3W7EA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-5-179
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
313
structure length
313
Chain Sequence
b'MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Trypanosoma cruzi
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-5-179
rcsb
total genus 107
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7eA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7eA01
4Y9AA 4IX0A 4GUFA 1D3GA 4BI7A 3GR7A 4JTSA 1KLZA 2X16A 3N3MA 1VS1A 1W5PA 4RX0A 1ML1A 5CPOA 4N2YA 4ADSA 3P8JA 2XN1A 3EX2A 1OYAA 1XUZA 2GJLA 1DOSA 3MHFA 1AG1O 4LC6A 4JDBA 4WOZA 3O1NA 4BI6A 1XCFA 1YLVA 4KFOA 1N8FA 3E9AA 1X1OA 1VR6A 5I3HA 1I4NA 2QJIA 1OG0A 2Y89A 1LORA 1N55A 4FB7A 5H91A 4O1BA 1W3IA 3N19B 3QM3A 4R33A 4XWUA 2QAPA 3DHDA 3G22A 5D2WA 1K3UA 1OFEA 4QNEA 4JTEA 1U5JA 2YZRA 3I65A 4M7SA 1BKSA 3L0GA 3TU9A 4BK9A 5G4EA 1K8XA 3CM4A 5K9XA 4AMAA 2V5LA 3L21A 1G7UA 1ALDA 3NOEA 3TDFA 5F2GA 2VEPA 2YPIA 4UTWC 1G69A 1PIIA 1QAPA 3EB2A 1WA3A 1YPIA 4Z08A 1VYSX 3KOFA 1O4UA 3W1TA 3FKRA 1SSDA 1H1ZA 1IF2A 1HL2A 2A7RA 1JCNA 1SFJA 3LRLA 1O60A 2DZUA 1ZY9A 3GXPA 4TX9A 2YSWA 1FXPA 4UTHA 1XM3A 4K8EA 3S6DA 4FNRA 4O1DA 2PCQA 2QCDB 3IIXA 2HS8A 3RF9A 2VENA 3FFSA 2C0AA 1QPNA 2ISWA 4GJ1A 3MJYA 1W3TA 1WOAA 3DFPA 1L6WA 1MEIA 1S3HA 4JTGA 2CZ5A 3IIVA 2NXHA 2G96A 2YGYA 1VCVA 1OJXA 2HS6A 2ISVA 4O0ZA 5CKSA 3Q94A 1ICPA 5HR6A 1E51A 2BXVA 1SSGA 3IVUA 3PULA 1YADA 1GTEA 3UZJA 5CPMA 1UASA 3INPA 4NX5A 1EUAA 4MIMA 1GJPA 3G0UA 1F7BA 5KTLA 2QUTA 4NJIA 3HGJA 1JCLA 4LVAA 2NUWA 1OX6A 3BLEA 2VEMA 5CSSA 1GT8A 1VQTA 5HMSA 3STEA 3TMLA 1IXQA 2FQIA 3A5VA 1XBXA 2B7QA 3TA6A 2YYTA 4LUIA 2NXIA 2QCMA 5EY5A 1ME9A 1KFLA 4RZ6A 4LS0A 2PRLA 1X8FA 1YDOA 1MXSA 2VOMA 1KFJA 4JTFA 1I2QA 1H7NA 4XQ6A 1W54A 2NV1A 4LUJA 4WY0F 4ZQOA 1GVQA 1VJIA 1GWJA 2PRMA 1UCWA 1P4CA 2G95A 4GUIA 3ABQA 2LLEA 2ATSA 3F4WA 2HSAA 3BLIA 4AEOA 2WNNA 1XBYA 3P84A 1THFD 2Q8ZA 1JUKA 4MFEA 2YW4A 3BGGA 1VLWA 4YLWA 1VCFA 2WKJA 3SIZA 2ZFAA 3HMJG 3NDOA 2Y61A 4A21A 5E93A 1HO4A 4O16A 5TIMA 1JVNA 3UYCA 3WFAA 3W1MA 3JRKA 3MBFA 3NPUA 3SECA 3PS7A 3HJZA 1F6PA 1J4EA 4CNOA 3W9ZA 1W8SA 5BNKA 3VE7A 1ZFJA 1C29A 1HFBA 4OGZA 5D30A 3EWYA 1LRQA 1SW0A 3W1LA 3OG3A 4KWVA 4WXZA 3EX4A 2V8ZA 4JNMA 4LY8A 3QMSA 4O18A 1SZEA 1Q6RA 1O94A 1C8VA 2ZA3A 5D2TA 2P1FA 1GOXA 3M41A 3TV8A 3TQKA 2VFDA 4R7JA 2B7NA 2WJZA 2RDTA 1ADOA 4PTNA 2QKFA 1H5YA 4AB4A 1YDNA 2XFWA 1T96A 1FBAA 3C61A 4NNAA 3NQGA 1GQNA 3H54A 1GVOA 4P61A 3OVPA 3R8RA 3P8IA 4ZVJA 5AFDA 4GE8A 5C55A 1ZAJA 2E68A 1WV2A 4ONVA 4WX2A 1HG3A 3LCLA 3GZ3A 4K38A 1NEYA 5BMWA 3W2MA 1FY6A 1G4EA 4WQ6A 1B3OA 2Q8LA 2B7OA 4S2CA 2NWRA 3LXBA 3THQA 4KFNA 4MYAA 3W2LA 1YTEA 4TO8A 4NJJA 3FA5A 2YW3A 2V30A 4UR8A 2C18A 1U83A 2EPHA 5AHLA 1LROA 2C3ZA 4H4IA 4QIUA 3T55A 4ICNA 1FXQA 4P2VA 4N4QA 2QCFA 2FLIA 1GPWA 5BRBA 4LU0A 2RDWA 3FKKA 3M7WA 1FDYA 3NQ6A 4FEZA 3SZ8A 5G1YA 1MZHA 1W31A 4TMBA 1EPXA 2E5CA 2ZRVA 1S5VA 2Z6IA 1OFRA 5FEXA 1IIGA 3C2OA 1ZAHA 3TC6A 5HQEA 4NX0A 1L6YA 1K02A 3NL6A 2GVLA 3PB0A 4EF9A 1TO3A 2CWNA 2NZLA 4YWIA 1M6JA 4L4MA 3FLUA 1OHLA 3GIYA 4LWWA 4E2BA 1XXXA 4LVGA 1L2UA 3MBDA 2E5DA 4FX7A 3W1NA 1K8YA 5K9DA 3QZEA 3TQ0A 1RR2A 4ORMA 5AHIA 3NR0A 4HNUA 3TFCA 2ZZ6A 4XKYA 2P10A 4MZ8A 4Z1AA 3GR8A 3G1AA 5D32A 1DQXA 1LP6A 3ANYA 1Q6LA 2O7QA 2OMAA 1I8JA 3W7CA 2ZZ2A 4O0KA 1G4TA 2PURA 1TRIA 1TPDA 2A0NA 1OK4A 4UFKA 4CQ9A 3P61A 3E96A 3NM3A 5HUOA 3LXAA 5AB3A 4FNTA 2GVGA 2FB2A 1SFLA 1D3HA 3DBPA 3G24A 2VKZG 5C6MA 3TROA 1N7KA 4HSOA 3F1QA 3HF3A 1QFEA 1TMHA 4UFMA 4W9TA 1R2RA 2VXNA 5LGZA 1W1ZA 4Z1DA 2AGKA 1I2RA 2E5BA 1GVFA 1R2TA 3P5YA 3OA3A 3W76A 3DU0A 3LCIA 3USBA 3ZR4A 4R34A 5AOUA 1JCYA 4LS2A 1YXYA 2X30A 3FEMA 5TQLA 5IBXA 3C6CA 5E0KA 4EOUA 1PE1A 1M7PA 1CW2A 1XC4A 5KINA 3GXNA 3O63A 2GQ9A 4M6VA 2PC4A 5F1VA 1SZNA 1O5KA 1DV7A 5IM51 2JKEA 2A5HA 3LX9A 4AHQA 5U4NA 1G67A 4A2SA 4H3DA 4UMCA 3P80A 3K30A 3BPWA 4XZ9A 2H3BA 1G7VA 4ML9A 4ZQMA 4O19A 3LRKA 2QR6A 3P7YA 3RLUA 3SGZA 4UNLA 1OFDA 2HMCA 5FF4A 3C56A 3LHZA 4TU1A 3C4UA 4JXCA 3V1PA 1OVDA 2CLHA 5EPDA 2A7NA 1KW1A 2CLLA 4KWWA 5DY3A 1TSIA 4I7VA 3IGUA 1KA9F 1WBHA 3TW7A 1TRDA 3BV4A 4GUHA 4JTJA 2X1TA 3QQ1A 5AHNA 1EUNA 4MZ1A 4EF8A 3QW4B 3W84A 1GTHA 4A22A 2EKCA 2NXGA 3PR2A 1NF7A 2A6LA 2CFFA 2RDUA 3L65A 2DZVA 1H62A 4MYXA 1ME8A 3BG3A 3W1RA 4RKAA 2CZEA 1GVRA 3SSJA 3U2OA 1LLZA 4JTIA 5C54A 3ZWSA 3W1XA 3G8RA 1AL8A 4NU7A 1NF0A 4HT3A 1R47A 2CZDA 3W74A 4M7TA 3HPSA 4QSHA 1XUUA 1KBIA 4JD4A 1QCWA 4JX6A 4IXHA 2R91A 1SO3A 1YPFA 4IGHA 3PB2A 5D37A 4HHPA 2ABAA 2O7SA 4Q33A 3W71A 1DKWA 2OJPA 1RQHA 5CZ0A 1ONRA 1UUMA 3GDTA 1QMLA 5F1UA 4MZYA 4EVZA 4CQAA 3T7VA 3O06A 4TIMA 1ZJIA 1SPQA 1W5NA 2C13A 3STGA 4DBDA 3TAOA 5EA9A 3KVMA 1GG1A 2CU0A 3UQNA 3LV6A 4PH6A 3TMQA 4JICA 1QOQA 4IX2A 4AHPA 1DBTA 3CEUA 3TNOA 1SO5A 3HOJA 1H7PA 4BF9A 2CLEA 3A9IA 4GUJA 2JGYA 5LHEA 3CIXA 4QAIA 1OF8A 1GYNA 2Z0IA 2V5BA 2WSYA 4OE7A 2FDSA 1I2OA 1OFPA 4JTHA 5KITA 3A23A 4N9CA 1YXDA 2BTMA 1KV8A 3DAQA 1RQBA 3ABOA 3NL3A 2DJXA 1TV8A 2ZRYA 4G1KA 5KZEA 1PCWA 3GAYA 3WJXA 4UTMA 3B0UX 3H55A 2Z1BA 4JX5A 4CNNA 3M9YA 1KM6A 1TPVA 2QF7A 4LT9A 4Q32A 4MLRA 2PRHA 3W7RA 1LDCA 1V5XA 1H51A 2VEIA 1FWRA 2QAFA 3A22A 5ABTA 3E12A 3PG8A 3G1YA 3LCXA 2FJKA 3SW6A 5K9CA 1RV8A 2R8WA 3E02A 4UMAA 2WPBA 6TIMA 3G1FA 1W3NA 3E49A 2A85A 3TH6A 3I7RA 3UNDA 3QRHA 4IPIA 3R12A 4FNQA 2TRSA 4O52A 1VRDA 4JY9A 3TXVA 5DXYA 1NSJA 4FO4A 2Y62A 2WQPA 3S42A 4DXVA 5D2VA 3W7KA 4E0CA 4MVAA 1YDVA 4HNVA 2FIQA 3GVGA 5D2XA 1VHNA 1FDJA 5DLCA 1A5BA 3TE9A 5DCDA 4J9JA 1W56A 4N9EA 1ICSA 4LVFA 5AHEA 1TREA 1TPUA 1DJQA 1F05A 3M43A 1ZALA 2H90A 2Q3OA 3EX6A 4XUGA 4TMCA 1LCOA 3MHGA 4JN6A 3TX9A 2DORA 5BMXA 1A5CA 3LCGA 3PWAA 3S1XA 1KFKA 2A2IA 4ADTA 3W7OA 4IWWA 1HTIA 2QJHA 3ZS4A 5DN1A 3AJXA 1H61A 1PS9A 5D38A 1W5OA 5K4ZA 4WD0A 3OVQA 1SO4A 3DGRA 2J24A 3GYEA 3HIJA 1L6SA 3PUDA 4K36A 3M5VA 3NL2A 2J6XA 1O95A 4M6PA 3NQAA 1NFBA 3LLFA 4IXXA 4EWND 4L4LA 5AYXA 1S5WA 4R53A 5CPLA 4AF0A 1QPOA 4S1FA 1WAUA 2BWGA 3G0SA 4N9DA 3Q37A 4NZJA 4AF0B 1EWEA 4O53A 2J9XA 4IMFA 4UFHA 3W1AA 1G6CA 5HUPA 1KM3A 3PC0A 1JRCA 5J5DA 4IQLA 2C15A 1Z44A 4BWLC 1OFQA 3OHIA 3NQMA 4JTTA 4Y90A 1MO0A 3O6CA 3LV5A 3ABSA 4WOQA 2D73A 1KM5A 3FYOA 1H7XA 5LZLA 4UTIA 1TPWA 4HPJA 3PSVA 3QMRA 3CIWA 3N14A 2WNZA 4I7UA 3L66A 3OVRA 3ATZA 4Z0JA 3G3MA 2YYUA 4O13A 4QJ1A 1GZGA 4TR9A 4UTJA 1F2JA 4UCGA 3RFAA 3VE9A 2NX3A 2FPVA 4LRTA 3S1UA 1EIXA 3LHYA 2X1UA 3PSWA 3TKFA 4BI5A 1FCQA 3DHFA 4NVTA 3RU6A 4C1LA 1KM0A 3NM1A 1AL7A 2NX1A 1G4SA 3UWVA 3MUXA 3VKJA 3T44A 4PEKA 4YL2A 1PHQA 1VHCA 2ZA2A 4IMDA 4NNCA 1SR9A 2Y70A 1QPQA 4PFMA 4NJGA 1P5BA 1ZNNA 2V9DA 3CQ0A 4IOTA 4ZQCA 1FWSA 3DH7A 3O15A 4DF2A 5K3VA 3LI1A 5HNRA 4QNWA 3W7EA 3HGSA 3WJZA 3NO5A 4JY8A 4LTSA 4CCCA 3WK3A 3IIPA 1BEUA 3G1HA 1DQWA 3GXTA 4QQ3A 1F5ZA 2BSLA 2QCCA 1VH7A 2ZCGA 4MY1A 5CPNA 4OWGA 4JX4A 3QEZA 3W86A 5F4SA 3M16A 4HSNA 2GUUA 1TPC1 2X1SA 3TQVA 3QPZA 1VYRA 2V2HA 2QCLA 3DZ1A 5G2HA 1OFOA 1SUXA 3TAKA 3YPIA 3EKZA 2RHGA 4U28A 3ELFA 3EX3A 4DO5A 3S0CA 4MOZA 4DQWA 3WK1A 1FCBA 1FUYA 2CLKA 4D2JA 5I3FA 2B7PA 1IXNA 4FIQA 1C9DA 4A3UA 1K7XA 2IQTA 1V7YA 5FF3A 3EX1A 2JKAA 1TV7A 2W0UA 4O12A 5D02A 3N9SA 2EF9A 3B06A 3NQ7A 3QF0A 4RZ4A 1KV5A 2A1YA 1I2NA 1YTDA 1H1YA 3W7LA 3NEVA 2A21A 2DP3A 1A5AA 3LTSA 3LHTA 4IJBA 3N9RA 3GKFA 3NQFA 4H6KA 2Y88A 2E6YA 5CG7A 4NXSA 3W2UA 3P67A 3EXSA 2Q3RA 2QUUA 3LCFA 1VZWA 3IEBA 1S5TA 3PBYA 2Y63A 2JBMA 4I9AA 1Z48A 3P74A 1KTNA 1H7WA 3W22A 1KTBA 3N73A 5DBUA 3L5LA 3TUUA 4IMGA 2QUVA 2QCNA 3HO8A 2ALDA 4O4WA 2GVJA 3H53A 1WQ5A 3HG3A 3LERA 3UPBA 4DO4A 4UNKA 2EGZA 2ZRWA 4JDYA 4LV4A 4AAJA 3PBVA 1TQXA 3NGJA 4LRSA 4UTUA 3W7NA 3AO0A 4NJHA 2ISSA 2J9ZA 4RK8A 3ABRA 3A5FA 3CU2A 2DZSA 2OT0A 3F4NA 5AC8A 2WSRA 3ZWTA 1WBJA 5FF0A 4MY8A 4RCXA 3QH2A 3BG9A 4Y8FA 1X6UA 3ATYA 4LNYA 3HG5A 1K7EA 5D2YA 1LRTA 1OF6A 3O05A 1PV8A 3UY8A 1XBZA 3KVJA 4OQVA 4RXGA 2QDHA 3UY7A 1KM2A 4JS3A 3CWNA 4M6QA 4YCPA 1TJRA 2H6RA 1OK6A 4YMZA 5AYZA 4WUIA 4GXMA 3DFNA 5AN7A 3KAOA 3NA8A 2X1RA 4UFIA 5KSWA 4HKPA 1TYGA 2J88A 2W6RA 3W1QA 4HNTA 4BWLA 2NWSA 1UB3A 3TSDA 4OU1A 4A29A 3G1VA 4PCFA 4FNUA 5LNVA 4ORIA 2WSQA 4N02A 5DCEA 3FOKA 3DFQA 2V0TA 4WY0A 4WZHA 4FXSA 1B4KA 2PE4A 4DEFA 1TPFA 3MW7A 1TTQA 3BG5A 4DBEA 1SU5A 2ZBTA 2V81A 4MUZA 1LTDA 4RLIA 2GQ8A 1F6KA 1EEPA 3QSRA 2DZTA 2QCHA 1JCMP 1SQ7A 4FX6M 1EP1A 1SZGA 1G4PA 1FWNA 4QM1A 4QITA 2A7PA 3EEGA 5FF7A 4UTKA 3NQEA 3G3DA 3KRUA 2VFEA 2WO5A 3MYPA 1YTKA 5CSRA 2ZDRA 2TYSA 1F76A 1RVGA 5HR7A 3VNDA 3CWOX 3D0CA 3BLFA 4XBKA 5LHFA 1AK5A 1QO5A 5HWMA 4JR5A 3NAVA 1KM4A 1FWTA 2FFCA 3W7JA 2C19A 5F4WA 2F84A 3VFLA 1KLYA 3UPWA 3FS2A 4O50A 4YCOA 4O11A 2DZPA 4FNPA 4DF0A 3NPWA 3NPXA 4MKNA 1RZMA 2BLEA 3M1ZA 3QQ0A 3TK7A 1FWWA 3TW6A 2Y7FA 3C0JA 4FNSA 3FJ6A 3V75A 5L6UA 3DXIA 4AHOA 5AC6A 1TTPA 4S2BA 3SY5A 3EWZA 4BFAA 1B9BA 1EP3A 1JULA 1QR7A 3GNDA 2FPYA 2J27A 3IGXA 3MMTA 5TBOA 3U8GA 3GDRA 1H7OA 1Q45A 2C14A 1MEWA 1DORA 1XKYA 3MP3A 3W7PA 1LM1A 3HPXA 3HG4A 4NUWA 2GPTA 2ZRZA 3STFA 3M5ZA 1FCUA 4RZ5A 1JR1A 1KTCA 3PUOA 4JGDA 3T4CA 5F2MA 1TCDA 3PF3A 4KFPA 4Y96A 3LLDA 4LOCA 3LI0A 5DXXA 4BR1A 3F03K 4RXFA 3BARA 3BW4A 2ZZ7A 1XBVA 1PHWA 2ZZ3A 1LBLA 3GLCA 2OZ0A 3HBLA 4AWUA 5CZSA 4Z0SA 3B04A 3CB8A 3MP5A 4HPXA 5EKYA 4CCDA 2Z2UA 3T78A 2YFNA 5HINA 5AC7A 1Q6QA 5MHBA 2VELA 2QCEA 3QFEA 1A53A 2ZYFA 5F4XA 2JGQA 2GJNA 4N6EA 3LM7A 4PL1A 3WK0A 1DJNA 3N34A 5LNWA 2V82A 4AWTA 1W5QA 2TPSA 3I68A 3UZ5A 3G1XA 1OFBA 2NLIA 3W1UA 4UFJA 1LOQA 3W6YA 4X2RA 3W7IA 3OIXA 3LOTA 3DENA 1QDSA 3M44A 3GNNA 1Y0EA 1Q3NA 4C1KA 5AHMA 1XI3A 3VI2A 1NVMA 3RLVA 3U6WA 2G5WA 3NPVA 4O54A 4O8RA 3O07A 1QOPA 3W73A 1J5TA 4ZQRA 1TTIA 1RD5A 2TMDA 3M6YA 3W83A 2NX9A 4JEQA 4KKXA 3L0KA 4FXRA 1O5XA 3LB0A 1PL9A 4XBSA 3DFSA 3W7GA 5G4WA 4UC5A 3R2GA 3LTYA 3C2VA 3S8HA 4NJKA 1LBFA 3LHVA 4PODA 1B4EA 4AWSA 3LGEA 1VC4A 1TPEA 2RKXA 5G2IA 1UJPA 1RQEA 2QJGA 3QPYA 1OFAA 3MP4A 4EIVA 5GVJA 1K8ZA 3IVTA 4IMCA 3C8FA 1ZCOA 2DZXA 5FEPA 1SZFA 3DKJA 3TJXA 5HJLA 3GDKA 1F73A 5D04C 4ADUA 3M47A 3NQ8A 1OX5A 1R2SA 1HO1A 4JIQA 3PVFA 5I3KA 2BX7A 4E2DA 1LOSA 3W23A 3MI6A 4XKYB 3LDVA 5D09A 2KZHA 3QW3A 3R89A 2R94A 3MI2A 3NQ2A 4ZMGA 2I9EA 2E6AA 2OCZA 3W87A 3CTLA 5D03A 1JQVA 1I2PA 2AAMA 1LBMA 1P0NA 1EWDA 3JS3A 1DL3A 5DBTA 3Q2DA 4HN4A 1F74A 3W70A 3PAJA 3P5ZA 4GBUA 3NQDA 1IXOA 3R5EA 1M7OA 2AQWA 1P1XA 2TSYA 5D05A 4DF1A 4GRSA 1OABA 4N4PA 5K2ZA 4GUGA 1T0OA 1MEHA 2ZTJA 1Q6OA 5DELA 2ATMA 3C3NA 4GWEA 3W7HA 3QJAA 1KM1A 4O1AA 3STCA 3G1SA 3UWQA 3NL5A 2E6DA 2ZA1A 2C16A 3L67A 4OV9A 4DELA 5FI8A 5D33A 4Z1CA 3RMJA 5EMUA 3CT7A 2R14A 3M5XA 1B57A 2ZQ0A 4RV8A 3S1VA 2B4GA 4PC8A 1OYBA 4K37A 5T26A 4DPPA 4Q4KA 1W0MA 3S5YA 2EAWA 4K7VA 3S5ZA 1OX4A 3L68A 2CLIA 2VFIA 3L5AA 3TCEA 3W2JA 3PBUA 3EWXA 3BO9A 1EP2A 4X22A 4WXYA 5SWUA 1IXPA 3QC3A 1JJKA 1RPXA 2RFGA 2XN2A 3HG2A 4NT0A 4CQ8A 1TB3A 2P0OA 5FESA 2JKPA 3CPRA 2CLOA 4FX8A 4IUOA 1JCJA 3TIMA 3GDMA 2I1OA 1VGAA 2CZFA 3DFOA 1UUOA 3Q58A 3KRZA 4M19A 4NZFA 1BWKA 1IGSA 1WX0A 3HGRA 1ZHAA 4GC4A 2ZZ1A 4OV4A 2A6NA 1LLWA 4MJZA 3SR7A 3BVJA 3WK2A 1GG0A 2WOQA 4JYFA 5HWJA 3CLMA 5CGQA 4HNNA 3B8DA 1ZAIA 3TFXA 3R13A 3EWWA 4MFDA 1WDWA 5LGXA 1EX5A 1WOBA 3CHVA 4OBTA 4MJMA 3UD6A 4UTTA 3KXQA 3B05A 3LHWA 3DKLA 3I7QA 4UTLA 4NQ1A 4O57A 1JCXA 3A21A 1FX6A 4LV9A 1XDMA 1AW2A 1NAL1 2V2DA 3NNTA 2G97A 2Y7GA 3W72A 2B0MA 1TQJA 3O8AA 4O14A 4MPQA 3LRMA 5BOOA 3NG3A 1LZOA 3T40A 1TPH1 5LNUA 1H50A 2ZZ5A 8TIMA 1OX4B 3LBMA 3MI3A 3TXZA 3UWYA 1ICQA 3FYPA 1KFEA 3HGOA 3G0XA 4RJEA 2VFFA 3PBWA 3UXDA 5LKYA 2Z6JA 2YXGA 2YFOA 2YX0A 1PCKA 5U7SA 1BWLA 2YR1A 3A24A 5K7JA 1Z42A 3NZ1A 3QSTA 1XL9A 2CLFA 1A50A 3HQ1A 3TR2A 3LHUA 1GVSA 3W07A 3GK0A 1QWGA 5CZJA 4O1CA 3DFTA 3UXAA 4A2RA 2Y6ZA 4UUIA 1MSSA 1FDZA 3WJSA 5C2XA 4CLMA 1X7FA 4N6FA 5F2IA 4ZQNA 3WJWA 2E09A 3KRSA 1JUBA 3SJ3A 1T8XA 2A4AA 3N2XA 4K6AA 5AHFA 4XTDA 3UWWA 2EHHA 3KFTA 1SW7A 1WXJA 3BW2A 2H8XA 3S5OA 2QEZA 2WNQA 3SFKA 3I6RA 3CEPA 1SO6A 1QO2A 3QMTA 2QCDA 4OT7A 4RR4A 5I3IA 3W7DA 3DI1A 2VC6A 3W2KA 1LRNA 1OYCA 3OEXA 1KFBA 1T99A 4O10A 1JUEA 3L5MA 1UBSA 1Z41A 5AYYA 2NUYA 4UR7A 3IIOA 4IMEA 3IV3A 4JTLA 5BW6A 3FJLA 3BW3A 2V2CA 4UMBA 4LS1A 4GNJA 1TIMA 3W1PA 3B4UA 5FEZA 3WJYA 4FIRA 5G2WA 3UWZA 3ZFHA 3W88A 1LYXA 1JQXA 3EXTA 2UV8G 4I7WA 3TJLA 2CW6A 5KZMA 4OHQA 4ZZ9A 1CX9A 1XFBA 3L9CA 1D9EA 3TSMA 1TPB1 4O15A 5EBUA 2QDGA 3BK0A 2VEKA 2I14A 4K8HA 3B03A 2E6FA 4FHAA 4UTTC 2C1HA 3JR2A 3UWUA 1EA0A 1FCVA 3C2RA 1K03A 3RK8A 3P82A 5HWNA 3M5YA 3RNDA 3P62A 4LC8A 3QYQA 4JYDA 4JTKA 5A8GA 2ZZ4A 3NYZA 3IGSA 4UIOA 1VCGA 2ZRUA 4UFLA 5G1TA 2ZRXA 5IBXC 6ALDA 5LNRA 2NUXA 4JYEA 3C2EA 3B0VC 4LVBA 3IVSA 4LW7A 4N9BA 2Y7DA 3S5NA 3HB9A 4XTIA 4FF7A 5DY2A 4YXGA 3W2NA 2X2GA 1AW1A 3C52A 4O28A 4JIPA 4QISA 2JK2A 3P81A 2HTMA 2VFGA 2F7FA 4DPQA 3FIGA 3PY2A 4X3ZA 4ALDA 5EL1A 3GKAA 2GQAA 3EWBX 4M5PA 1SW3A 2DU2A 2QCGA 3EWUA 3THAA 1HUVA 2BZNA 2DJLA 3M0ZA 1TV5A 5C5YA 3W7MA 2FB3A 4CNPA 5HULA 1FQ0A 1VLIA 4K7YA 4POCA 5EYWA 3W3OA 1GEQA 1H60A 4AVFA 4E38A 2Y7EA 4O17A 2E1DA 1EB3A 3W7QA 3DI0A 4NXKA 1W37A 3O6DA 3PG9A 3LTPA 1DHPA 2FPTA 3MYOA 1AMKA 3EKLA 5DCBA 1A5SA 3L0NA 4B5NA 1J2WA 4O4VA 2YCEA 3KX6A 2FTPA 3P60A 5G5IA 3HPZA 3GB6A 4MY9A 1YYAA 3KVKA 4ZQPA 1ZENA 7TIMA 2E77A 1R30A 1QPRA 1X1ZA 4JTUA 1XDLA 1VYPX 2OX1A 3NVTA 3GDLA 3LCWA 3C2FA 2OT1A 1L9WA 2Y85A 1VPXA 4AXKA 4CCEA 3G18A 3I7SA 1LOLA 3O6YX 5L9FA 3TSBA 3O16A 5I3JA 2VFHA 1TTJA 3LBCA 3PUEA 5FF2A 2XN0A 1BTMA 1M5WA 2CLMA 3SGUA 4GFSA 3IRDA 3NXFA 3MWAA 1PVNA 3W75A 3S1WA 4NNBA 3G1DA 1YXCA 4K39A 2RH9A 4X9SA 1KFCA 2H8ZA 3PM6A 3MO7A 5J5RA 2H3DA 3TC7A 5CZTA 4UXDA 1GYLA 5F2LA 2WV8A 3CC1A 3KHJA 1ME7A 5LNSA 1I45A 3NQCA 5E1QA 2ABBA 1WYIA 3BGJA 2C6QA 4PA8A 3G8EA 4HIBA 3KVLA 4WY0B 1JRBA 2J9YA 2W79A 2ZTKA 5LSMA 4UTWA 3MHUA 3GAKA 2NV2A 4AH7A 4LVDA 4IPJA 3W85A 5H2ZA 1AW5A 3GX9A 1H63A 5K4XA 3NZRA 3IIZA 3E0IA 3S9YA 3N2MA 5I3GA 1QNVA 1K7FA 1R46A 3LXCA 1W5MA 3VCRA 5KMYA 1DVJA 1TJPA 4Z1BA 5KZDA 1IIHA 5FEWA 4U4MA 1CI1A 2GOUA 3NQVA 1KBJA 3SI9A 1H7RA 4WJEA 2YDAA 4DO6A 1P0KA 3B0PA 5A5WA 3LCHA 2DZWA 3EXRA 3OBKA 3L2IA 4Y6GA 4MLJA 4PL2A 4ZL1A
chains in the Genus database with same CATH superfamily
3ITOA 3OLGA 2PDYA 3LMZA 1CLVA 3UCDA 2X40A 3WELA 3BAWA 1FWGC 4CD5A 3RRAA 4JTSA 3N3MA 2DQWA 4RX0A 3ZM8A 2VCCA 4N2YA 5GJPA 2XN1A 2VGBA 1XUZA 4OKDA 3MHFA 3QR1A 1U1JA 1EDQA 4GVHA 4BI6A 2YCLB 1XCFA 4PCSA 3H70A 3VNMA 1NP0A 1OM0A 1Q7MA 1Q6GA 2Y89A 1LORA 1IEXA 4O1BA 1SVDA 1C3FA 4RL3A 3QM3A 3WUGA 3J7HA 3DHDA 4PMQA 3G22A 4QNEA 1QOXA 2XIJA 5A95A 4BK9A 1S2TA 4D8ZA 4GNKB 3CM4A 5HPCA 4AMAA 4LB3A 1S1PA 2VEPA 3KCJA 2YPIA 4AUBA 2WVVB 1QAPA 4L7ZA 1YPIA 1XD0A 2ASHA 1O4UA 3KHDA 4XO7A 4JQAA 5ECUA 2CITA 2O9OA 1A5OC 1V0NA 2HBXA 4UQCA 1H1NA 1ZY9A 3WUFA 1FXPA 1NIUA 1UOZA 4UTHA 4WHBA 3TN6A 3S6DA 4LH8A 1MDLA 4RUBA 2PCQA 1VBGA 3W27A 3F5LA 2VENA 5BZAA 2C0AA 4ZCWA 1QPNA 1TV2A 2JEQA 2CZ5A 2PWUA 3IIVA 2G96A 2YGYA 3Q4DA 1OJXA 3DN5A 4W8AA 1WCGA 3EOEA 2PA6A 1Q7ZA 1ICPA 4JIHA 1E51A 2BXVA 4HZ7A 5HR6A 3WF2A 3SQLA 1YADA 4NZCA 3SY1A 3UZJA 4PRRA 1EUAA 2W92A 8RUCA 4ZOAA 1RJRA 4S3GA 4EX4A 5M03A 4H2HA 5ABEA 1H4PA 2VUYA 2QF8A 1HT6A 2VEMA 3LQGA 1XIBA 5HMSA 5I23A 4A3YA 1XBXA 2NLYA 2B7QA 3QTGA 4DWSB 5T9CE 6PTDA 2OO0A 2NXIA 3E2QA 4CEXC 2PRLA 4H04A 1YDOA 1ISYA 4XAYA 4UB9A 2HVMA 4JTFA 2WPGA 1HX0A 3AXHA 3GHRA 4WY0F 3VPLA 4ZQOA 1GVQA 2D2GA 1CGXA 1KBBA 2Q71A 3W6MA 2GGEA 1P4CA 1S5MA 3MKKA 1QT1A 5HQLA 2ATSA 3F4WA 1E72M 1UWTA 2HSAA 3ZLFA 3CLWA 2VZSA 1AH0A 3OYZA 1U1HA 1DXFA 4AEOA 4V2XA 2NVDA 1XBYA 3ABZA 3P84A 2PDKA 3BGGA 1VLWA 3A4AA 1VCFA 2Y61A 1TE6A 5E93A 1H49A 4JHZA 1IHIA 3QV6A 2PBOA 3FSUA 3S1GA 4CNOA 3AZRA 3O0KA 3W9ZA 3WH8A 5BNKA 4GQGA 3VE7A 1V79A 2OZ8A 4IJRA 8XIMA 5IRPA 4OGZA 5D30A 3TTYA 8CGTA 3W1LA 2XG9A 2BDQA 3VOGA 3EX4A 3W00A 2B31A 2DPEA 1GOXA 4GXPA 2V68A 3TV8A 4IF2A 2RDTA 2WM0A 4PTNA 2QKFA 3BAJA 2HRWA 3AUJA 1XH0A 1YDNA 4PB5A 1B54A 3C61A 3IUHA 3NOYA 3NO3A 3IANA 2V38A 5BXPA 1K4HA 4WEVX 1Q6DA 1BG4A 5AFDA 5BU6A 4Z2KA 4OBSA 5A1AA 1RVKA 4W93A 2QIWA 4WX2A 3GG0A 1UWQA 2PD5A 1MNSA 3H7RA 5ENLA 1OWQA 1BQCA 2DFAA 5FJPA 4WIWA 1MVYA 4BF7A 3THQA 1XWYA 3W2LA 3IGHX 1U83A 1LROA 2Z28A 3D47A 4ICNA 2I7GA 3SQSA 3B8TA 3BSHA 3ZIZA 3WH6A 1IGWA 3MT1A 1UR9A 3M7WA 2G37A 2OVLA 4TMBA 1OC5A 4U2ZA 1R3WA 4MM1A 2Z6IA 5FEXA 2WSPA 3W28A 4RPPA 1JPHA 1DJXA 4GBDA 4EF9A 2NZLA 4L4MA 3FLUA 1OHLA 3CH9A 3N04A 2E9MA 4V15A 2E5DA 1ADDA 4FX7A 4U10A 3ZQ9A 5K9DA 3QZEA 1E71M 2WHKA 3WBEA 1E4MM 4HNUA 3BCDA 2R1LA 5LXEA 1DWJM 1IT8A 3PZTA 4Z1AA 4MJ2A 3K46A 5BXSA 3PJUA 2GOKA 3C5QA 4JAWA 1ITXA 1TRIA 1TPDA 1TIWA 3ICJA 3E96A 5I0DA 4GQQA 3VGEA 2NQ5A 5AB3A 2GVGA 5JMUA 3GFZA 3GWQA 2VKZG 5C6MA 1DWAM 5E9AA 1N7KA 3HFYA 4WSHA 2XH4A 4CN4A 4YTUA 3VD3A 5LGZA 4GPNA 4E3VA 1PBGA 3S5SA 3P5YA 1F3TA 2FMOA 5I24A 2AQOA 4JKKA 1MUMA 4P8VA 1YXYA 3L23A 4I8DA 4DI9A 2J78A 3FEMA 4QRNA 1LLOA 3C6CA 3TOPA 3TWAA 3ARYA 1ZGDA 3FX4A 4HTBA 1PE1A 4IFKA 4I90A 1XC4A 1A0DA 3WG6A 4NZ3A 5KINA 1MWOA 2PC4A 4GYKA 1O5KA 3OJGA 2CHRA 5U4NA 2YL9A 1G67A 1DTUA 4UMCA 1MMFA 1ZJBA 3BPWA 2YOCA 4ML9A 4O19A 1L0PA 3SGZA 4TTUA 3TYAA 4UNLA 5FF4A 3S9ZA 3C56A 1TWSA 4JZ5A 3LHZA 4TU1A 5HAOA 4KWWA 4I7VA 1REQB 3TW7A 3T9PA 3LPPA 2NXGA 1LL6A 4ZB5A 4PUNA 3TA9A 2CFFA 3AIBA 3E0FA 4MYXA 3U7VA 2CZEA 3SSJA 2PU1A 2AQVA 3QN3A 4JTIA 1V3LA 4S23A 3AYSA 3ZWSA 3G8RA 4YHEA 3DG6A 4M7TA 2OKOA 2CC0A 3HPSA 4QSHA 4BS0A 5TD4A 4JD4A 5EFDA 4R7OA 1QCWA 4JX6A 1JNDA 4IGHA 1BHGA 1JD7A 3EMQA 1ZQ5A 4HHPA 4Q33A 3URBA 3W71A 2VX6A 5CZ0A 1UUMA 3MVTA 1UH4A 4MZYA 1E9ZB 3E74A 3AIRA 1SPQA 1W5NA 4DI8A 5EA9A 3VGGA 3ARTA 3UQNA 4LSBA 1KBKA 2OWCA 1SO5A 3APTA 3U2ZA 3VILA 1E70M 1V6VA 4GUJA 1OF8A 3QFWA 2V5BA 3W24A 1NJJA 2WSYA 3ZJ8A 2FDSA 4AD5A 5KITA 1US0A 1Q8AA 3GXMA 4U3CA 3WQ8A 4G2DA 4BQ3A 2BTMA 3DAQA 3VDBA 1HZYA 1BYCA 2DJXA 2ALRA 3WJXA 1S39A 1X1NA 4Q32A 4S38A 1GYMA 4ZO6A 4L9YA 1C7TA 1WKEA 3RM8A 3T1GA 5A8PA 5A69A 5I09A 3PG8A 4KCUA 4DUWA 1T6MA 3LCXA 4PUEA 3SW6A 1NWSA 1RV8A 1EKOA 2WBKA 2ZX5A 4KWOA 4W89A 4MNKA 1UBPC 2YA1A 2Z1KA 1EDTA 4MNJA 2PZ0A 3E49A 4JTQA 2ZUVA 3UNDA 3R12A 4FNQA 4WSKA 4JY9A 5HMEA 1HKVA 4FO4A 2HDJA 3VABA 4BQ2A 3PWGA 5M5DA 1JI2A 4HMEA 4KESA 1VHNA 3KTCA 1A5BA 4BHYA 4J9JA 1W56A 4N9EA 3M43A 2E8ZA 1ZALA 4XUGA 5E70A 3GNRA 4BJHA 3R0KA 1MQPA 5JIPA 5G1MA 3BUVA 5EFFA 4NYUA 3WD4A 1A5CA 3P6LA 3PWAA 2Y4SA 2DGAA 1A3WA 3GBEA 1UD5A 3GTHA 4IWWA 3KL0A 2V5KA 3ZS4A 4EP8C 5D38A 3WLSA 2V3FA 4WD0A 2QW5A 3IAQA 4AX6A 1W9XA 1L6SA 4KGLA 3NL2A 2Y8UA 2BGQA 1O95A 4AW7A 5MKGA 3HM7A 3VKDA 2QJJA 3C0QA 1NFBA 1PYMA 4LGXA 3CGTA 1S5WA 1GQIA 4S1FA 2F8QA 4N9DA 2DSUA 4NZJA 1NQ6A 1E73M 2J9XA 1PZ3A 1KM3A 4B4HA 3CK5A 2E0PA 2R1MA 4IQLA 3WLTA 5MKGB 2PGRA 3OHIA 4JTTA 2WC3A 4YN5A 1AD4A 3CYJA 2YCLA 3LV5A 4UQBA 3SRHA 4WOQA 2KAUC 3Q65A 5DANA 3H22A 1MDRA 2FGZA 2BY2A 3N14A 2WNZA 4I7UA 1U5HA 2MNRA 3KBSA 2WW5A 1XKJA 2NVAA 3G3MA 3EDDA 2YYUA 3TW9A 4IP5A 4QJ1A 3RFAA 3XINA 3VE9A 4Z2GA 3OIHA 3RU6A 1KM0A 4HZ6A 2DT0A 3H2FA 3B8IA 1CXFA 3F7JA 1BPLB 1VFTA 4DJFC 1R6WA 2Y70A 4H00A 3H8AA 2V9DA 3E2SA 1ZBKA 4IOTA 4ERIA 1RH9A 3R0DA 3LI1A 3CT2A 5HNRA 3TYDA 3UF9A 2OTDA 4LTSA 3O3RA 4IP7A 1GHRA 4AZGA 1DQWA 4QQ3A 5C9UA 1V3HA 1QNQA 3V0SA 2XU2A 2HV5A 2VP8A 3AMGA 4F2TA 2ISDA 1TPC1 4H1ZA 1VYRA 2V2HA 2IKHA 3TZNA 2ZUMA 3O0FA 5CPSA 5G2HA 3YPIA 2RHGA 1LQ2A 1EC9A 3S0CA 5A6BA 5HK4A 2WKLA 4DQWA 3WK1A 4HYWA 2CLKA 1GQLA 3I6TA 1E9YB 1K7XA 5EU9A 5BXTA 4GISA 1V7YA 5FF3A 3EX1A 1Q63A 3H24A 4O12A 4GOAA 3N9SA 3MWCA 2Z7GA 1XG3A 3NEVA 2YDRA 2DP3A 1A5AA 4Q4MA 4LF2A 2E6YA 3BMWA 3GTXA 3V5OA 4NXSA 1V4YA 2Q3RA 1FHDA 2QUUA 2F6UA 4WDWA 1ONXA 3T0DA 2XWDA 4YVXA 3SUVA 3M64A 1E0WA 1HJUA 2JBMA 2V69A 3SGGA 5BYWA 2QPUA 3P74A 1KTNA 3M0XA 1KTBA 4HJWA 3TUUA 4IMGA 4C6IA 3NGFA 3T2OA 4R7WA 3HG3A 5DQPA 3TYZA 4DO4A 5JBFA 3QHNA 4UNKA 2ZRWA 4AAJA 3P14A 4U31A 3NGJA 3MMUA 1D2KA 4YS1A 4LAOA 3GXDA 3K4AA 3OO2A 3UYIA 4NL1A 2BVTA 1PUDA 3W7NA 1B9ZA 1Y65A 1H2JA 2BY0A 4XKMA 4F2UA 1DJIA 3ITYA 1XC6A 4L80A 1P6CA 3ABRA 4L9XA 5CC5A 3A5FA 4YTSA 3CU2A 5A6SA 3C3UA 5AC8A 2PP0A 3UFYA 3W4RA 3KZPA 5D2YA 3O05A 2W61A 1PV8A 3OZPA 3UY8A 1EJXC 4GVGA 1SJAA 1UPMB 2ICSA 3ORWA 3CMGA 4C7GA 2V3EA 2QT3A 2PDXA 4YPJA 3VDAA 1PZ0A 4B90A 4ZODA 3HURA 4PTWA 4GCXA 1A4LA 3UJ2A 3KAOA 2PGFA 4HKPA 5CEWA 1JYXA 2NWSA 4LB4A 3CAKA 1ZRQA 1UB3A 2HNEA 4QCFA 5AKQA 1J01A 4GH1A 3VD4A 4YYFA 2WZHA 1UWRA 2QPSA 2OLAA 1CGYA 2V0TA 4WY0A 2PE4A 4DEFA 1KKRA 2PUZA 1TTQA 4OJYA 4J3XA 2ZBTA 5IFPA 1JD9A 2GQ8A 3QSRA 2QCHA 4L1XA 3NSNA 3UZWA 4C1NB 4FX6M 1EP1A 3WQOA 1SZGA 3WDQA 4QM1A 2A7PA 1U33A 5FF7A 3G3DA 3KRUA 3VTRA 4FSAA 2WO5A 3MCMA 1DWIM 4DZIA 3EA3A 4QG8A 4Q6JA 3REQB 2ZVIA 5HR7A 2Z2AA 3BLFA 1H41A 1AK5A 2WLYA 4H2CA 1YRRA 1P6BA 3N4FA 3UR7A 7PTDA 3NAVA 1KM4A 3L7RA 1FWTA 2XGZA 3GUGA 3UPWA 3FS2A 1XS2A 3NPWA 5HOSA 1RZMA 3N29A 3FJNA 2CIPA 2J74A 1J6OA 1FWWA 3TYCA 4GJIA 1DJWA 3D46A 4S2BA 3EWZA 4BFAA 2VDGA 1TUXA 1QR7A 3EBVA 2J27A 4AIOA 4JCMA 3CL7A 3IGXA 3VX1A 1BRLB 3T2PA 3UXKA 2C14A 1DORA 1XKYA 2QXWA 3N2TA 1LM1A 3HPXA 3HG4A 4NUWA 3VGHA 2IPGA 2ZRZA 3V5CA 1FCUA 1E1FA 4JGDA 3PF3A 6TAAA 4YIWA 3LI0A 1FHVA 4RXFA 1QASA 1ZL1A 1D8WA 3BW4A 2ZZ7A 1BXBA 1N8WA 3DG3A 3WNMA 4IG2B 3HBLA 4Q8NA 7REQA 1YHTA 1XYBA 4AG0A 4H6EA 3TTSA 4CN6A 4FLQA 1OC7A 3T78A 1SYTA 2QHAA 5I6SA 4AY7A 5GPRA 5MHBA 3BLDA 2VELA 3F4DA 3WLKX 1JIBA 2RJHA 3KLKA 4DB7A 4N6EA 3LM7A 3WK0A 1EC7A 2A3CA 1DJNA 3A64A 5LNWA 2PMQA 2D24A 1DWGM 3HV9A 2TPSA 3N1AA 4H7ZA 4U2YA 2OOFA 2NQZA 3KOYA 2I5GA 4X2RA 3W7IA 1DWHM 1MW3A 1ISWA 3DENA 1QDSA 3GNNA 1K1DA 1Q3NA 1LF1A 2ZKMX 4O54A 3AS2A 4QCEA 5CGTA 2OOGA 3WQDA 4Y9OA 2GUBA 3CUHA 2X0YA 3N13A 2OSWA 2GGHA 1WDPA 4PMRA 2PBGA 4HNOA 1FWDC 4UC5A 3HFTA 2ZWZA 3R2GA 2JEPA 1FWAC 2Y2WA 4KEMA 3S8HA 3VGBA 4PODA 1B4EA 4AWSA 3FW6A 3T2QA 4J7RA 1TMQA 3MP4A 1QNOA 4X60A 3GDKA 5D04C 3NSMA 3NQ8A 4A8LA 3H4WA 2J25A 5B7ZA 3DGBA 4D6JA 1M7XA 1TE1A 3BH4A 3W23A 4P8XA 4V1YA 2C7FA 1EOKA 2GJPA 1KRBC 3PPHA 2R94A 5REQB 1JNEA 3KL5A 3NQ2A 2GGGA 4IPPA 3N4EA 3CTTA 3AWNA 2X7VA 5D9MA 1JQVA 4OFCA 3SEPA 4FLSA 1XQLA 1UPPA 5AZ1A 3WD0A 3T4WA 4PMZA 1IXOA 1GOMA 1P1XA 4DF1A 4RNFA 1OABA 2BV9A 3AMDA 1BYDA 3II1A 2PGEA 5DELA 4GWEA 3QJAA 4O1AA 4F0RA 1KRAC 5HMFA 4W84A 4Z1CA 3RMJA 5EMUA 2UY2A 2JALA 3CT7A 3M5XA 3OGRA 5A8NA 3S1VA 2YB4A 4PC8A 3SCWA 3WMCA 4A8RA 5T26A 2I57A 4ACZB 4A8NA 3BZGA 4K7VA 3S5ZA 2REQB 3L5AA 1EP2A 4X22A 1L6FA 1WXYA 4BEQA 3FDGA 3DYMA 3IS4A 4CQ8A 4W87A 3WDHA 1RHCA 4G7EA 2WCAA 1NU5A 2WMGA 4IUOA 3WLOA 1YBQB 1JCJA 3TIMA 1VGAA 1XSIA 4CNTA 1KQZA 3C86A 2GJRA 4P8WA 4M19A 3AXMA 4PE8A 3HGRA 2ZZ1A 2A6NA 2OU4A 3PZQA 4ACYA 1JZ7A 3WK2A 4JYFA 2X1IA 5HWJA 1ADSA 4XUYA 3B8DA 2IPWA 3WLNA 2XSAA 1EGZA 1A49A 3VU2A 1JFXA 2E3ZA 1WOBA 4MJMA 3QXBA 3UD6A 3ARSA 4YU1A 3PJXA 2OXNA 2WZEA 3DKLA 4UTLA 1PKNA 1M7JA 3A9BA 3UXIA 2Y7GA 4MTVA 4M3PA 1PZ1A 3W72A 3PHAA 2B0MA 1TQJA 4O14A 3P0WA 2NVCA 3GXFA 3LRMA 1MUWA 2JIWA 3WLLA 5BOOA 5LNUA 1ELSA 4LJ3A 3MY9A 3VUPA 2J4GA 8TIMA 3WQEA 2ANUA 5EBAA 1OX4B 1ICQA 2FGLA 4NSBA 4Y9PA 4DBUA 3G0XA 3R79A 2VFFA 3PBWA 3UXDA 4RDYA 4H01A 2YFOA 2NSOA 3GXIA 4W8BA 1QHZA 5U7SA 1K77A 4S3DA 3WMLA 5H8PA 3NZ1A 3QSTA 2DEPA 1NARA 4IGNA 3WNNA 1JZ2A 1XYMA 3HQ1A 3TR2A 1GVSA 4DWSA 1CDGA 5ECVA 1X39A 3DFTA 4C6NA 4UOQA 3CYVA 4TUFA 1X7FA 3RRXA 2X41A 1JUBA 1QI3A 3SJ3A 2OEMA 1XLMA 3UG4A 2H8XA 3MJMA 3P2VA 3WYZA 3MCOA 4QFUA 4W5ZA 3AHZA 5H1WA 2QCDA 4OT7A 3CL6A 4RR4A 4CNSA 1OCQA 2C71A 4M82A 2DH2A 3DI1A 3W2KA 5BWAA 1KFBA 1U30A 4LPCA 5AYYA 5C9ZA 2NUYA 4FZIA 2RGMA 4QDWA 1QI0A 4UMBA 1A0CA 3SURA 4LS1A 4O0QA 1O5RA 3W1PA 3N17A 3JW7A 3UWZA 3ZFHA 1LYXA 3LPOA 4QROA 2CW6A 4OHQA 2VM8A 1V0KA 1CX9A 2V63A 2XM2A 3TSMA 5LIXX 3GQYA 1S2AA 2H9AB 4KIEA 4G9PA 4EXAA 4GIYA 3VDHA 2VEKA 2O9TA 4UQAA 2I14A 1W1VA 4DN1A 4Q8VA 1XH2A 2DZAA 2HK0A 2D2JA 2C1HA 4PBFA 5MF5A 2CESA 2J77A 2RDXA 2ZWYA 3OP2A 1EA0A 3LN3A 3W53A 1V3KA 3F4VA 3QYQA 1Y5XA 5A8GA 2ZZ4A 3NYZA 3U5UA 4UIOA 4MDPA 4IJCA 2VVNA 4ERAA 4Z2JA 6ALDA 3D6NA 5LNRA 1VJSA 3M07A 4AD4A 5BXRA 5T91A 1EO7A 2XISA 4FF7A 3M0YA 1IT7A 1S2VA 5DY2A 4YXGA 1IYXA 1TZ7A 1AW1A 4L9ZA 1XIJA 4G7FA 4GYPC 1O5QA 2JK2A 2HTMA 1ITQA 7REQB 1GVIA 3RO6A 4DPQA 3FIGA 4XAPA 3VINA 3GKAA 2GQAA 3EWBX 4M5PA 2QCGA 1B3YA 1HUVA 4B5SA 4QG6A 2BZNA 3NQBA 1TV5A 1C92A 5I78A 2ZX6A 2VCAA 3RITA 2IQ0A 4POCA 4K7YA 3LMYA 1GEQA 1H60A 1MYRA 1KCKA 2E1DA 1VF8A 1UR0A 1DHPA 3MYOA 1O1HA 3FGCB 4X9YA 3UT0A 3KX6A 1QNPA 3P60A 3KVKA 7TIMA 1E5JA 1TKKA 1HP4A 2V5CA 4C5YA 1QPRA 1A4MA 4YJ5A 1GORA 3CZKA 2D2HA 3UJSA 1ZSXA 2VRKA 4ZFMA 2FTYA 2OT1A 1L9WA 4CCEA 1LOLA 5L9FA 4PB3A 4I6KA 2CBUA 3EEZA 1B2YA 5FF2A 3KW3A 3S1WA 3RPTA 4NNBA 1XICA 4DNHA 2ZXDA 2RH9A 3GNPA 5E0FA 1KCXA 5HNTA 2Y0FA 3OG2A 5IFTA 1A5LC 3OVGA 3AOFA 1ESWA 1GOOA 1T5AA 1GYLA 1F9CA 4JEJA 1UR2A 2WV8A 4J1OA 4MKSA 5T8GA 1UIOA 4C5ZA 3UU0A 5E1QA 3G8EA 2E4TA 3MHUA 3GAKA 2NV2A 4F0KA 5LA0A 4Y9NA 2PGWA 1AW5A 3PPCA 4J3UA 4GINA 1Q8JA 3ZJKA 4IUGA 3VZYA 1HVQA 3SUTA 4D9PA 3OZOA 4MWAA 4JN7A 1QTWA 3VD5A 3B3DA 1LQAA 1DVJA 1EQCA 1IIHA 1PXGA 2CLPA 4UWMA 3DG7A 4R5EA 1E6PA 4XD6A 1KBJA 3FCPA 3SI9A 1H7RA 4LX4A 3TJ4A 3B0PA 1DPMA 1V3MA 3L2IA 3MB9A 4BF5A 5AC5A 1RLDA 2Y8VA 4IX0A 3A13A 4GUFA 4KEZA 3ES7A 2PWGA 1R7AA 3JVAA 4JTRA 3ENLA 1VS1A 1W5PA 3BAKA 3GS6A 1ML1A 5A6LA 4HU4A 1UR3M 5A2AA 3B4YA 4L4OA 2XH2A 2INZA 4F3HA 1DOSA 1AG1O 4QEHA 4LC6A 1F3XA 3ZSSA 1EGMA 3EDKA 1YLVA 4KFOA 3NZPA 1N8FA 3E9AA 2BODX 5GJMA 1VR6A 4FB7A 1N55A 2Z00A 1UZDA 1W3IA 2NSXA 3VUSA 2J7FA 2QV5A 4XWUA 2ZADA 2PTZA 2Q8XA 2E25A 4JTEA 3I65A 1M1BA 1Q13A 2QMKA 3EZ4A 3PTKA 1BKSA 2Z7KA 4TX8A 2VWSA 1WZKA 4H6QA 1EJUC 4AYSA 3BANA 5FAJA 5K9XA 4ZOBA 2GSJA 3L21A 1G7UA 3NOEA 4XISA 1GPFA 4W85A 3U4AA 2FZNA 3JUGA 3GC2A 4PSPA 1G69A 4M51A 4Z08A 2BP1A 2QS8A 3W1TA 3F5JA 1OY0A 3CZ8A 3FKRA 4Y9MA 3B97A 3L4XA 2A7RA 3LRLA 1O60A 2DZUA 3KBNA 4XBJA 1A47A 2DW6A 1FP8A 3CZLA 3UCCA 3VA8A 1NDVA 2QCDB 3WQCA 1HL9A 2IPFA 4DZ5A 3RF9A 2POTA 4GJ1A 1W3TA 2AL1A 3T81A 1MEIA 1S3HA 3IJLA 4JTGA 2NXHA 2D22A 1VCVA 3ANUA 1Z89A 3L4TA 1U1UA 3Q94A 1SSGA 3IVUA 2AMGA 3PULA 4H41A 3RN6A 4UQEA 2XIMA 4LANA 4IL2A 4IPLA 3W25A 5CPMA 3INPA 3VMNA 3WDIA 3G0UA 1EJRC 1F7BA 5KTLA 4XD4A 4NJIA 1ZS2A 1XRSA 1OX6A 2G0WA 4EXBA 4QEEA 3PJTA 3STEA 2GDUA 1JGMA 3TA6A 5EY5A 1ME9A 4LS0A 1TV3A 1O1ZA 4A6GA 5ABHA 1KFJA 1XSKA 1D7KA 3WD2A 2GFTA 2AL2B 1H7NA 4HSHA 1S2UA 3GIPA 2IQDA 4P7RA 4TV5A 2WCGA 1F3EA 3M0HA 1VJIA 3ISIX 4JKMA 4JIIX 3CAVA 2PRMA 1UCWA 4GUIA 1GQJA 3L4VA 5B7YA 2BVDA 4ICMA 2LLEA 3TTOA 4DJED 5JU6A 1E0XA 5DRIA 1ENUA 3QZ6A 1THFD 2Q8ZA 3M0MA 3FVDA 2WKJA 2ZFAA 4A21A 1JVNA 2QVHA 1XINA 3GIQA 3NPUA 4RW5A 3WMBA 3H2EA 1JYNA 4DJDA 2GSEA 4J3TA 3UA3A 3CV7A 3IK4A 1LRQA 1SW0A 3OG3A 4KWVA 4JNMA 1I6NA 4O18A 4XAZA 1SZEA 3HA1A 2UZ9A 3TQKA 2J6VA 5FCZA 2VFDA 2B7NA 3VIOA 2WJZA 3KP0A 1ADOA 1E15A 1F6YA 1DJZA 4AB4A 3PZUA 4JOMA 1YNQA 3RJYA 1EJTC 1FBAA 3DIPA 3QHOA 2GSHA 1NDYA 3GU2A 1BG9A 1SMDA 5HANA 4P61A 1AD1A 3R8RA 3P8IA 4ZVJA 1GVYA 1MQQA 1LL7A 2VZTA 4HU0A 2Y8KA 4GE8A 5C55A 1KQYA 5CLTA 4PUKA 2REQA 4LXFA 3DEQA 2Q09A 3N15A 1C8QA 1PX4A 2OLHA 5BMWA 1WKYA 3GO2A 2ZXQA 4NIRA 1FY6A 5GNYA 2QV4A 1OIFA 3CAWA 3LXBA 3MKVA 4IICA 4MYAA 2DIKA 3GVVA 1YTEA 4NJJA 4DWSC 5FOOA 2HVNA 2V30A 4UR8A 2EPHA 4Q4PA 2EG7A 4AC1X 3T55A 2P3EA 4D1JA 4AIEA 1FXQA 4PMUA 3GC4A 3EPOA 4P2VA 4N4QA 4XIAA 4Y8EA 1LWHA 3LZ3A 3SCQA 2FLIA 5FD0A 5BRBA 4LU0A 2RDWA 4NF7A 3NQ6A 3ECQA 1XIHA 1Z6KA 2QGHA 4BEUA 4F0LA 1B3WA 2VGFA 2ZRVA 3RCMA 1OFRA 2HISA 3C2OA 5DRCA 3SAZA 3WF4A 4NX0A 1K9TA 2B81A 1BRLA 4PMXA 3PB0A 2CHNA 1UD8A 2BNJA 1M6JA 2WMHA 1M9HA 1MQRA 1XXXA 1HXJA 1TR9A 1ZZMA 4S3EA 2W3ZA 4XV0A 1K8YA 3BZJA 5BRQA 4D8LA 3TQ0A 4LY4A 1RR2A 2VZUA 3MDUA 4Q4QA 4ORMA 5REQA 3NR0A 3WF0A 1BYAA 4XKYA 2PDJA 4MZ8A 1YQ2A 3C8NA 4FAMA 3SY8A 2DQXA 3AMLA 3N18A 1XIGA 3SSZA 1DQXA 2DIEA 3SRFA 1E4NA 1E5NA 2E7FA 1XLFA 3W7CA 1TVLA 4O0KA 1G4TA 4UFKA 4CQ9A 1RA5A 5LA2A 4FNTA 2X2YA 3SJNA 3W29A 2FB2A 1SFLA 1UUQA 2YA0A 3A4WA 3DBPA 3TVAA 1XLLA 3TROA 1RCOB 1UD3A 4W9TA 4IIHA 4CGTA 3F2BA 2AGKA 1F8IA 1LUCB 5EMLA 3W76A 3LCIA 3USBA 5I3DA 5AOUA 1JCYA 3NIYA 1IZCA 5FKYA 3LD5A 5TQLA 5IBXA 2JE8A 3OZMA 1REQA 4MUPA 3PTMA 2VR4A 5EMKA 1Q6FA 1VFFA 4CN1A 1TA3B 1AJ2A 1LG1A 4UZSA 5F1VA 3FAXA 4ZEPA 2JKEA 3LX9A 3NCOA 4W8LA 4A2SA 1IR1A 1R3RA 4F0HA 4DJEA 4XZ9A 5C9WA 2H3BA 1G7VA 1E0VA 3G1RA 4WRHA 4HYVA 2QR6A 3RLUA 3H23A 1RJPA 1TVPA 3EOLA 2PDHA 1MI3A 3C4UA 1UWUA 4GVFA 4D6FA 5EPDA 1P0EA 2A7NA 1FHUA 1KW1A 2CLLA 5DY3A 1WBHA 2GWGA 3PZGA 1E1EA 3QQ1A 4QE4A 4MZ1A 3QW4B 2VD8A 2EKCA 4AY8A 1XRVA 3TONA 4Q8QA 4PRTA 4KH2A 2RDUA 2VC7A 3L65A 2C0HA 3VIGA 1H62A 1QBBA 1LUCA 2GVEA 5C2GA 3IJQA 3W1RA 4RKAA 1V6WA 1GVRA 2XWEA 3U2OA 3PNZA 1DIKA 3FN9A 3CH0A 1BVNP 1W1B1 1AL8A 4NU7A 1NF0A 3WNLA 2CZDA 4EAMA 3ALFA 2ACUA 4YTQA 4AIUA 1BGAA 3ARPA 4X61A 1SO3A 3S2LA 3O9NA 3CASA 3LK6A 4M6UA 3BQ5A 3HV8A 4WR3A 1W2PA 3FXYA 3G6LA 1RQHA 5LIYX 3GDTA 1JZ4A 2PEVA 3T7VA 1Z69A 4IIEA 5A3HA 3E1F1 1TCMA 3TAOA 3HN3A 2DV0A 1W8GA 3LYEA 4PH6A 1PWMA 3UETA 3FJ4A 2CLEA 4E4UA 4RDVA 1CENA 3FXGA 4JQ1A 2JGYA 4QAIA 1H0IA 2Z0IA 1PDZA 2YZ5A 1XYZA 4OE7A 1I2OA 2G3NA 1WPCA 1FWIC 1EJ7L 1YXDA 1NQKA 3SCRA 1X8CA 8A3HA 1NOWA 3OBEA 4G1KA 3GAYA 4CNNA 1J18A 1GW9A 1KM6A 1TPVA 2OYMA 3W7RA 1KC7A 4JKLA 1H51A 4I5RA 1IR2A 2VEIA 1FWRA 2QAFA 4RNIA 5AVHA 3VCNA 1TVNA 3E02A 4UMAA 2WPBA 4HA3A 2A85A 4Q7NA 2V5DA 1X6LA 3I7RA 3QRHA 1RPKA 2TRSA 1TWZA 3TXVA 1VFHA 4GYPA 4X0VA 4H8NA 1FWCC 2Y62A 2EO7A 3N11A 4ZB2A 3OPSA 4E0CA 4MVAA 2EPLX 1UKSA 1YDVA 1BGGA 4HNVA 4V27A 2X8RA 2FIQA 1YE4A 2VMFA 1FDJA 5DLCA 3FHQA 5DCDA 4D71A 5XIAA 5AHEA 4LVFA 1ODUA 1TREA 1TPUA 4Q6XA 2X0SA 3POHA 3QBUA 1O7AA 3UXLA 4F9DA 3TX9A 3H2NA 1XYFA 1V03A 1US2A 3LCGA 4TVDA 2BASA 3GSMA 3B9EA 2A2IA 4ES4A 3SRDA 4KWSA 3G6MA 3RAOA 2DSZA 3JZEA 1HTIA 3APYA 4AZ5A 2QJHA 3CUIA 2OQYA 1W5OA 3VD9A 3T08A 1GGOA 4RW3A 2G3MA 3N6QA 1SO4A 2WCSA 2J24A 3HIJA 3PUDA 1KCLA 1OEPA 2DT2A 5LYRA 3TN3A 4GA8A 4D6EA 1JPIA 1XQKA 4L4LA 1FWFC 5AYXA 4WGHA 3E2VA 3WLIA 4AF0A 4Q4SA 1YNYA 2XVKA 1BXNA 3MDWA 3M0KA 4R3UA 4LCSA 4O53A 1QI4A 5HUPA 3W1AA 3CUXA 1M65A 4IGMA 3VIJA 4MB5A 2C15A 1Z44A 3NQMA 4HP5A 1OGSA 1CGUA 1MO0A 3WDJA 3ABSA 4NYYA 2D73A 1KM5A 3FYOA 1G01A 3AMCA 2OGYA 2YBUA 1H7XA 2R9RA 3CJPA 4HPJA 3E0VA 4L6OA 3UR5A 4KERA 4S3CA 1PX3A 1ZLPA 4LYKA 2CBIA 4E2VA 3G2GA 4R88A 3QV8A 4OVXA 3L66A 3OVRA 5FA5A 3WLRA 1DE5A 4O13A 4TR9A 2EG6A 4UTJA 1F2JA 4UCGA 5C0QA 1J5SA 2DSVA 2FPVA 4LRTA 3S1UA 1EIXA 3LHYA 3PSWA 5TNVA 4NVTA 4OECA 4C1LA 3MUXA 1P43A 2QMJA 3CXOA 1XIMA 2CEQA 1C90A 2L5HA 4NNCA 3AIVA 5H8MA 1SR9A 4RE0A 4MWAB 3V7PA 1EDGA 1I0DA 4NJGA 1ZNNA 5CAHA 2Z29A 3ERPA 2FKPA 1FWSA 3E3HA 3DH7A 1HJSA 1PTGA 3AYTA 3IWPA 3HGSA 1JPKA 5JH1A 3LLXA 4CCCA 3WK3A 1QHOA 3GXTA 1F5ZA 2YCKX 2BSLA 2XTKA 2QCCA 2OQHA 1CB2A 3W26A 4Q8PA 4AD3A 4E3TA 4RE2A 2WHMA 2ZCGA 1OCJA 4MY1A 2PWHA 3DC0A 2RJGA 3MUZ1 5TAOA 1NY1A 4PMNA 4JX4A 3QEZA 5F4SA 2DVUA 3TQVA 1HJXA 2CKRA 3TAKA 1YIXA 4U28A 1JF6A 3EKGA 4H8HA 2P76A 4MOZA 3WSUA 2PDGA 3CUZA 1FUYA 3QLLA 1P6WA 3HQOA 1RBLA 1C9DA 4A3UA 2GLKA 1DXEA 2P0IA 1YEYA 4RZ4A 3NQ7A 3B06A 1KV5A 3LNPA 1I2NA 1H1YA 2A21A 2OGJA 3WBWA 2XGBA 3NQFA 5CG7A 4LYPA 2BMBA 3EYPA 3LSBA 3B9OA 1KCZA 3KZSA 1S5TA 2A3AA 2PLCA 1UWSA 2XVNA 3AYRA 3BWWA 5GNXA 1UH3A 3N73A 5DBUA 3S6TA 3HJEA 2FHCA 1WQ5A 1OT1A 1LWJA 3UPBA 3OLDA 3H4XA 1KWGA 1A5KC 1JDCA 4MWAD 3OZYA 3IJIA 3R58A 3N3TA 2QZRA 2PAJA 5PTDA 4GX8A 4NJHA 2J9ZA 4D8AA 4QHRA 3AIWA 3BJFA 2DZSA 2OT0A 3RG6A 5I5RA 2WSRA 2CKSA 1WKDA 4B92A 4MY8A 2VRJA 4RCXA 3BG9A 3PANA 3FDKA 5CC3A 1V77A 1LRTA 3WH5A 1NP2A 3N25A 3GHUA 4UOZA 1CB7B 3COTA 3PFRA 1E9LA 1KM2A 4M6QA 2FZDA 4M81A 1TJRA 1J2BA 4YMZA 4WUIA 1GK8A 3DFNA 3NA8A 1RUSA 2QDDA 5KSWA 4LBRA 1IE7C 2EPMX 4BWLA 3HPAA 2ZDSA 1V8EA 3TSDA 4OU1A 4A29A 2DSWA 3EMCA 1EZWA 5LNVA 3CUJA 3NEHA 2WSQA 4N02A 3SCVA 4K1GA 3FOKA 3DFQA 4RDZA 1IQ8A 4IMAA 3UESA 4C6OA 4FXSA 1XRFA 1ZB5A 1IWPA 1HKIA 2F38A 3OU8A 4RLIA 1F6KA 1EEPA 1JCMP 3GE7A 1KWKA 3QZAA 1SQ7A 2Z1SA 4S3KA 1G4PA 1FWNA 5E6ZA 1U5VA 3VO0A 4YYCA 4DWSD 1XW8A 2XUCA 5CSRA 2TYSA 1VP5A 2C1IA 4DX3A 1F8MA 1RVGA 1V51A 4Q8MA 1JDDA 7TAAA 4LF1A 3WNKA 5HWMA 1EIBA 1JPDX 1K9FA 4KQNA 2GJXB 3W7JA 1KLYA 1GHSA 4YCOA 1UYQA 3TP4A 1EJWC 3QYSA 4FNPA 3GRIA 4MKNA 4C6DA 4MHBA 2BLEA 3URQA 4LAZA 3FJ6A 4QAWA 5L6UA 3DXIA 4AHOA 3P93A 3CWHA 3LPFA 3MCNA 1EP3A 1JULA 4D6HA 4PBGA 2FPYA 3C2YA 2QLYA 1M68A 2FVKA 3OHMB 3U8GA 3GDRA 1JF5A 1H7OA 2WK2A 1Q45A 3ITLA 1SJDA 1DJGA 3W7PA 1V7AA 4XAFA 1HKJA 5HNNA 2YJQA 3QGKC 4PMOA 4RZ5A 4ZE4A 1JR1A 3SN1A 3T4CA 5F2MA 1TCDA 4TVCA 3LLDA 5F7UA 4LOCA 5DXXA 1WUFA 3E0WA 4W7WA 1JG9A 1CXHA 5CJMA 1LT7A 3CPGA 4Z0SA 1AQMA 3B04A 4TV6A 3C0LA 3MP5A 3GH7A 3RCNA 4GYFA 4CKQA 2Z2UA 5HINA 5AC7A 3RU8X 5DFAA 3CIVA 3K8LA 4OBRA 3USZA 4GI4A 2E67A 3WO8A 2JGQA 4PL1A 4B3ZA 6REQA 3N34A 2Y5SA 2V82A 3WFLA 2OELA 3UZ5A 3G1XA 3RYSA 2Z1VA 2NLIA 3W1UA 4HPGA 2OQLA 5CPQA 3OIXA 4NILA 2HNHA 4L61A 4DJDD 3T0CA 1RBOB 2FVLA 4C1KA 1XI3A 3CMFA 1NVMA 4O8RA 4KCVA 1QOPA 1J5TA 2R82A 3UPMA 1TTIA 1DIOA 2MANA 5M2FX 1KGXA 2FYMA 3W83A 2FH6A 4FXRA 4YTTA 3UGRA 4JCLA 2G4JA 4XBSA 4MF4A 3B8WA 5G4WA 4Z17A 3LTYA 3S2JA 2DW7A 3LGEA 4J40A 2RKXA 1C91A 1UJPA 2YCJA 1IEIA 4KS0A 3I3BA 3IVTA 1IEQA 2DZXA 2J7BA 1SZFA 1F73A 4J3ZA 4ADUA 1R2SA 3PZVA 2CERA 1HO1A 1MW1A 3I6EA 3PVFA 5I3KA 2XSBA 1LOSA 3LDVA 4Q8WA 2NQJA 5D09A 1J8VA 3QW3A 4B5TA 4CU8A 4HB7A 3MI2A 5C71A 4YHGA 2I9EA 2OCZA 4ACZA 3W87A 3CTLA 1I2PA 1LBMA 1P0NA 1EWDA 1EF2A 1UOKA 3HPFA 3KUMA 3H2AA 2R1PA 5DBTA 3KDOA 4HN4A 3PAJA 1YKWA 3QHMA 4GBUA 4E2OA 3NQDA 1TJ1A 4Q4OA 4ROQA 6XIMA 2AL2A 5D05A 1M7OA 2AQWA 5K2ZA 4GUGA 1J9YA 3QV9A 5I03A 1JZ3A 2ZTJA 2JQXA 1OIMA 1KM1A 1CIUA 3G1SA 3UWQA 2FH8A 2ZA1A 3L67A 2ZXBA 1WDDA 2VOTA 3ONCA 3RJXA 4DZHA 2ON3A 3VM5A 4HU3A 3RM9A 2PLJA 2QUMA 2R14A 2ZQ0A 4RV8A 1IZKA 4V28A 2OYLA 4XK2A 4Q4KA 3EOSA 3S5YA 4C7DA 3MPGA 3L68A 2CLIA 2VFIA 5GQBA 1VFMA 2W62A 2PWVA 1ITUA 1ZJHA 1X97A 2CPUA 3BO9A 3PZ9A 3MO4A 2RFGA 5A6AA 4NT0A 3EPMA 3HG2A 4P7LA 4F9JA 1TB3A 3CPRA 2CLOA 4FX8A 3STPA 2I1OA 3R43A 2XINA 1UUOA 4IHCA 3WQWA 3KRZA 4ZFCA 1G1YA 1IGSA 1WX0A 4L65A 3MTWA 3WBYA 1ZUAX 1ZHAA 4OV4A 3UP8A 1LLWA 3T8QA 3SR7A 2WOQA 4WKAA 1H11A 2E8YA 5CGQA 3AXKA 4K2SA 3TYBA 1E3ZA 4DJDC 3R13A 3EWWA 2WMFA 4MMWA 2F6KA 1G0CA 3CHVA 1RK5A 1KBLA 3LHWA 4DBSA 1JCXA 3A21A 3MZNA 1FX6A 4C90A 3FNDA 4G7EB 5A6BD 1PEZA 4HPNA 2V2DA 2G97A 2NT1A 4X63A 4NAEA 3Q67A 1KKOA 4KCWA 1LZOA 2ZZ5A 2DVXA 3AZSA 6REQB 1KFEA 3AIEA 3W81A 4ZXLA 4Q7BA 3HGOA 3P3BA 5CQ1A 4RJEA 4Q7IA 2IW0A 5LKYA 1J93A 2BVYA 5EMJA 3I4KA 4RNJA 1PCKA 1OBAA 1TG7A 1RA0A 1QXLA 4HD5A 3B8UA 2J7EA 2X42A 1OB0A 1VRXA 3LHUA 1QNSA 3KWXA 1FWEC 1XGEA 1UP2A 3W07A 3GK0A 1QWGA 3H2CA 4J2MA 5CZJA 1M53A 4A8IA 2Y6ZA 4UUIA 3VNZA 3R10A 2QDEA 1N8IA 5JBDA 2AMXA 3RPMA 5F2IA 3RLHA 1FP9A 2XIBA 1T8XA 3BOFA 1HKKA 4L5ZA 4DYJA 3ZZ1A 3BW2A 3S5OA 2Q6ZA 4M80A 4EWJA 4H9ZA 3BOXA 3QMTA 3UVAA 4DBWA 2VC6A 1LRNA 1UD6A 3VOHA 1JUEA 1P7TA 3MMWA 3L5MA 1TX2A 4UR7A 5JUVA 3IIOA 4IMEA 2A3BA 3FJLA 2GK1B 4KRTA 3K13A 3Q45A 3AICA 4GNJA 4CEUC 4P7OA 4WCJA 1TIMA 3B4UA 3NO1A 5FJJA 1JQXA 4PUUA 1XGZA 5E0CA 2O92A 2PDWA 5KZMA 4WVXA 1K6WA 4QS5A 1I0BA 5J8LA 3DESA 1E55A 1GZ1A 3L9CA 1D9EA 2GYIA 2PLMA 1AQHA 4P7NA 4MNMA 4GLEA 3E2RA 3CQHA 1Y7VA 5EBUA 1Q5MA 1XH1A 3RO8A 3DERA 4C1NA 1WUEA 3AS0A 2YB1A 2P88A 2E6FA 2Q02A 3UWUA 3BL3A 1W9PA 1FCVA 2BHZA 1K03A 3WLHA 3P82A 4O1FA 3TNBA 2YDSA 3VNLA 3RNDA 3P62A 4LC8A 2EBNA 3IGSA 5CZKA 1VCGA 4XZLX 5G1TA 1I1WA 5IBXC 3WDPP 2PLKA 5I2UA 2OB3A 3VVGA 3B0VC 5BWFA 2Y7DA 1A0EA 4HBKA 3HB9A 4XTIA 3W2NA 3VC6A 1EBGA 4L4PA 2PTWA 2KX9A 3P81A 1V0LA 2VFGA 4S3BA 4O1EA 4IG2A 2R1NA 3FEQA 1OADA 4I5XA 5EL1A 2Y24A 1S1RA 2PDNA 4ML4A 2WMIA 4AX7A 4YVPA 1FWJC 4NRSA 1KR0A 4L6DA 5C7HA 3M0ZA 3UCQA 4A3RA 4MWAC 4ATDA 4H7VA 3R8HA 1FRBA 3MZ2A 5EYWA 4G5DA 1GCYA 1JL8A 1LQ0A 1XLHA 4PBEA 1W9VA 3EWCA 4MADA 1EB3A 4LEQA 1PX8A 2AKMA 3DI0A 2YXXA 4EKJA 2FPTA 5DCBA 2YIHA 1J2WA 1GQKA 1CEOA 3RR1A 3QGVA 1RALA 3L4UA 1QU4A 1YYAA 4GD0A 2E77A 4WDXA 1R30A 2I56A 1GUVA 1DIDA 4JTUA 2GJXA 1HJWA 2OX1A 3GDLA 3C0SA 2OR2A 1W3JA 2ZE3A 1AFSA 1CXEA 3G18A 2Z1WA 2BS9A 4D1IA 2PODA 3O16A 3WF3A 2VFHA 3PUEA 2XN0A 4L1GA 1M5WA 3SGUA 4Z2IA 1PVNA 4AD2A 5M3WA 3BDKA 3MC5A 1CPUA 3MO7A 1Q2RA 5KEZA 4I5UA 5F2LA 1BVZA 4XZIA 5EB8A 1S38A 4W88A 1T8QA 4NZ5A 1ME7A 4PUJA 5LNSA 2ABBA 3BGJA 4H19A 3SUUA 3V18A 2Z24A 3KVLA 3EGJA 2ZX9A 4WY0B 2W79A 3ARRA 5CC6A 4GQBA 4JPGA 4AH7A 1A3HA 5FJIA 1EA9C 4IPJA 1UZHA 5H2ZA 3GX9A 5E5CA 5K4XA 2WSKA 2NQLA 3NZRA 3E0IA 3QR3A 4B4FA 1YDYA 2DH3A 3S9YA 2WZTA 1GEHA 5I3GA 2D3NA 3BC9A 4PB4A 5AECA 1R46A 3LXCA 1W5MA 4PRWA 5KZDA 3L12A 5FEWA 4U4MA 1CI1A 2GOUA 2EKGA 4WJEA 5A5WA 3S4TA 2DZWA 3NYDA 4ZL1A 3WQPA 4RPQA 1BF6A 1D3GA 4LUTB 4WDTA 3QR0A 1XLCA 4EACA 3GR7A 3WUEA 1KLZA 2X16A 4DM1A 1XFCA 4ZSTA 5CPOA 4AD0A 1B3XA 4CUCA 3ES8A 3OBAA 1OYAA 4F0MA 3KLLA 2GJLA 4BZYA 4PCTA 1DYSA 3O1NA 4GKLA 1EBHA 4NASA 1R8LA 1MNZA 1X1OA 1I4NA 2ZUWA 5H91A 4ATWA 4J4KA 2F61A 3GVQA 1K3UA 1OFEA 1V3JA 5BCAA 1EX1A 1KNWA 3D3FA 1WDQA 3TN4A 1U5JA 2YZRA 3W82A 4MNLA 3GY1A 1XIIA 3L0GA 2OYKA 5C2CA 5FSDC 4O8AA 1EJSC 5G4EA 2V5LA 4GO9A 1ALDA 1F3WA 1ISZA 1DJHA 3UR2A 1PIIA 1MFUA 1Q2SA 3IK2A 4RV3A 1WA3A 5D9NA 2WANA 3H2MA 1TWIA 1VYSX 1ECEA 4K68A 3DECA 1BSIA 4E8CA 1CLKA 1SSDA 1H1ZA 1IF2A 3RX3A 3DYOA 1XR2A 2AKZA 4F48A 1JCNA 3GXPA 3CO4A 2HCVA 4OOUA 2WYSA 4TX9A 4B2DA 2YSWA 1XRTA 4M8UA 4K8EA 4QQUA 3ZMRA 1EQPA 2HQAA 4O1DA 1TUFA 1W1PA 4H9MA 1EHNA 3FFSA 2ISWA 3MJYA 1L8NA 3S2CA 1V0MA 4FMVA 1XIFA 4C6PA 2ISVA 4O0ZA 5CKSA 4RZBA 1GTEA 3GG1A 2BG5A 1N82A 1UASA 4MIMA 5H8UA 3U5YA 2GL5A 3QLDA 4QP0A 2QUTA 1W1A1 1JCLA 4LVAA 3WF1A 1GONA 5CSSA 1GT8A 3A3XA 1FFRA 2YYTA 3LU2A 3QGAC 1ZCCA 3WDRA 3WUBA 2QCMA 1KFLA 5A2BA 4RZ6A 1X8FA 2J66A 2VOMA 5C9RA 1XLKA 1XPYA 2DSKA 4QDPA 2WKGA 1I75A 1W54A 2ZOXA 4IIDA 3WIJA 1E40A 3CUGA 4WF7A 2G3IA 1JXJA 4IIGA 4CCZA 2INFA 3M6DA 3MKCA 3BLPX 4RE3A 3KBVA 4J2PA 3ABQA 4JFWA 3WY1A 3BLIA 4HTYA 4GXWA 1XCXA 1P0BA 4K3ZA 5I7GA 3LEPA 4JBRA 5BOEA 3HMJG 3SUSA 1GJWA 1HO4A 1XLGA 1HQTA 5TIMA 3UYCA 3WFAA 3W1MA 3JRKA 1BF2A 3MBFA 4FXFA 5DF0A 1F6PA 1X6NA 3PJWA 1W8SA 3DFHA 4UNIA 3MSRA 1BTCA 3B9NA 3S2MA 3S83A 3EWYA 3UWEA 1M3UA 3RXZA 4FA3A 2FTWA 4LY8A 3KRBA 3QMSA 3U48A 3K1GA 1Q6RA 1O94A 5D2TA 2P1FA 4GHRA 3APGA 2OO6A 4IQDA 1HL8A 4JFTA 1PIFA 4NRRA 1KXVA 4PMJA 4UQDA 1T40A 2XFWA 2XIOA 4W7UA 3NQGA 3AROA 1GVOA 3N9KA 3IUIA 6ENLA 4KBXA 3M4HA 1FH8A 3MSYA 1RY0A 1C8XA 2E68A 1UJQA 4F79A 1CGWA 1X38A 1EYEA 3VZXA 5E9XA 1HG3A 1PPIA 3GZ3A 3BV7A 1NEYA 1V08A 2D0HA 5ABGA 2Q8LA 4AZBA 4S2CA 2QQ6A 3ARWA 4KFNA 2AOSA 3FA5A 2YW3A 2C18A 3WLJA 2C3ZA 4H4IA 3GVWA 4QIUA 3PZOA 4Z42C 1E1CA 2DVTA 2QCFA 2P50A 3OODA 1GPWA 3OB8A 1UKPA 3TLQA 1FDYA 4FEZA 3SZ8A 3ZLGA 4EAYA 1M04A 1S5VA 3ABXA 3AMKA 3TTQA 1QVBA 2YCIX 3TC6A 5HQEA 3BURA 1L6YA 3NL6A 2CWNA 2PP1A 3AU6A 4HNCA 4GGBA 3GH5A 3S9IA 2EJ1A 4LWWA 4E2BA 3RDKA 3OLEA 3MBDA 5A6JA 3SN0A 2GDQA 4AZIA 1VFOA 4TTGA 3CV6A 5AHIA 2ZZ6A 2NQHA 3BOLA 3UZXA 2ZICA 1NWUA 9XIMA 5D32A 4FOKA 2PWFA 9XIAA 1LP6A 2XSXA 1D7FA 1Q6LA 2O7QA 2OMAA 2XH7A 2ZZ2A 3E38A 4AZCB 5EMYA 4L1WA 1QNRA 3P61A 5HUOA 3NM3A 2DY3A 5A6KA 2Y5JA 4IFRA 3SCOA 3UG3A 1D3HA 4M1RA 3E0LA 3G24A 1W1IE 4HSOA 3ITCA 3F1QA 3BSMA 1XPGA 4I6VA 4Z1DA 3R8GA 4E6MA 4KRZA 3M0IA 3CQJA 1GVFA 1R2TA 3KCOA 4QLJA 3OA3A 1KD0A 2PFHA 4IGSA 1E6NA 3ZR4A 4UTFA 4R9OA 3V36A 1GOKA 4LS2A 2X30A 1ISVA 1UIPA 4AXNA 1XLAA 1XIEA 4J5NA 4EOUA 1M7PA 1CW2A 7CGTA 3EDFA 1E1CB 3AHTA 1P48A 3O63A 5HATA 4M6VA 3AHXA 4AC7C 1DV7A 1UROA 3V16A 1SGJA 2EPKX 1GW1A 4LEFA 4H3DA 1PB0A 1Q4WA 1UC4A 3GFYA 2OG9A 3CBWA 4ZQMA 1W3KA 1R5YA 2QNEA 3THCA 2HMCA 1DP0A 1QI5A 3V1PA 2WM1A 1AH3A 2PS2A 1VBUA 1HVXA 4H8UA 1TSIA 2V3DA 3IGUA 1TRDA 3BV4A 4GUHA 4JTJA 4GY7A 2J7GA 3ZO9A 1ONWA 1V6UA 4EF8A 3UJFA 3V1HA 1GTHA 4AEEA 3IAPA 1PAMA 1NF7A 2A6LA 4F40A 4YWSA 4N7QA 4U33A 1MRAA 3QKEA 1M01A 4XIMA 5C54A 4MAZA 3HMCA 3W1XA 3L4YA 3N4AA 4HT3A 1R47A 3VNYA 3KS6A 5D9OA 3UZYA 4US5A 4A05A 2J8TA 1YPFA 2WVTA 4GZEA 5D37A 4HA0A 2BBFA 2VEGA 2OJPA 3AFBA 4ZXOA 1ONRA 4N0RA 4WSJA 3KWSA 1QMLA 2WLZA 3BLOA 4CQAA 3O06A 3WQ4A 3KTXA 5TF0A 5FIPA 4NI8A 2C13A 4JQ2A 4NY2A 4HHHA 3LV6A 2EQDA 3TMQA 4A3QA 3CEUA 5C8BB 3HOJA 1MXGA 5M17A 4BF9A 1JDAA 3A9IA 3CIXA 2X7WA 1GYNA 2PC8A 1OT2A 5LXXA 4UQ9A 4N9CA 2IXUA 2J8FA 3KOXA 3CZJA 1KV8A 2OEJA 1RQBA 2A3EA 2F6XA 3ABOA 2ZRYA 1PCWA 3E5BA 3W02A 1QWKA 2W67A 3H55A 4JX5A 2QF7A 4LT9A 1V5XA 1GKRA 1UG6A 1V02A 2ACSA 3VDCA 4LNCA 1ZBVA 3E12A 3G1YA 3WEMA 4XZMX 2P3ZA 3KBWA 6TIMA 1W3NA 3TH6A 4MB3A 1SFTA 1BXCA 1AODA 5HA7A 1J0IA 3MUIA 1C93A 5DXYA 1PDYA 2WQPA 3S42A 5I07A 4DXVA 4GNVA 1E56A 3W7KA 1GJUA 3I3EA 4C7FA 5D2XA 2OKTA 3VFCA 6CGTA 3SM0A 1TR1A 3H7UA 2VZVA 4WKFA 3PZIA 1HJVA 2XVGA 4PZVA 4AZ7A 1W1TA 1ICSA 1F05A 3WLPA 1NOUA 2Q3OA 3EX6A 4TMCA 5CXPA 5DMLA 1S2WA 1L2QA 1KFKA 4A35A 4HOZA 4ADTA 1RJQA 2J7HA 3AJXA 1DIEA 1PS9A 2VZOA 1J10A 4KEVA 3BE7A 5K4ZA 2FZ8A 5BRPA 3OVQA 4KWUA 2CETA 2QYGA 1B0IA 3M5VA 1QW8A 3T05A 4M6PA 3NQAA 4K8GA 4IXXA 4EWND 1Z9AA 4R53A 3CZGA 4WDUA 1QPOA 3R25A 1WAUA 2BWGA 3G0SA 3R94A 1NELA 3Q37A 5HBFA 1UMLA 4AF0B 2VDHA 1EWEA 4UFHA 1G6CA 3PC0A 3FA3A 2ISFA 3N2BA 1JRCA 5J5DA 3CAQA 2Z2BA 1OFQA 2BFGA 1B30A 1R9YA 2EPOA 2PI6A 5LZLA 4UTIA 1TPWA 4JTDA 1NWTA 5A2CA 2HE8A 2J79A 1B3ZA 3I4EA 1J0JA 2R24A 3CIWA 4PGLA 4KT2A 4HQVA 3LM3A 3UJEA 4HOXA 1J6PA 1RCQA 4TX6A 4PR4A