 4FEZA 4O1AA 4CQ8A 4OE7A 3LI0A 5LNRA 2CLMA 5I3GA 4O54A 4HPXA 4ADTA 3FOKA 3LCFA 2Q8LA 1GQNA 2WO5A 3UWYA 2C6QA 4RKAA 2V2DA 2V30A 3BLEA 4GBUA 1FXQA 1H63A 3NPWA 3LCXA 3QF0A 1K8XA 2WSYA 3N2XA 1SO4A 2NX1A 3KXQA 4UFJA 1GWJA 4HNUA 3UXDA 2VFFA 4RXGA 1HUVA 3S5NA 3NOEA 2VEPA 4RR4A 5CZTA 1F74A 3A9IA 3KRUA 5GVJA 5F1UA 1KA9F 2CZ5A 4UTLA 1XL9A 3QQ1A 3NPVA 3S1VA 2GVGA 4P2VA 1D9EA 4N4PA 1QPQA 5HR7A 4YWIA 1M7PA 4HIBA 1H7OA 2X30A 4JYEA 1VYSX 3HIJA 2ZRWA 2XN0A 3L0KA 3TQVA 4IX0A 5D02A 1GZGA 3M44A 5D04C 3G0SA 1TREA 4O10A 3BW2A 3L2IA 5DBUA 1JRCA 2H3BA 2J88A 3IVTA 3HMJG 4NJGA 3W7JA 3W72A 3W1MA 2FPVA 1F6PA 1A53A 1OK6A 4ALDA 2WJZA 3M47A 2PC4A 4GWEA 3MHGA 4OV9A 1GVOA 2B7OA 2FPTA 2PRLA 1Q6LA 4RZ4A 5KITA 4O13A 2C16A 1W5PA 1YLVA 2QCNA 3LERA 1KM6A 4FNPA 2RDTA 5U7SA 5AHNA 3W2LA 2IQTA 1SZGA 4N2YA 4IX2A 3BGJA 3LDVA 1JCXA 3FFSA 3DKJA 3BGGA 1WOBA 2QCGA 4G1KA 2G96A 4NZFA 1XFBA 5LNVA 3OIXA 3WJXA 1OF8A 5CPOA 2YYUA 1YXYA 3EX3A 5FEZA 4DO5A 1RZMA 1YTKA 1TIMA 1EUAA 1OFDA 2GQ8A 2Z1BA 3L21A 4GRSA 1MEIA 3HBLA 3PVFA 4UFMA 3W1TA 2XN1A 1H7PA 2BTMA 2QCEA 3SFKA 4LUJA 3SECA 1OK4A 3PWAA 1AL8A 1NVMA 3E49A 3QJAA 3IV3A 2CLLA 1XM3A 1CI1A 3TKFA 2TRSA 3LTYA 1VR6A 2GOUA 3TAOA 2RHGA 2ZDRA 3A22A 3LV5A 3N34A 2FPYA 5F4XA 5HR6A 3B4UA 3B8DA 4N6EA 1NEYA 3M9YA 1GYNA 3NQMA 2Y88A 1W5NA 5AYYA 4ZQRA 3T78A 2GVLA 1OF6A 3OEXA 4HT3A 4Z1DA 1X8FA 2QCFA 3M6YA 3W7HA 3W7KA 2I14A 4UTKA 8TIMA 4KFOA 4MLRA 3Q94A 3VCRA 2AGKA 5HULA 2ZQ0A 1MEHA 3STEA 4A29A 1PV8A 2VOMA 1ZY9A 4ZQOA 4IUOA 2FQIA 3BW3A 4JTEA 3T4CA 2CLFA 4AF0B 3O16A 3PC0A 1KV8A 3NPUA 3E96A 1LLZA 3GKFA 4O1BA 1IXOA 2LLEA 4CCEA 2PRHA 5I3JA 1S5WA 4GC4A 3B05A 2YW4A 1F6KA 2BWGA 3DFNA 4JTFA 3TQKA 3G0XA 1AW5A 5TQLA 1FX6A 3KVMA 3P74A 3NYZA 4UTWC 3LRKA 2Z6JA 3DENA 3FKKA 3TX9A 4DPPA 1R47A 4RZ5A 4ZQMA 1UJPA 2W0UA 3R5EA 4JN6A 3RLUA 3GR8A 5I3IA 3LCLA 4S1FA 1ZJIA 5FEWA 3BV4A 3GIYA 3PF3A 3NXFA 1KFJA 1B4EA 4NJJA 1FWTA 1KFLA 1QWGA 1THFD 6TIMA 1TV5A 4ZVJA 1H7RA 4GJ1A 4WXYA 3QMRA 3PUDA 3CB8A 1I45A 4OGZA 3TC6A 3C6CA 1I4NA 2A7NA 2Y7FA 1XDLA 2J9XA 2V5LA 4JTGA 5L9FA 1BWKA 2QCMA 1EWEA 1EP2A 4K39A 4N4QA 3VKJA 3PBWA 3P7YA 4Q33A 2VENA 4BI7A 3CIXA 4OQVA 4RXFA 4AF0A 4EF8A 1WXJA 4ADUA 3NQDA 1Z48A 2R14A 4JS3A 4EF9A 2WQPA 2J6XA 1B57A 1LTDA 1Q3NA 1VJIA 4O50A 5CSRA 1A5BA 2E6FA 1RD5A 3L68A 1O60A 3TR2A 4XTDA 5BNKA 4Y8FA 1KFBA 4O17A 1KM1A 1G7UA 3GNDA 1QR7A 1KM5A 5G1TA 1PE1A 1H62A 2WV8A 2Y89A 5FI8A 5FF2A 5HQEA 1TTPA 1TYGA 4A22A 1AW2A 1MXSA 3VI2A 3FS2A 3FJ6A 1H1ZA 5D05A 1LROA 3P8IA 5FEPA 1T96A 5AOUA 3W2KA 3IGSA 4NT0A 4R53A 2DZWA 1KM4A 4JTKA 4JR5A 3BG9A 2Q3RA 1Z44A 2B7PA 3UNDA 2WSRA 3IRDA 4AVFA 4FNRA 2WOQA 2YFOA 4BF9A 2YZRA 1LOSA 3GVGA 3E12A 4UIOA 4O4VA 3TMLA 2QCLA 3NQ6A 2B7QA 1TPUA 1VZWA 2X1TA 3SGUA 1IXQA 1JCYA 2ISSA 3DFOA 1TQXA 2F84A 3DXIA 5DN1A 1OFBA 3C3NA 2ZA1A 1F73A 2FTPA 4ORIA 1KBJA 2EKCA 4E2DA 1AK5A 3W1PA 2FIQA 5K4ZA 4ORMA 5LGZA 2QEZA 2WNZA 4O0KA 1GVQA 5D30A 2FLIA 4LS1A 2FB3A 3S42A 1QPNA 5F2GA 4UR8A 5AB3A 4N02A 3ZWTA 5EL1A 3MW7A 3A24A 1LOLA 4M7SA 4JTJA 2Z6IA 5F4WA 3DI1A 3IIPA 3W2UA 1GVFA 3R13A 4X9SA 4XQ6A 4LU0A 1GT8A 5K2ZA 3PG8A 3NQFA 2NLIA 1EA0A 5D32A 3QPYA 2GPTA 4QNWA 1ICPA 5TIMA 3NA8A 2A7RA 3PAJA 3U8GA 2Z0IA 3Q37A 2QF7A 4DF0A 3KVJA 4E38A 3P67A 2X1UA 2VKZG 3P61A 1J4EA 3PULA 1G4PA 1O5KA 3W7RA 1LBLA 3SGZA 3HJZA 3PBUA 4IPJA 1K3UA 4DEFA 3O1NA 4M19A 4FHAA 5D2YA 1DQXA 2V2CA 1TTIA 4O16A 5F1VA 4M6QA 3C61A 4R34A 5TBOA 1TRDA 3QRHA 1OVDA 2QKFA 1YXDA 3NAVA 3EWUA 3QSRA 1FCVA 2CWNA 4JIPA 1P5BA 4CCDA 3IIZA 1GYLA 3G22A 3CM4A 3S1UA 1XXXA 3TC7A 3TSDA 2WPBA 3BVJA 3RK8A 3QYQA 3YPIA 3N9SA 5G2HA 3NL5A 3WJYA 4YLWA 4CLMA 2VFGA 2Y7EA 4M6PA 1TJRA 1SZFA 5D2XA 2A4AA 1WV2A 3TAKA 4O1DA 4O53A 4LV4A 1PL9A 3M7WA 2HMCA 3FJLA 2Y7GA 4OT7A 1KW1A 4R7JA 4M6VA 4MJZA 5F2LA 5F2IA 3W76A 4HNVA 1AW1A 2QCDB 3PY2A 4WOQA 5IBXC 3L0NA 4NU7A 3G0UA 4LRSA 2I1OA 3ATYA 2Q8ZA 1YDVA 1SPQA 4MYXA 4MY9A 1W5OA 4BI6A 2FB2A 3UWWA 3O15A 1KLZA 2CLIA 2NUYA 1HO1A 4HNNA 1K7XA 1L6WA 2FFCA 2C13A 3VFLA 2FJKA 3LXBA 3T40A 2OZ0A 1RQHA 1L9WA 4N9DA 4C1LA 1WX0A 2ZRYA 2JGQA 1W0MA 3KAOA 1DL3A 1EIXA 1DQWA 1EB3A 3LTSA 2RDWA 5HNRA 5KZEA 4O28A 1H7NA 1OX6A 4H3DA 3VE7A 4IWWA 3L0GA 1KTCA 3W7LA 1SW3A 5D2WA 4HNTA 2X1SA 1I2PA 1GTEA 3W1NA 5G4EA 1C8VA 3N19B 1UASA 3W2MA 3VNDA 4KFNA 3LV6A 4ADSA 3A5FA 4S2CA 1ME8A 3NPXA 1PS9A 3LRLA 2ISWA 5KZMA 1G4EA 2ZZ2A 4AWTA 3R8RA 4K36A 3U2OA 1I2RA 1XBYA 4E2BA 2X1RA 2HS8A 5AC8A 2NUXA 1TSIA 1OABA 1OX5A 3KFTA 4UTHA 3LLFA 4PODA 4OHQA 2YX0A 5CPNA 3H54A 1GJPA 2O7SA 3SR7A 1GG0A 2UV8G 1QNVA 4QNEA 1FDZA 1H61A 3W1RA 4O18A 3KX6A 4NXKA 3M41A 2Y6ZA 1KM3A 1G4TA 3TJXA 2HSAA 4LT9A 2C0AA 1TPEA 1NF7A 1X1ZA 3EWBX 2ZCGA 4I7VA 3HPSA 1FWRA 1RPXA 5K4XA 5G1YA 1KV5A 1KM0A 4LVAA 5CGQA 2YSWA 3WK3A 2G95A 3PM6A 1ZAJA 2RKXA 2VFDA 4N9EA 3LCGA 3N2MA 1OFOA 2WNNA 1EWDA 3ABOA 1TPH1 1FCBA 1OYBA 1SO5A 4UFLA 1T0OA 1KFKA 3P5YA 1ZAIA 1I2QA 3P81A 4JX4A 2QUUA 3A5VA 1MO0A 3QH2A 3T7VA 4JTLA 4GNJA 3GZ3A 4IMEA 5ABTA 5DELA 2NXIA 1A50A 5EMUA 1MEWA 3L5AA 1U83A 1JCMP 3C4UA 3TIMA 1YXCA 5K9CA 3S9YA 3C52A 4HSNA 5FF4A 5AYZA 3TXVA 4FNUA 3DI0A 2PCQA 3I68A 5H91A 2C18A 3UWUA 3N14A 4AWUA 3G1XA 3GNNA 3INPA 2B7NA 1TQJA 1XBXA 3CIWA 3EX4A 4GFSA 1DORA 1YDOA 3L5LA 4KKXA 3TW7A 4FB7A 2CZFA 2NXHA 3HQ1A 4O15A 2NX3A 2QR6A 1IIGA 4ZQPA 3DFPA 3O05A 4DBDA 2GUUA 4IQLA 3LGEA 5IBXA 1YPFA 2OT0A 4GUGA 4ZZ9A 3G1DA 1IXNA 1RQEA 2E6YA 1TPWA 2GJLA 3LCIA 3W3OA 4LVFA 3E9AA 4J9JA 4LY8A 4YCOA 2VFHA 2BSLA 1TO3A 3LOTA 1N8FA 2QJHA 3NQEA 1H1YA 3DHDA 5K7JA 1ICSA 1NFBA 1P1XA 1W5QA 4NJKA 4IPIA 3RMJA 5D03A 2ZRXA 3GXPA 4O0ZA 4XBSA 4EIVA 2ABBA 1ML1A 3P84A 4K38A 1BWLA 3G18A 4N6FA 5HWMA 4IMCA 3W22A 2J24A 3NZRA 3FLUA 4BWLC 2V5BA 1JUBA 3W23A 4LUIA 4UTIA 4MUZA 3H53A 4QSHA 3NQGA 3STGA 2G97A 3TW6A 5BRBA 3SY5A 3BLFA 3L66A 5HMSA 1KTNA 1K02A 3NDOA 1GTHA 2QAFA 3CWNA 4RX0A 3TA6A 2DP3A 3UPBA 3HPZA 3OA3A 1VS1A 2JKAA 4JICA 5CZSA 4UTUA 2YYTA 3F03K 4JYFA 1BEUA 3W7CA 4QISA 3G1HA 3WK0A 3Q58A 3GDLA 3R2GA 4Z08A 1LOQA 3P62A 5LHEA 4PL2A 4AXKA 2W79A 3FKRA 1W56A 1D3GA 5DCDA 1R30A 4ICNA 5KSWA 1T8XA 3MBDA 3WJZA 3G1SA 2QJGA 5LZLA 4JXCA 4XKYB 2J27A 1KFCA 2TPSA 4TR9A 1XCFA 4UTTC 3M0ZA 5CZ0A 2XN2A 1HO4A 2TMDA 1LBMA 3DBPA 3LI1A 4BFAA 1SZNA 2QUVA 2PURA 2EHHA 4WX2A 5CSSA 2H8XA 2OJPA 4X2RA 4JDYA 3LCHA 2CU0A 3EKZA 2DORA 4Y9AA 1VYPX 4LC6A 4LVBA 5K9DA 1EPXA 3OHIA 3K30A 2P1FA 2H90A 5G4WA 3MP4A 1SQ7A 1WDWA 4UR7A 3OVQA 1VHNA 5I3FA 3Q2DA 5AHLA 5EPDA 5A8GA 3OVRA 1JCJA 5DY2A 3W07A 4WXZA 4FX7A 4O14A 3B0PA 5BOOA 2ZRUA 3NQ7A 1KLYA 4QITA 2ZZ6A 3W2NA 1FY6A 2TYSA 3B04A 3PR2A 4O11A 4UFKA 5LNWA 1UB3A 1MZHA 2VC6A 4NUWA 2HS6A 3EXTA 4MY8A 4O19A 1LORA 3GAKA 1AL7A 5L6UA 3W85A 1VCVA 3LCWA 3DFQA 1HL2A 3C0JA 1IIHA 3W7EA 3QW4B 3HG4A 3ABRA 1AG1O 3C8FA 3W1UA 1I2NA 1ZALA 4PL1A 3I65A 3QMSA 3PUEA 3TSMA 4K8EA 3TE9A 2DJXA 2NV2A 1DV7A 3LXCA 3UWVA 1DVJA 1VLIA 2R91A 2ALDA 4UMAA 1FUYA 3L5MA 2CLOA 2P10A 2E77A 4ZMGA 5HWNA 4I7UA 1Q6RA 4YMZA 2OX1A 4K7VA 1VCGA 1PHQA 1PIIA 3GKAA 1VRDA 3GR7A 3N3MA 3G1VA 4UMCA 4TMCA 3LBCA 3ABSA 1ZFJA 1HG3A 1WAUA 2V9DA 4JTIA 4K7YA 3LB0A 1KTBA 3P8JA 4FIQA 4FXRA 1Y0EA 5EBUA 3DH7A 3MBFA 1QDSA 4KWWA 2G5WA 1ZCOA 4HN4A 1F76A 3LRMA 2A7PA 1R46A 2A1YA 3BG3A 5DCBA 2V8ZA 2QJIA 3TH6A 3C2FA 5DXYA 3ZS4A 2ZFAA 1FQ0A 3O6CA 3M5VA 1UCWA 5C55A 1K03A 3PS7A 1SUXA 1OX4A 2CZDA 1DJQA 1OFEA 2VEIA 2DZTA 1VQTA 1K8YA 3LXAA 3LHWA 2P0OA 2A2IA 4UTTA 1F2JA 2W6RA 2Y85A 1LRQA 2CW6A 4XKYA 1Z42A 3I6RA 1VHCA 1XUZA 5DCEA 1W37A 2ZZ1A 5HUOA 4MJMA 5EA9A 3G3DA 4WUIA 3ZFHA 3HGJA 2F7FA 4UTMA 3QC3A 4U28A 2A5HA 2B0MA 2ZZ7A 5D33A 5C6MA 1LLWA 2ATSA 1WBHA 2X16A 3CC1A 3C2RA 4JNMA 1YYAA 2JKEA 1OYCA 2E5DA 3DAQA 3NQAA 4MFDA 2Y7DA 4UTWA 1ZNNA 5C54A 4IMFA 3CTLA 1WYIA 3G8EA 1B9BA 3UD6A 3QW3A 4DBEA 1JULA 3NL3A 1LP6A 3V1PA 3KVLA 1ADOA 2CFFA 4GE8A 3EWYA 1GPWA 4OWGA 4ML9A 4FNQA 5BW6A 1G4SA 4JTSA 1RVGA 1YTEA 1M5WA 3NO5A 4JY8A 2QCDA 3A23A 3QZEA 4IJBA 4JYDA 5LSMA 3LM7A 2A21A 3LHTA 1XI3A 1CX9A 4AAJA 4K8HA 2VEMA 4K37A 3W1QA 1QOQA 2VELA 4LTSA 3PB0A 3LHVA 2NZLA 3HGSA 1ZENA 1FBAA 3D0CA 3CHVA 1PCKA 1LBFA 1QPRA 4M5PA 2R94A 3LHUA 3M5XA 1UBSA 3BW4A 3ZR4A 3G8RA 1JCNA 3W1AA 4RCXA 3SIZA 1F5ZA 4XTIA 4UC5A 3EWWA 2NXGA 4TO8A 4RJEA 3UQNA 5AC7A 1W3TA 4NX5A 4WOZA 3C2OA 3TMQA 3W87A 4RZ6A 3W7NA 5BMXA 3M5ZA 4AMAA 1EP3A 3PG9A 4JY9A 3FYOA 3B03A 1YTDA 2JKPA 3CWOX 1VYRA 4R33A 1XUUA 3IVUA 5CPLA 1C29A 2WNQA 5G5IA 4NVTA 1QO2A 2ABAA 3EWZA 1OFAA 4NX0A 3TK7A 5MHBA 3TFCA 1H51A 2NWSA 3GB6A 3W88A 1VLWA 2DJLA 4FF7A 3PB2A 1X1OA 3IIVA 5G2WA 3TCEA 2J9ZA 3UPWA 3TNOA 4GUJA 3DZ1A 1N7KA 4ZQNA 5D2TA 5K9XA 2QDGA 2VXNA 4XWUA 4UUIA 4JIQA 2CLKA 3EKLA 1SR9A 4FIRA 4Z1AA 1JUEA 2DZPA 5F2MA 2Y63A 4CQAA 4RV8A 1SO6A 5AHIA 3NEVA 4LWWA 3VE9A 1YPIA 2GVJA 1JRBA 4MOZA 4RLIA 1RV8A 1V7YA 1XKYA 1L2UA 1RQBA 2ZBTA 3RLVA 2WKJA 3L67A 1JUKA 5D38A 3BK0A 3CEPA 4GXMA 4LOCA 1P4CA 3S5OA 3I7QA 2CLEA 1LRNA 3HGRA 3ZWSA 1G67A 1SFJA 6ALDA 3O6DA 3NQ8A 2ZA3A 4LRTA 5DLCA 3SJ3A 2A6LA 3A21A 4YXGA 1HTIA 3H55A 2EAWA 3DU0A 3MHFA 4QJ1A 3GXTA 1TV7A 4TMBA 3W74A 2R8WA 1W54A 3O6YX 4MY1A 3ABQA 3FA5A 1LM1A 5E0KA 5CG7A 1EP1A 1W3IA 1EX5A 3GK0A 3MYOA 1FWSA 1VPXA 3THAA 3PBVA 4AHOA 4X3ZA 3O06A 4TX9A 1H5YA 5LNUA 2YFNA 4H4IA 3EXRA 2CLHA 3RU6A 4MKNA 4DPQA 1FCUA 4MIMA 3UZJA 4LNYA 1JQVA 5FEXA 3V75A 5DBTA 1TPB1 1W1ZA 3NG3A 3O07A 3C2VA 4OV4A 1SW0A 3BG5A 3BLIA 5FF7A 3DFSA 3WJWA 3B0UX 4O4WA 4BWLA 4D2JA 2ZYFA 4CNPA 5I3HA 1LCOA 5KMYA 1QPOA 4AWSA 3IEBA 2DZXA 1YADA 4NQ1A 3TV8A 4A2SA 4ZQCA 1SZEA 2E1DA 3QEZA 5C5YA 3SI9A 2I9EA 4PCFA 3PUOA 4BI5A 1EUNA 3EX6A 1B4KA 1NAL1 1TMHA 1LYXA 2PE4A 3IVSA 3MI3A 4MLJA 4NJIA 1H7WA 3T55A 3S0CA 3QPZA 5U4NA 4EOUA 1S5TA 5C2XA 3UYCA 3NVTA 3W7DA 2QCHA 3B0VC 4FNTA 5D09A 2V0TA 1K7EA 1C9DA 3EXSA 4AB4A 4CQ9A 4DF2A 3W71A 3W86A 1D3HA 1B3OA 3GDRA 3W1XA 3EX1A 4NXSA 3CPRA 3HPXA 1LRTA 4LS0A 3W1LA 1A5CA 1JR1A 1KM2A 5E1QA 1JJKA 2ZZ3A 3LHZA 1LDCA 3W7QA 4ONVA 4O8RA 3RFAA 3LTPA 4UNLA 4NNBA 5EYWA 3UXAA 4BR1A 4OBTA 3M43A 3WJSA 1DKWA 4KFPA 3DFTA 3PBYA 5LHFA 1OFPA 1IF2A 5J5DA 3QFEA 4XZ9A 2Y62A 4C1KA 1H50A 2ZRVA 4I7WA 1P0KA 3USBA 3N73A 3W84A 3TJLA 1O94A 1TRIA 3GXNA 5I3KA 3G24A 3S1WA 1W3NA 2D73A 3IGUA 3C2EA 4TIMA 3S8HA 2Z2UA 1TPFA 4WZHA 2DU2A 3TUUA 1PCWA 4UTJA 1TV8A 3KVKA 5AFDA 4JDBA 4FX6M 4CNNA 2Q3OA 1Q6QA 4BK9A 4TU1A 4GUFA 2JK2A 2BX7A 1P0NA 1SU5A 5AN7A 5CKSA 7TIMA 1TTJA 1O5XA 1T99A 3CLMA 4LV9A 4QAIA 1DHPA 1H7XA 1NF0A 3HO8A 5E93A 3TQ0A 4IMGA 4Z0SA 3NM3A 2YDAA 2BZNA 3TFXA 3STFA 2JGYA 2NWRA 1OG0A 3L65A 2GJNA 1LZOA 3LBMA 1L6SA 3T44A 4JTTA 3MP3A 1VCFA 3F4WA 4DXVA 4XUGA 4PFMA 1TPC1 1JVNA 1TPVA 2X2GA 5EY5A 3KOFA 4E0CA 4ZL1A 3MWAA 4O52A 4LW7A 1WOAA 1ZHAA 3NQVA 4KWVA 4X22A 4Q4KA 2A85A 1TCDA 2RDUA 3GX9A 4HSOA 3UY8A 4P61A 3UZ5A 3JS3A 5AHEA 4IOTA 2DZSA 2JBMA 5F4SA 3O63A 1U5JA 4PA8A 4PEKA 1GEQA 1QMLA 2E68A 3F4NA 1RR2A 5AHMA 1QO5A 1S3HA 2E09A 2ZTKA 4Q32A 4Z0JA 2YW3A 3E02A 2NV1A 1A5SA 4QM1A 1KBIA 2C19A 2ZA2A 1R2RA 4Z1BA 2V2HA 3GDMA 4K6AA 3W9ZA 4AHQA 2ISVA 3FEMA 4H6KA 3LHYA 1MSSA 1I2OA 4JEQA 3W7IA 3P82A 4Z1CA 4N9BA 4MZ1A 3BO9A 1ICQA 1R2TA 1UUMA 2A0NA 1DJNA 3NM1A 3MMTA 4PH6A 1AMKA 2QUTA 3CT7A 5HINA 2PRMA 1QOPA 1VC4A 3IIOA 2RH9A 4UMBA 1A5AA 3RNDA 1GG1A 1PVNA 4WQ6A 3UY7A 4GUIA 2ZTJA 1TTQA 1EEPA 5EKYA 3TSBA 1TB3A 3IGXA 3KHJA 4UFHA 1WBJA 4GUHA 4JD4A 2ZRZA 3O8AA 3W6YA 3G3MA 1DBTA 5LGXA 1FWWA 1N55A 1SFLA 4FX8A 1QCWA 2A6NA 3ANYA 3GDKA 3CQ0A 4HKPA 4YL2A 4QQ3A 4Y96A 2E5CA 3RF9A 2ATMA 1JQXA 4UCGA 3U6WA 2OMAA 2O7QA 3EEGA 2TSYA 1K7FA 2YPIA 4O12A 1J5TA 4UXDA 3EWXA 1OFQA 4MYAA 5FESA 2QDHA 1Q6OA 5AHFA 4JGDA 3M16A 2HTMA 4MZYA 3MUXA 4JX5A 3WK1A 3AO0A 4A3UA 4WD0A 2E5BA 2OCZA 2C14A 3BPWA 5AC6A 4PC8A 2B4GA 4EVZA 4CNOA 4LS2A
chains in the Genus database with same CATH superfamily
4AHPA 1QW7A 2HK1A 3RCNA 4QS6A 4ZSUA 3DHPA 4FXSA 3DKLA 1GKRA 1MUMA 1JDDA 2E9BA 4UOJA 2OQHA 3E0VA 1P6BA 1W9VA 4JX6A 2PLKA 3W6MA 3QV8A 2IS7A 3MB9A 2H3DA 1HKMA 5T26A 1O12A 2ZX5A 3QM3A 2OOFA 1J9YA 2C3ZA 5REQA 4M82A 2XHYA 2BLEA 3NVDA 4FLQA 3MP5A 2E6DA 2XIQA 3TU9A 4LVDA 3PZOA 4PSRA 5LA1A 3VNMA 1QASA 1AVAA 3WLPA 2BB0A 1ADSA 1V3KA 3EEZA 3NZ1A 5T91A 1UC5A 3HOJA 3VOFA 3V0UA 2GVEA 4HGXA 4WJEA 3NR0A 1XBVA 3P14A 2QT3A 3KLKA 2GGIA 4JQ2A 3LZ3A 1BGGA 3S5SA 4OFCA 1HXJA 3GW0A 1CGUA 4FNSA 3BGAA 4PYSA 3LPFA 4UFIA 1ME7A 3ATZA 3H2CA 1GOXA 5CZJA 4HMCA 4U10A 1KD0A 4J4KA 4WY0F 3I7SA 2BVTA 4AH7A 5C9UA 2ZX7A 4ZB5A 5BMWA 4INFA 1XV8A 3RLGA 1C7SA 3FA3A 1YBQA 4R7OA 3WD4A 1Y5WA 3AI0A 1UIOA 3BAYA 4JTHA 2C91A 2CETA 3M5YA 4W7UA 3NL6A 3JZUA 3VDAA 5A6AA 3GLCA 3NZQA 4XAZA 1VBGA 1SSGA 2VDGA 2DZUA 5HWJA 2I56A 2E40A 2XWEA 4WDUA 1VEOA 1KGWA 1RJPA 4CCCA 1J93A 4KRZA 4XZNX 1W3JA 5A2BA 3DOPA 4DX3A 1MW2A 3KBMA 1PZ3A 3TTEA 4M80A 1AQFA 2YXGA 1RCXB 1L6YA 2FTWA 1OX4B 4NZ1A 1E3ZA 1R2SA 2VRKA 2GWGA 2ZZ4A 2NW0A 1I0DA 3IJ9A 2ZZ5A 5DRIA 5D9PA 4NILA 5FL0A 4IGHA 3ELFA 1W5MA 6ENLA 2DZVA 2FVLA 4RK8A 2GQ3A 3P80A 3IS4A 3T8LA 5A1AA 1TV3A 2NUWA 1FDJA 3F1QA 1KBLA 3GAYA 4PCSA 1H0GA 3MDUA 5LKYA 3TDFA 1JIBA 2F61A 4NNCA 1H60A 4ERGA 2FMOA 4POCA 1KNWA 4ZEPA 4NY2A 1IXPA 5D9NA 3BLDA 5A8MA 3SGGA 3OZOA 3PBGA 3RM4A 5G2IA 4IGMA 3S2JA 3QSTA 3WFAA 2Y61A 3HG5A 3TYEA 4IMDA 3QR0A 1UOZA 1S38A 1ONRA 5T9CE 2Q6ZA 3CUJA 3W7GA 2C15A 3CZGA 2VEKA 4GKTA 1FHDA 4A6GA 4YTTA 3PSVA 2WCSA 4C7DA 1DIOA 5FAGA 2OT1A 3WLTA 2H6RA 3A3HA 3UWQA 1E6RA 3OVPA 5FF3A 3RHGA 1PZ0A 4ZXLA 4WY0B 5KINA 2WHLA 4GXPA 2PP1A 1V02A 4O1AA 4W84A 3SJNA 1X6LA 4CQ8A 4OE7A 3LI0A 3BH4A 1IEXA 3WBAA 4D6FA 4HPXA 4CVWA 3FOKA 3H2EA 1NQ6A 3UWYA 3UERA 5T9BG 4BKNA 2BGNE 2V2DA 4GYKA 4EAMA 4MJ2A 4ZFMA 4GBUA 2XH4A 4WDWA 3S9ZA 4PMRA 1G01A 3LCXA 3QF0A 1K8XA 1O1HA 3PTQA 3KXQA 4M8UA 1GWJA 5BU6A 4S3DA 1JZ4A 2O55A 3PP7A 1BYAA 4U33A 4AUBA 4FAMA 1DJGA 5C9XA 2BG5A 1ECQA 2SFPA 2QQ6A 2GSHA 4IJRA 1L2QA 2GVGA 1HVXA 1RSCA 4RZBA 3VKKA 5LXEA 3PWIA 4HIBA 1IZCA 3M0MA 1GCYA 4W86A 1BVWA 3N6JA 4MWAD 1TV2A 2ZRWA 2XN0A 2ZADA 5FAJA 3OQ8A 3I10A 1GZGA 3RRXA 3G0SA 1UR1A 1LUCB 1PX8A 3BW2A 3L2IA 2H3BA 3S2CA 3W72A 5EFFA 4IL0A 4ZSTA 4KEZA 4HZ8A 1Q13A 3AXHA 1I75A 1W2VA 5EU9A 4CEUC 4RZ4A 2HPMA 1YLVA 1DJXA 2J6VA 4H9ZA 3LERA 3MSGA 2UZ9A 5LYRA 3KM8A 5AHNA 2IQTA 4M1RA 6CGTA 4N2YA 2WMIB 1JCXA 4QDWA 1A5OC 1UA7A 3CUFA 4QCEA 4WJ8A 1JD7A 4GVGA 2OZ8A 3AQUA 1OF8A 2CXEA 4E2OA 4EXBA 5CPOA 5FEZA 3RX3A 2XTKA 2GQ8A 5DT7A 1MEIA 3B3DA 5CGMA 3PVFA 2XN1A 1Z32X 1H7PA 2O9RA 4CD6A 1F3EA 3WBYA 1F9CA 5HJXA 3SFKA 3VNZA 1BTCA 1OK4A 2YXXA 4GZEA 3K8MA 3E49A 4HTYA 3IV3A 1XM3A 2TRSA 1VR6A 5I06A 4V33A 4I3GA 3IWPA 3A22A 4FMVA 1NEYA 3M9YA 4HYVA 1GYNA 1W5NA 1JXJA 1KBBA 2GVLA 4YN5A 1VJZA 4URIA 1AQ0A 3CLWA 4HCHA 2BVDA 5A8PA 1RAKA 8TIMA 3BAWA 4CN1A 5BCAA 3BICA 4CN4A 4YTQA 1ZY9A 4ZQOA 3TC3A 3V18A 4XKMA 1PWLA 3RJXA 4IUOA 4JTEA 3UWEA 2HZGA 2FGLA 4AF0B 3NDYA 3O16A 3AYVA 3A47A 2Y24A 3NPUA 2ZC8A 1WXYA 3B97A 3N2OA 3VPLA 3F5LA 3HU7A 4XD6A 1DXFA 1G1YA 1CBGA 3W81A 4ZO7A 3ARTA 4MWAC 3DFNA 3BMVA 3G0XA 1V03A 2JIEA 3NIYA 2V5CA 3KVMA 3KS5A 1J79A 2WVVA 4UTWC 1XW8A 3MQTA 1R0MA 1XYAA 3DENA 1E1CB 1UJPA 4HNLA 2W0UA 2NQZA 2YBVA 2Z4GA 5HQLA 3I4EA 5FEWA 3NXFA 2WJDA 1KFJA 1B4EA 5AC4A 1FWTA 3MUY1 4UQAA 3VUSA 2EEXA 4YTSA 5HANA 2ZUTA 5I23A 3TC6A 3CB8A 1I45A 3TYBA 1E70M 5B7ZA 3FDGA 1Q2SA 2QCMA 4K39A 1NP0A 2DSVA 3O0KA 3P7YA 2VENA 2XGIA 3GU9A 4HU0A 2GUBA 3VNJA 2HV5A 1RD6A 4EF9A 2UY4A 4F0HA 1B54A 5AVNA 1GJUA 1LTDA 4J3SA 4Y2WA 3SN1A 4NG3A 4WHBA 4GMEA 4Y8FA 3IUHA 3H2OA 2BV9A 5EMYA 5JMUA 5G1TA 3UGRA 4C6PA 1BF2A 3SCPA 1EJWC 4WSKA 1XIEA 2P53A 1K9DA 1DWFM 4UB9A 4H9VA 1EOKA 3FJ6A 5A2AA 2BOEX 2PTXA 5D05A 3EA1A 4JFSA 2BOFX 3VOHA 1T96A 4F2BA 5AOUA 2F6XA 3KCOA 3WN6A 2WMGA 2RJGA 2NQJA 2WKLA 3T8QA 1Z6KA 3WNOA 3BG9A 2Q3RA 3TN4A 2EG7A 5H8UA 3RGTA 4UQDA 3UNDA 3EB4A 4MADA 3TA9A 1IEQA 4BF9A 1K1DA 3ZLGA 1LOSA 4UIOA 4L6HA 1S39A 2QCLA 2FJUB 1TPUA 1VZWA 3CQKA 3TQPA 2PGWA 2DV0A 1TCMA 2E28A 3ARWA 4HU8A 2YA2A 3Q65A 1GZJA 3DXIA 1GQIA 2FTPA 4L9ZA 3T2PA 1E4MM 3E5BA 4E2DA 1AK5A 1GQJA 2QUMA 4JEJA 2FIQA 3W24A 4KESA 2WNZA 3WFZA 4LS1A 8XIAA 1E56A 1HL8A 5AB3A 2QXWA 3BE7A 1V0MA 4LYQA 3CXOA 1MXGA 3MW7A 4X9YA 2V68A 5H8PA 1JYNA 4BS0A 3ARSA 4UBPC 1BQCA 1RALA 3W2UA 1GVFA 1BSLA 5IOBA 4HB7A 1CCWB 3MU7A 5K2ZA 2YJQA 3PG8A 2PBGA 4OKDA 3AMLA 3W0KA 1E9LA 4TV6A 4S3EA 4S3AA 4QNWA 1ICPA 4Q3MA 4X0NA 2QF7A 3ERPA 4DF0A 2EPKX 1R85A 2X1UA 3FYYA 1F8MA 2VKZG 1QJWA 4QE5A 3PULA 1DJHA 4LYRA 3LMZA 1O5KA 2XIJA 3SCVA 4MNLA 3DDMA 2AQOA 4QTGA 4FHAA 3UCDA 5B80A 2X7VA 3SCUA 1TTIA 1XLLA 5F1VA 1TRDA 4LCQA 2VUNA 3QRHA 4S39A 1CXLA 1PZ1A 1VFLA 1CLXA 2BY0A 1MVYA 3G22A 5CC5A 4GJJA 4LCRA 1A49A 3BVJA 3E3HA 3QYQA 1C8YA 3YPIA 4BQ5A 4US5D 3CAWA 3AISA 1S2WA 2YKKA 4CLMA 2Y7EA 4M6PA 1TJRA 5D2XA 3QHOA 4PMUA 4O1DA 1UQYA 2Y7GA 3H70A 1KW1A 4R9XA 1O5RA 4M6VA 4MJZA 1OADA 5I2UA 3PY2A 4WOQA 3TOPA 3HURA 2I1OA 4ATLA 2Q8ZA 5LIWX 2FB2A 3UWWA 2QDDA 4IF2A 2CLIA 1HO1A 2Y2WA 1K7XA 3BSMA 2FFCA 2J66A 1JFHA 2D3LA 1H41A 4N9DA 4C1NA 1BD0A 2XVKA 4C1LA 4QEEA 1W0MA 3KAOA 3UG3A 3GG1A 3LTSA 2HXTA 3C86A 4C5ZA 2PU0A 3RPTA 1H7NA 3M46A 3SRHA 3L0GA 1KTCA 1SJDA 5D2WA 1B5TA 4JN7A 4P8VA 4TV5A 3N19B 1UASA 3VNDA 3LV6A 4ADSA 3A5FA 3G77A 5E0FA 2J8GA 4HA1A 2GUYA 1CECA 2WLZA 5KZMA 2HK0A 4GH1A 3R8RA 2G3FA 1D7FA 3U2OA 5A2CA 3CHEA 4AZ7A 4AD0A 3OP2A 6PTDA 1PYFA 4A3QA 2WC4A 4KBXA 1TELA 2O7SA 1JL8A 4HA3A 4HU3A 1XH1A 3QKEA 3DYPA 3BLLA 2E25A 5MKGB 2WZEA 3W1RA 4O18A 4ASTA 3PZGA 2P3ZA 2OQYA 2G3IA 1KWGA 2ZX6A 1GGOA 2OEKA 3TJXA 1Q8JA 1FWRA 1RPXA 3PHAA 4TTUA 2NLYA 1HW6A 3Q45A 1NWTA 3UEQA 4U31A 2G95A 3PM6A 5ABGA 1R6WA 4N9EA 4G2DA 3OBAA 2VZVA 4UFLA 5FSEC 1KFKA 2PDGA 4LEQA 4KQNA 3P81A 4B16A 2QUUA 4RDWA 3E1F1 3T7VA 1S2TA 4L4OA 4GNJA 2Z28A 5CPSA 5ABTA 3WNNA 2NXIA 4FP1A 1W6TA 5EMUA 1MEWA 5GNXA 3L5AA 4E8DA 3GVRA 2VURA 4KS0A 3DYOA 3C4UA 3IJ8A 1M65A 5FF4A 3TXVA 3UFYA 5D8WA 2C18A 3UWUA 4BHYA 7REQA 1P1MA 1QI3A 1V3IA 1XBXA 3HQNA 3EX4A 4GFSA 1YDOA 1M9HA 2GDQA 4X2PA 1EO5A 3L5LA 3GU1A 1B9ZA 4O15A 2CZVA 3RRAA 3TN5A 3DFPA 3QHMA 3ITXA 4AZHA 2HRWA 5IBXA 1EF3A 1KBKA 2OT0A 4GUGA 1RQEA 4BQ2A 3K1GA 3LCIA 5ABFA 3W3OA 3FVMA 4LVFA 1QT1A 4J9JA 4LY8A 4AWEA 3GYCA 4LY4A 2ONEA 2QJHA 3NQEA 1H1YA 3DEQA 4XD4A 4EWJA 1J0YA 5MKGA 1OBAA 1HJWA 5AVHA 2CIPA 1P1XA 3L4WA 1UR4A 4OUEA 5D03A 4XBSA 4EIVA 4H7VA 2ABBA 4K38A 5HWMA 2NVAA 1ZB5A 3NZRA 1PTAA 1R3QA 3PWGA 3W23A 4LUIA 4UTIA 4LUTB 1UD4A 4MUZA 1UWQA 3CUZA 3L66A 4PTXA 1MXDA 1P0BA 3CWNA 2DFAA 4ZB0A 4IUGA 2XG9A 4JICA 5CZSA 3AS0A 2MANA 4G5DA 3EDEA 4UR9A 1LOQA 1OIFA 4ACZA 2VZSA 1ZBWA 3UR7A 4DJED 1IGWA 3PPGA 2O4MA 2HBXA 4XKYB 3NSNA 2TPSA 1JZ2A 1VAHA 5A6TC 3R7MA 1FOBA 1L8NA 2TMDA 2JIWA 1REQB 4FF5A 1SZNA 2EHHA 4WX2A 2W27A 4HZ7A 4J3UA 3T07A 2H8XA 2OJPA 4X2RA 2ANUA 1CZ1A 5I3DA 3OODA 2Y8UA 3EKZA 4YHGA 1E6PA 4K3ZA 2X40A 3V36A 1EPXA 4KEMA 1E4IA 3CQHA 3W28A 3OHIA 4H1ZA 5G4WA 1WDWA 4UR7A 5FJIA 5AHLA 5EPDA 4A35A 1JCJA 3W07A 1RH9A 4AW7A 1KLYA 3CZ8A 2ZZ6A 4DWSB 2TYSA 1LL6A 2VC6A 2PDCA 4PSPA 2Y1HA 3GAKA 1UPPA 5L6UA 3N3TA 1YPXA 4IPNB 4LB3A 1H3GA 2EJ1A 3ABRA 1AG1O 3W1UA 1ZALA 4PL1A 3N13A 4US5A 3H2NA 1W91A 3TE9A 2E0PA 3RO8A 5I24A 1DVJA 2R91A 4W5ZA 4AX6A 2XIIA 2FDMA 3GHUA 3I3BA 2OX1A 1XH0A 3SQMA 4XD5A 3UCQA 4CNSA 1NWSA 1VF8A 3N3MA 1GK8A 3OGRA 1BRLB 3C3UA 3LBCA 1ZFJA 6TAAA 1UC4A 2J7FA 3SCWA 3KE0A 2ZUUA 4BA0A 4K7YA 3RO6A 4DXKA 1KTBA 3P8JA 1MW3A 2XFRA 3ECQA 4FXRA 4JQ4A 2OYKA 1OC5A 3AXXA 3MBFA 1QDSA 2G5WA 2Q8XA 1S46A 1E40A 3LRMA 2V8ZA 2QJIA 1EBGA 1BRLA 4RE2A 2R9RA 3M5VA 3B9NA 5C55A 3WL0A 1V6YA 4C6QA 1K8YA 3LXAA 2W6RA 3P0XA 4LUSB 4XZLX 3I6RA 1VHCA 1PO9A 3GXDA 4S3CA 4ZOBA 1XC6A 5HUOA 3NCOA 1LL4A 3G3DA 3MA8A 2A5HA 2YB1A 2ZXBA 2B0MA 5D33A 5C6MA 2PZNA 3AS1A 3CC1A 1C8QA 4F0KA 1OYCA 1S1PA 2E5DA 4WKAA 3DAQA 4MFDA 1Y5VA 2Y7DA 1E55A 3AC0A 1TZ9A 4IMFA 3WG6A 1PSCA 3ZLHA 1SJAA 4GKLA 3HFYA 5JBDA 4DJDC 5E6YA 4Q8TA 4GE8A 3SQLA 3EWYA 3SY1A 1EL3A 2ASHA 5FACA 5BW6A 5CGTA 1RVGA 1UKQA 1A4MA 1NARA 4DRSA 2Y0FA 2QCDA 3A23A 2J4GA 4IJBA 1CDGA 3LM7A 1J6PA 3N4EA 3ZJ7A 1DPMA 3LHTA 1UH2A 2OEJA 3O2LA 3ZZ1A 4AQLA 1EYEA 1TKKA 3UVIA 3S6OA 3W1QA 4M81A 4REQA 1UH4A 3RM9A 4U3AA 1OGGA 4HMDA 1XIMA 1J0KA 2GLKA 1V7AA 3E5PA 3IV8A 3UR8A 3ZR4A 3G8RA 1OGSA 1MFUA 2IXVA 3SIZA 4R3UA 3O9NA 3L4XA 4UC5A 4L6DA 4RJEA 5HAOA 1QNOA 3EWDA 3QKZA 1PZ2A 1POKA 4F2TA 3MDWA 1LQ2A 3UCCA 3C2OA 1SYTA 3M5ZA 4AMAA 4IMAA 4KF1A 4AY7A 3FYOA 1YTDA 3UP8A 1VYRA 5I03A 2J7EA 1PIGA 3U9IA 1US3A 1QO2A 2ABAA 2NVCA 3EWZA 1OFAA 3TK7A 3TFCA 2CBIA 4JIEA 3GB6A 1XIBA 4FF7A 4JFUA 5G2WA 5HNTA 3VGGA 4P7QA 2J9ZA 3UPWA 2GZXA 4NI3A 4GUJA 3SUSA 1MRAA 2VMFA 5K9XA 4EANA 2WZTA 4K68A 4XWUA 2CBVA 2QJMA 1GOKA 4ZO8A 3VM5A 2DZBA 5DQPA 4QRNA 2ZUWA 2PWGA 1JYWA 2OZTA 5E70A 1NQKA 5FA5A 4RUBA 4KCWA 3AXKA 1BYCA 4MOZA 4RLIA 1XKYA 1L2UA 1OD8A 2NQLA 3WLLA 4JAWA 1W3KA 3CEPA 4GXMA 4P7NA 4PFHA 3RPMA 1TA3B 3VK5A 1LRNA 1J11A 3LSBA 6ALDA 3O6DA 3NQ8A 3GW3A 5DLCA 3SJ3A 2YL8A 4YXGA 3A4XA 4EAYA 2BASA 3MHFA 2WSKA 4TMBA 2DQXA 2R8WA 1W54A 3ABQA 1CXIA 3WIJA 1MQPA 1XQKA 1LM1A 5E0KA 1EP1A 1W3IA 2HE5A 2GWNA 3WYZA 2VGFA 1K6AA 3N15A 1E3XA 2Y4SA 3PBVA 4AHOA 1N82A 2NT1A 3BCDA 2TAAA 5AECA 3EXRA 3N17A 3KS6A 4DPQA 4MIMA 4MJ4A 1B3VA 2OO6A 1G9HA 3N25A 3TP4A 3IJQA 3R58A 3MVTA 3NG3A 5HMEA 3C2VA 4OV4A 3BG5A 4PGLA 3VIFA 1OY0A 4M29A 3WJWA 2IKHA 3LPGA 3B0UX 4BWLA 4CNPA 1K77A 4KWSA 1YADA 2D20A 2I9UA 1TWWA 3TV8A 4A2SA 4DY1A 2VCBA 4KCVA 1VBRA 3VIPA 5C5YA 3WDIA 4CCZA 1KO0A 2I9EA 4PCFA 4NRRA 3EX6A 1NAL1 1PX3A 3S0CA 3T55A 1XGEA 1FFQA 1VPQA 4GGHA 2GK1B 4Q4MA 2BY2A 1QRQA 3W7DA 4FNTA 1WAWA 4DF2A 3W71A 1D3HA 3URBA 4D8ZA 4HMEA 2DZAA 1HX0A 3GDRA 1XS2A 3ZR6A 1OD0A 3CPRA 9CGTA 2DUAA 5CLTA 5BXPA 1JR1A 3GVQA 4GXWA 2BHYA 4DUXA 1LDCA 2W61A 1XSIA 1XDJA 3B8VA 3AIEA 5GJMA 3T42A 3LTPA 3UXAA 4QSFA 3FXYA 4B2DA 2GJXB 1KRMA 1OFPA 1IF2A 1W9XA 3QFEA 2JF7A 3U3HA 3N73A 3W84A 5CPQA 1TRIA 3T09A 3S1WA 1W3NA 1DWJM 3HV8A 3B4YA 3VILA 3RR1A 1OZQA 2NVDA 2DU2A 3ZOAA 4UTJA 1TV8A 4JDBA 1GPFA 3RMEA 1BXNA 4BK9A 4TU1A 2OKOA 1R5YA 2ON3A 3CYVA 1BYBA 3BSGA 3H8AA 4YS1A 1JPMA 3PAOA 4HPGA 4JFWA 3MKCA 1SFTA 4P7LA 4LQ1A 3MUCA 3WMCA 3WO8A 5RUBA 1PTDA 2NWRA 4GZ7A 3KBWA 1OG0A 1LZOA 3LBMA 4GX9A 4N42A 4PUUA 1YDYA 3F4WA 2HDJA 1C7TA 4XUGA 2EPLX 3AICA 1SJBA 4H8UA 3VD4A 1UD8A 4LW7A 1NM9A 1WOAA 1TX0A 3EZ4A 1QNPA 3BAXA 1V6WA 1KCKA 2RDUA 4D6DA 4HSOA 3UY8A 2UY5A 2PC8A 2QDEA 1Q2RA 1E6SM 1XYCA 4Q7NA 1HT6A 2JBMA 5F4SA 1JYXA 3O63A 1U5JA 1R3TA 1OCNA 4C6CA 4B4HA 3OZPA 4FA3A 4DUWA 1RR2A 5AHMA 5HA7A 3TTSA 3CT2A 4JQAA 1YRRA 5D9MA 2J47A 3E02A 3UZYA 1KBIA 2C19A 3FY1A 3FAWA 4Z1BA 3GDMA 3QBUA 5H6HA 3DX5A 1JI2A 2WHMA 2FHCA 3FEMA 4H6KA 3T81A 3SUWA 1I2OA 3P82A 2G8ZA 5EMMA 1OG6A 1TUFA 1DJNA 4GK8A 4YIWA 2PWHA 1F07A 4XIMA 4QLKA 4TUFA 3S47A 1QOPA 1VEPA 4QEHA 1DXEA 1VC4A 2ZX8A 3WH9A 1XYBA 1MUWA 2Q01A 2RH9A 2YLLA 4UZSA 4UMBA 4CQCA 2PDYA 3UY7A 4J3XA 4AMCA 2QMJA 1J8VA 2DUXA 1IT8A 3TSBA 2A3BA 4H01A 3AU2A 2QVHA 4JD4A 4QBXA 1SFLA 1QCWA 2QLYA 3FX4A 1EJ7L 3PFRA 4Y96A 2ATMA 4PMYA 4FLSA 4UCGA 3MT1A 3QY7A 2YPIA 4NASA 3B8SA 2TODA 1Q6OA 5AHFA 2D24A 4JGDA 1Q7QA 1Q4WA 3MUXA 4JX5A 4WD0A 1JAEA 3LU2A 2C14A 1GVYA 5AC6A 4PC8A 1OCJA 1NDVA 5EGRA 2Y70A 3R94A 4DQWA 4MAVA 4GISA 5A5WA 3AJXA 1XLDA 2WW5A 3DGRA 5HJLA 3PZQA 3QV6A 3RN6A 4EE9A 1D2KA 2V81A 1XDMA 3R89A 1UKSA 4KIRA 1E0UA 4EPDC 3NQ2A 3IACA 2H9AB 1ZU8A 1AZ1A 1TE6A 1UUOA 4GO9A 3W7OA 3CO8A 1IGSA 3CMGA 3BAKA 2XINA 1SFSA 5DY3A 1EYWA 1EX1A 5LNSA 3VDCA 3A3WA 5D2VA 5FF0A 3GUWA 1F05A 2Y8KA 4IPPA 4Z2IA 1Q45A 3EX2A 2BY3A 1JDCA 2E7FA 4QJ5B 2C1GA 5ECUA 3VX1A 2AQWA 3WBWA 5HUPA 1CXHA 2WANA 5C8BB 4YTRA 3G1AA 1A5UA 3VUPA 1XCXA 4GQQA 4MPKA 4AEFA 4AX7A 2E3ZA 3GTNA 4R88A 3IIXA 1Q85A 2Z2AA 2WVVB 4M6UA 1TMQA 4IXXA 2QF8A 4GVHA 1XHGA 2H8ZA 1UWAA 2C1HA 3B8UA 4A2RA 2J9YA 4DLMA 1WA3A 1Q7MA 1CT5A 3GNRA 2FVMA 1NSJA 5B7YA 3NL2A 4ZGYA 2GQAA 1K8ZA 4MZ8A 4U4MA 3MCNA 1KXVA 3KRZA 1U2YA 1LG1A 1UQZA 3GSMA 4NZJA 3S6DA 3OBKA 2EF9A 9XIMA 5CCZA 4MFEA 2XH7A 2VNCA 1X7FA 2HBVA 4DLFA 3G1YA 1YKWA 2YOCA 1O4UA 4CD8A 1VJSA 3HGOA 2E6AA 1V4YA 1EQPA 5BWAA 2OKTA 3N9RA 5IDIA 4LVGA 1FXPA 4WSJA 3EB2A 2X09A 3SIMA 3L9CA 4ACZB 5H2ZA 1VGAA 1ALDA 3MO7A 5CPMA 3UWZA 1DWAM 1HN1A 1BTMA 1JG9A 3MYPA 4TTGA 2XFWA 4LC8A 3EBVA 3FIGA 5E9XA 5AYBA 4J35A 1HFBA 3WNPA 3G5EA 2C71A 3JR2A 1EBHA 4JQ1A 1AH4A 4HPJA 3HG2A 3AZSA 3URNA 1OINA 3CK5A 4ILSA 1OJXA 1CLVA 1O95A 2UBPC 2OPJA 4MDOA 1PKNA 2YR1A 4FZIA 4JHMA 3TXZA 3TWBA 1XBZA 1PHWA 1FH7A 1DOSA 5FD0A 4O57A 3FV9A 2O0TA 2EGZA 4Q4RA 3MANA 4CD7A 2I5GA 1WQ5A 2GJPA 3BOXA 3OLIA 1JCLA 3I7RA 3OJGA 4Q8UA 4DO4A 4Y6GA 5HMFA 3THQA 3DG3A 3ALGA 2AKMA 3CU2A 1XH2A 1XSJA 4NNAA 1GW1A 4NJHA 1QBAA 4GYPA 4WGHA 3OYZA 1Z41A 3VIGA 3P60A 3W7PA 2GSJA 4H9TA 5C9ZA 2X0YA 4HA0A 1S2AA 5LNRA 1O7AA 5I3GA 4O54A 2PTZA 3M6DA 4WK9A 2WO5A 3NQBA 4RKAA 3PTMA 5HQMA 1OB0A 2BGQA 3BLEA 3E38A 1FXQA 3W01A 1DP0A 3N2XA 2PDMA 1PBGA 4HNUA 3UG8A 2VFFA 2IPFA 2DW6A 1W9UA 1CGXA 3GIPA 5CZTA 4ERAA 2V69A 1KA9F 4Z17A 1AODA 5I78A 1IQ8A 3QQ1A 1VD6A 4ZFCA 1D9EA 4N4PA 1EA9C 1A0DA 4QX4A 4MDPA 2X41A 1ZBCA 1H7OA 4DYEA 1D3CA 3EOLA 3HIJA 1O66A 4Q8NA 3TQVA 5D02A 3FJ4A 4KPLA 3RIKA 4O10A 5DBUA 1JRCA 3KCLA 3CPGA 3GM8A 1OK6A 2WJZA 3M0JA 4S3GA 1UR9A 3C0LA 3VOCA 1W9PA 1XLGA 5AZ0A 2FPTA 2PRLA 1Q6LA 5KITA 1W5PA 2QCNA 4GQRA 2I7GA 4ZB2A 2CLPA 3UJRA 1G5AA 3KRBA 4EP8C 2F2KA 4C6OA 4IISA 1PDZA 2YCJA 3BGGA 1WOBA 4G1KA 2G96A 5M2FX 4NZFA 5LNVA 4RNJA 4A8LA 3WJXA 1GONA 1ZP3A 2CBJA 4KEUA 3EX3A 4DO5A 5ABHA 1YTKA 3SURA 4DWSD 2OO0A 1E6ZA 3UXIA 3DCPA 4F2UA 3W1TA 4J2PA 4HOWA 1C93A 1P48A 2WM1A 3SECA 2AGTA 1AL8A 3ZSTA 3QJAA 1O1ZA 1CI1A 1OGBA 3EA3A 2W91A 3LK6A 2GOUA 3TAOA 1JF6A 5XIAA 4GZJA 3ZT7A 2NV9A 2X0HA 2FPYA 3N34A 4AISA 5HR6A 3B4UA 3B8DA 4CGTA 1VKFA 3NQMA 2Y88A 2RUSA 5AYYA 1OF6A 4HT3A 1U1HA 4Z1DA 2QCFA 2I14A 4UTKA 3ES8A 3Q94A 3N2BA 3VCRA 5JH2A 2CHRA 2ZQ0A 1YW1A 1MEHA 4B91A 1PV8A 2VOMA 3QOMA 5HJYA 1N2VA 3BW3A 3WQDA 2CLFA 3VXGA 4LYPA 3BQ6A 1LLZA 3UZXA 3TONA 4O1BA 1IXOA 4CCEA 1L0PA 5I3JA 1S5WA 3L2MA 3U48A 3B05A 3IGHX 2YW4A 1F6KA 3OPSA 4JTFA 3U7BA 1AW5A 1MNSA 3CHCA 3FKKA 1F6YA 3BAJA 1R47A 4RZ5A 4D8LA 4GACA 4D8AA 4J3VA 3FSTA 4HQVA 4JN6A 4GVIA 3LCLA 4S1FA 2WXDM 3BV4A 2DSKA 3GIYA 2YZ5A 3N9KA 4NJJA 4DXXA 1VRXA 1QWGA 2P5NA 1S2CA 1LT7A 3PTKA 3LENA 3S83A 3POCA 4GJ1A 4WXYA 4NL1A 2A79A 4AZGA 5C7VA 4BCEA 1RY8A 4L65A 5L9FA 2OOGA 4JNZA 1EWEA 3FJNA 4S3KA 4H6QA 4CVUA 3PBWA 4Z1YA 3CIXA 3B9EA 3NZGA 4JNYA 4OQVA 3WF1A 4O1FA 4AF0A 1WXJA 1Z48A 2QGHA 4JS3A 2FMNA 2WKGA 3KBVA 2J6XA 4JIHA 1Q3NA 2Y8VA 1A5BA 2E6FA 1RD5A 1O60A 4XTDA 1U5VA 3P2VA 4J5NA 2Q71A 1KGUA 3OLGA 3WFLA 3F4VA 4E4UA 1FHLA 2HWGA 2WV8A 3D47A 3VU2A 1QHOA 4NHVA 2VVSA 4PTMA 1JCTA 3FS2A 1KXHA 1H1ZA 1LROA 3P8IA 3TW9A 5FEPA 4WDXA 2JALA 3IGSA 5CLWA 4C60A 1KM4A 3F2BA 3LGDA 1CNVA 3P3BA 4IH3A 3CL7A 4IIHA 3WQ5A 3IRDA 1V0NA 3CMJA 4AVFA 4FNRA 2WOQA 2YZRA 2DUZA 3U5UA 3N04A 3VCCA 1DWHM 3E12A 4IZGA 2MNRA 3EGJA 4O4VA 1KQYA 3TMLA 3NQ6A 3SGUA 3TJ4A 2E67A 3UR5A 1NH6A 4GHRA 3D3AA 5DN1A 4I8YA 2ZA1A 2BFGA 4HPNA 2PPGA 1KBJA 2EKCA 3W1PA 4LH8A 5LIKX 3ES7A 1EHNA 2FLIA 4DB7A 1QPNA 4R27A 2PUZA 2W92A 5EL1A 4QDMA 1BHGA 4BQ4A 5F4WA 3DI1A 4XUYA 2GGGA 3IIPA 1KXQA 4IL2A 1NJJA 3ZJ8A 3R13A 1XICA 2OWCA 4UQEA 3AZRA 4JKKA 1EJUC 4DJEA 3U0HA 4GY1A 3MV01 3W38A 3W27A 1PXGA 3CUIA 2NLIA 4Y7EA 4L64A 1EA0A 2ZUNA 1EJXC 5D32A 3QPYA 4GG9A 5TIMA 3NA8A 3N2CA 2A7RA 3U8GA 2CNCA 1ITQA 4P8UA 2FZBA 2V5JA 4LAZA 4E38A 4HCLA 3P61A 4MWAB 4B5WA 3T08A 2PWFA 3W7RA 1LBLA 3SGZA 4IPJA 3QGVA 1K3UA 5D2YA 1JGMA 2V2CA 1HKVA 1PIFA 2YCLB 5M03A 1UD6A 4ZO6A 1YXDA 3QSRA 2CEQA 4BEUA 2WSPA 3UBPC 4JIPA 4CCDA 2BDQA 2GK1A 1TWDA 3CM4A 3S1UA 3A9BA 3GBEA 2W3ZA 3VMNA 1WKEA 4KRTA 1WDSA 1KCZA 3UA3A 2D0GA 1R3WA 3TJIA 1GVIA 3QZ6A 3N9SA 5G2HA 5A3HA 2DH3A 1Z89A 1XLFA 4YLWA 4ROQA 3VDGA 4Q8PA 2ZE3A 3CZEA 1SZFA 1DWIM 3D46A 3KHDA 3AIRA 3TAKA 4LV4A 1PL9A 4QE1A 4DWSA 3B9AA 4JTAA 2J7CA 3LMYA 5F2IA 3U2EA 3L0NA 1A5MC 4ZOEA 2BXYA 3G0UA 3ATYA 3ARPA 1PX4A 3LNPA 1YDVA 1SPQA 4MY9A 1W5OA 4KH2A 1E0TA 4GPNA 2NUYA 4HNNA 2C13A 1J0HA 4M1BA 1UP0A 1BXBA 2OZ0A 5BXTA 2ZRYA 1P0EA 1X97A 3GTIA 5KZEA 2UY3A 4L1WA 3R8GA 4H3DA 3I4KA 3VE7A 4IWWA 2GOKA 2PGEA 3W7LA 2X1SA 4DM2A 2EPMX 2EKGA 1KWKA 3W1NA 1RVKA 5HMDA 1C8VA 5GQBA 3GDBA 4KFNA 3BSHA 5CEWA 3OLEA 4S2CA 1XCWA 3NPXA 3UGVA 3CZKA 3LS9A 4AWTA 4K36A 1EJTC 1ONEA 4E2BA 2X1RA 5AC8A 2GYIA 2O9OA 3WX7A 1TSIA 3V4BA 1OX5A 1CENA 7REQB 4OHQA 1JDAA 1I0BA 2PWUA 1NOFA 4XO7A 5FIPA 3EYPA 3ARQA 1HGYA 4ZOAA 3FVDA 2UV8G 4KW2A 3IJ6A 3QPEA 1H61A 1LUCA 4CNTA 1A4LA 3KX6A 4LUTA 4C91A 3M41A 2WMHA 4AEEA 4K1GA 4Z2LA 3UJEA 3MC5A 2Y6ZA 3PZUA 4B3KA 4HHMA 3V35A 1OT2A 2HSAA 4J7RA 1VFTA 2D2OA 2E4TA 5IFPA 3QGKC 2EQDA 5K4XA 5G1YA 2VI0A 3QFWA 1MZRA 4QJ4B 1KGXA 2XISA 2ZUSA 3W02A 3COTA 1MRQA 3N2MA 4WCJA 1OFOA 1EWDA 3GTXA 1BG9A 1TPH1 3MUAA 1SO5A 4M0XA 5CSUA 2KX9A 4BEQA 1ZUAX 3K13A 1MO0A 5CXPA 4G56A 3WH8A 3CWHA 3GXFA 4B3LA 4JTLA 3GZ3A 5GPRA 5DELA 1VFOA 3SM0A 4PCPA 1JCMP 1V0LA 2FGZA 1ZP4A 3TIMA 3H26A 3NFUA 2BMBA 5AYZA 3VX0A 1OIMA 3WDPP 3DI0A 2PCQA 3I68A 5H91A 4AVNA 1IEIA 3PZ9A 3N14A 2ACUA 2PDNA 3INPA 2B7NA 1TQJA 3CIWA 4L4PA 3AIBA 1L6FA 2VRJA 2NXHA 1AD1A 2NX3A 2QR6A 1WZKA 2GUUA 1CB7B 4RE3A 1ZZMA 3G1DA 3WNLA 3GVVA 3F2DA 4YCOA 2VFHA 3SAZA 1M3UA 1N8FA 2XJ7A 4MB3A 3WD0A 4ATDA 5K7JA 1ICSA 1RLDA 4E4FA 3EAUA 3RMJA 1VFUA 3GXPA 3U4FA 3P84A 1A80A 3G18A 2WJEA 1E73M 4MGGA 4IMCA 3W22A 2J24A 4ZCWA 1JYVA 3PK7A 3W53A 1QVBA 4BWLC 3C0QA 3FDKA 1RK6A 4UOZA 5IFTA 1E6XM 1XD1A 1XYLA 3TW6A 1V3JA 3L23A 3GHSA 1PUDA 2FHBA 1KTNA 3CPUA 1GTHA 4DHGA 2QAFA 3E2VA 3NZPA 4RX0A 3BJTA 5A8QA 5CQ1A 4UTUA 2PLMA 4WF7A 4J40A 4QISA 2WK2A 3C2YA 4I5XA 3Q58A 3R2GA 4Z08A 4LAOA 2POTA 4PL2A 1W56A 1YHTA 5DCDA 1R30A 2V67A 2GFTA 5KSWA 3BUVA 4GLEA 2PDQA 4LANA 3WJZA 2QJGA 4KERA 4CD5A 4JXCA 1GYMA 1KFCA 1SMDA 3RU8X 5BU9A 1XCFA 1ELSA 1H2JA 3EPMA 1HO4A 3CAKA 1XPYA 1LBMA 1MW0A 4NYYA 4WR3A 3VIOA 1JEZA 2YIHA 1QNRA 2CU0A 4F3HA 2Z00A 4YU1A 4NSBA 4LVBA 1JAKA 3SUVA 3SCTA 2H90A 1PPIA 1ZRQA 1FWEC 2R82A 3OVQA 5A8GA 3PBMA 4JKLA 5BOOA 2ZRUA 3M07A 4V1XA 3GH4A 3LY0A 4O11A 3PR2A 4B2DD 4UFKA 5LNWA 1MZHA 2W9MA 4Q4PA 1K9EA 3GNOA 4NUWA 2HS6A 5HDRA 5GJNA 1LORA 1AL7A 1HL2A 1E0VA 5HPCA 2ZXQA 3DYMA 3P6LA 4D6HA 1FFRA 1I2NA 3LYEA 4B9YA 2W63A 3M7SA 3K2GA 3I65A 4Q8QA 4K8EA 2NV2A 1GOWA 3LXCA 5FJTA 1VLIA 5I09A 2INFA 4ZMGA 5CZKA 4XG1A 3GY1A 4I7UA 3AS3A 3BCFA 4YMZA 3ALFA 5XIMA 1XRTA 4K8GA 2BHUA 1VCGA 1PHQA 1UA3A 2V3DA 3GR7A 3UG4A 3VNLA 3ZT6A 2QULA 3ABSA 2WZIA 1HG3A 3PN8A 2G0WA 2FZDA 5JIWA 4JTIA 3DG6A 4PEEA 4C6LA 3FA4A 1DIEA 2A3LA 1XLCA 2ESCA 1UZDA 4KWWA 1ZCOA 4HN4A 5AY7A 3FEQA 1XD0A 3VO0A 1R46A 2A1YA 3BG3A 5DCBA 4J27A 3TH6A 2ZFAA 4J28A 5I5RA 1UP3A 5F7UA 4F9JA 1FWFC 1OX4A 4L5ZA 3WQ6A 2CZDA 2VEIA 3ARUA 4IJCA 4H9XA 1E5JA 3LHWA 2HISA 2A2IA 9XIAA 4UTTA 1CTNA 3I3EA 3B8WA 4XKYA 1Z42A 5A6LA 3HN3A 1W37A 2YLAA 1W2PA 4QCFA 1XLBA 1REQA 3CZLA 1R3SA 3JVAA 1LLWA 1CGVA 3A4AA 4WSHA 4Q6JA 3C2RA 3WLJA 3GD6A 5FKYA 2WMKA 3N1AA 4N7QA 1WYIA 4IFKB 1IWBA 3QR1A 4DBEA 3AU6A 3N29A 2CFFA 4DJEC 1GPWA 2D2HA 2X0SA 3CGTA 4H2CA 4OWGA 3H24A 5EMKA 4UQ9A 2YCKX 3W82A 1YTEA 4QP0A 1M5WA 1U22A 3QZEA 1SR0A 4JYDA 2PDXA 1A47A 1J01A 3GIQA 4AAJA 4K37A 4F66A 3LD5A 2IMRA 3AHZA 1T8QA 3PB0A 3LHVA 1R8LA 3HGSA 2X1IA 2A3AA 1EJVC 3WH5A 3HFTA 3WLNA 1VENA 4M3PA 1PB0A 2XGZA 1MDLA 5TF0A 3S2LA 2QJNA 1QPRA 1PAMA 3E2SA 2R94A 3LHUA 5IDZA 4IP5A 1F5ZA 4E4PA 5I02A 4GJIA 4PMNA 3EWWA 4IIDA 1H4PA 4Q7BA 1H1NA 4L9YA 3T0BA 4NZ5A 4GH3A 3M0KA 3AZTA 2VHLA 3TMQA 3W7NA 4B90A 5XINA 4YHEA 3PG9A 4JY9A 1K4GA 2PSNA 2F8QA 3IVUA 1LWIA 1C29A 2G41A 5EMJA 2WNQA 1HKWA 3F5JA 2EG6A 4NVTA 1ECEA 2WHKA 2XH2A 4H04A 4DAIA 2BXZA 1GNXA 5DT5A 3KZSA 2NWSA 3W88A 2FZNA 3B9DA 3V16A 5C2CA 1PKMA 1LT8A 4ENLA 3I6TA 3WLQA 3IIVA 5C7HA 3UA4A 3FK4A 5BXSA 5M5DA 4ZQNA 2QDGA 4DN1A 4UUIA 2CLKA 3OA5A 1XWYA 5I07A 5ABEA 4C7FA 1JUEA 2DZPA 5F2MA 2Y63A 3MSYA 1JXKA 4CQAA 4RV8A 3STPA 5HPOA 3VVGA 2HROA 4NAFA 3NEVA 4PBEA 4J3TA 1YPIA 2GVJA 2DT0A 1JRBA 1AJ2A 1U33A 5D8ZA 1HKIA 1V7YA 1RBLA 2XSXA 3EDKA 1JF5A 3ZXWA 3BK0A 4AC1X 3I7QA 3ZWSA 1MYRA 1SFJA 4LRTA 4PMZA 3W6LA 2FKPA 1HTIA 3E2RA 3H55A 4HHHA 2PDUA 4WIWA 3V3WA 4PCTA 3GXTA 1O5QA 2PODA 2QYGA 4C5YA 3RLHA 3EPOA 3VGBA 1EX5A 3MYOA 3SRKA 1K8CA 4OOZA 3THAA 2VC7A 1VFFA 3VMPA 3ITVA 2EXOA 1OCBA 1H5YA 3L4UA 3AMDA 2VDIA 2D22A 2CLHA 3RU6A 4MKNA 3NSMA 3BCJA 1JQVA 3AYRA 1WKFA 3V75A 3ENLA 1NDWA 5DBTA 1VBJA 1SW0A 1MQQA 3DFSA 3T0TA 5A8NA 2AMXA 4OBRA 4AWSA 4OBSA 4GQ0A 3IAQA 3BL3A 3CZJA 1CIUA 2WAGA 4GINA 1J0IA 4WGXA 4BI5A 1EUNA 4KWUA 4IFRA 2BP1A 1Y65A 3IVSA 5U4NA 3ANVA 4I8DA 2D0FA 4EOUA 3SRDA 4MNJA 4KIEA 1C9DA 4AIEA 1A0CA 2WB5A 1P6CA 1UYQA 3SN0A 3R4IA 2HNEA 3CH0A 1Q63A 1GW9A 3W1LA 3FSUA 5E1QA 3OGVA 3W7QA 4MNKA 1C90A 4BR1A 3M43A 3WJSA 4KFPA 3PBYA 2OLAA 1ONWA 2POZA 3UJ2A 4HJFA 3T0DA 1B90A 2Y62A 1GKQA 2ZRVA 4I7WA 1X1NA 1UZHA 4XZWA 3USBA 2WLYA 4DNHA 4H8HA 1J0JA 3LPPA 3U57A 3GXNA 4C6FA 3CTTA 3WY1A 1W1B1 2D73A 3GZAA 3C2EA 1RUSA 3CUHA 1ODUA 4JZ5A 1XR2A 4X61A 4FX6M 3CB3A 1Q6QA 4GUFA 2JK2A 4AZCB 3HTWA 4DBSA 3MCOA 1ZGDA 2PI6A 4F0RA 1E1CA 2BODX 1E15A 1DTNA 3FN9A 3CLMA 5HATA 1KKOA 1H7XA 5E93A 4Z0SA 2VL4A 3FGCB 5HK4A 2YDAA 3TFXA 3STFA 2QGYA 2JGYA 3ZJ6A 3L65A 3EMCA 4EACA 3CHDA 2QJJA 1QW8A 4DXVA 4I5RA 2J77A 1OCQA 4PFMA 4DI9A 2FFIA 1JVNA 1IWPA 2D3NA 2DSUA 3TLLA 3GHRA 1R7AA 2E8YA 3KP1A 3NQVA 3CYJA 4X22A 3ZR5A 2A85A 4XAPA 2QHAA 2V6AA 3ZJKA 1EGVA 3JS3A 4HK7A 5EMLA 3S6TA 1PWMA 2ZUMA 2C7FA 1ZPTA 5JQ9A 3T6CA 2DSWA 1S3HA 2E09A 2B31A 4Q32A 1UKTA 1P7TB 4GOAA 4GBDA 1XINA 4J2MA 7XIMA 3T4WA 3TR9A 1XRSA 2HCVA 2BBFA 3W9ZA 4C90A 2FHFA 1E43A 1UMLA 1WZLA 4PUMA 2DGAA 3LHYA 4N9BA 2PA6A 3BO9A 1ICQA 3S46A 1AMKA 3CT7A 5HINA 3KLLA 3ARXA 4M51A 4WLCA 4JKMA 4HA4A 1H5VA 3RNDA 1PVNA 2OWXA 4C6BA 1EEPA 3VDHA 1Q5MA 3VA8A 3IGXA 1WBJA 4GUHA 5DMNA 4MB1A 4LYKA 3AFBA 1FWWA 4FX8A 2GGHA 4AZCA 3OYXA 3ANYA 5BWFA 2JEQA 3GDKA 3CQ0A 3H4XA 4G9PA 2QV5A 4QQ3A 3RF9A 1ESWA 3WQ4A 2O7QA 3V1HA 3L4TA 3GWQA 4UXDA 4GY0A 3CNYA 5FESA 2QDHA 5A6KA 3K4AA 4A3UA 4JHZA 3SDOA 3XINA 3PJTA 4LS2A 8XIMA 2VFEA 3ABXA 2PDPA 5KZ6A 3HB9A 1OSEA 3DHFA 4PN2A 2NX9A 3DHUA 1GJWA 4HK6A 1G69A 1HP4A 3HG3A 4AEOA 2OSXA 5KEZA 5BZAA 5JIPA 1OHLA 3WD2A 3KDOA 1JPDX 5D37A 3HPFA 3W29A 4AIOA 4JTUA 2ZOXA 3KOXA 4FS9A 3G1FA 1O6IA 4DF1A 4MKSA 3IJ7A 3ITYA 3M1ZA 5DMYA 4P5UA 1ZTVA 3WNKA 3UT0A 3GYEA 3N11A 2VC9A 4C6JA 5FJUA 2RFGA 3KZPA 5DXXA 3M0IA 1HKKA 4H2HA 3JU2A 3B06A 1FWNA 3CAVA 4ICMA 2J7DA 3QQ0A 3MHUA 3K4DA 1LJYA 4GO8A 3CMFA 3TROA 3KBSA 3KBNA 2VQUA 3W2JA 4YCPA 4S38A 3FYPA 4DO6A 4PTNA 3WQ8A 3PSWA 1M7OA 2VZTA 1QAPA 4B5SA 3PZIA 4Y90A 3SN4A 4MVAA 2YGYA 4LNCA 2WQDA 3TN6A 3POHA 2QCCA 5IM51 2BXVA 3C56A 1YDNA 3APYA 3DGBA 3NGJA 3STCA 4OTKA 4IIEA 2VWSA 2Q02A 1H0IA 3P5ZA 2XIMA 5AYXA 1VH7A 3HQPA 3SZ8A 3N4AA 3SSJA 4R5EA 4DZ5A 3W00A 3EDDA 3WCZA 5JU6A 1OWQA 2KZHA 2OLHA 3W75A 4GNVA 3GFXA 3MMDA 3SB0A 4RNHA 4PRRA 2ISDA 5JVLA 3ZM8A 1DJZA 1GVSA 3KBJA 2AAMA 5FJJA 2OX4A 1Y8BA 1E1EA 3OGSA 2GQ9A 4RE0A 1PEZA 1PTGA 1E4LA 2PGRA 5J5RA 3HF3A 4DZAA 4FO4A 4EWND 3JRKA 1FH8A 2ACQA 4L4LA 4W9TA 4XZIA 3AJ7A 3S5ZA 2GDUA 4W8BA 1ZAHA 3F2CA 2Z26A 3E0IA 3QLLA 4RE4A 1UWSA 4C6IA 3AIQA 2BVWA 3E6EA 4Z42C 1E51A 2QAPA 1JI1A 4BF7A 1I8JA 1V6UA 5SWUA 1GVRA 1FCQA 2PWDA 3GTFA 2VDHA 2P3EA 3DERA 2VZOA 1TV4A 4U2YA 4FPSA 4WY0A 5BRQA 4XK2A 1VBUA 1DJIA 2DEPA 3WH6A 2IPGA 3W83A 4ZODA 1OFRA 3WQOA 3H7VA 1GEHA 2V82A 1R86A 3PZMA 1RK5A 4N9CA 1J18A 3WQWA 4PUKA 1WUEA 1TWSA 1QFEA 1W31A 1EDTA 2YCIX 1X6UA 1LG2A 3NDZA 5DX7A 1TJPA 4FEZA 3VOGA 3RJYA 4ADTA 3MVIA 3LCFA 4I9MA 2Q8LA 5REQB 4MWAA 3B40A 3GS6A 3A4WA 4JQ3A 4AXNA 4JHOA 3NPWA 2WSYA 2X2YA 1SO4A 5M1TA 4RXGA 1HUVA 2YBTA 3VDBA 1OZMA 4HU4A 1ISWA 3S5NA 3CL6A 2REQB 4RR4A 3II1A 2CZ5A 1XL9A 3CH9A 3DUGA 2G3JA 3S1VA 5DMLA 1P6WA 5HR7A 2ZXDA 2X30A 4JYEA 2PEVA 1UR0A 3C8NA 4GD0A 3VD3A 2VOTA 5AYIA 3DBNA 1TREA 2J88A 5FSDC 3HMJG 4NJGA 2JF6A 1NOWA 2FPVA 2XWDA 4A3RA 2PLJA 4ALDA 4HCDA 2PC4A 3MHGA 4Q4OA 1B3YA 4E8GA 4O13A 2C16A 2VYOA 4A8IA 4FI4A 4Q6XA 1KM6A 4ML4A 2OSWA 2RDTA 5U7SA 4NAEA 1BKHA 3W2LA 4AD2A 3UXKA 1SZGA 4IX2A 3WF0A 4IP4A 3BQ5A 4WRHA 4GABA 2QCGA 3SQSA 1WP6A 1CLKA 1SVDA 1DYSA 3HM7A 3J7HA 2YYUA 3FNDA 3VC6A 1YXYA 3TTOA 3GE7A 3IK4A 3UR2A 1RZMA 1EUAA 1OFDA 3L21A 3HBLA 2G50A 1XP3A 3AWOA 1LL7A 3QY8A 4LJ3A 1BYDA 2QCEA 1NVMA 1XQLA 4UCFA 2CLLA 4HMNA 3NUKA 2RHGA 3EPNA 1QHZA 2ZDRA 3L4VA 3VKDA 4H9YA 5A6BA 3AMKA 5F4XA 4ZQRA 3T78A 2FZ8A 3OEXA 5IXEA 1X8FA 3M6YA 2X42A 1TIWA 3BTNA 3D5HA 4KFOA 1B30A 2R24A 5HULA 1TR9A 3MCMA 3STEA 4A29A 3ORWA 4AU0A 4UWMA 2BNJA 1MNZA 1NFPA 2VGGA 3T4CA 2XPKA 4W85A 5EB8A 1YNQA 1QOXA 1KV8A 4WKHA 3VFCA 1A5LC 2LLEA 1BAGA 4JOMA 2D23A 1R87A 1FWJC 2G37A 5TQLA 5BXRA 3M0YA 1UHVA 3QYSA 2VT0A 1BFNA 2PTWA 3LRKA 3KWXA 4DZIA 3M0LA 4ZQMA 3R5EA 1J96A 3AHVA 1UD5A 3RLUA 3GR8A 3URQA 1ZJIA 2ZKMX 1RCOB 3PF3A 2GJXA 4E5TA 2J8TA 4CU8A 3EWCA 9RUBA 4IIGA 2VCAA 4XV0A 1KFLA 1THFD 1TZZA 1UUQA 1GQKA 3UU0A 4JFVA 5IRPA 3ZIZA 1TJ1A 1W9BM 5I7GA 2J13A 1M7XA 4BQ3A 3C6CA 1I4NA 4DZHA 2Y7FA 3JZEA 3PUGA 2J9XA 3KTSA 4JTGA 4HHLA 4AY8A 1IWAA 1BWKA 2OZ3A 1EP2A 4N4QA 3VKJA 3N6HA 2XH0A 4BI7A 2G4FA 3QC0A 4RXFA 3G6LA 5GNZA 3NQDA 2IUZA 1RXOB 2L5HA 2XSBA 3WLKX 3SFWA 4C6DA 2DW7A 3BANA 2WQPA 3NXLA 4JCMA 4O50A 5CSRA 1YE4A 5HNNA 4PR4A 4MWAE 3TR2A 1KFBA 3SCNA 1G7UA 3GNDA 4E8CA 1PE1A 2Y89A 5FI8A 5HQEA 3KP0A 4DI8A 5CJNA 4A22A 3KUMA 1AW2A 3VI2A 4LALA 2PFHA 1R3YA 1XF0A 4A8NA 1FWBC 5TNVA 4LF2A 3W2KA 3OBEA 5HOSA 4D6IA 4JTKA 4EPKA 2WVSA 1Z44A 3ME3A 4GI4A 2B7PA 4H7ZA 4G8TA 2WSRA 5ABFB 3E0WA 3E0LA 2YFOA 1EC8A 4RNIA 1C3FA 2XVLA 3TYZA 3GO2A 1JDFA 4JTRA 2X1TA 1IXQA 2AL1A 1S2VA 4V1YA 3DFOA 2F84A 2WVUA 1F3XA 4AG0A 3C3NA 1F73A 2QPXA 5K4ZA 3IARA 5LGZA 2QEZA 3H7UA 1QWKA 1AJ0A 5I79A 1P43A 2OODA 5D30A 1H09A 5LIUX 3S42A 3VMOA 5F2GA 4UR8A 4D1IA 4D6JA 3ZWTA 1Q7ZA 3A24A 1LOLA 4IM4A 1FWDC 1FVPA 3AYSA 3RITA 4XZMX 2BHZA 2E9MA 4OUIA 2FH8A 3CASA 4LU0A 1TR1A 3FXGA 1C92A 4CKQA 5C2GA 2HPIA 2RGMA 5C71A 4S3FA 4NI8A 3U4AA 2GPTA 4YVPA 4ZE5A 3KVJA 3P67A 4GIYA 4UQCA 1J4EA 2DT1A 3WF2A 1DXIA 3L12A 2J78A 3HJZA 1US0A 3PBUA 3SO7A 2R1NA 4DEFA 4CQBA 5I00A 1XRFA 3MZNA 3O7UA 3QHNA 4O16A 3VNYA 4AYGA 1UD2A 4R34A 5TBOA 1E1FA 4Q4QA 6REQB 3K8LA 1WB0A 1XLIA 4DJDA 3H6OA 4IG2B 4ACYA 2WWDA 3VYLA 3NAVA 2CWNA 1GYLA 3MUIA 1M41A 1XXXA 3OLDA 3TC7A 3WEOA 1JPKA 3TSDA 3GG8A 1DE6A 2WPGA 3WQEA 1F4AA 1KRAC 2VX5A 5MF5A 1WKDA 3HZ3A 3AMGA 4B15A 3V0SA 2Z24A 1QNQA 4O53A 4LFYA 3FJLA 4OT7A 4PUNA 2BVYA 1Q6DA 1UMYA 3W76A 1AW1A 4Q22A 3ARZA 4QG8A 4W93A 4H8VA 5FL1A 2VZUA 3ITGA 3U7VA 3G1RA 4A8RA 4MYXA 4AZBA 4DJFC 3IK2A 3O15A 4HP5A 2CHNA 5A6JA 4DUVA 2FJKA 3LXBA 4Q8OA 2DY3A 4GCXA 1L9WA 1WX0A 2FZMA 1EIXA 1DQWA 1EB3A 2PWVA 2RDWA 1MDRA 3TLQA 4LAUA 1OX6A 4WKFA 4BZYA 4FR1A 4HNTA 1XIFA 1A3XA 4JTCA 1G0CA 1I2PA 1GTEA 5G4EA 3L4YA 1NIUA 4C6MA 3O6AA 1E6QM 1K6WA 3DFYA 2ZE0A 1K9TA 3TWAA 3V7PA 3LRLA 3DG7A 4HPHA 2ISWA 2ZZ2A 4F8XA 2WC7A 4U3CA 1I2RA 4X0VA 3CHFA 4JTDA 6XIMA