3W7EA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-5-179
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-5-179
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 107
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7eA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7eA01
1A50A 4GWEA 4MY1A 3W7MA 1FWWA 1XBVA 2X1SA 4DO5A 1QPRA 1ZAHA 1O5XA 4XBSA 1OFBA 5EY5A 1JCJA 1XBYA 4BR1A 4M7TA 5I3KA 3A9IA 1FY6A 4UTJA 1GTHA 2ALDA 2NLIA 3WJYA 4L4MA 3LI1A 1JQVA 1QAPA 2YZRA 3DKLA 5HWMA 2PURA 3M5VA 1GG1A 4QSHA 1AL7A 2EPHA 5J5RA 2NXIA 3HGJA 4K8HA 3TQKA 4WY0B 1TPH1 5CZSA 2XFWA 2V82A 3TA6A 3IGUA 3VCRA 4JGDA 4O4VA 1DV7A 1X1OA 3GDLA 4OWGA 1FDYA 1I8JA 3M44A 1UBSA 5DN1A 3DENA 5LNUA 1AW5A 1TTJA 4O16A 3FYOA 4O17A 2Y88A 1THFD 5DCBA 3LBCA 3LTPA 3TJLA 1OK4A 1TRIA 3AJXA 1RR2A 4OV9A 4O1BA 1YDVA 4IX2A 5LNSA 3L0KA 5EYWA 4LC8A 3C2OA 3C2VA 3NL3A 2BZNA 3MP4A 3PG9A 4PL1A 3EKZA 2XN1A 2PE4A 3LCIA 3TIMA 3FEMA 3EWBX 4LOCA 1H63A 4FF7A 3QJAA 3GDKA 4HT3A 1OVDA 4O13A 4AF0B 3OVQA 4JYDA 4BF9A 1XDMA 5H2ZA 3UZJA 1AG1O 1OFQA 1KW1A 1V7YA 1LTDA 4ZZ9A 3RFAA 2YSWA 1ICSA 3G24A 3KAOA 4H4IA 5D30A 3LOTA 3G1YA 1ZALA 4KFNA 3G1AA 5KINA 4NJGA 4FIQA 5D09A 3IIVA 3STCA 5DXXA 4S1FA 1ME7A 1MEHA 3B4UA 3PBYA 5BOOA 3O06A 1Q6QA 5G5IA 3W86A 2VC6A 4N4PA 3OVPA 4GC4A 1K8YA 5D2VA 2ZZ3A 2V2HA 4RZ5A 4YL2A 5CZTA 5D32A 2QCDB 3IRDA 4Y9AA 5I3HA 3IVSA 5CPOA 4TR9A 4N6FA 1R46A 3BW4A 3THAA 3ATYA 4MJZA 1WAUA 2DZTA 4E2DA 1Q6OA 1RD5A 3NAVA 3CEUA 5F2IA 3PS7A 3IVUA 2QAFA 4JY8A 1G69A 3W71A 4S2BA 5CPNA 4UNLA 3B04A 1KFCA 3P8IA 2WOQA 4JTKA 2FPTA 3L9CA 4AHPA 1ME8A 4X22A 3W73A 4C1LA 2A0NA 5EL1A 3KVMA 4I7WA 2V2DA 4IOTA 3PSVA 1SO6A 3NPVA 1TMHA 3IGXA 1TQJA 4IMDA 4GRSA 2PRLA 3NQVA 4KFPA 1BWKA 3P60A 1T0OA 4MLJA 5AHIA 4A29A 1TPB1 4O0ZA 2Y6ZA 1DJNA 3BGJA 2VFHA 2WQPA 3STEA 1GEQA 2WSRA 3LLFA 4ML9A 2QCFA 3B05A 4MVAA 1YYAA 3TW7A 5HNRA 4LW7A 3TC7A 5K4XA 3CT7A 4QISA 3SJ3A 2BSLA 4PH6A 3QRHA 5KMYA 4IX0A 4MYXA 3G8RA 3TDFA 2BTMA 4QJ1A 3NQEA 2FFCA 2Y7FA 3KOFA 3W1RA 2CLHA 1FCVA 3INPA 8TIMA 4RZ6A 2Y85A 1I2OA 2Y70A 3QMRA 3HPZA 4LNYA 2X1RA 1SQ7A 2ZYFA 3W74A 3NL6A 3GAKA 4FIRA 1PHQA 4N02A 3VNDA 4K6AA 1PV8A 3GZ3A 1S5VA 3DBPA 3R5EA 3TJXA 4XUGA 2A85A 1BEUA 3QC3A 2D73A 3NQAA 1GVFA 2V2CA 1VPXA 1XDLA 4NJKA 5G1TA 3IVTA 4JIQA 3W07A 4JICA 2WJZA 3F03K 5D2WA 3L65A 3W7CA 1LBLA 1OX4B 1FCQA 4WOZA 4M6PA 4QQ3A 2W6RA 1SSDA 3HJZA 3VE7A 2RFGA 2JBMA 3HF3A 1W8SA 1TSIA 3B8DA 4XKYA 1KTNA 1SFLA 3P74A 3EX4A 2JGYA 1LRNA 3HPSA 3W7OA 1FUYA 2NXGA 1LRTA 3E02A 3MWAA 3JS3A 5TBOA 1SU5A 3F1QA 1ML1A 1EP2A 2E6DA 3NR0A 1OF6A 1XUUA 4LRSA 3GX9A 3W7HA 4WOQA 3QPYA 2ATSA 4MYAA 4M7SA 1KA9F 1VGAA 3W1TA 1Z42A 1VLWA 3HQ1A 3BW2A 4BFAA 3GXPA 3P80A 2I14A 3TROA 2VEIA 4FHAA 4IQLA 3LHUA 5I3IA 1XBXA 4JTGA 1Q3NA 2FTPA 2JKPA 1B4EA 5D37A 1I2PA 3R13A 1RQHA 2DZUA 1YDOA 4BK9A 4GUIA 1OG0A 1PHWA 3GAYA 3EXRA 3W1LA 1MZHA 2P0OA 3S5OA 3KVLA 4KWVA 4RLIA 5KSWA 2QUTA 1R47A 4JNMA 4Y90A 4X2RA 3NQ6A 2ZRVA 4W9TA 1H50A 2ZCGA 3PR2A 2G97A 1B3OA 3M47A 1W5PA 3M41A 2ZDRA 1KLZA 1H7OA 5HQEA 3EWWA 3N19B 4DEFA 4POCA 1H62A 1SW7A 4A2SA 2VELA 3W9ZA 4JTJA 1VJIA 3EXTA 3EWUA 1KM3A 1NAL1 3TFCA 1VYSX 4CNPA 2VXNA 4UMAA 4JTLA 2CW6A 2QJIA 1N55A 2HMCA 1EX5A 3W22A 4ICNA 2XN0A 3DFSA 3OVRA 3LV5A 3BGGA 3CWNA 1RVGA 1H51A 1A5AA 2R14A 5D05A 4DXVA 3QPZA 4UNKA 4QM1A 3HG5A 3W1MA 5CZ0A 1ZNNA 4YCPA 4P2VA 3S0CA 3P62A 1FX6A 2B7PA 1VCVA 3S8HA 1L6WA 3O16A 2OT0A 1SZFA 4KWWA 3LCWA 3I7SA 1NVMA 3DI1A 1LDCA 3P5ZA 3IIZA 3N9RA 1JRBA 3NYZA 4LV9A 1P0NA 3LX9A 5T26A 3W87A 2QCCA 4Z08A 5FEXA 1UCWA 4MZ1A 3TU9A 3M0ZA 3ABRA 3O1NA 4FXSA 4TMCA 3SSJA 3DI0A 2Z1BA 3NXFA 2JKAA 1GZGA 3FJLA 3TAKA 5LNVA 2C3ZA 1XCFA 3MMTA 1X1ZA 3R89A 4DBDA 4O57A 1JULA 4AWUA 1GYNA 1K3UA 4DO6A 5ABTA 3W2LA 2CLIA 1KTCA 3NG3A 5FF7A 1TB3A 3B0VC 4DF0A 1P0KA 5EA9A 3C2FA 1TIMA 2V5BA 3G0XA 2V81A 1KV5A 3O6YX 3GXTA 3BLEA 3BG5A 4LRTA 1FWSA 1TO3A 3PB0A 4LC6A 1IXNA 3W7QA 3N73A 1GYLA 4BI6A 3PUEA 4N2YA 2RDWA 2ZZ7A 1B9BA 2Y7DA 3GKFA 4N9BA 3M5ZA 2WNNA 2VFIA 3C52A 2QCNA 3QSRA 3MYPA 4XKYB 1FCUA 6TIMA 3UPWA 1EIXA 1YADA 4FNUA 2Y63A 3SGZA 1T8XA 5MHBA 3G18A 4HPJA 1EUNA 2X1TA 4K36A 3G0UA 5CZJA 4R7JA 5HUPA 4MUZA 2BWGA 3G1FA 3SGUA 2DJXA 5FF0A 5L9FA 2CZDA 2QCDA 4RCXA 2HS6A 4HSOA 4NNBA 5EBUA 5F2LA 2ZA2A 5G2HA 3LB0A 4JN6A 3CHVA 4FX7A 4M6QA 4Q33A 3NNTA 4O19A 5D2YA 4JTHA 4WJEA 2G5WA 1OFPA 1WXJA 3PWAA 1A5SA 2WNQA 3C2RA 4ZQNA 1ICQA 1KFLA 2H6RA 3LI0A 5I3GA 1X6UA 3EX6A 4TO8A 1SZEA 5C54A 3L0GA 4I9AA 3MHGA 5C6MA 5D2XA 3Q2DA 4O11A 1W5OA 2ABBA 4LS0A 1GTEA 1F76A 3BV4A 4L4LA 1OYBA 3AO0A 4IXXA 2GVJA 3S1UA 4PFMA 1W1ZA 3NQFA 5LZLA 3L2IA 1WDWA 4WUIA 3WJXA 2P1FA 3GYEA 1BTMA 2EF9A 4FO4A 2B7NA 4XTDA 1FXPA 5LGZA 3DHFA 4PODA 4NXSA 4GBUA 2I1OA 1Y0EA 4AHQA 1DJQA 1AL8A 3T40A 4K39A 1VZWA 2Y61A 5D02A 1RPXA 2NV2A 1JR1A 3L21A 4CCEA 4ONVA 3QMSA 1A5CA 4AXKA 1LBMA 2C18A 1TTPA 2E6FA 1JJKA 4N9CA 1MEIA 3UY7A 2C0AA 3JR2A 1QFEA 3PC0A 3W7EA 2YXGA 3OIXA 1KBJA 1MSSA 5HUOA 2QJGA 3MP3A 3LTYA 1ALDA 1NFBA 3NM1A 3KVJA 1QMLA 3C56A 3B03A 1U5JA 2FIQA 1R30A 2ZRXA 4OT7A 4NJIA 1DHPA 1TYGA 5E1QA 1QDSA 3P61A 3A23A 5AHFA 3CQ0A 3G3DA 4UCGA 4LVBA 1D9EA 3CIXA 3UXAA 2H3DA 2E68A 2V5LA 1KM2A 1LORA 5LKYA 5DXYA 4IMEA 5AHNA 4MFEA 3LHYA 3OA3A 4IMFA 3LGEA 3ABQA 2FPYA 4UTLA 1M5WA 4JS3A 4OV4A 5K9CA 2GVLA 1ZY9A 4OQVA 5G4EA 3RF9A 3W7JA 5AB3A 3M7WA 3JRKA 1UB3A 2YFNA 1H60A 1WBJA 3P7YA 1YTDA 4GUGA 4R53A 3VKJA 1WYIA 2DU2A 4H6KA 1EA0A 3OHIA 3C8FA 1J2WA 2F7FA 2QCHA 3NM3A 1O95A 1X8FA 5FF2A 2V30A 2I9EA 3P81A 1W37A 5DCDA 4I7VA 4TU1A 3C61A 5D04C 1UUOA 4ADTA 3TR2A 1N8FA 1QR7A 2CZ5A 4ALDA 4O50A 3EEGA 2TMDA 4UMBA 1VHCA 1EP1A 2Y7GA 2X30A 2OZ0A 5FESA 1YDNA 1S5WA 3O63A 5DELA 5C2XA 4Z1CA 3TQ0A 1TCDA 4UC5A 4JEQA 3ZR4A 4YCOA 2CWNA 2ZRYA 3LCGA 3OEXA 3LXCA 3HB9A 1GVOA 4XZ9A 3I7RA 1W0MA 3U6WA 1YPIA 5BMXA 2C14A 1TTQA 1ZHAA 3GDMA 3L5AA 3F4NA 1Z44A 3PB2A 4IUOA 3VI2A 1FCBA 2Z6JA 4HNUA 1DKWA 3TMQA 5TQLA 1DQWA 5DY2A 3TXVA 5LHFA 3Q94A 4DO4A 5D2TA 3HMJG 5G2IA 4JX5A 1QO2A 3A21A 1OFAA 3M5XA 2OJPA 3RLUA 4NX5A 2HSAA 3S42A 2CFFA 1VC4A 4DQWA 1W5MA 3FS2A 4MKNA 5CGQA 3L68A 1PL9A 2CU0A 4K7VA 3S5ZA 3IIOA 1KBIA 4C1KA 5HULA 4WQ6A 3UWWA 4HNNA 4O8RA 3ZWTA 4JDBA 4E0CA 1HO1A 2XN2A 2YYTA 5DLCA 3USBA 1SO4A 1IXPA 3CC1A 1TRDA 3HG3A 1JUEA 3C2EA 3N9SA 1PCWA 3CTLA 3DAQA 3G22A 3E96A 3LCFA 4Y8FA 4Y6GA 1EEPA 2P10A 1GVSA 4JR5A 1NF0A 1OF8A 4RXFA 4LVGA 5D38A 1B4KA 4WZHA 3THQA 2E6AA 3CPRA 5F2MA 4UFLA 2GQ9A 3WJSA 1FQ0A 3LHTA 1QPNA 1CI1A 1F5ZA 3NQMA 4LS2A 4JD4A 1A5BA 2Z0IA 1LOQA 4LVDA 3A5VA 4OBTA 1K03A 3S1VA 5HINA 5AC8A 4XQ6A 5I3JA 4N6EA 3L5MA 2FDSA 1BWLA 3S5NA 3UNDA 3OBKA 5KZEA 2ISSA 2TSYA 1SO5A 1EUAA 5SWUA 4HSNA 1I2RA 3BK0A 2GOUA 1SZGA 1VR6A 3CEPA 1RQBA 1OYAA 5CPLA 1WOAA 3NO5A 3P82A 5EPDA 4UTTC 2NZLA 5AHEA 4D2JA 3W2KA 1KM0A 1O4UA 1C29A 2WSYA 4JTSA 2DORA 4TIMA 3W7DA 1K7XA 3W84A 1EPXA 3EXSA 4N4QA 2JK2A 1NF7A 4U28A 3E12A 3W72A 5BMWA 1VH7A 1HL2A 3D0CA 3V75A 2QCLA 3W6YA 4JTEA 3W76A 4GNJA 4UXDA 1VCGA 2X2GA 1SFJA 3Q37A 1LROA 3NA8A 4QIUA 1OYCA 3S1XA 1O5KA 4GUHA 1T96A 2PCQA 5AYYA 3STFA 3GXNA 1TPDA 4A3UA 2ZZ1A 3KFTA 3NDOA 3WK3A 4WD0A 4LY8A 3FIGA 4O52A 3H54A 1GPWA 3QW3A 5DBUA 3ABSA 1YLVA 2YFOA 3TSMA 2GJLA 4J9JA 4NXKA 4AAJA 3SECA 5CSSA 3LDVA 4ZQCA 1MEWA 3GDRA 1F6PA 4O15A 2BXVA 3TXZA 1OX4A 2WKJA 1LOLA 4NVTA 4N9DA 1HFBA 4M6VA 1UASA 4O1CA 1JRCA 2WV8A 4IMGA 1YXCA 3NOEA 1AW1A 1AK5A 1E51A 1IIHA 2FLIA 2J6XA 4DPPA 2JKEA 1KFBA 2B4GA 4IPIA 4NNCA 4GE8A 3R12A 4MY9A 4DBEA 4JTFA 4GFSA 2W79A 3L67A 4CQ8A 4Z1DA 2YDAA 3RK8A 4E38A 1U83A 2O7SA 3F4WA 4UTTA 4KKXA 3TK7A 2ZZ2A 3W85A 3W1AA 1I2QA 1OFDA 1TTIA 4JX6A 4JTIA 1ZAIA 2QCEA 4IPJA 1UUMA 5CKSA 1RQEA 1F7BA 3MP5A 4RZ4A 4NJHA 3MI6A 4NUWA 3BG3A 3NPWA 3UQNA 1H7NA 2VOMA 3ANYA 2YYUA 1QWGA 3W7KA 3EWXA 2GUUA 1AW2A 3FFSA 3QM3A 3E0IA 1KM4A 2ZZ6A 1IF2A 1PS9A 2ZA3A 3CWOX 4E2BA 5AHLA 3L0NA 5AYZA 3DH7A 3RU6A 4PA8A 4AHOA 3BVJA 1XC4A 4AEOA 3PUDA 5AYXA 1ONRA 2Q8LA 2YW3A 2CLMA 5K4ZA 3LCLA 1DORA 2G95A 3NQGA 2RDTA 3GNNA 1F6KA 2IQTA 3PSWA 1I4NA 3TC6A 1FDZA 3W7RA 4CNOA 3UXDA 4ORIA 3T44A 3O15A 4WY0A 4IJBA 3LLDA 2QR6A 1T99A 3GB6A 5LHEA 2ZZ4A 3TAOA 1O60A 5HWNA 2ZTJA 1VYRA 3W75A 3QF0A 3DHDA 1P1XA 2CLFA 3FJ6A 1N7KA 5HJLA 5C5YA 2RHGA 3LHWA 4AMAA 1PE1A 2YX0A 1DBTA 1LZOA 2EAWA 3C4UA 5K2ZA 1GWJA 3WK2A 1W5NA 3G1XA 1TJRA 3T78A 4IMCA 4BI7A 1OFEA 1WOBA 4ORMA 1QOPA 3MI2A 3FKKA 2A7PA 4O28A 4ADUA 4UFKA 1OX5A 1IGSA 1L6YA 2ISVA 2NV1A 1OABA 7TIMA 3GLCA 3VE9A 3W83A 3DFPA 1Q45A 4BWLA 1W3IA 5IBXC 1F73A 3TX9A 4A22A 4O53A 3NVTA 3TQVA 2VKZG 1ZJIA 2VFFA 3EB2A 5TIMA 2NWSA 2J88A 1YPFA 3BLFA 1KM6A 1TPEA 4RX0A 1OX6A 2PRHA 3UPBA 2QEZA 3KRSA 2CZEA 5KZMA 3W2NA 3W7PA 1G4PA 4O1DA 1FDJA 4HKPA 4CNNA 4DPQA 3NQ7A 4YLWA 2YCEA 4WY0F 3QZEA 2ZQ0A 3TSDA 2JGQA 3M6YA 2VFGA 3LXAA 4WX2A 2C6QA 1H7PA 3PBUA 3G3MA 3U8GA 4UTMA 2Y89A 1GOXA 4B5NA 3A22A 4O4WA 3IIXA 1G7UA 5LNWA 4CQ9A 4QAIA 4LTSA 1SW3A 4A2RA 3MBFA 4MZ8A 1LOSA 3NQ8A 4UTKA 2DZPA 1VQTA 1A53A 4EVZA 5FEPA 1JCMP 3LBMA 3L5LA 2GVGA 3SY5A 3M5YA 3DGRA 2BX7A 1NEYA 3A24A 4HNTA 3DZ1A 2AAMA 3Q58A 3V1PA 4UMCA 2E09A 2TPSA 2QUUA 3HIJA 4ZL1A 2QUVA 4GUFA 2ZZ5A 3G1HA 5F4XA 3BLIA 3BARA 3G1VA 3H55A 4NJJA 3W2JA 3G1DA 4XBKA 3NGJA 4PC8A 5AC6A 3LRMA 3UWZA 1K02A 2C19A 3FLUA 4OU1A 3TSBA 3B0UX 3S9YA 3PM6A 2NXHA 4Z0JA 3C0JA 3KRUA 5CG7A 1QPQA 3PBWA 4P61A 1UJPA 1KM1A 2FJKA 4QNEA 3QMTA 4BI5A 3W1NA 1SUXA 4ZQRA 4Z1AA 4AWTA 2A1YA 4LV4A 1J5TA 3N14A 5AC7A 3O05A 1F2JA 1Z48A 1W31A 3DKJA 5DY3A 1FWTA 2A6NA 3RNDA 1QO5A 2Q3RA 5AN7A 3YPIA 3EWZA 5DCEA 1KLYA 5CSRA 3RLVA 2AGKA 3HGSA 4OGZA 4NX0A 3EWYA 2QDGA 2C15A 1LLZA 4JIPA 5EKYA 2E5DA 1TV5A 3W88A 4LWWA 1K7EA 2GJNA 2DZWA 4LUJA 2J27A 3WK0A 4Y96A 1GT8A 2Q8ZA 2CLOA 4GXMA 1H7RA 2B7OA 1FWNA 1MO0A 5E0KA 3KX6A 5F4SA 3DFTA 4R34A 2Q3OA 4N9EA 2W0UA 1XM3A 2NX1A 4K37A 3UY8A 3QSTA 2A7NA 2A5HA 2RKXA 1TREA 5FI8A 4FX6M 3HOJA 4R33A 3W1PA 3NQ2A 4QNWA 1G6CA 3NPUA 2NUYA 2QCGA 2YGYA 4EF9A 1XFBA 2VENA 2LLEA 4HIBA 3PF3A 3CB8A 2DJLA 3DFOA 1H1YA 4O14A 1VHNA 3K30A 2A6LA 1FBAA 3S5YA 4LT9A 4FX8A 1JCYA 3O07A 3SR7A 1GVRA 3WJWA 1OHLA 2GQAA 5I3FA 4BWLC 4FNSA 3PY2A 1LP6A 1YTEA 5GVJA 2H90A 3TH6A 2DP3A 1H61A 1TPUA 1G7VA 2QKFA 3NPXA 2C13A 2EGZA 2ZRWA 2ZBTA 4HHPA 1XUZA 4NZFA 4FEZA 5FF3A 4EF8A 4JDYA 3W7IA 4K8EA 5LNRA 3TMLA 4AWSA 1B57A 2Z6IA 3TFXA 5F1UA 3MBDA 4CCCA 4UIOA 2FPVA 5K9DA 3NEVA 3FKRA 1D3HA 2A2IA 1PIIA 4FXRA 1DVJA 3W2UA 3B06A 1TPWA 2GQ8A 3NL2A 2ATMA 5LSMA 2H3BA 5CPMA 3DFQA 4FNTA 1ZAJA 4O1AA 3H53A 3GK0A 3ABOA 2R8WA 3P5YA 1JQXA 1XKYA 3ELFA 4MIMA 3FA5A 1RV8A 3G8EA 4XTIA 1KM5A 3KRZA 3PULA 2QF7A 3W23A 1WA3A 3GDTA 5A5WA 1K8ZA 3OG3A 1GG0A 2CLLA 3I6RA 3GKAA 4K7YA 3NQCA 3W1QA 3BW3A 2HTMA 2E5BA 3ATZA 3STGA 4ZMGA 5BRBA 1MXSA 3CM4A 1F05A 4Q32A 3W3OA 4LS1A 1QPOA 3P8JA 1FXQA 4ADSA 1Q6RA 1QNVA 3DXIA 3UD6A 5K3VA 2PRMA 1P4CA 4AF0A 3E9AA 1TV8A 4M5PA 3EX3A 2G96A 3RMJA 4NNAA 4TMBA 2Y7EA 5G1YA 3TUUA 1M7PA 1TJPA 3HBLA 3HGOA 1VS1A 3W70A 5F4WA 3CIWA 3EKLA 2YW4A 3HO8A 2DZXA 3L66A 3PAJA 1Z41A 1Q6LA 2J9XA 3W7NA 2ISWA 1HUVA 1R2TA 4UFIA 2C16A 1S3HA 4TX9A 2A4AA 1JCXA 1C8VA 2NWRA 2EKCA 2Z2UA 3LHVA 3PVFA 3EX1A 1EWEA 3LRLA 5G4WA 2NUWA 4MFDA 1KTBA 2VEPA 1R2SA 2E5CA 3W1UA 5BW6A 4YWIA 1S5TA 1TQXA 3QQ1A 1HO4A 1OK6A 1IXQA 3HGRA 5HMSA 1H7WA 1PCKA 2TRSA 5F2GA 2DZSA 4G1KA 4UFMA 1GVQA 1LYXA 1YTKA 1KFKA 3FYPA 3GIYA 4FNPA 1W3TA 1YXDA 1VLIA 2H8XA 1H1ZA 4O12A 4UTWA 4YMZA 4HN4A 4PCFA 4NU7A 3TE9A 4AVFA 5KZDA 4JX4A 2B7QA 1WQ5A 1R2RA 4RJEA 2ZTKA 2WNZA 2QDHA 2X16A 1CW2A 1H5YA 4UUIA 3HPXA 5AFDA 1ICPA 4FB7A 1W5QA 3BO9A 2X1UA 4KFOA 2V8ZA 3IIPA 4UTUA 3LRKA 2V9DA 2O7QA 1ZENA 4OE7A 1QCWA 3WJZA 1ME9A 5HWJA 4DF1A 3NQDA 3SIZA 2ZA1A 4WXZA 4S2CA 1G4SA 4JY9A 2R91A 3TNOA 3MO7A 1IIGA 3O6CA 2ZRZA 4HNVA 2EHHA 1J4EA 1JCLA 4MY8A 1G67A 3MHFA 4RXGA 1O94A 5D33A 3R8RA 3UWYA 2CLKA 2A7RA 1VYPX 3IV3A 3TCEA 2KZHA 1JUKA 4MJMA 3W7LA 1QOQA 3SFKA 2PC4A 1XBZA 3EX2A 3W1XA 1LBFA 1F74A 3MHUA 2B0MA 4GUJA 2RH9A 1BKSA 3MJYA 2VEKA 1K8XA 4UR8A 5F1VA 1V5XA 2C1HA 1P5BA 2E1DA 4LUIA 3W2MA 4PEKA 4RV8A 3O6DA 4JTTA 3LERA 3M16A 3A5FA 4UTIA 4Z0SA 4EIVA 1C9DA 5J5DA 5KTLA 3QQ0A 4MZYA 3QFEA 4CLMA 1OJXA 1M7OA 3T4CA 2GPTA 1JUBA 1SO3A 1H7XA 3GR7A 4Q4KA 2RDUA 1WX0A 3KXQA 2J24A 2NX3A 5U7SA 4JYFA 3GVGA 3HG4A 1SZNA 3LM7A 3TKFA 1HG3A 5LGXA 3PG8A 4Z1BA 5A8GA 3P84A 4UTWC 1EWDA 3N2XA 4ZQOA 4UFJA 2E6YA 1DL3A 3SW6A 5C55A 2VEMA 4WXYA 3M9YA 2NUXA 3DFNA 1VCFA 4K38A 3IEBA 3CU2A 3O8AA 1W56A 3I68A 3E49A 4RR4A 6ALDA 4NT0A 2A21A 2OT1A 2NX9A 1K7FA 4UTHA 2F84A 3N34A 1G4EA 3PBVA 4IWWA 3GR8A 3T55A 1X7FA 3NZ1A 1CX9A 1TPC1 5FEZA 2ABAA 4O54A 3WK1A 3MI3A 3LCXA 1KV8A 2J9YA 1EP3A 1WV2A 3DU0A 4X9SA 2QJHA 5E93A 3UZ5A 4DELA 4LU0A 2OCZA 3LXBA 3MUXA 5G2WA 3UWVA 3HG2A 3MYOA 4AB4A 1LLWA 4JYEA 5KITA 1SSGA 3LTSA 1SPQA 5AOUA 4XWUA 2VFEA 4EWND 2FQIA 1SW0A 4I7UA 4RK8A 1W54A 1WBHA 2Y62A 1TPVA 4U4MA 3P67A 4HPXA 1EB3A 1SR9A 2TYSA 3TW6A 4RKAA 4EOUA 4NQ1A 3MW7A 4LVAA 3I7QA 2AQWA 3ZWSA 3M43A 4IGHA 4OHQA 2VFDA 5HR7A 1HTIA 4X3ZA 2WPBA 1I45A 3G0SA 1RZMA 1I2NA 5IBXA 3W7GA 1ZCOA 4YXGA 3QYQA 2CLEA 4QITA 3UYCA 3CLMA 1XL9A 4A21A 2R94A 3BG9A 5FF4A 2YPIA 2QCMA 1NSJA 2FB3A 3QW4B 1FWRA 2UV8G 4CQAA 1AMKA 3UWUA 3U2OA 3GNDA 3SI9A 3N2MA 3LV6A 4AH7A 1L6SA 1ZFJA 2QAPA 3NZRA 4JXCA 4JTUA 1GJPA 4LVFA 3BPWA 4UFHA 5D03A 5BNKA 3QEZA 4O0KA 2CZFA 1OFOA 1M6JA 1TV7A 3B0PA 1ADOA 1PVNA 3M1ZA 5H91A 4GJ1A 4ZVJA 3KVKA 4CCDA 1YXYA 3PUOA 3ZFHA 5K7JA 1DQXA 5IM51 3NL5A 3VFLA 4O10A 1DOSA 5AHMA 2ZFAA 4PL2A 2E77A 4O18A 4PTNA 4ZQPA 1IXOA 5EMUA 3TV8A 4UR7A 3KHJA 1G4TA 4M19A 4MLRA 2J9ZA 2HS8A 4MPQA 3LCHA 5FEWA 4FNRA 1VRDA 1OFRA 3C6CA 3FOKA 4FNQA 3T7VA 5K9XA 3LHZA 4ZQMA 1JCNA 4H3DA 5DBTA 2FB2A 4MOZA 3R2GA 2V0TA 3S6DA 2OX1A 1GQNA 5L6UA 2WSQA 3UWQA 3QH2A 1LM1A 3C3NA 1TPFA 3S1WA 2YR1A 1KFEA 1JVNA 2DZVA 1XI3A 3N3MA 1LCOA 2WO5A 3G1SA 2OMAA 4NZJA 4DF2A 2ZRUA 3WFAA 5U4NA 1W3NA 3SZ8A 4IXHA 1D3GA 1KFJA 1LRQA 3ZS4A 1XXXA 3I65A 1L2UA 1L9WA 2H8ZA 3IGSA 5HR6A 2BLEA
chains in the Genus database with same CATH superfamily
3U48A 4UOZA 1H1NA 3W7MA 1RP8A 3LD5A 2ACSA 2XWDA 3L4ZA 4W7UA 1OQFA 4UQEA 3SUWA 1O5XA 4XBSA 4BA0A 4BR1A 4IQEA 1XCXA 4PB3A 3BCFA 3LI1A 2BB0A 3VNIA 3DKLA 1J18A 2XFRA 4DVOA 5I78A 3AALA 1JAKA 1GG1A 5DFAA 3QHMA 1AL7A 1JGMA 4QSHA 4OJYA 4BQ2A 3TQKA 1W17A 5I09A 2V82A 3TA6A 3IGUA 4JGDA 4AZCA 4O4VA 3GDLA 3GBEA 3WBAA 1I8JA 1SMAA 3DENA 1AW5A 3SCSA 1UKOA 1VF8A 4QAWA 4O17A 1THFD 1UD4A 3KBMA 2PODA 1EDTA 2VO5A 3CZ8A 4Y2WA 4OFCA 3TJLA 4BEUA 2DIKA 1OK4A 1KD0A 4XZHA 3AJXA 1VEOA 1RR2A 4O1BA 1S5NA 1JFXA 3PJUA 4I5XA 5E6ZA 1U1JA 4QXIA 5EYWA 4C6MA 4MF4A 2OU4A 3NL3A 1OT1A 3MVTA 3EKZA 4A3RA 2XN1A 3K4AA 3LCIA 2GK1B 3TIMA 4Q8WA 1H63A 3MZ2A 3GDKA 1OVDA 2X8RA 3COTA 4O13A 4AF0B 1MMFA 1TZ9A 2ZE3A 3OVQA 4JYDA 4BF9A 1JZ6A 1OFQA 2OO0A 3LPGA 2ZX6A 1PKNA 2WPGA 3R0UA 2INEA 2YSWA 1E1CA 2VI0A 2E67A 3CL6A 4Z2KA 1ZALA 4KFNA 3VNLA 1AODA 3L4WA 5DXXA 4S3FA 4IIEA 1ME7A 3PNZA 3PBYA 8CGTA 3W86A 4AD3A 4WJXA 4YL2A 2JE8A 4B5TA 4D1JA 3P14A 2PDCA 4FK9A 3D46A 2X09A 4Q6JA 1WNOA 2PU1A 1CIUA 1JF5A 1WAUA 2DZTA 1BWVA 3CS2A 3NAVA 3NTYA 4J35A 3AOFA 1YX1A 2PZNA 1CGXA 2W63A 5CXPA 1UW9A 3CH0A 2WOQA 2YA1A 2Q02A 2Z24A 1HJSA 2WMKA 3KVMA 2V2DA 5H8MA 4IOTA 3N04A 3PSVA 3NPVA 1ZB5A 1TMHA 4X60A 4HJWA 5FJIA 3F5KA 2J66A 3VIMA 1E5JA 3GFXA 1B90A 1BWKA 3P60A 4MLJA 4A29A 4BF7A 1FHUA 1GEQA 1OSEA 2WSRA 3ABXA 3TW7A 1QBBA 4XUYA 3STPA 3W00A 2CXEA 4MUPA 2JIEA 2GJXA 4G7EA 5FKYA 3F2DA 3SRDA 4KETA 4QJ1A 1CB7B 1ITXA 1XGEA 4OECA 2FZ8A 2Y7FA 3CV6A 2CLHA 1FCVA 2YB1A 3INPA 2WWCA 7REQA 2INZA 4OUEA 3ZIZA 4HMDA 1I2OA 3QMRA 3ITOA 3HPZA 3LLXA 1GCYA 1US2A 4IG2A 3T4WA 1SQ7A 1ENUA 2ZXAA 3T2QA 3W29A 3GAKA 2OYLA 3WLMA 5CAHA 2PD5A 3B9EA 3R5EA 4KERA 3MWCA 1BEUA 1M1BA 1V3MA 3PTMA 1VPXA 4NJKA 5G1TA 3IVTA 4JICA 4W85A 1A5NC 3FXYA 1HL8A 2BGQA 1LBLA 1OX4B 1FCQA 4WOZA 1M7JA 4PCTA 4PMJA 4QQ3A 1SSDA 3HJZA 4HTYA 2RFGA 2EPLX 3TWAA 3GD6A 3EX4A 1LRNA 3HPSA 1Q6CA 3WMSA 4D9PA 3FXGA 4HB7A 3JS3A 4IP4A 5TBOA 1SU5A 3APTA 2E6DA 3NR0A 3P0XA 1OF6A 4LRSA 4JFUA 2ZX5A 1UIOA 1Q13A 3U3HA 3W1TA 2PGRA 1G94A 1QVBA 3GXPA 1O66A 2VEIA 3LHUA 4JTGA 1Q3NA 1A47A 1D8WA 1I2PA 3R13A 1FWIC 3UJEA 1D2KA 3GYCA 1CXKA 5MF5A 1OG0A 4IFKB 3EXRA 1E1EA 3BQ6A 2QUTA 3A12A 4LPCA 4KW2A 5IXEA 4Y90A 4X2RA 2BY3A 1HKKA 4FOJA 4IGNA 2YZ5A 1XG4A 4JTCA 4F0SA 1B3OA 4CN6A 4Q8PA 3BJSA 3HFYA 4S3GA 2PDLA 1IWBA 1H62A 3DHUA 4E3VA 4E4UA 2VELA 4FXFA 1VJIA 5BCAA 3QHNA 3VIIA 1VYSX 4CD7A 4CNPA 1HJXA 2J8TA 1BF2A 2VXNA 2H9AB 1XIJA 5LA1A 5E9XA 1N55A 6XIAA 1J0YA 1NH6A 3WLTA 5FOOA 3OVRA 2XVGA 4TVUA 2R6OA 4R9XA 3CT2A 3T2OA 1BVZA 1H51A 2R14A 2WXDM 4DXVA 4H6EA 3HG5A 3WLJA 4C5YA 1ZNNA 4YCPA 5D4YA 2B7PA 3BLKA 2NQ9A 3VYLA 4Z42C 2TAAA 3LCWA 2I17A 3IAQA 5HBFA 4HK6A 3AQUA 3N9RA 1JRBA 1M3UA 1NWSA 3RO6A 3VVGA 1KCXA 5FEXA 1TMLA 4KRUA 5AKQA 2OLAA 3WQGA 1W1YA 3G77A 3KTXA 2H9AA 3TU9A 1AH3A 3ABRA 4GK8A 3FY1A 3WEZA 3M7SA 2C3ZA 1UH4A 4RV3A 1XCFA 3CUZA 1X1ZA 2XPKA 3AS2A 3EB3A 4AWUA 1E6QM 4LCSA 3HV8A 4GVIA 5FF7A 2CC0A 5HXMA 4DF0A 3WF1A 5A6JA 3C2FA 2WANA 3TVAA 3UG5A 3O6YX 3BLEA 3WG6A 1FWSA 3PB0A 2R82A 2ZXQA 1IXNA 2W92A 3ARTA 3TYEA 3V5CA 1GYLA 4N2YA 1DIKA 1B9BA 2YBVA 1W2PA 3ITGA 4ZXOA 1UKPA 2Y7DA 3A6OA 1UA7A 3CAWA 2WNNA 3AWNA 4RE2A 3OLEA 4XZMX 3MU7A 3WSUA 4ZO7A 3FA3A 3KW3A 4LEQA 3G18A 3HU7A 1QHOA 1EUNA 2OEMA 3G0UA 3H4XA 1ESWA 2XVNA 4CCZA 4MUZA 2BWGA 3G1FA 1H41A 3TOPA 4BCEA 2ONEA 1ZQ5A 1DJXA 2BOFX 3FDGA 3F5LA 1HP5A 4RCXA 3QY8A 4L7ZA 1BYAA 4XZLX 5G2HA 3ANVA 3PNUA 7TAAA 3ZSSA 2PDPA 2VRQA 4E8DA 1R0MA 1B2YA 4JTHA 1JAEA 2PA6A 1OFPA 2ESCA 4FR1A 1HZYA 1US0A 3C2RA 1ICQA 1W1B1 2J8GA 4WJ8A 1RCOB 2ON3A 3GHUA 4TO8A 3GS6A 3UNTA 1QTWA 5C6MA 3OA5A 4O11A 1RAKA 1W5OA 1E6NA 1FWFC 1Z32X 3VD5A 3FSTA 1K77A 1F3TA 4PFMA 4JCLA 5LZLA 1WDWA 3WJXA 1H11A 2PLCA 4KPLA 1P7TB 2EF9A 1CCWB 4F9DA 4Q8NA 4KEUA 5LGZA 2G3FA 4K8GA 3ARQA 4H19A 4KCTA 3FVMA 5AECA 5LA0A 1UR1A 4HVXA 2NV2A 4CCEA 3QBUA 2G50A 3QMSA 1RCXB 1W8GA 3L2LA 2RJGA 5GJNA 1MEIA 4DWSA 3CZEA 3PC0A 3VMNA 5ENLA 3EKGA 4PRTA 1KBJA 4CUCA 1Z7AA 2HK1A 2V5JA 1QMLA 1HVXA 3ZSTA 3WY1A 2JF7A 5DANA 5I5RA 3V16A 2FIQA 5FD0A 5C7HA 4OT7A 1TYGA 3WLQA 3P61A 3A23A 1ONEA 1PDZA 4S3DA 4EPDC 1LQ0A 3ZVHB 1KM2A 1LORA 3SBFA 4MFEA 3LHYA 3OA3A 1XLFA 3RG6A 4UTLA 2A3HA 1CTNA 4OV4A 2DVTA 2GVLA 1O1HA 3RF9A 4LALA 2YFNA 3LUTA 1WBJA 4R53A 4ZFMA 1WYIA 3GNRA 1F9CA 3QOKA 1J2WA 2F7FA 1P48A 1EXBA 3W01A 1IEVA 2J7BA 1JCTA 3CHCA 5DCDA 1R5YA 5D04C 1A3HA 4W7WA 1QR7A 3T05A 2CBJA 2FHCA 4QJ3B 4H9VA 1EP1A 3IUDA 3PK7A 3WQWA 2Y7GA 5HQMA 2OZ0A 5FESA 3GC4A 4Z1CA 4D8LA 4MWAB 4NSBA 4RUBA 4IHCA 4M8UA 1BHGA 2CWNA 2HQAA 1V0LA 2G4FA 4Q8QA 3HB9A 4Q4RA 4XZ9A 2QIIA 5BMXA 1TTQA 3L5AA 1KRCC 6XIMA 3F4NA 5HPOA 3TMQA 4RZBA 1H4PA 1PX3A 4XK2A 2Z27A 3UXLA 3Q94A 4HZ7A 1QU4A 3TJIA 5D2TA 3EBVA 5F7UA 1MW0A 3S42A 1QOXA 1W5MA 2WW5A 1NFGA 4QG9A 5CGQA 1REQA 3L68A 2CU0A 3KUMA 4K7VA 1VBUA 1PXGA 5A69A 3FAXA 3R11A 3ZWTA 3ARRA 2YYTA 2J78A 2PDUA 3HG3A 1JUEA 3C2EA 4YHEA 3LCFA 1XRSA 4Y8FA 2GVYA 4XD3A 1GVSA 1F07A 4PUDA 2QMKA 1I60A 3GHSA 4RXFA 4UFLA 1R3WA 1IE7C 4UTFA 1FQ0A 3VNKA 2FH8A 3ZVIA 1XYFA 1Y5WA 4NILA 1E72M 4LVDA 3CZKA 3S1VA 3VC5A 4D8AA 5FJPA 4JHOA 4N6EA 4AD1A 1BWLA 3OBKA 5EMMA 1EO7A 2TSYA 1SO5A 1V6TA 1KKRA 3DERA 3EDFA 1J9YA 5A8PA 1NQ6A 1VR6A 2EJAA 1QRQA 5CPLA 5TD4A 3QOMA 4UTTC 5AHEA 3S2NA 4D2JA 2GDQA 1QI2A 4KIEA 2QF8A 4B5SA 4YTTA 1EYWA 2CHRA 2OEKA 3W7DA 1CGVA 1JI2A 4DNHA 4N4QA 3F2CA 1IEQA 2V69A 1QHZA 4JTEA 2P53A 2VTFA 1VCGA 3UBPC 4ERGA 1LROA 4GY1A 3NA8A 4HQVA 2R24A 2X7WA 1K8CA 4ZENA 1O5KA 4GUHA 3ZLHA 2C1GA 1E55A 3UXKA 1CGYA 4S39A 4FPSA 3STFA 4A8NA 1TJ2A 3GNPA 4A3UA 2ZZ1A 1UQYA 1V6YA 3WK3A 4LY8A 3FIGA 3KBNA 3AFBA 5GNZA 1GQIA 1N2VA 2OKTA 3MQTA 5DBUA 3ABSA 3DC8A 3UG4A 3CBWA 4AAJA 3SECA 3LYEA 1GW1A 1YPXA 2WCSA 1OX4A 2WKJA 4V1YA 1OIMA 4RNFA 1W3JA 1JRCA 1S2VA 1YXCA 5C2GA 3AUOA 1AW1A 1AK5A 1IIHA 4C6QA 3TN4A 3W38A 2J6XA 2BFGA 1PWMA 4GX8A 3A4WA 1KFBA 3OLGA 1A5KC 4DBEA 4JTFA 3PTDA 3T0TA 1JZ8A 1BGAA 3L67A 4CQ8A 1OZQA 2O4QA 3PZUA 2XSXA 1OD8A 1KCKA 4E38A 1U83A 2O7SA 1F6YA 3DESA 5I77A 1K6AA 2ZZ2A 1I2QA 2PTDA 4X9YA 4JTIA 1YE4A 2VGBA 5CKSA 3ME3A 4LUSA 3RLHA 3GG8A 2VGFA 1QWGA 1TG7A 2ZADA 3FFSA 2BNJA 3QM3A 1IF2A 1W3LA 1YQ2A 4C7GA 4PA8A 3TYZA 4H1ZA 4AEOA 2YW3A 5K4ZA 3UETA 5D8ZA 4H8NA 3TC6A 3W7RA 4CNOA 5JMUA 2Z00A 4H01A 3IRSA 4IJBA 2HNHA 3GB6A 3KHDA 4NY2A 4CU6A 1WKYA 2X2YA 4CD8A 4UBPC 2Z26A 3KBJA 2CYGA 5HWNA 2PGWA 3FYYA 1VYRA 2CLFA 5C5YA 5HJLA 1K9DA 1TWIA 3OJGA 3LHWA 1DBTA 1GOWA 3VZXA 3I3EA 3U9IA 1ELSA 3FAWA 3C4UA 1V0KA 1FH8A 1GHRA 3EWDA 5A8OA 3WK2A 2XU2A 3G1XA 1BQCA 1IWPA 2Q09A 2R1KA 1OFEA 1QOPA 1IT8A 2XM2A 3LNMA 4TV5A 2J47A 1UC5A 4ENLA 4P5UA 7TIMA 1V6UA 3VE9A 2DUZA 1O5RA 2J79A 4HA4A 2B31A 4YWSA 4ASTA 5HJXA 2WAGA 3IARA 3I4EA 1PIGA 3W24A 3QV8A 1GOKA 1OX6A 6TAAA 3ABZA 3KRSA 2CHOA 3H22A 3W7PA 1G4PA 4LANA 1WKFA 2PDWA 1R9ZA 4PULA 4WY0F 3QZEA 4IIBA 3S5SA 2ZQ0A 1VJZA 3M6YA 4GCAA 2Z1SA 1TWDA 4S3BA 3SB0A 4PUUA 3RRXA 3RLGA 5I00A 3OQ8A 4ROPA 3WUGA 4CQ9A 2P5NA 2J7HA 1XH0A 3AXXA 3SQLA 4MZ8A 2BHYA 1UKQA 1A53A 3NZPA 4LFYA 3SCOA 5GQBA 4ZODA 1CGUA 3M5YA 3VIFA 3WDPP 1NEYA 3DZ1A 2OR2A 2PDIA 3Q58A 3NSNA 3V1PA 3BLPX 1XIIA 1O1ZA 2QUVA 1W9UA 3R8GA 3H55A 4NJJA 3VAVA 4DIAA 2CKRA 1W9XA 3UWZA 3RM9A 1K02A 2AGTA 3H2OA 3B0UX 4AZCB 4H6QA 2HROA 5EBAA 3VNYA 3KP1A 2HBXA 2WVTA 1UJPA 2OELA 2ZUUA 3EA3A 3H8AA 4BI5A 5TAOA 4A6GA 4IIFA 3VDAA 4IUGA 3M07A 1PTAA 5T91A 4LV4A 2V6AA 3N14A 3V4BA 3WNMA 1KRAC 3QKZA 1IT7A 5LYRA 5DY3A 1B3YA 2AL1A 3N29A 4JKLA 3EWZA 3E0VA 3RLVA 2AGKA 3HGSA 3EWYA 1MNZA 5I3DA 3MUIA 2WLYA 4MAVA 2GJNA 2V67A 3ARPA 2DPEA 4LUJA 4QLJA 1E70M 3HJEA 1H7RA 1S39A 3K1DA 1IYXA 4E8GA 4N9EA 5DMMA 1GQLA 3W82A 2PLKA 2RKXA 3GU1A 3HQNA 2YBTA 3PZOA 3NPUA 1E40A 2YGYA 1H5VA 5JBDA 4EF9A 1UR3M 5ABFA 3UT0A 3CB8A 3DFOA 3LMZA 1H1YA 3ZJ8A 1A3XA 5BZAA 1NDYA 3S5YA 4GLEA 3QZAA 4LT9A 3WX7A 1OGGA 1NM9A 3VIJA 4RNHA 3OBAA 1YTEA 1UZDA 2JEQA 2H90A 3V0UA 2DP3A 1ZBCA 5FJOA 2W5FA 5D9MA 1ZU8A 1H61A 4AFYA 1VFSA 1XICA 1YKWA 4HHPA 4NZFA 4FEZA 1PDYA 1PKMA 2DW7A 3UZZA 3VNZA 4EF8A 3Q65A 2YA0A 3W7IA 3WNKA 2QW5A 5LNRA 4AWSA 3W6MA 3BZGA 4CKQA 4GJIA 4GY0A 3MBDA 2HXUA 3GRIA 5LIUX 5K9DA 3WLPA 2A2IA 1PIIA 4PSPA 4M24A 3B06A 2GQ8A 3DN5A 5LSMA 1XG3A 5M2FX 1ZAJA 1XKYA 1VFTA 1DIDA 3EOUA 4FA3A 2Q6ZA 4DJFD 3SN4A 5E5CA 2QF7A 1JF6A 3VFCA 3W23A 1UH2A 2OWCA 1GG0A 3CV1A 3GKAA 1MUCA 2J77A 3BW3A 2E5BA 4Q32A 1QJWA 3W3OA 4MB3A 4LAOA 3P8JA 1Q6RA 4L9ZA 3CL8A 3UD6A 5K3VA 2O55A 5J04A 3EX3A 1LL7A 1MDRA 4NNAA 1JZ5A 4IL0A 4DWSD 2Y7EA 5G1YA 1V7AA 1GONA 2EEXA 2YCJA 1QATA 2PP3A 5F4WA 1B3XA 3OYXA 3CIWA 4E8CA 3EKLA 3GR4A 3PAJA 1P6CA 1Q6LA 3M46A 1JDCA 3KZPA 2C16A 1S3HA 4LUSB 4FF5A 5HNNA 1C8VA 2NWRA 2EKCA 3BICA 1G0CA 2VEPA 3WN6A 2E5CA 3IACA 1A80A 4YWIA 3SY1A 5LIKX 4HA1A 1P0EA 3NSMA 4O1FA 4UFMA 1GVQA 4REQA 1HKMA 2E9BA 3FYPA 4HZ8A 2ZX9A 1GKPA 2PAJA 4GACA 1JL8A 2PDMA 4HN4A 3AYTA 5KZDA 4WKAA 4JX4A 3CTTA 1R2RA 4RJEA 2ZTKA 4M51A 4NHVA 3NOYA 4OBSA 4B92A 3HPXA 5AFDA 4XAGA 4OVXA 5LIXX 1ZENA 3E2QA 2CNCA 1OC6A 4IP5A 3KEHA 4WXZA 4REQB 2R91A 4A3YA 3SN0A 3O6CA 5C9UA 4Z2HA 1MW2A 1J4EA 3A47A 5EMYA 5CC7A 5D33A 3UWYA 3VTRA 2Y0FA 1VYPX 3ZLFA 4GI4A 2KZHA 3UCCA 1JUKA 4GD0A 3SFKA 1JPIA 3BMWA 3EX2A 2OODA 1F74A 3M0XA 2J6VA 3WD1A 4GO9A 2VEFA 4D6EA 1K8XA 3WD3A 1B3VA 4IFRA 1V5XA 1J12A 1Q6GA 1P5BA 1V6WA 4PRWA 4YYFA 3M16A 2OGYA 3A5FA 4UTIA 4Z0SA 4GKTA 5CLWA 5BOEA 5J5DA 1FWBC 2AKZA 3DHPA 4CLMA 4V1XA 3EOSA 5JBEA 1H7XA 3BGAA 1U2YA 2WMGA 1JG9A 3MKCA 3MV01 1XGDA 1XHGA 1D7KA 1EOMA 3E2SA 3H2MA 4Z2LA 4WIWA 1S2CA 3GVGA 3OLIA 3PG8A 2OSWA 5A8GA 1EWDA 2GWGA 4A05A 3SCNA 5C55A 2NUXA 3GTFA 3E0WA 3DFNA 1EEXA 2GSHA 3UCQA 2PP0A 3IEBA 3TP4A 3BC9A 2OSYA 1Q6FA 4JNZA 4RR4A 4MDPA 2A21A 2BMBA 2GSEA 2NX9A 5CLTA 1K7FA 3PZQA 2F84A 1G4EA 3PBVA 3T55A 4FP1A 3ZQ9A 5CC6A 1TPC1 1GJWA 2J7EA 2ABAA 2Z7GA 3WK1A 4H83A 4X9SA 2QJHA 4BKNA 4DELA 3N15A 1XH2A 1W1PA 5G2WA 3S3GA 4EPEC 3U2ZA 3UWVA 3HG2A 4G9PA 3WLRA 5KITA 3G6MA 1SSGA 3WZ0E 5AOUA 3SCWA 3POHA 4XWUA 3VOFA 3NQBA 3CZLA 1A5OC 1SW0A 4RK8A 3GW3A 1Y5VA 5CJ5A 2Y62A 3ARUA 3RITA 4U4MA 3U2CA 2PTWA 2IS7A 5FA5A 4RKAA 5C2CA 4LVAA 4NZ4A 4GQRA 4R9OA 4NZ5A 4KGJA 1HIZA 4OHQA 1JNDA 4AVNA 2WPBA 4O8AA 3G0SA 1RZMA 1I2NA 5IBXA 4YXGA 3QYQA 2CLEA 4KCWA 4KF1A 3MDUA 7REQB 3GH4A 4YPJA 4B5WA 3ZLGA 4CNTA 5A6MA 1FWRA 1AMKA 2PEVA 4FS9A 2XZ9A 4RE0A 3LV6A 1ZFJA 3M0MA 3A3WA 3OZYA 2V3FA 4UFHA 1JNEA 1XYAA 2QJJA 3VGEA 3HURA 5BNKA 3QEZA 2YL8A 2CZFA 1UHVA 1TV7A 3AMKA 4GGBA 4XX6A 4ZVJA 3PUOA 3S2LA 3VOGA 1DQXA 3VFLA 3WEOA 4CNSA 4IIDA 4ZQPA 1MRAA 1J93A 4P8XA 3TV8A 1DJWA 1KXVA 3LQLA 4ZO6A 2BY2A 4MPQA 3CYVA 3ES7A 1VEPA 4NG3A 1VRDA 3FOKA 4FNQA 3T7VA 1PZ3A 3LHZA 4H3DA 4MOZA 3R2GA 5I06A 2HPIA 1KXTA 4AZIA 1ITUA 4CU8A 3QH2A 3DYOA 1TPFA 4MKSA 1KFEA 1KR0A 1LCOA 1KCLA 3IUHA 1W91A 1YBQA 4GH3A 5U4NA 4IXHA 4I6KA 1LRQA 3CZJA 1V3IA 3I65A 1L2UA 4DLFA 1SGJA 1A50A 2QDEA 2BODX 3CHFA 2FTYA 1FWWA 2EXOA 1XBVA 3BV7A 5BRPA 1EC7A 2CITA 3B40A 1QPRA 1ZAHA 3CGTA 2PDYA 3SM0A 1NOFA 1GOQA 1GTHA 2J62A 4L4MA 1JQVA 1QAPA 1XF0A 5M1TA 2PURA 5KETA 5J5RA 4PZVA 4RPQA 1XLEA 4K8HA 2AL2A 1RJPA 4WY0B 5CZSA 3UW6A 2XUCA 1X1OA 2I5QA 3M44A 1UBSA 1CXHA 2WKGA 3GC2A 5LNUA 5D9NA 4O16A 5A8QA 1UD6A 1HXJA 5A3HA 3USZA 3LTPA 2XHYA 4PEEA 5G4HC 4AVOA 1RA5A 2IW0A 1OINA 3ZJ6A 4BF5A 1TRIA 4FOKA 3CL7A 4GXPA 4C91A 1C7SA 4IX2A 3WCZA 2E8ZA 3L0KA 4MB1A 3VK5A 1UD3A 1J2BA 4LBRA 1GKQA 4EX4A 5DRCA 3T0CA 3HM7A 3OVGA 2ZVRA 2CEQA 1AZ2A 1V3JA 1X7IA 3VNJA 1XDMA 1AG1O 1EJ7L 4FLSA 1KW1A 1LTDA 3PZNA 4DAFA 2D69A 1ICSA 1ZBVA 3I3BA 1JDDA 2V3EA 4WR3A 4HU0A 4W5ZA 2O9PA 3MMUA 1XD1A 3FN9A 3B4UA 3OW1A 5BOOA 5XINA 4DWSB 3JVAA 3WBWA 1XISA 5G5IA 4D6JA 1K8YA 1C90A 5D2VA 2ZZ3A 2V2HA 4LJ3A 5D32A 3IRDA 3CASA 3E0FA 3IVSA 5CPOA 4Y9AA 3EEZA 3AIUA 4TR9A 1V79A 2VQUA 1R46A 2VR4A 1BXCA 2WM1A 4D6IA 4WDTA 5T9CE 3K13A 2DT1A 3CEUA 5F2IA 1L2QA 4AG0A 3QKEA 3LPPA 2GUBA 1SR0A 3KOXA 1WO2A 2POTA 5CPNA 3UG3A 1FWAC 1KFCA 1IWAA 2NSOA 3IUIA 4AHPA 2XZ7A 3T08A 3AYRA 4K1GA 4J7RA 2A0NA 1AD4A 4I7WA 1VFOA 3E5BA 1UROA 3IJ9A 5E0CA 3VD4A 4GRSA 1UYQA 2FGLA 5LXEA 1T0OA 5MKGB 5HAOA 3RJYA 2Y6ZA 3BGJA 4HMCA 4ML9A 2QCFA 4MVAA 1YYAA 2G41A 4KEZA 4AQLA 5JIWA 2BSLA 4PH6A 3WLOA 2I7GA 1R3VA 4AUBA 5KMYA 4AYSA 4H9UA 3OGVA 2DQWA 3NQEA 3UJFA 2VNCA 1KBBA 1ONWA 3GW0A 1NDZA 1MQRA 1GW9A 3GNXA 5FSDC 3SUSA 2Y70A 4J3WA 4A8LA 2X1RA 3AU6A 3LSBA 3GZ3A 4ZSUA 2WMIB 1RP9A 2WMIA 4XUGA 1GORA 3QC3A 3UJSA 1GVFA 2XINA 2IPWA 2V2CA 3CV7A 3U7VA 1UR0A 4WKHA 1LF1A 1DWGM 4HMEA 1NIUA 1XRTA 3T8QA 1RY0A 5A6SA 1TSIA 3B8DA 4UR9A 1SFLA 4YVXA 2JGYA 4F40A 1LRTA 3E02A 3MWAA 1M68A 3TYAA 3HTWA 4DZAA 1CBGA 3R4IA 2RDXA 2Y8KA 4FLRA 2G3MA 3RN6A 4MYAA 1R7OA 3H4GA 4M7SA 4ZOBA 3P80A 4FHAA 3WH9A 1YDYA 2EPMX 2FTPA 1IR1A 2JKPA 2WHJA 5BWFA 3URNA 4AZ7A 1KGUA 4Q3MA 4GUIA 2C79A 1SVDA 1BG4A 2P0OA 2WBKA 4KWVA 1R47A 3S46A 3D6NA 2PPGA 4ZE5A 4X61A 3NQ6A 2P88A 3N17A 2ZRVA 1H50A 2ZCGA 3EOOA 3PHAA 1H0IA 2VM8A 1EZ2A 3UZXA 5GJMA 3F7JA 4PE8A 1BD0A 8XIMA 3M41A 2ZDRA 3ITVA 1H7OA 1QW7A 3EWWA 3H7RA 1FHDA 2PF0A 2PCEA 1P7TA 4H9YA 4POCA 4C6BA 1SW7A 2PLJA 3W9ZA 4JTJA 3EWUA 3TFCA 2MANA 5FIPA 3ITCA 3WELA 4UMAA 1BYDA 4JTLA 2CW6A 2QJIA 4V33A 4CGTA 1FRBA 2HMCA 3W22A 1HKJA 2XN0A 3SCUA 3GXIA 2FFIA 3LV5A 3APGA 1CLVA 1A5AA 1JPKA 3CHEA 2BGSA 4UNKA 1P6WA 3IJLA 6REQA 3DEQA 5CZ0A 1VD6A 3V35A 3SRHA 3S8HA 4L64A 1L6WA 3NGFA 4X63A 3GTHA 1EC9A 3I7SA 3FCPA 3URAA 2FJUB 1LDCA 1DWAM 2L5HA 1OGBA 3NYZA 3AIQA 3N9KA 1UCWA 1K4HA 4FXSA 4TMCA 3PZTA 3DI0A 1WCGA 2JKAA 3TAKA 4GIRA 2VD8A 1HX0A 5REQA 1JZ4A 4DBDA 1C7TA 3VIHA 2YCKX 3C0LA 4DO6A 5ABTA 2CLIA 1RVKA 1GJUA 1JFHA 3NG3A 1IEIA 3B0VC 3B9NA 2V5BA 2EPNA 1DPMA 1KV5A 3GXTA 3BG5A 4PUKA 3CUHA 4LC6A 4DJEC 2C1IA 3W7QA 3N73A 4I8DA 4QFUA 3FJ4A 3TW9A 4U2ZA 4M1RA 2XH7A 3I6EA 2QV4A 3C52A 2QCNA 3C0QA 3S6OA 4XKYB 6TIMA 3UPWA 5KEZA 1EIXA 2VX6A 4FNUA 3QVQA 1PX4A 2QPUA 5MHBA 1L0PA 2G3NA 5CZJA 4NZ1A 3MKVA 2GGIA 1ZCCA 1GQJA 3SGUA 3K8MA 5FF0A 1SJAA 3PZGA 5A6BD 2Y5SA 2QCDA 4HSOA 4NNBA 1EF3A 4H7ZA 2QPSA 4PB5A 2ZA2A 3BZJA 4ATLA 3CQJA 3GIPA 3LB0A 4CN4A 1MFVA 1QK0A 4KH2A 4NYYA 4TUFA 1NARA 4M6QA 1E4LA 2Y8VA 4YTQA 4O19A 4F0KA 3KZSA 4WJEA 2P0IA 2J75A 3TJ4A 1NWTA 3LI0A 1XIEA 5I3GA 1EKOA 2OQHA 3UERA 3CMGA 1WKEA 2QIWA 5D2XA 3Q2DA 3WFZA 1F76A 2XH2A 4L4LA 5A2BA 2ZWZA 4HU4A 1IZKA 2GVJA 1VIWA 3FHAA 4H9MA 3V5OA 2DT0A 4WUIA 5C70A 1XLJA 2B7NA 5CH9A 4XTDA 3DHFA 4ML4A 4PODA 3TR9A 4C5ZA 1Y0EA 4JIEA 3OZOA 1XQKA 2WVVB 1DJQA 4B90A 1AL8A 3S83A 3ZT5A 4Q8OA 2G37A 2HPMA 1VZWA 4XVDA 5D02A 4O0QA 4MNMA 3L21A 2XIOA 4BZYA 3ONCA 4AXKA 4P7OA 1TTPA 2E6FA 1Y8BA 3FDKA 4QSFA 1JJKA 3GY1A 2ZOXA 1NWRA 3UY7A 1NELA 2G3IA 3JR2A 5A6AA 2O9TA 3DC0A 1MSSA 3KE0A 5MKGA 1ALDA 2OO6A 2PTYA 3KVJA 2F6UA 1TUXA 2BBFA 1JEZA 3B03A 5D9OA 1R30A 1DHPA 5E1QA 1Q7MA 2OYMA 1EJSC 4HK5A 5AHFA 1Z89A 4UCGA 1NWUA 4ACYA 2E68A 4PUMA 3T07A 5LKYA 3WNNA 1DXIA 3ZO9A 4IMFA 3TTSA 3LGEA 3ABQA 1M5WA 4RDWA 4JS3A 1A0CA 4JIRA 1WKDA 1KWKA 5AB3A 1KQYA 3JRKA 3N2BA 4Y7EA 1UB3A 4ZEPA 3P7YA 4GUGA 1UZ4A 4J2MA 1XJBA 2DU2A 3B8IA 3T1GA 1J8VA 4EP8C 1X8FA 4UZUA 4LF1A 4GYPA 1RCQA 4DUOA 1KGXA 5HNTA 1W37A 3WF4A 4I7VA 3KDOA 1TR9A 2TMDA 4UZSA 4CN1A 5EFDA 3ARSA 2CZVA 1GOIA 2UWFA 2JEPA 1NFPA 4JEQA 4LAKA 4DBSA 2F61A 3SCRA 3TWBA 3WQOA 4GKLA 4CVWA 1KWGA 3O7UA 3U6WA 3PB2A 1Z44A 4GG9A 1FCBA 2Z6JA 2NQLA 1NDWA 1DKWA 3HA1A 5HPCA 2ZXBA 4DO4A 3HMJG 5G2IA 4WK9A 3A21A 1OFAA 3TLQA 2CFFA 1VC4A 3FS2A 5HQLA 3N4EA 3S2CA 1PL9A 1E4NA 2AAAA 3IIOA 3BAIA 4C1KA 2YLLA 5HULA 4EXBA 2PS2A 2ZWYA 4RDZA 4O8RA 4PMVA 1TFVA 1H49A 1IXPA 1UKTA 2W61A 3MUY1 1TRDA 3G5EA 1PCWA 2WK2A 2XIBA 1VAHA 4I5UA 1EEPA 2WM0A 2YB4A 1NF0A 1B4KA 1JXJA 2O9RA 3CPRA 3WJSA 2GQ9A 3LHTA 1QPNA 1E3XA 3NZQA 1YNQA 4LS2A 3HV9A 2D24A 3RYSA 5E0FA 1P0DA 2OOFA 5HINA 4XQ6A 2PGEA 4DZHA 1R3QA 1XS2A 3PWIA 1EUAA 5SWUA 1WXZA 2C71A 3KDNA 3PZMA 2WKLA 3AZSA 1SZGA 3CEPA 1Z9AA 4QR6A 4G5DA 3U4AA 1ITCA 2J7GA 4RE3A 3EDDA 1XSKA 2NZLA 1DJHA 4B91A 1O4UA 3VZYA 1WAWA 3KP0A 1K6WA 4FALA 4JTSA 4F4RA 1JDAA 2ODOA 3SRFA 3UP8A 3W84A 3EXSA 1IEXA 2JK2A 1NF7A 3KBSA 1XYCA 3D0CA 3B8SA 3GVWA 4FI4A 3O0KA 3W0KA 4UXDA 1N8IA 4QE1A 1QW8A 5G1MA 3SCQA 4WSKA 1XQLA 4C6OA 3QTGA 1A0EA 4QIUA 3S1XA 1M9HA 2PWHA 1T96A 2PCQA 3GXNA 2VR5A 5D9PA 3URBA 5AZ1A 3BLOA 2OFJA 1AUSL 4I90A 1C8XA 4O52A 2DUXA 5HMFA 4KIRA 4D6DA 1OCQA 1S2UA 5CSSA 3LDVA 3TXZA 3ITLA 4NVTA 4PMUA 3TTQA 4L65A 1HFBA 4O1CA 3GBDA 2WV8A 5FJJA 1X6LA 4NAFB 1KGWA 3NOEA 4XAFA 4GQBA 1EIBA 4NZ3A 2A3CA 3VDHA 2B4GA 4GE8A 3WNOA 1J10A 2WWDA 1TMQA 4GFSA 3GG7A 3A4JA 2O4MA 7A3HA 4URIA 1UR4A 3AHYA 4GYPC 4Z1DA 3BLLA 4PUEA 3AMLA 3F4WA 4KEVA 4L4PA 4GIAA 3CUIA 3CUFA 3GE7A 3W85A 3W1AA 1OFDA 1E56A 1TTIA 1SMDA 4JX6A 3GO2A 4IPJA 3GH7A 1F7BA 1Q7ZA 2OYKA 4NUWA 3UQNA 1H7NA 4XO6A 2Z1KA 2VR2A 3FX4A 4PRRA 3UYIA 3W7KA 3EWXA 4PGLA 4AMCA 3EGJA 1KM4A 2HRWA 2ZZ6A 3DBNA 1PS9A 1PKLA 2ZA3A 1W3KA 5AHLA 3L0NA 3W4RA 5BXRA 1LT8A 4JQ1A 4RL3A 2R1MA 3W53A 3PUDA 1NTHA 2CLMA 3N3TA 3W26A 3LCLA 3IPWA 3ARWA 2G95A 3N4AA 4XD6A 3GNNA 3ERPA 2A79A 2FH6A 2CKSA 3AS1A 1OG6A 3O15A 1VFHA 4HOXA 4GJJA 1T99A 1M04A 1CPUA 4QTGA 2ZZ4A 2ZTJA 3W75A 4G7FA 1P1XA 1N7KA 2RHGA 2E8YA 5CSYA 2R1PA 3O2LA 2EAWA 3WBEA 2PBOA 2PTXA 5T8GA 1GWJA 3THDA 4EANA 1TJRA 2IKIA 4BI7A 1UOKA 1X97A 2I5GA 4DJDD 3E6EA 4ADUA 1AJ2A 1EJTC 4ERAA 1IGWA 5ABGA 1AQHA 1IGSA 1OABA 3GLCA 2VZOA 3W83A 2D3NA 3DFPA 1Q45A 1QNSA 2JFEX 4HD5A 5I07A 3ZJ7A 1W3IA 5IBXC 4GY7A 3TX9A 5JH1A 4ICMA 3NVTA 3TQVA 1US3A 1ZJIA 2Z7KA 1PUDA 5JQ9A 2NWSA 2J88A 3ZMRA 1C93A 4GBDA 2PRHA 3UPBA 4W87A 3MANA 2CZEA 4KT2A 2QQ6A 5KZMA 3W2NA 1J0KA 4BQ3A 2I56A 1FDJA 4LAZA 4HKPA 4XIMA 3K1GA 2YCEA 3A13A 3ITTA 1DIOA 4F0RA 5HK4A 2JGQA 3VNMA 4J5NA 1V02E 3NVDA 5HDRA 4WX2A 1H7PA 1UBPC 3PBUA 2Y89A 2OPJA 3TZNA 4B5NA 4BS0A 3IIXA 1G7UA 5LNWA 4MNKA 2CBVA 3GVRA 3S9ZA 1WB0A 3RR1A 1SW3A 4R27A 1EF2A 1Q65A 3OP2A 3NQ8A 3NJ3A 4EVZA 3H24A 4B3LA 1PYFA 4JOMA 3IJQA 3G6LA 3SY5A 3DGRA 2UZ9A 1XIHA 2AAMA 1W9DM 4HPHA 4ILSA 4UMCA 1XLHA 2TPSA 2ZZ5A 1AH0A 1Q7QA 3AXMA 3DFYA 3G1HA 2E4TA 3G1VA 1DJIA 2QHAA 3G1DA 2BXYA 2W3ZA 4XBKA 4LEFA 5CCZA 2C19A 4OU1A 1J0IA 2QXWA 3S9YA 3C0JA 5CG7A 1GK8A 4AIBA 1I0BA 4P61A 1I75A 4I9MA 4C1NA 3W1NA 1SUXA 2DIJA 5AY7A 1RSCA 2GGGA 4Z1AA 4AWTA 3CUGA 3SO7A 4W8BA 4Y9NA 1Z48A 5DF0A 1R9YA 4Y8EA 1CDGA 1C8YA 3AXKA 3EMCA 1OWQA 2OTDA 4KCUA 3YPIA 1OCBA 2D2HA 2VGIA 5CBIA 3QC0A 4OGZA 3K4DA 1LLZA 3D5HA 3OPSA 4JIPA 3ES8A 1W2VA 4HZMA 1UR8A 1QNRA 2E3ZA 1X96A 3EOLA 1NY1A 3O0FA 2OZ8A 3WK0A 4Y96A 1GT8A 2BOGX 2PWFA 4GXMA 4LY4A 5E0KA 3VDGA 3RILA 3T0AA 3LZ3A 2PDQA 3OQEA 3VXGA 1XLLA 3TYCA 4DJFC 4K37A 3WNPA 5BRQA 3TN3A 3UY8A 5C7VA 3QSTA 2A5HA 1TVNA 3B3DA 1CLXA 2DZAA 3NQ2A 4LUYA 5J8LA 4IPLA 5FJUA 2QT3A 3ZJKA 3SQSA 1UA3A 4RW5A 1DWHM 4JIHA 2VENA 3FA4A 2OG9A 4O14A 4EXAA 1VHNA 3K30A 5DMLA 1FBAA 3AZTA 2FZ9A 2XGIA 4JQ3A 3SR7A 1GVRA 1XWYA 1V6XA 2WJFA 1OHLA 4TVCA 4LB3A 4BWLC 1V3LA 3C2YA 3KCOA 2UY4A 3BL3A 1J01A 1HVQA 3NPXA 2C13A 4MG4A 2ZRWA 2ZBTA 4ATWA 5CC3A 2BVYA 4US5A 4HCHA 4XAZA 1B57A 4E5TA 3M0VA 4HYWA 2Z4GA 4Q4MA 5F1UA 4LF2A 1SJBA 4CCCA 4UIOA 2FPVA 1BTCA 1D3HA 4OOUA 2ALRA 5CPMA 4ROQA 4D6CA 4O1AA 2R8WA 3QZ6A 3P5YA 1E6RA 2UBPC 4MIMA 3PBMA 1RV8A 3N6HA 3G8EA 3NO3A 5H1WA 3VIOA 1C91A 2JIWA 4CQDA 1QW9A 4XTIA 3G1RA 4RDYA 1KM5A 3TTYA 3QQWA 1VFMA 1WA3A 3GDTA 4V28A 4TX8A 3VA8A 2IKGA 3OG3A 3I6RA 4RW3A 3ATZA 3STGA 5EFFA 4ZMGA 4GQQA 3GUGA 1F05A 2VRJA 4I9TA 4LS1A 4WGHA 4ADSA 3WQ6A 1OCNA 4ZTYA 1YNPA 9XIAA 1BF6A 3QR1A 1TV8A 1PX8A 4D8ZA 2UY2A 1DJGA 2G96A 1YIXA 4HJFA 2WNWA 3UFYA 1EGZA 4AISA 1W1A1 3AXIA 1M7PA 3JW7A 2YW4A 2DZXA 3L66A 4Y9MA 2ISWA 4US5D 4UFIA 4LBUA 4TX9A 1MWOA 3EX1A 3VOIA 2NUWA 1JPMA 2F9RA 1CGTA 3QQ1A 1HO4A 1T40A 4OUIA 1MQPA 4DO7A 2PDJA 5HMSA 2WJDA 3A4XA 3HGRA 3MDWA 5F2GA 3KL0A 2WVSA 4G1KA 1QNOA 5CGMA 3KS6A 3GIYA 4FNPA 1W3TA 1SYTA 3LNPA 5BROA 2FZNA 5EGRA 2CHNA 3S6TA 4R7WA 2F6KA 4DX3A 3U2EA 4PCFA 4NU7A 2XGZA 4PBGA 3TE9A 4AVFA 1XFCA 1HF6A 4AD2A 1JIBA 4CD5A 2WNZA 3KBWA 2QDHA 4HTBA 4B4HA 4DYEA 3QGAC 4ZA0A 2V8ZA 3PANA 2V9DA 2O7QA 3QHOA 2X0YA 1CENA 3A3XA 4J3UA 2ZA1A 4B3ZA 3OGRA 2OQYA 4JY9A 3UA3A 1DQUA 1ZJAA 3H6OA 5FSEC 2E7FA 1JCLA 5CQ1A 3R25A 2XVLA 5H8UA 4QROA 2A7RA 4AX6A 1YEYA 3TCEA 2BHUA 1PIFA 4MJMA 1XIMA 3JUGA 4OBRA 2YL9A 1E1CB 3KL3A 3W1XA 1LBFA 3MHUA 4WHBA 4PMQA 3BMVA 3CYJA 2ZDSA 3L4VA 3O6DA 1K9TA 1RPKA 3QYSA 4JTTA 2OX4A 2VJXA 3MZNA 4YHGA 1PSCA 1BLIA 4H2HA 4NF7A 3R43A 1C9DA 1PB0A 1EA9C 2FTWA 3QFEA 1AZ1A 1M7OA 3T4CA 1L6FA 3UPMA 1RK5A 1SO3A 3VX0A 1FWEC 1Q6DA 4Q4KA 2RDUA 3HPAA 3KXQA 2NX3A 4I9JA 4JYFA 3UR8A 3HG4A 1SZNA 3LM7A 3TKFA 1HG3A 2YBUA 4Z1BA 3GNOA 3WDIA 4UTWC 2WQDA 4ZQOA 1TA3A 4UFJA 2NSXA 1EJVC 2E6YA 3LBOA 3SW6A 4WXYA 3BJTA 3W6LA 1QI4A 4K38A 4JQ4A 3QV6A 4I8YA 1E71M 3I68A 3MVIA 2W91A 4L61A 4HGXA 1LQAA 1MXDA 5CJNA 5H6HA 1IR2A 2O9OA 1X6NA 2GDUA 3GR8A 1X7FA 1XGZA 2HE5A 1XLAA 1TE6A 2DV0A 1KV8A 4M0XA 1WV2A 3VUSA 4DJFA 1VIZA 1PZ2A 4LU0A 1XV8A 3ALGA 5E9AA 3MYOA 4AB4A 1U33A 3SCPA 2YL5A 3PZVA 1OADA 5C8BB 1SZRA 2DT3A 4P8UA 1Z69A 4EWND 4I7UA 1WBHA 3GWQA 3EZ4A 3TW6A 4Z17A 4EOUA 5IHRA 4NQ1A 4PN2A 5CJMA 1OIFA 2B81A 4IGHA 3ARZA 2P50A 1X38A 3H2FA 3W7GA 3L2MA 5JUVA 1PAMA 3CXOA 4QITA 2J7CA 3VD9A 4A21A 1OGSA 5FF4A 2OKOA 1ZJHA 7ENLA 1R3RA 3QW4B 3L23A 3UWUA 3U2OA 1GOOA 3N2MA 1LWIA 1IQ8A 5BU6A 1WDRA 2Y4SA 4M6UA 3FGCA 4ZR8A 4A3QA 3MTWA 2WZMA 2Y5JA 4H6RA 3SEPA 3Q67A 1OFOA 1ADOA 1PVNA 3M1ZA 4GX9A 4GJ1A 2V3GA 3KVKA 4GZIA 4CCDA 3P6LA 4ZO9A 4R5EA 1TUFA 3NL5A 1UD2A 1YW1A 1DOSA 4JN8A 2ZFAA 5JIPA 5ECUA 4PTNA 1IXOA 1E4MM 1J0ZA 3N1AA 4M19A 4IIHA 1P0BA 2Q8XA 1R9XA 1J6PA 1XCWA 1OFRA 1POJA 1UWQA 3ZR5A 3EDKA 4FZIA 1CWYA 5DBTA 2FB2A 4LYQA 2V0TA 4D6FA 2OX1A 4FSAA 1GQNA 5L6UA 3VD7A 3UWQA 2YOCA 4GI9A 1LM1A 4MTVA 1PTGA 7CGTA 2YR1A 1XI3A 4GI6A 3RPDA 3AI0A 3VKAA 3G1SA 4NZJA 4DF2A 3WFAA 1HKVA 3SZ8A 2QLYA 3ZS4A 3RIKA 4QP0A 1L9WA 2BLEA 4DRSA 2ZIDA 4GWEA 4MY1A 1A5UA 2D2OA 1QWKA 2X1SA 4DO5A 1TWWA 3MS8A 1OFBA 4K1WA 1JCJA 3A9IA 4UTJA 4L9YA 4LXFA 4AY8A 4E4PA 1KR1A 3M5VA 1XYZA 3IWPA 5A6LA 4P8WA 1CLKA 4X2PA 1BYBA 3HGJA 1TPH1 3EMQA 4W8LA 3VCRA 4ZBCA 4QEHA 1DV7A 4OWGA 1QXLA 4S3AA 2IPFA 2WSPA 1TTJA 3FYOA 2Y88A 4I6VA 4TXEA 3LBCA 4ZCWA 1TA3B 3PPFA 4LGXA 2PWDA 1E0VA 2PP1A 4JCMA 2WVUA 4AIUA 5GJPA 2V5CA 5FCZA 3VU2A 2PDHA 1D3CA 2VC5A 1YDVA 5LNSA 3A9BA 2WMFA 1G01A 2XIIA 2IMRA 4Q8VA 2BDQA 1U5HA 4PL1A 4C6FA 2PE4A 3EWBX 4IIGA 3THUA 3T81A 4FF7A 3TONA 4HCDA 1S1RA 9XIMA 2EJ1A 3RCNA 5H2ZA 3V0SA 5T9BG 1G5AA 3VIKA 3RFAA 3G24A 3KAOA 1UQZA 3WQCA 4EE9A 3G1YA 3VGBA 3GU9A 3DYMA 4FIQA 4B5VA 5D09A 4GNVA 5HATA 4S1FA 4IZGA 1JDFA 2RAGA 1Q6QA 4N4PA 4GC4A 2AKMA 3LU2A 2VCBA 1Q66A 4RZ5A 4DN1A 3RU8X 1F8IA 4LH8A 3BW4A 4GI8A 3EYPA 4HN8A 4MJZA 4E2DA 1Q6OA 1RXOB 4ZTXA 3PS7A 2QAFA 4H9XA 1G69A 1XYBA 5LIWX 4S2BA 4Z2JA 3ITXA 4UNLA 4PTXA 3LPFA 3B04A 3P8IA 1CXLA 3FV9A 2WMHA 3L9CA 1ME8A 4HHHA 4AD4A 4X22A 3W73A 4C1LA 5EL1A 3BURA 2A3BA 1LL4A 2DSVA 3LM3A 1TQJA 2PRLA 4KFPA 3Q45A 2DVXA 5AHIA 4RE4A 4YYCA 2R9RA 3WDQA 2VFHA 2WQPA 3STEA 1EBGA 4H04A 5HNRA 1KRBC 1XRFA 3TC7A 1R6WA 5AZ0A 3WLKX 2A3LA 4IX0A 1UD8A 4MYXA 3TDFA 1CNVA 1RHCA 4Z2GA 4C65A 4LB4A 1E6PA 4D71A 2WHMA 4N42A 3W1RA 4MMWA 2ZC8A 5DQPA 1T41A 4RZ6A 2Y85A 2GK1A 1HT6A 2F2HA 4AYGA 4GIYA 1QNPA 2CPUA 1IT0A 1UR9A 4GPNA 3KM8A 3NL6A 1PHQA 3MMDA 3H4WA 4K6AA 2XYLA 3DBPA 3RXZA 2A85A 2D73A 3NQAA 3AAMA 1R87A 1XDLA 4U5IA 3VKBA 3GHRA 5I23A 5D2WA 1XLMA 1WZMA 3SADA 3W7CA 2GWNA 4M6PA 3N2CA 2ZUTA 1UR2A 1Y65A 4L1WA 2YCIX 2W6RA 4C7DA 5A1AA 2JBMA 3AICA 3HF3A 2AQOA 4XKYA 1KTNA 4YNGA 2ZX8A 3P74A 4D6HA 1DYSA 2WJEA 1ISXA 1BXBA 3BXWA 3W81A 4E6MA 3F1QA 3I10A 2O0TA 1ML1A 2QJMA 1XUUA 1BRLA 2CLPA 2DH3A 3TYUA 3WLHA 4JZ5A 4LNCA 1BAGA 2QMJA 1UIPA 3VGFA 2HVOA 1VGAA 1Z42A 1VLWA 3HQ1A 4A3HA 4BFAA 1ISVA 4JEJA 2WC4A 5I3IA 5D37A 2QDDA 3VX1A 1A4LA 2DZUA 4BK9A 3DX5A 1TKKA 1EDGA 3GAYA 1MZHA 1C8QA 2VYOA 3KVLA 4RLIA 3M0KA 5KSWA 4JNMA 3QLLA 3T8LA 3RX4A 3PTKA 3PR2A 4H9ZA 4NI3A 4XO7A 2G97A 3VZZA 1W5PA 1DTUA 1E43A 1JD9A 2PLMA 4CU7A 4AX7A 3WKZA 3OZPA 4L1XA 4JPGA 5HOSA 4XAPA 6A3HA 2Z1XA 2ACQA 4F3HA 1NAL1 3L12A 2ACUA 1YMYA 4J40A 1V02A 1FFRA 4NIRA 3LQGA 2YDSA 2YLAA 2OVLA 4Q7BA 3PFRA 3OODA 1ISZA 3GDBA 4ICNA 1Q2SA 4NASA 2V68A 1UWIA 2YDQA 3FJNA 3BOLA 2CBIA 3CWNA 1ISYA 1RVGA 1LT7A 2QVHA 2BY0A 2DDXA 3H70A 4QM1A 3W1MA 3S0CA 3P62A 2XSBA 1VCVA 1HJWA 4WKFA 2OT0A 1SZFA 2HBVA 1NVMA 2WC7A 3AYSA 3DI1A 4MPKA 5I03A 3P5ZA 3IIZA 1RBOB 5D8WA 1V51A 2XGBA 4Z08A 1TJ0A 2VZVA 2PF8A 5A6KA 2EO7A 1E6ZA 2C0HA 3EOEA 1W32A 1EGMA 3M0ZA 3ZZ1A 3WD2A 4DWDA 2PUZA 3O1NA 4HOZA 3SSJA 3WL1A 4KMQA 2Z1BA 3NXFA 1GZGA 5LNVA 1EGVA 3PBGA 2HV5A 1UH3A 3FSUA 2KX9A 3B0XA 3R89A 3LGDA 4O57A 3UZYA 1GYNA 4U2YA 3W2LA 1KTCA 2HISA 3KRBA 1P0KA 5KZ6A 5EA9A 2RJHA 1XIBA 4GZEA 1VFLA 1PTDA 2CERA 4EK7A 3VGHA 8RUCA 4LRTA 4JTRA 3UJRA 4HU8A 4AXNA 1P43A 4BY3A 5A2CA 4YVVA 2RDWA 3BH4A 3VO0A 1E0XA 2DUAA 4N9BA 3M5ZA 2VFIA 1M53A 1WE5A 4W4QA 1YADA 3P0WA 2J25A 2Y63A 3IV8A 3OYZA 3SGZA 4AW7A 3GHTA 3BAKA 5EMLA 4JFTA 3MJMA 4PTDA 2X1TA 1GPFA 4YU1A 4R7JA 4WDWA 5HUPA 3V18A 4EWJA 3RUBL 1LG1A 4C6IA 1TVLA 2WYSA 1V6VA 2QZRA 2QYGA 1RLCL 5EBUA 5F2LA 1HNYA 3H12A 1KXHA 4JN6A 1TX0A 4XIAA 3AYVA 3U0HA 3MSRA 1EH9A 4FX7A 3IAPA 4Q33A 1J6OA 3SJNA 5D2YA 1JZ2A 5CSUA 2G5WA 5I79A 4Z1YA 3PWAA 2GJPA 2WNQA 1KFLA 2Z28A 4GVGA 1HN1A 3EX6A 3CNYA 1B54A 3CAVA 5AC5A 3L0GA 3MHGA 5C0QA 4IPPA 2ABBA 4LS0A 1W1IE 3BV4A 3SUVA 5C9XA 1OYBA 4H2CA 1E9IA 4IXXA 2PMQA 5IHSA 3S1UA 3NQFA 3L2IA 3BTNA 2P1FA 1BTMA 2FHFA 4FO4A 4D72A 3FGCB 3WFLA 1C3FA 4NXSA 3PZ9A 4XG1A 4AHQA 1JGIA 1V8EA 1FKWA 3WBXA 3EDEA 3T40A 3GFZA 2NVAA 2Y61A 4GNKB 2VDIA 1LUCB 1RPXA 4QEEA 4ONVA 3H7UA 1A5CA 2WMJA 1LBMA 3VPLA 1QBAA 2VL4A 3HQPA 1ZUAX 2GLKA 3PPCA 4N9CA 5I2UA 3WQVA 1K1DA 1QFEA 3W7EA 2YXGA 3VC6A 1ECEA 2EPOA 5ABEA 2QJGA 4QE4A 5DT7A 1TCMA 3NM1A 1TVPA 4P7NA 2XIJA 3DOPA 1ADSA 3C56A 4XBJA 1U5JA 4Q6XA 2ZRXA 4NJIA 2F2KA 2PBGA 4F2BA 1F3EA 3RX2A 3SURA 2I5IA 3UGRA 3G3DA 2Z29A 4PMZA 3RJXA 2H3DA 2OWXA 2X0HA 3APYA 3I6TA 4B9YA 3C3UA 3V5FA 2E1WA 4M56A 4QDWA 3MCMA 4PSRA 1BXNA 2FYMA 1PYMA 3V1HA 1R3SA 3ZT7A 4OQVA 4WEVX 5G4EA 3W7JA 3ITYA 3TEVA 5GNXA 3VKJA 1YTDA 3W37A 4C6LA 3OHIA 2WCGA 2QCHA 3NM3A 4XISA 3RM4A 1O95A 4AZGA 1FWGC 2ZUSA 4L6DA 5CPSA 4W8AA 5FF2A 2V30A 4A8IA 3AXHA 3P81A 1Y7VA 3C61A 3WO8A 1UUOA 4ADTA 1N8FA 2D2JA 3N11A 3K8LA 3T0DA 4ALDA 2OB3A 4HNOA 4UMBA 3NURA 1VHCA 2HZGA 2FVMA 4A35A 3O63A 1S5WA 3JZUA 1WZAA 5C2XA 1EDQA 3TQ0A 2GGEA 4YCOA 4OKDA 2WHKA 1WZLA 5A8MA 5A6BA 2ISFA 3LCGA 3LXCA 3GXDA 5TNVA 3LN3A 1GVOA 4XZWA 5ABFB 4GYFA 3I7RA 2XWEA 1YPIA 2C14A 1ZHAA 3VI2A 4HNUA 2OWWA 3QPEA 5DY2A 3B8WA 3TXVA 1UP2A 3WMLA 4PBFA 2GQ3A 1GEHA 2OJPA 1LWJA 3RLUA 1PJ9A 4DQWA 3SCTA 3S5ZA 3M4HA 3S47A 3UWWA 2OGJA 1EHNA 4JDBA 1HO1A 3BOFA 2XN2A 3ANUA 1SO4A 3CC1A 3DAQA 3N9SA 3CTLA 3G22A 3B8UA 3QV9A 4H41A 1EO5A 1TELA 4JR5A 3K8KA 1OF8A 4LVGA 3IANA 2E6AA 1YBQB 4NAEB 2Z2BA 4JD4A 4FOUA 3WIJA 1A5BA 1LOQA 3TN5A 2EBNA 1J0JA 4F79A 1DTNA 4HMNA 1K03A 5AC8A 3VCNA 1WP6A 4GABA 2FDSA 3S5NA 5JH2A 2E0PA 1FFQA 3EWCA 1RY8A 5AC4A 1KC7A 5BXPA 4HSNA 2JALA 2CIPA 3WQFA 2VT0A 3TCSA 1OYAA 2G4JA 1WOAA 4PTVA 1GGOA 3NO5A 3P82A 5EPDA