3W7EA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-5-179
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-5-179
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 107
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7eA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7eA01
3FKRA 4IMDA 1BWKA 4O4WA 3ELFA 3MBFA 1I2RA 3FS2A 1KFJA 4UTTC 1DJQA 2ZZ3A 3GVGA 2QCHA 4IXHA 2Y63A 3KVJA 4UTLA 5L6UA 3GDMA 1YADA 4H3DA 1I2QA 4O1AA 4PC8A 3SGUA 2ZTJA 4NXSA 3TAKA 5FF7A 1D9EA 3G1AA 2B7NA 2Y89A 3N3MA 4O0KA 1H63A 1FXQA 3STFA 3G3DA 3P5YA 3P7YA 2WQPA 2ZRWA 4EOUA 1TTQA 1OVDA 3W7DA 1LCOA 3KFTA 3S1UA 3HPXA 4HN4A 4UTKA 3B0VC 4K8EA 1A5BA 4K38A 3GK0A 1GTHA 4GUHA 1EIXA 1RQBA 5BW6A 1TQXA 2PC4A 4NXKA 1R2SA 1AG1O 3G0UA 1JQXA 1OX5A 1G4EA 5LHEA 5LNWA 1Q6LA 2E5BA 4AWSA 3A5VA 1Z41A 3GR8A 2A7PA 2ZZ5A 2QF7A 3G1FA 1XBXA 4AHQA 2XN1A 5CSRA 4O19A 5EBUA 3C2RA 4I9AA 1KBJA 1WDWA 3STGA 4POCA 3LGEA 4EWND 2JGYA 2QCMA 3E12A 1N55A 1Z48A 4AMAA 1A5SA 3A9IA 4PEKA 4AWUA 3GB6A 3STCA 2V2CA 3W2KA 1G4PA 2CZ5A 3HJZA 1WXJA 5HNRA 3NNTA 5FI8A 3B05A 5EPDA 3HG5A 3TMQA 3QQ0A 1IGSA 4CCCA 4JY9A 1KM2A 3EKZA 3L0KA 1K8YA 3TMLA 3P82A 1H7OA 2A1YA 4RXFA 5DBUA 2B0MA 5LNVA 4WY0F 2QUUA 3UZJA 5EY5A 3M5XA 4ORIA 1SU5A 2NLIA 3T78A 1L6SA 3QM3A 4HPXA 4EF9A 1SO6A 3V75A 2GVGA 3G1SA 2ZQ0A 4Z0SA 1DHPA 5K4XA 2B7OA 3R2GA 1ML1A 4WXYA 4A2SA 3N19B 2X1UA 2DZXA 2ZFAA 2QUTA 1H51A 3NL3A 4FIRA 4XTIA 5D33A 5KTLA 3UZ5A 1KW1A 1JCYA 3HG2A 1W8SA 4DXVA 2FB2A 2HMCA 3UYCA 2PURA 3DENA 1Z44A 1SPQA 3L5LA 3O16A 2Q3RA 4MLJA 3TFCA 3W3OA 5AB3A 3WK3A 1I8JA 2GJNA 4LRSA 1EP2A 1G4TA 2E77A 4M7TA 2H8ZA 2GQ8A 4GXMA 5D03A 3EWBX 2CLOA 3O06A 3O6DA 2BZNA 1TB3A 2C6QA 3R13A 4HIBA 4ZQMA 1LBFA 2GVJA 1AMKA 2QR6A 5AHLA 5TBOA 5KZMA 1YPFA 1XBVA 1ZALA 5H91A 2E6YA 4MY1A 2ZZ6A 1KFLA 4Q33A 1TMHA 1S3HA 3KVLA 3KHJA 3DU0A 1XDLA 3I6RA 4BI7A 4MY9A 4FXSA 3MI6A 1TYGA 2QCLA 3NXFA 5D30A 3NQVA 3QQ1A 2FQIA 4IX2A 3EX1A 3NOEA 2LLEA 1H61A 1FDYA 2IQTA 1AW5A 2A4AA 2YX0A 4FB7A 1I2NA 3WK0A 1X8FA 5LGXA 3CT7A 3QSTA 5D09A 3NG3A 2ALDA 4JD4A 1K8ZA 5HMSA 5BRBA 1QMLA 4JIPA 5CPOA 4Z1AA 4E0CA 2PRLA 1OJXA 2Z1BA 1WV2A 5AC7A 5FF2A 2WSYA 5CPLA 3N34A 3PG8A 1O94A 3DKJA 3L65A 3NDOA 3VI2A 1H7PA 1VPXA 1YYAA 2O7QA 4DBEA 3W2NA 1K03A 3PVFA 1K8XA 1LLZA 3GDKA 4UMCA 3MHUA 2ZBTA 5K9CA 3L21A 1MO0A 3MHFA 3EWWA 2JBMA 1R47A 3L0GA 3W6YA 3FYPA 1W5PA 2C0AA 4NNAA 4UTMA 2CLHA 4KFPA 1FCUA 3EWZA 2H3BA 2G5WA 4ADUA 3L9CA 3PG9A 1KTCA 2CLLA 3V1PA 1S5VA 3HIJA 3TW7A 4JEQA 4BF9A 1ONRA 1X6UA 1EUAA 3PSVA 3HPZA 2TSYA 3UD6A 3NL6A 2FTPA 3PUEA 4GBUA 4OGZA 1JCJA 4DO5A 3UXDA 3QSRA 1KTNA 3QYQA 4L4LA 1YDOA 1XCFA 3K30A 2C18A 3W76A 2WO5A 3UPWA 3OHIA 4WOZA 3C2FA 4NT0A 3M7WA 3T40A 1IXQA 4UFJA 4BFAA 1Q6OA 2QCDA 4MIMA 3GIYA 2DZTA 3CWOX 2X30A 1WQ5A 4M5PA 5K9DA 1YXCA 4X2RA 4FNQA 3W7OA 2V2DA 3NQ2A 5KMYA 3FEMA 2QJGA 1ICQA 3W2LA 3B8DA 1L6WA 1KLYA 2QDGA 3NM1A 1LRNA 3W84A 1DVJA 1F05A 3G1VA 4XZ9A 3LB0A 3VKJA 3FA5A 2Y88A 1QAPA 2ISWA 2VKZG 4QM1A 3O15A 2FJKA 5K3VA 5HINA 4DO6A 3RFAA 2FB3A 1KM3A 3MW7A 4O1CA 1LDCA 1PS9A 4WY0B 2V81A 4M6VA 5FEXA 4K39A 4B5NA 2VFHA 1L2UA 2BSLA 3BGGA 3GR7A 4JTLA 3H55A 2W0UA 3TXVA 1GZGA 1TTPA 4ZQNA 1OFOA 4ADTA 1VR6A 2A0NA 4XUGA 3NQGA 4JDBA 4O0ZA 3LXBA 1M5WA 2C1HA 3CIWA 3C8FA 3A23A 1XUUA 1K02A 4E38A 1C29A 4JTSA 5EKYA 1KV8A 2J9XA 4UCGA 5DELA 4JDYA 5J5DA 5IBXA 4UIOA 3DGRA 3S5YA 3GX9A 2FLIA 4A2RA 3NM3A 5E93A 4IGHA 2OZ0A 3SY5A 1OX4A 1Z42A 2WSRA 2QCFA 1TRIA 3GNDA 3LCIA 1NF0A 4NUWA 4NJGA 2EF9A 1VHCA 1A5AA 3CM4A 3TJXA 3C56A 2J9YA 3TE9A 1UCWA 4NNBA 1JCMP 2WOQA 4JYDA 3RLVA 4CNOA 3UNDA 1G6CA 2QAPA 3L66A 4TIMA 1KM4A 4N4PA 5FESA 4JTUA 4OHQA 2V8ZA 1Q6QA 3HB9A 4NQ1A 4R33A 5G4EA 3HGOA 4XBKA 1H7WA 2ZRZA 4WZHA 2HS8A 1X7FA 1HUVA 4D2JA 1BTMA 3LI0A 2BTMA 3DFQA 4KWVA 3S6DA 1F2JA 3NVTA 2Y85A 4AB4A 4I7UA 3W1UA 3MP3A 2RHGA 1FCVA 3GLCA 1H1ZA 5FEWA 1GVSA 5C2XA 2R14A 1JRCA 1OFPA 1W5MA 4CCDA 2A21A 3QFEA 1VRDA 4G1KA 3IGSA 4QJ1A 3WJZA 3ZWTA 1DORA 2GPTA 2YW3A 1HO1A 1QDSA 1OK4A 3GKFA 1H7XA 1X1ZA 1J5TA 4MYXA 4UFIA 1TPC1 1FWTA 5D02A 2WJZA 1TIMA 3I7RA 1R2RA 1VZWA 2ABAA 3IV3A 4O28A 1S5WA 2NXIA 3NQEA 1YTEA 3O6YX 3UQNA 1FWWA 5F1VA 2OT1A 5DCBA 2CLIA 1O5KA 3NQDA 1LYXA 3USBA 5BNKA 3CB8A 3LHTA 4JX4A 1YXDA 1FWRA 3HG3A 4UMBA 3VCRA 3LDVA 8TIMA 4WUIA 1O60A 2J88A 4I7VA 5LNSA 4HPJA 3OVPA 3MO7A 4LV4A 5U4NA 3C3NA 4O13A 1JUBA 1MXSA 3DFNA 2VFIA 5AFDA 3PBYA 5C54A 3C6CA 1PHQA 3HMJG 3CIXA 1I2PA 3BLFA 1PHWA 3CQ0A 3PY2A 1OFRA 1LP6A 4UFHA 4PL1A 3PAJA 3NPUA 4FX7A 3RF9A 2XN0A 4N9EA 3TQVA 5G2WA 3T44A 1FBAA 2GJLA 4E2BA 5EYWA 4N9DA 4Y8FA 1TPWA 1BWLA 2I14A 4TU1A 3UY8A 5D2WA 1ICSA 4K36A 3W88A 4O1BA 3P61A 1VHNA 4QAIA 1EWEA 5I3FA 1K3UA 3DBPA 4WX2A 3SI9A 3P80A 4ADSA 2B4GA 3NPVA 1VLWA 3U8GA 3Q58A 3S5OA 2FPVA 2HTMA 2P10A 5EA9A 4Z1CA 4UFKA 4KWWA 1QPRA 2CZEA 2ZZ2A 4FXRA 1TPH1 3S9YA 1SO5A 3G1HA 4U4MA 3NPWA 4CNNA 2F7FA 3DI1A 5CZSA 3C2VA 5J5RA 3W85A 1QNVA 5H2ZA 3W1QA 3NQFA 4M19A 3SR7A 4FX6M 4JTJA 4IOTA 1VGAA 3TR2A 1JVNA 3LI1A 1K7XA 2JKAA 3F4WA 1B3OA 1F6PA 3MUXA 1WOAA 3ZFHA 3VNDA 2Y7DA 1EWDA 3R8RA 3BW3A 3PS7A 1SW3A 5FF4A 2Y7FA 1EPXA 4RZ6A 4LRTA 2YR1A 2BWGA 2Y7GA 1KFKA 4XKYA 1OF8A 3G8EA 3OBKA 4CQ9A 4O11A 3BV4A 4O8RA 1T99A 4YWIA 1A53A 1PVNA 3JS3A 3VE7A 3W7NA 3B0PA 1SZFA 4BI6A 1G67A 3KRUA 2V82A 3THQA 2DZSA 4WOQA 3L68A 3W1AA 3SGZA 1HG3A 4LVFA 2E6DA 4AEOA 3TNOA 1QPNA 2H90A 4GUGA 5G2IA 1Q6RA 4BWLA 4RLIA 5LGZA 3I68A 1GVOA 4NX5A 3GYEA 1OFAA 1NVMA 2C3ZA 1LROA 2RH9A 5HULA 3ZR4A 4ZQPA 1L9WA 1LOQA 3OA3A 4OT7A 2Y6ZA 3G0SA 4NNCA 3LXAA 2FFCA 4S1FA 5DY2A 4DEFA 4UFLA 2TMDA 1C9DA 5HR6A 2XN2A 4LU0A 1M7OA 1T0OA 2ISVA 2VOMA 1DJNA 1WOBA 3LRLA 4IJBA 3LCLA 3M5ZA 1MSSA 2QAFA 1SSDA 1NFBA 1BEUA 3IIZA 1UJPA 2CLFA 3LERA 1VH7A 3S5ZA 2ATMA 4O1DA 1V5XA 6ALDA 3W73A 4BK9A 4Q4KA 1SFLA 4JX5A 5F4SA 2A85A 5G5IA 5F2GA 3ABQA 3LTSA 1CX9A 2OCZA 3MJYA 3BG3A 5TIMA 4IXXA 4TMCA 5FF3A 3QJAA 2X1RA 2OT0A 1F5ZA 3QMRA 4EIVA 1H7RA 4MVAA 2ISSA 4NJJA 4UXDA 4LVDA 5KITA 2GQ9A 2CZFA 2V2HA 3W9ZA 3EWYA 3M1ZA 3E02A 2ZRUA 4JTFA 2Q8LA 1VYSX 3R12A 1H60A 3TSDA 2EKCA 1O95A 1W3IA 3HBLA 3C2OA 1M6JA 2J6XA 5GVJA 4DPQA 1TRDA 1Y0EA 1ADOA 5DLCA 4S2BA 3C2EA 4IPIA 4DF2A 3W7HA 5LZLA 3HG4A 1SO3A 1OHLA 3B04A 5AYXA 3QMSA 3VFLA 3M5YA 2NX9A 5ABTA 4LWWA 5BMXA 3T7VA 3MWAA 5D2TA 3BGJA 1JCXA 1NSJA 1VYRA 2AAMA 4JGDA 4O54A 3NQCA 1KLZA 3W2JA 3N9SA 1JCLA 3DZ1A 4LS2A 3QH2A 1KFCA 2DJXA 3LV5A 4WQ6A 5AOUA 4UR7A 3W7IA 2J27A 2E1DA 1R2TA 2QCEA 4O50A 2Z0IA 1B4KA 4BWLC 3IVSA 4J9JA 2ABBA 3GDTA 1F76A 3S1VA 5CPNA 2CLKA 1SO4A 4QQ3A 5AHMA 3EXRA 5DXYA 5BMWA 2E68A 2ZZ1A 1PL9A 3W7EA 3RU6A 3O05A 5LNUA 3OVQA 2E09A 3G18A 2E6AA 3T55A 3IRDA 4P61A 2J9ZA 3LRKA 3NQ8A 2W6RA 1VYPX 2Y62A 2JKPA 3RLUA 4JIQA 3I7SA 4NZJA 4KFOA 3EWXA 3W7JA 3WFAA 5AHNA 4HNNA 2FPYA 1D3GA 4KFNA 5AC6A 4N9CA 1O4UA 3QW3A 3EX3A 4PH6A 5HR7A 3M9YA 4NZFA 4ONVA 3MI3A 1HL2A 4OQVA 2G96A 3A5FA 4IPJA 5D37A 2F84A 4DO4A 3PUDA 3THAA 5F2MA 3TQKA 2ZA2A 4JN6A 4FHAA 3TKFA 5HWNA 3FFSA 3P5ZA 4Y9AA 3KX6A 1UUMA 4NX0A 3ATZA 4N2YA 1H1YA 3PUOA 5I3GA 5E0KA 2P1FA 3NQAA 3RMJA 1GT8A 1ICPA 1AK5A 1HFBA 4CNPA 3MYPA 3W22A 4UTWA 3QZEA 4UMAA 2ZCGA 4A3UA 3M5VA 4M6QA 2DJLA 1JRBA 3KOFA 1SR9A 3MYOA 4RX0A 2TRSA 4GUFA 1TPFA 2CW6A 1YDNA 1QOPA 2A6LA 2ZZ4A 1G69A 1GVRA 3TW6A 3LBCA 1ZY9A 4IQLA 4C1KA 3EX4A 3E0IA 3MP5A 5LKYA 4AVFA 2FIQA 3LTPA 1YDVA 3DFSA 4AF0B 2YYTA 3TROA 2VEIA 1WBJA 2ZYFA 4AHOA 1TREA 4LNYA 3Q2DA 4DQWA 4S2CA 4MKNA 1MEWA 4C1LA 2NWSA 1XXXA 4YCPA 1O5XA 4YLWA 3TC6A 1W31A 1TPEA 3S42A 1YXYA 1DQXA 1WYIA 4QNWA 1ZFJA 2NWRA 1IXNA 4FIQA 1LZOA 1VQTA 3LX9A 1ME7A 1EB3A 2JGQA 3CLMA 2WPBA 2NV2A 4O16A 1QOQA 4JICA 1UUOA 5C5YA 4XWUA 3TH6A 3TUUA 1OFBA 3RNDA 3L0NA 3W7LA 4LTSA 2C19A 4O4VA 1UB3A 1VCFA 1FDJA 2AQWA 3ABOA 2YSWA 3BARA 3EX6A 4HHPA 3LRMA 5HUOA 1N8FA 5AHFA 1TPDA 3HPSA 4MFDA 3S5NA 2X16A 3LHVA 4UTJA 1H7NA 4OV4A 1HTIA 4FO4A 4GNJA 3QC3A 1GPWA 3W23A 4RCXA 5F2LA 1Q45A 1E51A 2TYSA 2YDAA 5DY3A 3UWUA 1YPIA 1OK6A 2Z2UA 3G1DA 1XKYA 3W72A 4FNPA 4UTWC 4UTIA 2WV8A 1W56A 2O7SA 4YL2A 2NXGA 2NUWA 5LSMA 4EF8A 1B4EA 1VLIA 4WY0A 3FIGA 3W1PA 5KINA 5EMUA 4IWWA 2V30A 4N6FA 3N2XA 1GG1A 4JTKA 3GNNA 4UFMA 3SFKA 3TQ0A 3TDFA 1DL3A 3IIPA 4YMZA 1SZGA 1VCGA 3UY7A 2R8WA 1CI1A 3PC0A 2QDHA 5KSWA 4UNKA 3BW2A 1TV8A 1FCQA 1KM5A 1Q3NA 1TPB1 3P60A 1EX5A 5G1YA 1RV8A 1RQEA 3FOKA 1NAL1 3IIOA 3DH7A 3C52A 3WJYA 4HNUA 3LOTA 3E9AA 3S1WA 4LW7A 1DV7A 4LUJA 3CC1A 2A7NA 1I2OA 1KFBA 1SQ7A 4CCEA 2CZDA 3W2MA 4FX8A 2E5DA 3JRKA 2A2IA 2Z6IA 3EEGA 1KM1A 1PIIA 5G2HA 1ZAHA 3UXAA 4NVTA 4Z0JA 4RKAA 4ML9A 4EVZA 1XC4A 3KAOA 4NJIA 4Y6GA 5DN1A 3LCFA 5AHEA 5HWMA 1F7BA 1WAUA 1PCWA 3W2UA 4QIUA 2YFNA 1ZNNA 4GRSA 3NEVA 3PBWA 3DXIA 1GG0A 3CU2A 2BX7A 3HF3A 3PSWA 3FJ6A 5F4XA 4FNUA 3HGSA 3ZS4A 1FX6A 3CEUA 3PR2A 3PBVA 3TK7A 4X22A 2XFWA 1F6KA 3P74A 3A22A 3M6YA 1LOLA 5AC8A 1PCKA 5D2YA 4A21A 1MEIA 2ZRVA 1LOSA 2FPTA 6TIMA 1G7UA 1RR2A 1TCDA 5D38A 3CHVA 3Q94A 3EB2A 4FNSA 4O57A 1EUNA 1MZHA 3EXSA 3HO8A 5SWUA 3STEA 1XBZA 3BLIA 4GWEA 3GAKA 4MFEA 1OABA 3W7PA 3W1LA 2YW4A 2BXVA 4LV9A 3CPRA 4X9SA 3GXNA 1R30A 4MLRA 4ZQCA 1P1XA 3B03A 2NUYA 4N4QA 3LHWA 3HOJA 1NEYA 3OEXA 3N14A 4HNTA 4AHPA 2VEKA 5KZEA 5CKSA 2EAWA 1FY6A 1JJKA 3LCHA 1M7PA 3IEBA 2PRHA 4LC6A 3PBUA 5I3IA 2ATSA 5BOOA 3M41A 1IF2A 1K7EA 3LCXA 1SUXA 5CZTA 2VXNA 1LLWA 1TV7A 1IXOA 3GDLA 3EWUA 1QFEA 2X1SA 2ZA1A 4JYEA 4IMGA 3UPBA 1GOXA 3W83A 3L2IA 2V5LA 3T4CA 3NYZA 1QWGA 2NXHA 4PL2A 1H62A 4MYAA 1B57A 3N73A 2OX1A 5A5WA 3KVKA 5FF0A 2QCGA 3IVUA 1CW2A 1FXPA 2ZA3A 3MBDA 3MP4A 3NGJA 5I3JA 1RZMA 1VCVA 4I7WA 3TU9A 3JR2A 2CU0A 3BK0A 3NZRA 1G7VA 1JUEA 1JUKA 1ZENA 3U2OA 2FDSA 1U83A 1SFJA 3BO9A 2A5HA 4M7SA 1OFDA 1THFD 4XQ6A 3TJLA 1DOSA 1QO5A 3NPXA 2H6RA 2V9DA 4JR5A 1FWSA 1ALDA 2Q3OA 2VFDA 5KZDA 4GJ1A 1JCNA 3RK8A 4QISA 4UTHA 3I65A 4GUJA 4LT9A 1XI3A 1WBHA 3OG3A 1ME9A 5CGQA 1OG0A 1GQNA 3SW6A 4M6PA 1OYCA 1JQVA 2PRMA 3QPYA 4ZQRA 4K8HA 4MY8A 2YFOA 3W70A 4JTEA 2JK2A 1GTEA 5IM51 4CQ8A 1EEPA 1LBMA 2Z6JA 2C13A 1H5YA 3SECA 5HUPA 2Q8ZA 2YXGA 1SSGA 4IMFA 3LM7A 1F74A 5AYZA 3WK1A 1ZHAA 5K9XA 1TSIA 3F1QA 1AW1A 4OBTA 3R5EA 2CLMA 3BG5A 2YZRA 3LLDA 3EKLA 4MPQA 1GJPA 2BLEA 1W1ZA 3M43A 3SJ3A 4WJEA 4LOCA 4WD0A 3PULA 1GVFA 5G4WA 4JTTA 1D3HA 1TPVA 2QUVA 3W71A 5L9FA 2B7QA 4ZQOA 4BR1A 3PB2A 3IGXA 1W3TA 2RDTA 2VELA 4JNMA 1TTIA 1RQHA 4R53A 3W7GA 4Z1BA 5LNRA 1C8VA 2VFGA 4O15A 4DF0A 3LHZA 1DKWA 3PWAA 1KM6A 1ME8A 3KRSA 4MJMA 4NJHA 3U6WA 2DU2A 5CG7A 1L6YA 3W7MA 4BI5A 4HSNA 1GYNA 1LTDA 3NA8A 1SW0A 1H50A 3LCWA 1TJRA 1OFEA 1LRTA 2B7PA 3IIVA 3R89A 2HS6A 3LCGA 4O53A 1FUYA 3G3MA 4OU1A 2A7RA 4RZ4A 1AW2A 1OYAA 4GC4A 1JR1A 4YCOA 3FLUA 4AH7A 3FJLA 3NAVA 2EPHA 5D05A 5FEPA 3WJXA 2PCQA 3O63A 2R91A 4MZ1A 3UWVA 2VC6A 3QEZA 4IMEA 1W3NA 4IX0A 4TMBA 3LLFA 4QNEA 4QITA 3LXCA 3PM6A 2VEPA 4GE8A 3W1XA 2C16A 3L5MA 5HJLA 3QPZA 1QR7A 4Z1DA 4U28A 3W1TA 2DZVA 2H8XA 2Y70A 4LS1A 2AGKA 1GYLA 3GAYA 4YXGA 4MUZA 5I3KA 2A6NA 4RV8A 4P2VA 4LVBA 5K4ZA 1N7KA 3ABRA 4MZ8A 1KBIA 2KZHA 2W79A 4UR8A 1YTKA 2G95A 5AN7A 1KTBA 4AWTA 2CFFA 4WXZA 3LV6A 1GVQA 3NQMA 3O07A 2WSQA 3B06A 1LM1A 1R46A 4N6EA 4PA8A 5D2XA 4NJKA 2NV1A 2OMAA 3W75A 4N02A 5E1QA 1V7YA 3MHGA 2NX1A 3TCEA 1JULA 3IIXA 1W54A 3P8IA 4H4IA 5HWJA 4PTNA 3W1RA 3L5AA 4H6KA 3B4UA 3D0CA 2E6FA 1EP3A 2X2GA 3WJWA 3N9RA 2QCDB 4JYFA 2GVLA 4O12A 3B0UX 1UASA 3BW4A 1NF7A 4JS3A 2TPSA 5AHIA 1LRQA 2QEZA 4DELA 4A29A 4OV9A 1EP1A 3NR0A 4Q32A 1T96A 1XM3A 5G1TA 3S1XA 4X3ZA 2VFEA 4UNLA 1I4NA 1W0MA 1EA0A 2QCNA 4RR4A 3TSBA 4OWGA 4FF7A 2DZWA 1LBLA 1KV5A 1K7FA 3O1NA 2NUXA 3MI2A 5DBTA 2RDUA 1OF6A 4LY8A 2WKJA 2CLEA 3GKAA 5F4WA 5D04C 3W7QA 1TTJA 1FDZA 4IMCA 3G8RA 3LTYA 1RVGA 5CZJA 3SSJA 1PV8A 2YCEA 3S8HA 3BG9A 3ATYA 4LC8A 2GQAA 2D73A 4MOZA 3W87A 4RK8A 4E2DA 3P8JA 4W9TA 3F03K 3WK2A 4N9BA 1BKSA 3G0XA 5F2IA 2J24A 4JTHA 3OIXA 3M47A 2V0TA 4PFMA 3FYOA 1IXPA 3M0ZA 3P62A 4O17A 2YGYA 3PB0A 4PODA 1TJPA 3FKKA 4OE7A 1WA3A 4ZL1A 5A8GA 3S0CA 1FCBA 2RFGA 4DBDA 4RJEA 4JXCA 4HT3A 2H3DA 3CWNA 3LHYA 1TV5A 4KKXA 5F1UA 1OX4B 4L4MA 3W1MA 1HO4A 1F73A 1TPUA 1W5NA 3DHFA 4R7JA 3H54A 2NZLA 1QPOA 3UWZA 2ZRXA 4JY8A 3DHDA 3H53A 3GXTA 1IIHA 2UV8G 3NQ6A 5U7SA 3I7QA 3CEPA 5DCEA 4RXGA 4AF0A 2Y7EA 1XL9A 5MHBA 3EX2A 2VEMA 2PE4A 5T26A 1P5BA 4Y96A 4DPPA 1T8XA 1KFEA 2C14A 4ICNA 3E96A 2QJIA 3MMTA 1KM0A 2ZRYA 1J2WA 2ZZ7A 3DFOA 1DQWA 4TR9A 3P81A 5CPMA 2WNNA 1TQJA 1OFQA 4JX6A 3AJXA 2DP3A 4ZZ9A 5I3HA 5DCDA 1RD5A 3GZ3A 4RZ5A 1ZJIA 3LBMA 4K37A 4ALDA 4NU7A 1XDMA 3W7CA 4LVGA 3O8AA 2WNQA 1B9BA 5D2VA 3TA6A 1S5TA 3DKLA 4GFSA 3W1NA 4K7YA 2NX3A 4HKPA 5K7JA 3IGUA 1X1OA 3BVJA 3CTLA 4O14A 3KXQA 3NL5A 3UWWA 3G1XA 1W5QA 3Q37A 5EL1A 3LHUA 4UC5A 2G97A 2YYUA 4PCFA 4MJZA 2QKFA 3W74A 1RPXA 1P4CA 1GWJA 1VC4A 4Z08A 2YPIA 3BLEA 2OJPA 4LVAA 5C6MA 2V5BA 3NQ7A 1VS1A 2DZPA 3SIZA 2Y61A 2RKXA 5K2ZA 1KA9F 4IUOA 3DAQA 5TQLA 2WNZA 1UBSA 3HGRA 3L67A 4UTUA 2I1OA 3W86A 1MEHA 2HSAA 3W7RA 2VFFA 3M44A 1W37A 3QF0A 2E5CA 1G4SA 5C55A 1P0NA 3P84A 3A21A 3VE9A 1ZAIA 1YTDA 3AO0A 4GUIA 1ZCOA 1OX6A 1TO3A 3DI0A 3DFPA 4XTDA 1DBTA 4AAJA 1QCWA 3TC7A 3N2MA 3G24A 5LHFA 3INPA 2GOUA 3YPIA 3KVMA 4UTTA 3OVRA 3W7KA 2CWNA 1SZNA 4XBSA 2GUUA 1P0KA 2JKEA 3KRZA 2ZTKA 4O10A 3NL2A 2EHHA 3TAOA 1VJIA 1AL8A 7TIMA 4K6AA 1XBYA 4JTIA 1GEQA 1XUZA 3TV8A 3QMTA 4ORMA 4LS0A 3NZ1A 4TO8A 5CSSA 2QCCA 3TX9A 5CZ0A 3O6CA 3W07A 3BPWA 4ZVJA 1QO2A 1AL7A 2X1TA 4TX9A 3WJSA 1IIGA 1FWNA 3G1YA 4FEZA 3C0JA 3ANYA 1W5OA 3ZWSA 1FQ0A 5IBXC 3IVTA 4O52A 2C15A 1WX0A 4A22A 3NO5A 4Y90A 1SZEA 3EXTA 3SZ8A 3UWQA 4O18A 2DZUA 3C4UA 1PE1A 3PF3A 3UWYA 1XFBA 4DF1A 2QJHA 3TIMA 4ZMGA 3E49A 1A50A 2VENA 1A5CA 4LUIA 3C61A 4CQAA 1LORA 4CLMA 1I45A 4JTGA 4UUIA 3ABSA 3G22A 2I9EA 2ZDRA 1QPQA 2RDWA 4MZYA 4XKYB 3GXPA 3HGJA 1YLVA 3HQ1A 4QSHA 2DORA 3F4NA 2R94A 3P67A 4HNVA 1SW7A 3GDRA 3TFXA 1U5JA 5HQEA 4AXKA 3DFTA 4HSOA 5FEZA 4FNTA 1OYBA 2P0OA 1J4EA 2EGZA 3TXZA 1ZAJA 5DXXA 3QW4B 4FNRA 5AYYA 4K7VA 3QRHA 4R34A 3TSMA 5D32A 3M16A 3A24A
chains in the Genus database with same CATH superfamily
1DWAM 3PBGA 3FY1A 3QY7A 1I2RA 3FS2A 4UTTC 1DJQA 1ZPTA 3GVGA 3GO2A 1YBQA 3VA8A 1ECQA 3WF2A 3KVJA 3GDMA 1S1RA 5M03A 4AX6A 5LIWX 3K8MA 4BY3A 4AY8A 5FF7A 2VVNA 3NVDA 2AL2A 5DRCA 1H63A 1FXQA 4D8AA 3P7YA 1REQB 2WQPA 3W7DA 4PB4A 3WLKX 3L2LA 1GTHA 3QV7A 4B3LA 2OKOA 4DJED 2OEMA 3T09A 1W1IE 3SN1A 2GDVA 3H4XA 1G4EA 3JW7A 4ZO6A 4FLRA 4AWSA 3ANVA 4FR6A 1C8YA 4IL0A 1HP4A 5CSRA 4UTFA 4O19A 2Z1KA 4MJ2A 3EDDA 3STGA 4POCA 3E12A 2GGEA 4AWUA 3TWBA 2WBGA 5C7VA 3SCVA 1GOMA 1H1NA 5A6MA 1TV3A 4TV5A 4Y8EA 3WF1A 3B05A 5EPDA 3N4FA 1JPDX 1XIHA 3OYXA 4CNSA 2B0MA 4IP4A 5LNVA 1WNOA 4JTAA 5HJXA 2QUUA 2OX4A 5EY5A 1E0UA 2XG9A 3T78A 2OWXA 3EWCA 4HPXA 2F6XA 2ZQ0A 4DUOA 1NOWA 1DHPA 3N6QA 5D9OA 4C7DA 2X1UA 2DZXA 3WBAA 3UZ5A 1PBGA 5CPQA 3HG2A 1W8SA 4PCPA 1X8CA 4UR9A 4MMWA 1SPQA 1EJWC 4MLJA 4LBSA 3V5CA 4GXMA 2OEKA 2XIJA 3O06A 2BZNA 2ISFA 1IT7A 3VNYA 2GVJA 1AMKA 1PIFA 2QR6A 5AKQA 5KZMA 2W3ZA 1ZALA 4MDOA 4YHEA 2E6YA 1S3HA 4ASTA 3NDZA 1SYTA 5XIMA 1F3XA 4QRNA 5D30A 1TWIA 4IX2A 2LLEA 1TUFA 3VNIA 2WCGA 3PZIA 4JD4A 5A6SA 4UOQA 4LCRA 3E5BA 3UW6A 1LLOA 5AC7A 3GU1A 3PG8A 3VI2A 2DSWA 4FOUA 4FXFA 1ONXA 1H7PA 1VPXA 2I16A 1K03A 1M41A 3TYAA 3V0SA 3UT0A 4UMCA 1CXLA 3MHUA 3L21A 4NAFA 4DYKA 1W5PA 2C0AA 5HDRA 9XIAA 2BB0A 3L4UA 1FCUA 2H3BA 4GGHA 3L9CA 3CUGA 1KTCA 4AYGA 3R79A 1S5VA 3K13A 4BCEA 1HJWA 3HPZA 4O0QA 3UXIA 5CC3A 4LQ1A 3S4TA 1F3WA 3FK4A 3OU8A 1JCJA 4DO5A 2XM2A 3UXDA 3FDKA 2OB3A 1KTNA 3QYQA 4IJRA 4HK5A 2C18A 2QPSA 2WO5A 3UPWA 3OHIA 3C2FA 4NT0A 4DUWA 5BOFA 1IXQA 4BFAA 1B3YA 3CV6A 1BG4A 1A5NC 1O5QA 1YXCA 4L6DA 3SCSA 5KMYA 2QDDA 3DGBA 2BVTA 3G2GA 3FGCA 1W9XA 1V6WA 2C1IA 3K8LA 2DIKA 3R0KA 1A47A 3NM1A 3BOXA 3LSCA 2EPKX 3BSGA 1JF5A 3ISIX 3FA5A 3TTYA 5HANA 4QM1A 3O15A 2FJKA 4TVUA 3VKCA 3WELA 4DO6A 1OCNA 4EACA 2YCKX 4MWAE 4M6VA 4HBKA 3XISA 2C8NA 2WKLA 4MB4A 3W4RA 2VFHA 2YBTA 1GEHA 3VTRA 3CQIA 4LEFA 3W6MA 4IUGA 4DI8A 1GZGA 1Z89A 4L56A 2PDGA 1UKTA 3ZJKA 1XD1A 4ADTA 3SQSA 2A0NA 4YYCA 3NQGA 1AODA 4UOJA 3QV8A 3WSUA 1I9CB 3WNMA 3A23A 1XUUA 1K02A 5EKYA 2B81A 2J9XA 3B8SA 3W25A 1Q8JA 3S5YA 2OYMA 4A2RA 2FLIA 1CPUA 1W1YA 2PU0A 4JIHA 2OZ0A 2PC8A 5IFTA 2L5HA 2WSRA 3PWIA 3R7MA 1CTNA 3LLXA 1R86A 1EH9A 1VFSA 5GJMA 1VHCA 1Y5VA 4HA1A 2OKTA 3RRXA 4H04A 4L61A 1TJ0A 4R7OA 1HIZA 4NRSA 4P7LA 3UNDA 4Z2KA 1KM4A 2WWDA 4HK6A 5FESA 3HB9A 5A6JA 2ZVIA 5C8BB 1BTCA 1X7FA 3MKKA 5HOSA 1J10A 2INZA 3PFMA 4DAFA 1FCVA 3S9ZA 2OWCA 4LAKA 5FEWA 3M4HA 5HNNA 4H7VA 1XLHA 3DERA 2NSOA 1GQJA 3ZWTA 1DORA 2YW3A 1I1WA 1HO1A 1QDSA 1OK4A 1QASA 1E1CB 4XAZA 1G9HA 3GUWA 1TIMA 3IV3A 4WK9A 3DG3A 3TOPA 2HQAA 1S5WA 4GIRA 3OB8A 2VRKA 2MANA 3CT2A 5AYIA 1YRRA 4NZ5A 3M0JA 2DSZA 5BNKA 4JX4A 1YXDA 2HZGA 3LBOA 1G0CA 2WZHA 2VRQA 1JI1A 4WUIA 5LNSA 2J88A 4Y9PA 3MO7A 2E8ZA 4LV4A 4UOZA 4L1GA 3GVVA 5U4NA 3C3NA 2V3EA 4O13A 4L1WA 1E0WA 1P0EA 1EA9C 3LPOA 1WDRA 1LL7A 1I2PA 2IPJA 1Z32X 4TX8A 5D9MA 1RD6A 1OFRA 4AZ7A 4CEXC 3CPGA 3TOYA 4XZNX 2J75A 5EYWA 2VGBA 4NZ3A 3WLHA 3WL0A 2P3ZA 2DT3A 4XD3A 1BYDA 3Q4DA 4K36A 1UHVA 4QAIA 1EWEA 1XH1A 1E6NA 2J7FA 2J8FA 1ODZA 2B4GA 4H6QA 1L0PA 3S3GA 4CD7A 3PZQA 3S5OA 4YS1A 1CXIA 2HTMA 2OELA 3UZWA 4AZCA 1RK6A 5EA9A 2J7HA 4UFKA 1YKWA 1FWGC 4LYKA 2AL2B 2Z1SA 2ZZ2A 4MDPA 1TPH1 3S9YA 3OLGA 4G7EA 3G1HA 4J7RA 3TZNA 2F7FA 3NFUA 3VUSA 5EMMA 2HK0A 3C2VA 5J5RA 4J3WA 1QNVA 1Y65A 3W1QA 2Q71A 4J27A 4JTJA 2BP1A 3GFZA 3KTCA 1P6BA 2CXGA 1K7XA 3CV1A 4I8YA 1V0KA 3BURA 2EJ1A 2MUCA 3OOQA 3VNDA 1EWDA 3NSXA 2XIQA 2WB5A 5FF4A 2XM1A 3U2ZA 2Y7FA 1L8PA 2W4XA 4KBXA 3BV4A 4GZEA 1I1XA 2WYSA 1E4LA 4KW2A 4EK7A 3DBNA 3IJ6A 5I77A 2CNCA 3AUOA 4WOQA 3L68A 3WDIA 3W1AA 3MO4A 1B3XA 2E6DA 3M0YA 1E9YB 4WDTA 3UR2A 5I7GA 3RMEA 4QS6A 3I68A 4NX5A 3UG4A 3K5XA 2C3ZA 3URBA 4RPPA 3ITCA 3REQA 3TONA 1LOQA 3OA3A 3RIKA 2YLLA 3WLJA 3G0SA 4NNCA 3LXAA 4HZ6A 4UQ9A 3LPFA 1C9DA 4HN8A 3ES7A 2XN2A 1XIGA 1YQ2A 1GVEA 3F4VA 1DJNA 3LCLA 4GX9A 4MHBA 3M5ZA 5C0QA 1NDZA 1SSDA 1NFBA 4LYRA 1TR1A 2QXWA 1G1YA 3ZJ6A 2HDJA 4O1DA 5EU9A 1SFLA 4JX5A 3U48A 5F2GA 1K9TA 5AVHA 1Q6GA 2VEFA 1CX9A 3GU9A 3PTDA 5TIMA 4IXXA 3NO1A 4TMCA 2D23A 3CHCA 2X1RA 3PJUA 3QMRA 1LT7A 4MTVA 4GI9A 4W7WA 2A3BA 3W24A 5GQBA 3WLNA 3T9PA 4UXDA 8CGTA 3ZVHA 1H49A 3TVAA 1K1DA 3W9ZA 4HQVA 3E02A 2ZRUA 1KFWA 2XHYA 2WKGA 2WQDA 5I23A 4PZVA 1M6JA 1O5RA 4DPQA 4MAZA 2ANUA 1ADOA 1HX0A 4IIDA 2NT1A 3VZZA 4IL2A 3M5YA 3UR8A 3VD4A 3T7VA 5D2TA 1YEYA 1JCXA 1ZBCA 4JQ1A 1VKFA 1NQKA 4GVFA 2Z4GA 4JGDA 3S2JA 1JD7A 3OLDA 1KLZA 3ZZ1A 3W2JA 4PRTA 5ECUA 3IV8A 3LU2A 3EGJA 4JAWA 4C6CA 4UR7A 3W7IA 2CC0A 3WBEA 3KBJA 3IVSA 3GDTA 3S1VA 3KUMA 1SO4A 2OO6A 4QQ3A 5AHMA 3EXRA 2BDQA 3II1A 3M07A 2QJJA 3UVIA 3RU6A 3O05A 4E2OA 3NTYA 3EPMA 1BRLA 4HHLA 2ACRA 5CCZA 4H2CA 4GZJA 3IRDA 1A5MC 1IEQA 2Y62A 1M3UA 4M24A 2UZ9A 4DJFC 2JKPA 6CGTA 4E8GA 3W7JA 3WFAA 3PN8A 4HNNA 3AC0A 1D3GA 4KFNA 3S2MA 3KP0A 5AC6A 3QW3A 5LXXA 1N8WA 3APTA 5HR7A 3GTFA 4ONVA 3MI3A 1HL2A 1UOZA 4OQVA 1UQYA 3A5FA 4IPJA 2C79A 3L4WA 3PUDA 3AS3A 4JN6A 3ITLA 1ISYA 3TKFA 1TWWA 2WLZA 3FFSA 1S2WA 2FZNA 1XX1A 4GOAA 1J12A 2J62A 3PUOA 1XRTA 3CYJA 1EL3A 5C9WA 5FJJA 3SQMA 3TNBA 2ZCGA 2XGZA 4F9JA 1QNRA 2DJLA 3OGRA 1QXLA 3T6CA 3AYVA 2I57A 1B0IA 2CW6A 4HZ8A 1YDNA 1QOPA 1GVRA 3CH9A 5HMEA 3LBCA 3N6HA 4IQLA 1AH4A 3MP5A 5LKYA 3T42A 4MNJA 2FIQA 4RW5A 3DFSA 4AF0B 3TLQA 2VEIA 1WBJA 4ZOAA 4QJ4B 3BLOA 1S3TC 4IGNA 3FYYA 5DO8A 4URIA 5CJMA 4GH3A 3WBXA 4S2CA 4WF7A 3H21A 2NWSA 2JIEA 4YCPA 4YLWA 3RJYA 1IWBA 1F3EA 4Y9MA 5JBEA 1WYIA 3SO7A 2D2OA 2D0GA 3AHXA 4M51A 1B9ZA 3VD7A 4FIQA 3E1F1 4M8UA 1VQTA 4H9TA 4B5VA 1EB3A 4W8BA 3GFXA 4NSBA 5PTDA 1UMYA 3RR4A 1V6YA 1UUOA 4GIAA 3ANUA 4KS0A 5LIKX 4FI4A 4CCZA 3RG6A 3W7LA 1K4GA 5MKGA 4L4OA 4C6IA 2YSWA 3BARA 4HHPA 1N8FA 4BJHA 2VQTA 3EOLA 2X16A 2PP3A 4FSAA 3H2NA 3NZPA 2NT0A 1KRMA 3I4EA 2O56A 1CB2A 4GNJA 4IP7A 5BROA 1BXCA 4YVXA 3W23A 3AMLA 3I10A 3VGHA 4LCSA 2YDAA 4HHHA 2Z7GA 5CBIA 2PDHA 1XKYA 4XZMX 4E3VA 5A2AA 2WV8A 1W56A 2O7SA 6ENLA 1EGVA 4WY0A 3N29A 4IWWA 3N2XA 2W63A 3GNNA 4UFMA 3RDKA 3OBEA 4YMZA 1VCGA 4US6A 3UY7A 1WUEA 3PC0A 4L9YA 3WH5A 5KSWA 3BH4A 1TV8A 2X7VA 3CAKA 1FCQA 4H19A 1EHNA 1YW1A 1NWUA 3AAMA 4ZEPA 2Z29A 3NXLA 3WJYA 4PULA 3LOTA 1ZQ5A 3CL8A 3E9AA 4LUJA 3N2BA 1Q7ZA 2J66A 4NRRA 4BEUA 4CCEA 3EOSA 1KNWA 1P6CA 1IEIA 1BF6A 2Z1XA 1AZ1A 2WHMA 1HJSA 2V3GA 1G94A 2DGAA 4H41A 1JYNA 4NVTA 4ES4A 1W9UA 1XP3A 4NILA 1XC4A 3TZFA 5DN1A 1CBGA 3LCFA 1PCWA 2HE5A 4M3PA 5HPOA 1YE4A 3NEVA 4DWSD 1PO9A 3GQYA 1XIMA 3SIMA 4IPNB 4US5D 2BX7A 3PSWA 3FJ6A 4R7WA 3HGSA 3ZS4A 2DDXA 3PR2A 3PBVA 4X22A 2DH3A 2ZX8A 4A21A 1MEIA 3CXOA 2E8YA 4LAMA 5E70A 4G7EB 1V8EA 2BS9A 4MADA 4KGLA 3CHVA 3W0KA 2GGHA 2BY1A 5TD4A 3G6LA 3EB2A 1LWIA 1ZZMA 2ZX5A 1MZHA 1XV8A 1SR0A 1PZ1A 3HO8A 5SWUA 1R0MA 2ZXDA 3L12A 3ZLHA 2VT0A 2BXVA 3H2CA 3DCPA 4CD8A 3RAOA 1L6GA 4ZQCA 1P1XA 3POHA 4ACZB 3B03A 1NOUA 2NUYA 3LHWA 3HOJA 1NEYA 3OEXA 4FPSA 1FH8A 5H1WA 1FY6A 1JJKA 4U5KA 4A3QA 5I2UA 4C7GA 4TXEA 4WSKA 3PBUA 3CPUA 1DYSA 1BLIA 4Q8QA 1IF2A 1K7EA 5E0CA 1SUXA 2VXNA 2X41A 3VIPA 5KZ6A 2ZA1A 2G3FA 5HQMA 1X7IA 3UPBA 3W83A 3T4CA 4HSHA 2PDYA 3V16A 1VP5A 4MYAA 3N73A 3GE7A 5FOOA 4W93A 3BSHA 5FF0A 2QCGA 3NGJA 2JF7A 1C8QA 3ZYZA 3OIHA 4Q8WA 3T08A 1ZENA 3U2OA 2FDSA 3FA4A 2XZ9A 3PZMA 4JFSA 3BO9A 4RE3A 3NO3A 1CYGA 3N11A 2R1LA 2A5HA 3CUFA 1AD1A 1XYAA 1E4NA 1QU4A 1UP0A 4HPGA 1THFD 1DOSA 1QO5A 1ZU8A 2H6RA 2V9DA 1ALDA 1EGMA 4JHMA 2PDIA 2WCSA 4JIIX 1TMQA 3DG7A 1QOXA 3RK8A 1TWSA 4QISA 2XGBA 4C6FA 4LT9A 4AY7A 2OZ8A 4Q4RA 3ONCA 2J7EA 1CNVA 1W1TA 3UP8A 2NQ5A 4UNIA 2RGMA 2YFOA 2NVAA 3RO8A 1WDQA 3N18A 4EWJA 1AZ2A 2XH4A 4CQ8A 1DWHM 1EEPA 1GKPA 1UD2A 3VNKA 1FHVA 4AZIA 4PUMA 3MVTA 2X0SA 2QDEA 5K9XA 3DC8A 4AY1A 1FFQA 1TSIA 3I6TA 1D7FA 4R3UA 4Q8PA 1HQTA 1GJPA 2BLEA 1Y5WA 4LOCA 4NZCA 2VL4A 4JCLA 4GXPA 3W38A 5G4WA 2INEA 4UBPC 2VD9A 2A3LA 1DJHA 5HQLA 3W71A 1VFFA 4ZQOA 4BR1A 3RPMA 3PB2A 5M5DA 4HU3A 4NAEB 4HOWA 1W6TA 4JNMA 4KWSA 2VM8A 4ERAA 3W7GA 1C8VA 2VFGA 4RW3A 4W7UA 4GY7A 4WIWA 2PAJA 2DU2A 1L6YA 3W7MA 4IIGA 2W5FA 3BZGA 1TJRA 1R3RA 1OFEA 3VOCA 3T4WA 4H9VA 3V0UA 3IJ9A 7XIMA 2QMJA 1AW2A 3SUVA 3FLUA 3VU2A 3NAVA 5ABHA 2PCQA 4QBXA 2CHRA 4FZIA 4XAFA 3MPGA 4LXFA 3F7JA 2DT0A 4IX0A 4TMBA 3SURA 2J47A 4QITA 3LXCA 4GE8A 4ZFCA 2GJXB 4GPNA 3KZPA 3H2AA 2DZVA 1DIDA 3B9AA 3VGFA 4EKJA 4YXGA 4MUZA 5CLWA 4UCFA 3AHZA 1GKQA 5J8LA 3OHMB 2KZHA 1SGJA 1YTKA 4AWTA 1AJZA 5DMLA 2F2HA 1H11A 2CFFA 5B80A 5JU6A 3LV6A 1GVQA 3UEQA 1ZBWA 2NV1A 1RK5A 3LGGA 4ZTYA 3W75A 4N02A 1V7YA 4KEZA 3S2LA 2EO7A 2QVNA 3CQJA 3IIXA 3KCOA 3A6OA 5HWJA 3W1RA 4PTVA 2X2GA 2PP1A 3EBVA 1U5HA 1V7AA 2BVWA 2J7CA 4JYFA 1HXJA 4O12A 3BW4A 1NF7A 4JQ2A 5AHIA 1LRQA 2EXOA 4HCHA 1J0IA 4OV9A 3VAVA 3EMQA 3U5UA 4X3ZA 1BYCA 4LAZA 4OWGA 5DQPA 5EFDA 1OADA 4HMEA 3MMWA 1VFLA 1P1MA 2ZOXA 1MW0A 3MI2A 5CAKA 4V28A 1PZ3A 2OVLA 3WUEA 5HAOA 5EGRA 5IRPA 4RNJA 4ACYA 3W7QA 1EZWA 4IHCA 1RCOB 3VOJA 1UH2A 4EAMA 3ID7A 3CZ8A 2NV9A 2UWFA 4LC8A 4ZB0A 4FP1A 1CIUA 2D3NA 1S38A 1FWIC 3W87A 4RK8A 5BCAA 5CC5A 3WK2A 4N9BA 3G0XA 3K1DA 1V3KA 2V0TA 1EBHA 3UJEA 4JBRA 1NFGA 3CUZA 1NH6A 4ZL1A 3S0CA 2CEQA 3N9KA 1BD0A 4DBDA 2VNCA 4DIAA 2VTFA 1HO4A 3IJ8A 1F73A 1W5NA 5A6BD 4DWDA 4R7JA 3T07A 1Q6CA 1TCMA 3WQFA 2NZLA 1QPOA 4KETA 2Y5SA 4GX8A 2ZRXA 3GBDA 4JY8A 3DHDA 3ZMRA 5HA7A 2ONEA 4KF1A 2OLAA 1R6WA 2HVMA 5MHBA 3EX2A 4Y96A 2G4JA 2J74A 3VIMA 2I5QA 1KFEA 2OPJA 2C14A 2FHCA 4ICNA 3E96A 3A12A 1KM0A 2DW7A 4DNMA 4HU4A 2EBNA 2BBFA 2ZC1A 4TR9A 1RPKA 5LXEA 1OFQA 2JIWA 2DP3A 1ZP4A 3ARUA 4QG9A 1LQAA 2ZXBA 3JZEA 4K37A 3PANA 3U2CA 2GK1A 3W7CA 5LYRA 4LVGA 1FHUA 3ARQA 3E2SA 2OODA 3O2LA 4GZ7A 5K7JA 1X1OA 3CTLA 4O14A 3KXQA 2P8BA 3UWWA 3G1XA 5EL1A 3VIKA 3LHUA 1U30A 3K1GA 4MJZA 3W74A 2GDUA 2VR2A 4A6GA 1XGDA 2OJPA 3WD4A 4MUPA 1GW9A 4A4AA 2Y61A 2RKXA 5DRIA 1XHGA 4HPNA 3WH9A 2I1OA 1MEHA 1CZ1A 4QXIA 3QF0A 3LNMA 2OO0A 4GI8A 2E5CA 4NL1A 3A21A 2J78A 1ZAIA 1EJVC 1KCLA 3KWXA 3AO0A 1TA3A 1VPQA 1ZCOA 4FLSA 3ARYA 3DFPA 3A9BA 4IIHA 4B9ZA 4AAJA 1M7XA 3TC7A 5A2BA 6PTDA 3OP2A 5FAGA 3LS9A 4L65A 4UTTA 3OVRA 3W7KA 1DJYA 2ZWYA 1ZP3A 2ESCA 2W27A 6TAAA 2J77A 2BFGA 3SCWA 1JZ5A 3UPMA 4N42A 5LA0A 3KRZA 2ZX7A 3GXIA 4YTRA 1XDJA 3NL2A 4QDMA 3OGSA 2XSBA 4MWAB 3MS8A 1AL8A 1SZRA 7TIMA 4DJDC 3TV8A 4ORMA 2XIIA 3NZ1A 3VDGA 4TO8A 1F9CA 3TX9A 3O6CA 4ZVJA 2X1TA 1AL7A 4GJIA 4KWOA 4HNCA 1IIGA 1FWNA 1JCTA 3C0JA 1TMLA 3GNPA 4PUNA 1W5OA 3ZWSA 1FQ0A 4UQCA 2C15A 3VKBA 4A22A 1EJSC 1VENA 3EXTA 4Y7EA 2DZUA 4C5YA 3C4UA 1AUSL 5EB8A 3PF3A 4DF1A 1XFBA 4ZMGA 2AAAA 3E49A 3RM9A 1XSJA 4QGCA 3ARZA 2PWGA 1W1B1 2VP8A 4KEUA 4CLMA 2BASA 2WC7A 1I45A 1CGUA 1JNDA 4JTGA 4MZYA 3EWDA 3GHUA 3H2MA 3B8UA 2ZC8A 4MPKA 4QSHA 3WDHA 2DORA 3F4NA 4FLOA 3GDRA 3USZA 3DFTA 4HSOA 5FEZA 5H8MA 4FNTA 3ABZA 1JYVA 3KOYA 1J4EA 1DE5A 4AYSA 3WX7A 1US0A 5DXXA 3N6JA 5DMNA 4PRRA 3AMGA 4K7VA 3BANA 4V1XA 3TSMA 4KCTA 4IZGA 3FKRA 4L6HA 4J5NA 3ELFA 3VM5A 3GG1A 2KX9A 2VEGA 1LQ2A 3RCMA 3QLLA 4UTLA 1FP8A 4ZOCA 3SGUA 2ZTJA 4JFVA 1D9EA 4YTTA 4IICA 3N3MA 3G3DA 4MKVA 2FDMA 4C7FA 1FWDC 4EOUA 3BZJA 3T2QA 2ZVRA 4YTSA 4MG4A 3KFTA 3HPXA 3A4XA 4UTKA 3WQ8A 3B9OA 1DJIA 2QV4A 1XLFA 4K8EA 2WHKA 2XVGA 3GK0A 4P7RA 5C9RA 4LSBA 2OGYA 4XG1A 3ARWA 1JQXA 3SFWA 2E5BA 1EBGA 3AYSA 2BHUA 3GR8A 2A3AA 5D8WA 1UUQA 1XBXA 2FHBA 2EG7A 3BCDA 2PD9A 3KS6A 1KBJA 3MY9A 1KGUA 3S2NA 3GRIA 2P8CA 3LGEA 4MB3A 2VC9A 1V0LA 2QCMA 3I6EA 1Z48A 4AMAA 4PMRA 1NFPA 4JHZA 4Q7NA 3NNTA 2JF6A 3HG5A 3TMQA 4QROA 4CCCA 4JY9A 1KM2A 3EKZA 3L0KA 2PD5A 3WF3A 2JEPA 2A1YA 1XLBA 1PTDA 3M5XA 4ORIA 1J0JA 1SO6A 2GVGA 4KT2A 2ZWZA 4PB3A 2OQLA 3UVAA 1ML1A 3N13A 4BEQA 2ZFAA 3NL3A 1AA1B 1BPLB 5FD0A 1KW1A 1JCYA 3TQPA 4OJYA 4DLMA 3ZQ9A 2PURA 2VDIA 2WZTA 2YB1A 3L5LA 4XB3A 3RX4A 3ARXA 2Q3RA 5E0FA 2WMIA 4CD5A 3W3OA 2ZIDA 5AB3A 2Z1WA 3WK3A 1EOKA 4LRSA 1GHSA 4M7TA 1SMDA 4Q6XA 5D03A 4DYEA 4JIEA 1S2TA 3O6DA 2REQA 4HIBA 2CXEA 3U9IA 3D3AA 1QPKA 5TBOA 1XBVA 1HKIA 4JNYA 4Q7IA 4Y2WA 1KFLA 3UCQA 1A0CA 3WQVA 3TLLA 3KVLA 4I6VA 4ZOEA 3RO6A 1XDLA 4MY9A 3SY8A 5DANA 4L9ZA 1TYGA 4RNIA 3WY1A 4CN4A 4HMCA 5FIPA 4W8LA 1LT8A 1XIFA 5D9NA 1I2NA 3VD3A 1E6ZA 5DMMA 3NG3A 2YCIX 3LGDA 1K8ZA 4E4FA 5BRBA 4HVXA 2ALRA 4Z1AA 4LUSA 3GHTA 2XIOA 1WV2A 1UZHA 4GG9A 4DI9A 3N34A 1O94A 6REQB 4UZUA 3IJIA 5GPRA 3CWHA 1UROA 2O7QA 1KCXA 3PVFA 1K8XA 3MB9A 3GDKA 4QTGA 2ZBTA 3WDJA 2B31A 3CMGA 3BJTA 2JBMA 5CC6A 1R47A 3N04A 3W6YA 1UR2A 3HZ3A 4UTMA 2DY3A 3UFYA 3KTXA 3MZNA 3WH8A 3PG9A 1FVPA 4PMDA 3RN6A 4LYQA 2WM1A 4BZYA 2IKGA 3C0LA 1ZRQA 1ONRA 2Q01A 3PSVA 1UWAA 2DT1A 5BXTA 2VUYA 5AZ0A 5M17A 1UD5A 3C86A 5CG0A 4AD1A 2FTPA 4Q4PA 3D3FA 5BXSA 2Z25A 3CBWA 4Q3MA 3NJ3A 3VD5A 3MUZ1 2ACQA 3M7WA 4KIRA 3ARSA 4EXAA 4DNHA 4LUTB 1Q6OA 4QS5A 2QHAA 3F4DA 3WQGA 5K9DA 4X2RA 3W7OA 2V2DA 5RUBA 2JEQA 1ICQA 3QHOA 3B8DA 3BOLA 1L6WA 2NQHA 3VOHA 2RGLA 3OVGA 2BOGX 3ITTA 3R11A 1E5NA 3G1VA 3LB0A 1W3JA 1QAPA 2ISWA 2J13A 2VKZG 4W5UA 5HINA 1XH2A 2FB3A 1R3YA 4O1CA 4V1YA 1LDCA 2FZ9A 3SAZA 4B5NA 4C90A 3AWOA 1L2UA 1VPYA 2BSLA 1QT1A 2W0UA 1TTPA 1AH3A 4ZQNA 1OFOA 4DZHA 1WKDA 4W84A 5DX7A 3O6AA 1M5WA 1PIGA 2C1HA 3CIWA 3N2TA 4XKMA 3QGAC 4E38A 4KIEA 1VEMA 4JTSA 3MCOA 2FMNA 3TYCA 3VK5A 4Q4MA 4PB5A 4XZWA 5IBXA 3GW3A 3GG7A 2Z28A 4X63A 2DSVA 4XD6A 3GX9A 2YL5A 5E93A 1HNYA 3GNOA 2GSEA 1X96A 2QQ6A 3PNUA 4QLKA 1TJ2A 3PTQA 1K70A 5CZKA 4WSJA 4NJGA 2EF9A 4G2DA 3WLOA 3OGVA 2J9YA 4CNTA 4K68A 4W7VA 1UPMB 1JCMP 2WOQA 2R1NA 4CNOA 1YX1A 2GFTA 1Q6DA 5J04A 5I78A 3WQOA 4DZ5A 4TIMA 1F07A 1K77A 1O12A 4NQ1A 4W88A 1KRBC 3A4WA 3CTTA 4WZHA 3VDAA 1GOQA 1Q7QA 3DN5A 5A95A 4D72A 1BTMA 2P5NA 2BTMA 3CYVA 2PDLA 3GDBA 3CV2A 2F6KA 3S6DA 2AKZA 1UKSA 4AB4A 4I7UA 4PBGA 1IQ8A 5EMJA 1OWQA 1H1ZA 1P7TB 1OFPA 3DYPA 3WD1A 1VRDA 4G1KA 3IGSA 1V0NA 3GG0A 4QSFA 3FXYA 1S46A 1PX3A 4AEFA 1Q85A 4CNUA 4RDYA 3BJFA 5REQB 1R2RA 5A69A 2ABAA 4O28A 2NXIA 3NQEA 1PAMA 3UJFA 1YTEA 4F0RA 2FZDA 3WYZA 3O6YX 3UQNA 5F1VA 2OT1A 3RM8A 4NIRA 2VOTA 1LYXA 1E4IA 3USBA 4B3ZA 4HCDA 1EDQA 3GYCA 3LHTA 2G41A 3KOXA 4J28A 2WJDA 3ARVA 4PRWA 2DZAA 2F9RA 3DFNA 4JN7A 1PHQA 1JZ3A 3S9IA 3SN4A 4ZE4A 2TODA 4GKTA 3PY2A 3CQ0A 3E3HA 4UFHA 4PL1A 2XN0A 4ZB2A 5G2WA 3T44A 2GJLA 4JKMA 3UJSA 4F0HA 3SSZA 4N9DA 4H8HA 4QX4A 1DPMA 4TU1A 4H9UA 3K4WA 3UY8A 2XZ7A 1ICSA 3QGKC 4O1BA 3P61A 2AMGA 3V0TA 1Q4NX 3SI9A 4ADSA 3NPVA 1VLWA 1XF0A 2FPVA 4QEEA 4Z1CA 4ECLA 1QPRA 5BZAA 3UR7A 2W67A 4FXRA 1BF2A 1WXYA 3EPOA 1XQKA 4CNNA 1V6XA 3WNLA 4RDVA 4LF2A 1BG9A 1ZBVA 4HYWA 1Q2SA 5H2ZA 2EPNA 1QW9A 3NQFA 3B3DA 1XSKA 2HJPA 1M65A 3VZYA 4TQTA 1UG6A 1VGAA 1YMYA 5BWFA 1RAKA 3WQWA 3CMFA 1QBAA 3NZQA 3F4WA 1HJQA 3BQ6A 1ZCCA 4IGMA 3ZJ8A 4S38A 2Y7DA 2JFEX 4C6JA 1FFRA 1EPXA 3RILA 3KM8A 1T8QA 4WKHA 2YR1A 1NELA 1KFKA 1KRCC 4NY2A 3G8EA 3OBKA 3UCDA 3BE7A 1AJ0A 1BVWA 3QXBA 1UZ1A 1M1BA 3SY1A 1PVNA 1UJQA 3W7NA 1SZFA 1G67A 3PPCA 2V82A 4WSHA 2DZSA 2D3LA 1HG3A 4WDWA 4AEOA 3TNOA 2H90A 3R43A 4OFCA 3GYEA 3C0QA 3H23A 5A6AA 1OFAA 1CGYA 3ITXA 2CERA 2IPGA 4YU1A 2RH9A 1BQGA 3H24A 1L9WA 4OT7A 1US2A 4S1FA 3SJNA 5DY2A 4S3AA 4UFLA 2TMDA 3F2BA 4GQQA 4MKSA 4KEMA 4LU0A 1NARA 3B97A 1M7OA 1TWDA 2VOMA 1WOBA 3LRLA 2QAFA 1TR9A 2JALA 4DJFA 3PWGA 5CEWA 3IIZA 4MWAC 1UJPA 2CLFA 4YNGA 1REQA 1A5KC 3W73A 1Y8BA 4Q4KA 2J4GA 3AALA 3D5HA 2YIHA 3MJYA 2Y5JA 3BG3A 4PCTA 5FF3A 3LPGA 4EIVA 3UETA 2NVCA 5LA1A 3PJTA 4NJJA 4AZHA 4LVDA 2DVUA 2VX7A 1J0KA 4Z2GA 2GQ9A 2CZFA 4GI6A 3M1ZA 3OA5A 1VYSX 3BXWA 3TSDA 2EKCA 4DZIA 2UY4A 2FH6A 1VBHA 2WXDM 4AISA 4ZGYA 3MUY1 1TRDA 1Y0EA 3H26A 5A8OA 3C2EA 1WKFA 4JCMA 3HG4A 1SO3A 4X0VA 2NX9A 4LWWA 3H4WA 4X2PA 5BMXA 1PUDA 8A3HA 3W02A 3EDKA 2CKRA 3SRKA 1VYRA 2AAMA 3AIWA 1B90A 4I5RA 3N9SA 4ERIA 3DZ1A 4LS2A 1GZJA 3QH2A 4O1FA 1EOMA 1V3IA 2PF0A 2WLYA 4D6EA 2J27A 2E1DA 3HQPA 1S2UA 4BWLC 2OOFA 3FHQA 2ABBA 1F76A 4GC3A 2CLKA 2F38A 3LSBA 3PZNA 4DUVA 2ZZ1A 1PL9A 1R3TA 2UY3A 4AG0A 3W7EA 4QE4A 3DYMA 4HA3A 4JPGA 1MMFA 3HJEA 4C6QA 2DVTA 3G18A 5C7HA 2E6AA 3PTKA 3IUHA 3NQ8A 1KCKA 3QZ6A 2W6RA 3EDEA 4ATWA 3RLUA 3N3TA 3I7SA 4JIQA 4KFOA 1RP9A 3EWXA 3P2VA 2FPYA 5BRQA 3QN3A 1O4UA 3R94A 2WZEA 3WFLA 5I02A 2PB1A 2J7DA 3QV9A 2G96A 2QGHA 3BAIA 1MWOA 2WHLA 4PN2A 4HD5A 1MUCA 3THAA 3DG6A 2ZA2A 4H9XA 2VURA 5I6SA 1NP0A 1XLGA 3VOFA 4N2YA 4D6DA 5A3HA 1UIPA 4GO9A 4S23A 1ICPA 1HFBA 1UD8A 1WCGA 3MYPA 4CNPA 3APGA 1FH9A 3VDCA 5E9XA 1DWGM 1EYWA 4OUEA 4M80A 1JRBA 4GUFA 1XIJA 1E9LA 2YL8A 1ZY9A 3EX4A 2O4QA 3E0IA 4AVFA 3ALGA 1OG6A 1TREA 3URNA 4LNYA 3WL1A 3PZOA 4LGXA 4XK2A 4XVEA 2GL5A 1MEWA 4C1LA 2WNWA 3H4GA 3TC6A 1TPEA 3S42A 1EKOA 4LB3A 2NWRA 1IXNA 3R8GA 2IPFA 1LZOA 3LX9A 4ATDA 4L5ZA 2JGQA 3CLMA 2ZUWA 1FOBA 2O9PA 4OBRA 2WMGA 3BDKA 4QLLA 3E2QA 3L0NA 4NZ4A 5JBDA 1WB0A 2C19A 3EDFA 1DWFM 1FDJA 1RLDA 3U4AA 3AFBA 3ABOA 4PUKA 3LRMA 4B5SA 5AHFA 4I5XA 1C91A 4B5WA 2PPGA 3P14A 4LCQA 3HPSA 5BOEA 4C5ZA 3LHVA 4UTJA 2PBGA 4EAYA 1HTIA 4H7CA 4QP0A 3RLHA 4FO4A 3SCNA 3QC3A 3TYZA 2PDXA 4IIEA 2PWFA 4KGJA 1SFSA 4RCXA 1KKRA 4J2PA 1ELSA 3IAPA 2TYSA 1OBAA 2HPIA 3UZXA 2CETA 4P5UA 3W27A 5DY3A 1M9HA 4LNCA 2Z2UA 3AXXA 5LIYX 4UTWC 4QE5A 1LL4A 5A6TC 1GQKA 3THUA 4Y9NA 3FIGA 3WQEA 3AHTA 5KINA 2XWDA 2V30A 3IGHX 4N6FA 1GG1A 3E2VA 3IIPA 1UH3A 1CXFA 4QG8A 1BWVA 3IPWA 2NLYA 3QFWA 2OSWA 1ONWA 4HMDA 1GOWA 2XJ7A 1C7SA 1Q3NA 1TPB1 5G1YA 1RV8A 4ZTXA 3IIOA 1NWRA 2PCEA 3S1WA 4LW7A 1DV7A 2AGTA 3SRFA 2PDMA 3CC1A 2AL1A 1QI4A 1I2OA 3O7UA 1XCXA 4H8VA 3KTSA 1BGAA 2E5DA 2Z6IA 1R9ZA 1PIIA 5C9XA 3UXAA 1TVPA 4IPPA 4ML9A 3VNJA 4EVZA 2PLJA 2GWNA 3RX3A 4F9DA 1F7BA 3W2UA 2YFNA 1MDLA 4M1RA 2FVKA 3DXIA 3T0CA 2CYGA 1BSLA 3HF3A 3SCRA 4I3GA 3AS2A 1WUFA 3VUPA 1FX6A 4J3UA 4HMNA 1T41A 2PDJA 3HU7A 3C3UA 4PMXA 2V6AA 3A22A 4B91A 1Y7VA 3WD0A 3KDNA 1MFUA 3PP7A 2FGBA 2ZRVA 1K9EA 1LG1A 3V1HA 1AQ0A 2SFPA 1E1CA 1X38A 4DO7A 1EUNA 1PDZA 5HNUA 3B8TA 1OCJA 1HL9A 4GISA 1XBZA 2PUZA 3BLIA 1W3LA 3GAKA 4GWEA 4MFEA 4YTQA 1GHRA 4S3BA 4UQBA 7ODCA 2CWXA 4HNTA 4AHPA 5KZEA 5CKSA 1XICA 5AZ1A 4R85A 3LCHA 1TV4A 1MQRA 3SCPA 1M7PA 1OM0A 2PRHA 4AMCA 2PLCA 1UWUA 3WBWA 5I3IA 3M41A 1LLWA 1HZYA 3GDLA 3EWUA 3GC4A 4LYPA 4IMGA 1QHZA 4CQDA 4W8AA 3MSDA 3B8IA 2OEJA 2VUNA 1B2YA 3TCSA 1CEOA 1QWGA 2NXHA 1H62A 3TN6A 1B57A 4RE4A 2OX1A 3KVKA 4E6MA 2OR2A 1FXPA 2E40A 1ITUA 1RZMA 3TTOA 4F0KA 3JR2A 2CU0A 3BK0A 4DHGA 3NZRA 4DBWA 2XTKA 3C0SA 1B1YA 4YWSA 1Z3NA 1U83A 2NQ9A 1SFJA 1JZ2A 3KEHA 1W91A 4NYYA 4GINA 1EQPA 3UZYA 1QI2A 1ODUA 3TJLA 3WFZA 1UH4A 1FWSA 2Q3OA 4GJ1A 1OZQA 1JCNA 5KETA 5FL1A 4UTHA 2FVLA 4AD3A 5A8PA 1WBHA 3A47A 2EEXA 5LIUX 3QV6A 3H22A 5CGQA 1OG0A 1GQNA 3SW6A 1E15A 4M6PA 1EHAA 1JQVA 4AZ6A 3QPYA 7CGTA 4JTEA 1AH0A 4H9YA 2FZ8A 5IM51 1IT0A 3K4DA 4GA8A 1H5YA 5HUPA 2Q8ZA 2YXGA 3VD9A 1SSGA 2GUBA 1BHGA 5AYZA 1DXEA 8XIAA 3R4IA 3AU6A 3F1QA 1AW1A 3ARTA 4UZSA 2A3EA 3BG5A 2GDQA 3LLDA 4IH3A 3WUFA 1W1ZA 3M43A 3HQNA 5H8PA 4LBRA 4UQDA 1GUVA 1RBAA 4XIAA 1CGVA 2WM0A 1TPVA 2QUVA 1O1ZA 2B7QA 3VX1A 1HN1A 1W3TA 3KZSA 2RDTA 1BVNP 4FALA 1RQHA 2PU1A 4W86A 1W1VA 4DF0A 3LHZA 3PWAA 1QHPA 1KM6A 4NJHA 2D69A 1WO2A 4CD4A 5CG7A 1JDFA 1GYNA 1YNPA 1V3JA 4GQ0A 2FYMA 4PMYA 2WC3A 2WMKA 2B7PA 3GM8A 3R89A 3LCGA 3MJMA 3SDOA 1FUYA 3G3MA 3CK5A 3AYTA 4OU1A 5ABGA 2H9AB 4PBFA 2CKSA 1WPCA 1JR1A 1DHKA 4YCOA 4AH7A 1WZAA 3FJLA 3DDMA 3WLQA 4BQ3A 2EPHA 5D05A 3SN0A 2VC5A 3O63A 2Y8VA 8RUCA 4MZ1A 3ZLFA 3DX5A 2HRWA 4BHYA 1J9YA 1HKMA 3PHAA 3W1XA 2C16A 5HJLA 3QPZA 4Z1DA 3W1TA 3DIPA 3ONBA 1S5NA 3CZKA 1POKA 2YOCA 2DIEA 4ZSTA 1JIBA 3SB0A 4JFUA 1E6QM 3BSMA 3ABRA 4UR8A 2PDWA 5AN7A 1KTBA 3M0KA 1V08A 3MZ2A 2BVDA 3BMVA 3FAWA 3OQEA 1LM1A 4HZMA 3R1ZA 2PEVA 3KL3A 3TCEA 4J40A 3PK7A 2CBVA 4PTNA 3L5AA 5I00A 1EP3A 4IJCA 2O0TA 2QCDB 2GVLA 3GH4A 4H9MA 1VBRA 5GNYA 3B0UX 1UASA 4B90A 5BRPA 4JS3A 2TPSA 1V6UA 2P76A 4HOZA 1VJSA 8XIMA 4CGTA 4AXNA 3BCFA 3CASA 5G1TA 3KLKA 2VFEA 3CZGA 3L4ZA 4Q8MA 1I4NA 3B4YA 1W0MA 4IQDA 4RR4A 1DTNA 2RDXA 4WEVX 1RJQA 3O1NA 3TJIA 2X0HA 2WMHA 2RDUA 4D1IA 2Z00A 4C6MA 3AU2A 3SUWA 5F4WA 3VO0A 5D9PA 3HV8A 1O66A 2A3CA 1TTJA 4IMCA 4KMQA 4DJEC 3G8RA 1RVGA 1AMYA 1PV8A 3S8HA 4LX4A 3ATYA 4UQAA 2D73A 1A80A 5FSDC 3P8JA 5XIAA 2R1PA 4H6RA 4W9TA 7A3HA 3A4JA 5F2IA 1XLIA 2J24A 3IJLA 3OIXA 3WN6A 4CU8A 4PFMA 1XYZA 3CUJA 1TVLA 3FKKA 1XLKA 1K9FA 2QJMA 5A8GA 5G4HC 4A3YA 4RJEA 4QJ5B 3LHYA 3U7VA 4LY4A 2WVUA 1A3WA 1OX4B 1XLDA 4PYSA 2YCLA 3UCCA 4GYFA 3DHFA 3OZOA 3CHFA 4M81A 3GXTA 3VM7A 4NKCA 1IIHA 4XO6A 4PMZA 3AMKA 2CESA 4RXGA 4AF0A 4A8LA 4IT1A 1P5BA 3L2MA 4DPPA 3QBUA 4C1NB 1T8XA 3QZAA 3LPPA 4HU0A 2CBUA 1BYBA 1J2WA 4DJDA 3DFOA 3P81A 4MJ4A 5T9CE 1I75A 2WNNA 4CVUA 3HA1A 3FJNA 1GNXA 3EB3A 3R10A 2VX5A 1HF6A 2Z26A 5I3HA 1U2YA 3IK2A 4HA4A 1TKKA 4JHOA 1Z9AA 4Z42C 3LBMA 3RRAA 4XO7A 4AD5A 1MRQA 2PLKA 5HXMA 3TA6A 3MVIA 2V68A 3W1NA 3RCYA 2NX3A 2NW0A 4RZBA 3I3EA 2BMBA 2WSPA 1W5QA 3VIIA 5IHRA 1ISWA 3UU0A 2GZXA 1XYCA 3PZGA 2G97A 2RAGA 4PCFA 3F5LA 4U2ZA 1RPXA 1P4CA 2POZA 4X0NA 1WKYA 1CENA 1VC4A 3NURA 4Z08A 1V79A 4M82A 1BVZA 3BLEA 4LVAA 4OKDA 3NQBA 2ZUMA 4AX7A 2DZPA 1V4YA 3P93A 1PYMA 1E73M 1E3XA 3SIZA 3ZO9A 1DXIA 3DAQA 4AD0A 1TZZA 3HGRA 3U0HA 4LBUA 3SQLA 3W86A 1OEPA 4Q4QA 4GFIA 1P0NA 3P84A 1QRQA 2ZUVA 3VE9A 1YTDA 4ML4A 4RDZA 4Q8OA 1F8IA 1OX6A 1TO3A 3H7VA 3C2YA 2C0HA 2HWGA 4F79A 2DZBA 1DBTA 1UD3A 2XH2A 3LENA 3N2MA 5LHFA 5BU9A 2GOUA 3YPIA 4GI4A 2FZMA 3QTGA 1EQCA 1CLVA 3AYRA 3WO8A 1G5AA 4G6CA 1P0KA 2IQDA 1GOOA 4X9YA 4PEEA 1KQYA 2ZTKA 4BF7A 1DJZA 1D7KA 5CH9A 1KGXA 3EA3A 4IMAA 3SGGA 4HYVA 4V33A 3KDOA 4JTIA 1V93A 4D9PA 3ERPA 2XGIA 1ITXA 2Y4SA 2VGFA 1HJUA 1QW7A 1I6NA 1NU5A 4IG2B 3VIFA 3G1YA 3GHSA 4FEZA 1B30A 1J2BA 5IBXC 3IVTA 4O52A 1CDGA 1WX0A 3T0BA 1IZKA 3TWAA 4O18A 4OBSA 3GNXA 4DWSB 4KQNA 3AMDA 3VNMA 3WH7A 3TIMA 1XKJA 4HK7A 3FN9A 1A50A 3UERA 2CCRA 3CUHA 4JQAA 2GJRA 1HP5A 1MVYA 3ZSTA 2TAAA 3WLMA 3LNPA 2RDWA 1FWEC 4XKYB 3GXPA 3PTMA 2PGWA 3HQ1A 1JFXA 2QLYA 4U33A 5G1MA 2R94A 1HJXA 3UGVA 2D0HA 4PMUA 3AIUA 1JZ6A 1OYBA 1XYFA 2X1IA 1EC7A 4F48A 1KR0A 1FWJC 4IF2A 1OT2A 4FNRA 3HMCA 4LANA 1M68A 2X09A 4HOXA 1UC5A 3K8KA 4IMDA 1JGIA 2OLSA 2YL6A 1BWKA 1KFJA 2ZZ3A 1VD6A 2QCHA 1XFCA 4IFKB 4IXHA 1HKJA 4TTUA 4H3DA 1YADA 3RITA 4ACZA 4O1AA 4PC8A 3TAKA 3G1AA 2B7NA 4O0KA 4CD6A 3P5YA 4J35A 2ZRWA 1TTQA 4NZ1A 1OVDA 3CHDA 5LIXX 5FAJA 1LCOA 3S1UA 3WQDA 1VRXA 3B0VC 4C6BA 1BXNA 1FHLA 1EIXA 5BW6A 2PC4A 1R2SA 4NASA 1MW2A 1AG1O 3G0UA 5LHEA 5LNWA 1FKWA 1Q6LA 3GXDA 4LFYA 2YDQA 4GO8A 4QFUA 5BXRA 2ZZ5A 3G1FA 3A3HA 4AHQA 2WWCA 4WGXA 5EBUA 3MV11 2C71A 3C2RA 1WDWA 4QG6A 4EWND 4PEKA 2V2CA 3EA1A 1BAGA 1G4PA 3HJZA 1WXJA 2XIBA 5HNRA 5FI8A 1LL6A 2MNRA 3POCA 4GD0A 1MI3A 1IGSA 2GOKA 4PSPA 3TMLA 3ICJA 1NWTA 5DBUA 4XZBA 3VOIA 4WY0F 3WF0A 4C6NA 2HROA 3RX2A 2CITA 2NLIA 1L6SA 3QYSA 1Z6KA 3QM3A 4RE2A 1GYMA 2DVXA 4EF9A 3G1SA 4XX6A 3PPGA 1FWCC 1NM9A 4B3KA 2B7OA 4H6EA 4A2SA 3WD2A 4H00A 5D33A 1H51A 4XTIA 5KTLA 4RV3A 3BC9A 3ALFA 4IIBA 3IJQA 2FB2A 3T8QA 4WGHA 1GORA 2HMCA 3COTA 1GGOA 3VC6A 1J93A 1Z44A 1HGYA 3O16A 4AC1X 3WCZA 3TFCA 1KBKA 3BAJA 1VIWA 2GJNA 3GTXA 3LD5A 4AU0A 1EP2A 1G4TA 3FVMA 2E77A 3J7HA 2H8ZA 2GQ8A 4K1GA 1Q7MA 4CN6A 2CLOA 2VWTA 1ZLPA 2C6QA 3R13A 3N2CA 4ZQMA 3ZSSA 1W9BM 5CBJA 4JN8A 3GVRA 1LBFA 2DW6A 3GS6A 3LMYA 1YPFA 4D8LA 1LJYA 1OD0A 1VF8A 7ENLA 4MY1A 3WNOA 1TMHA 5B7YA 4HU8A 1MZRA 3WENA 1Q65A 3KHJA 2EPOA 3DECA 3VX0A 3DU0A 3HFYA 4WKAA 4NAEA 3FCPA 1N82A 2QCLA 1TIWA 3DC0A 3NQVA 3UG3A 4OOZA 3EX1A 3NOEA 4AFYA 2ZX6A 3HFTA 2IQTA 4FB7A 2A4AA 2VO5A 2YX0A 3WK0A 4ATLA 5C2CA 4HTBA 1X8FA 1J01A 3S2CA 5D09A 2ALDA 1A3XA 4JIPA 5CPOA 7REQB 4PMOA 4E0CA 1OJXA 2Z1BA 4JL1A 1QI0A 1V3MA 3BWWA 1VFMA 3MSYA 3VABA 3T2OA 1QNSA 4GH1A 1IGWA 1YYAA 3W2NA 4MGGA 1TE1A 2YCJA 3E0WA 1N2VA 4K1WA 1LLZA 4YN5A 3U2EA 5K9CA 3OJGA 3EWWA 3MHFA 2GJXA 1ESWA 3ENLA 4PGLA 1OZMA 3FYPA 2G0WA 4NNAA 2YBVA 3LY0A 2G5WA 4ADUA 1Q4WA 1E0VA 3ME3A 1UC4A 4TV6A 2EQDA 5E5CA 3TW7A 1V6VA 4JEQA 4D6IA 4BF9A 1ZJBA 3LG3A 1K4HA 1X6UA 1EUAA 4C6OA 3Q65A 3UD6A 3GHRA 5M2FX 4L64A 3V36A 3WLLA 2YCLB 4I6KA 2PDNA 1JD9A 4GBUA 4OGZA 4ENLA 5DF0A 4ZBCA 3QSRA 1K9DA 3MDWA 4L4LA 3RXZA 1YDOA 1XCFA 3W76A 4WOZA 2BY2A 4MNLA 1KO0A 4L1XA 3AXHA 4WJXA 1IE7C 3XINA 4MIMA 2DZTA 1OSEA 3CWOX 2QUMA 1WQ5A 4M5PA 4WDXA 4FNQA 1JG9A 2PDFA 3FEMA 3W2LA 2VGIA 3NSNA 3CNYA 1KLYA 2QDGA 3T0DA 1Q63A 6XIAA 1LRNA 4PE8A 3FJ4A 4Q8TA 1F05A 2WCAA 1CGWA 2DQWA 3VKJA 2Y88A 2DH2A 3RFAA 3MW7A 3CV7A 3SM0A 2HPMA 2V81A 3KRBA 1H5VA 3OODA 1ZL1A 2J8GA 2IMRA 3N15A 3MTWA 3H55A 3TXVA 1P43A 2ZXAA 5CAHA 3LQGA 1VR6A 4XUGA 2YLAA 4O0ZA 4JEJA 3AIRA 3C8FA 2BY3A 1R3SA 2ACSA 5AY7A 3VILA 4UCGA 2F61A 1IWAA 4JDYA 4UIOA 4WRHA 3VGDA 1DWIM 5AYBA 3NM3A 1OGGA 1FWAC 4IGHA 2V63A 3SY5A 2DSKA 4BQ4A 4P7QA 1E72M 1VFUA 3O9NA 2E9MA 2QCFA 1TRIA 3GNDA 3LCIA 1NF0A 4NUWA 4AIOA 4AZBA 3PJWA 1PJ9A 4F3HA 3TJXA 2O92A 1UCWA 4OOUA 3AROA 3RLVA 1G6CA 3M0IA 2QAPA 1G01A 3L66A 3ZM8A 4XSLA 4QEHA 4ZSUA 4N4PA 2D1ZA 3C8NA 2PBOA 4JTUA 1W3HA 1RSCA 1JPIA 5GJNA 1H7WA 4F2BA 1HUVA 4J4KA 4HGXA 1B3WA 1PTAA 5I07A 3NVTA 4P7OA 2Y85A 3ARPA 4D6JA 3W1UA 4F0LA 2IXVA 2V5DA 1J18A 4HNLA 2HXTA 1W5MA 2GSHA 3GBEA 2HCVA 3HPFA 1V51A 1CXHA 3WJZA 3LMZA 1C90A 2PZNA 4DBUA 4GQRA 3GKFA 2R1MA 1H7XA 1X1ZA 1J5TA 2ZE3A 1TPC1 2WJZA 3CL6A 3I7RA 1VZWA 3AOFA 4ZXOA 1FWWA 3UNTA 4RUBA 2CLIA 2AQOA 3NQDA 3EOUA 1B3ZA 3CB8A 1FWRA 4UMBA 3MKCA 3TJ4A 3LDVA 5CGMA 1O60A 4I7VA 2W61A 3GTHA 2XIMA 4B2DA 3MUCA 4K3ZA 3CO8A 3H8AA 4AC7C 1PKYA 1XPYA 1MXSA 1AQHA 2VFIA 5AFDA 3PBYA 3VKDA 3C6CA 1X97A 1SVDA 3CAQA 2BHZA 2BOEX 3BLFA 5IDZA 1AVAA 3NPUA 3RF9A 3TQVA 4E2BA 4LJ3A 4Y8FA 1TPWA 1BWLA 3QOKA 1E1EA 2I14A 5D2WA 3KWSA 3W88A 4FA3A 5IFPA 1K3UA 3DBPA 4WX2A 1XPGA 4MWAA 3Q58A 1NOFA 2P10A 3I3BA 1IWPA 1S2VA 4YJ5A 4INFA 2WK2A 1UR8A 4PMNA 1OB0A 1E6RA 1W8GA 1A4LA 2ZE0A 1FRBA 3BV7A 1O7AA 3TR9A 1SMAA 1NDWA 1J0HA 3VOGA 3TTEA 1PX8A 4FX6M 3PUGA 2P0IA 2ZUNA 1JVNA 1JYXA 3EPNA 1B3OA 3N4EA 4KWUA 4KESA 4Q22A 2WSKA 2GGJA 2BG5A 3R0DA 3FX4A 3SADA 3FDGA 2WVTA 1SW3A 3WQPA 4IFOA 1TZ9A 4RZ6A 1F8MA 1XD0A 4LRTA 3BAWA 1XJBA 3OLIA 4GIYA 2G8ZA 5CSYA 4D8ZA 4O11A 1T99A 3F2CA 3H2FA 3B0PA 1I0DA 4X61A 4BI6A 1J0ZA 2VYOA 3KRUA 3NZGA 1GONA 2GUYA 3G1RA 3THQA 4XAYA 4GY1A 2DFAA 1GJUA 3KL0A 4GUGA 1Q6RA 3WUGA 4BWLA 2XYLA 3UYIA 4M1BA 2X7WA 1LROA 3WQ4A 4GGBA 5HULA 1E6PA 1JXKA 1V02E 3R58A 4F0SA 4E2VA 3ZR5A 3EA2A 2Y6ZA 4Z2IA 4DEFA 4AD2A 1T0OA 2ISVA 1EXPA 4IJBA 3RYSA 1BEUA 1T5AA 3LERA 3S5ZA 4HNOA 1GQIA 2D2JA 2E9LA 1V5XA 6ALDA 1RY0A 5F4SA 5G5IA 2DUZA 3ABQA 2OCZA 3LTSA 5JH2A 1KRAC 3LUTA 1R38A 4REQB 3MWCA 4JQ3A 2ISSA 1F4AA 2EPMX 2VWSA 1E40A 2Z7KA 2NQLA 3EWYA 4DWSC 2FHFA 4JTFA 3BUVA 3CMJA 4NHVA 2QGYA 1ZS2A 1HL8A 1VBJA 3TYEA 3HBLA 3AZTA 3C2OA 2J6XA 4UB9A 1KBLA 2R6OA 3AUJA 3DHUA 2GVYA 4IPIA 3W7HA 2IKIA 5LZLA 3KOWA 1OHLA 5ABTA 1XYLA 1BKHA 1YNQA 3MWAA 1D2KA 1NSJA 2Q09A 4DVOA 5HATA 4O54A 2HISA 2GLKA 4Z2JA 1UWQA 2F8QA 4U3CA 2V67A 4PUEA 1JCLA 1CXKA 2DJXA 3LV5A 5AOUA 3GC2A 2I56A 1XG3A 2Z0IA 1B4KA 3UG5A 4DBSA 4QHRA 5A6LA 2ZKMX 1FH7A 5T9BG 1MFVA 3APYA 5BMWA 2E68A 3A13A 3CZLA 1YNYA 5A8MA 1J6PA 3T55A 4P61A 2J9ZA 3VGBA 4YHGA 2AKMA 2EG6A 2WVVA 5AHNA 4BQ2A 2E4TA 3EYPA 1V77A 3EX3A 1W9DM 1JZ4A 3M9YA 4A35A 3WH6A 4AZGA 5AECA 4V27A 3IK4A 1UPPA 5CJNA 2F84A 4DO4A 3UESA 5F2MA 4DB7A