3W7OA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with tt2-3-165
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with TT2-3-165
rcsb
source organism Trypanosoma cruzi
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7oA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7oA01
2CLFA 2PURA 4OGZA 3W2KA 1DQWA 2YXGA 1VCFA 1TPVA 3CLMA 2FLIA 1KM0A 4O1DA 4R7JA 2J27A 5AHMA 3DU0A 3EWWA 1FCQA 3W1RA 2ZZ7A 5F1VA 2EPHA 4U28A 4K8HA 4M7SA 1HUVA 1KM2A 3LHUA 1H63A 1GTHA 4X22A 3EX4A 4AWSA 1N7KA 1RQEA 1YPIA 2E1DA 3G1AA 4EVZA 5H2ZA 1KBIA 1ICSA 1ZHAA 3KOFA 3GX9A 2CLIA 4NXKA 4UMAA 4BWLA 2X30A 3O16A 3CEUA 1WBHA 3P84A 6TIMA 4O54A 3YPIA 4ADSA 1Z41A 3L67A 1KV5A 1A5AA 2NXHA 3G0XA 4EF9A 4OV4A 2V2HA 1RZMA 4K6AA 3ZS4A 3L68A 4UNLA 3S8HA 1AK5A 4XBSA 5D2XA 1DHPA 3GAYA 4AWUA 3TA6A 3THQA 1L9WA 2FPTA 5TBOA 3HG3A 3W7CA 3LERA 3E96A 3NXFA 1A53A 5G4EA 4IUOA 5AYYA 4MUZA 3Q58A 3FKRA 3WJZA 3PY2A 3UY8A 4E0CA 4MZYA 1GJPA 4FX6M 2I1OA 5KINA 1VRDA 3W1PA 5HQEA 2WQPA 2FIQA 1BKSA 1S5VA 3G8RA 3TROA 2NWSA 1OF6A 4HNTA 3CWNA 4GFSA 3NZRA 2BWGA 1TJRA 3OBKA 4MY1A 3AO0A 2B7QA 2TRSA 3GKAA 3BW2A 3LI1A 1SZGA 2YCEA 4WUIA 3UZ5A 4N4PA 3W7QA 2ZRUA 5F4WA 5AB3A 2C3ZA 2A21A 1OJXA 3UQNA 2WNZA 4QNWA 4OE7A 3O6YX 1W3TA 3R13A 1Q6OA 4DELA 5DXXA 2YGYA 2NX1A 5AHFA 4BFAA 4QIUA 3GB6A 4ONVA 1B4EA 4QNEA 3CPRA 2KZHA 2A7NA 4JX5A 4GUFA 3W1NA 3DAQA 2A1YA 4M7TA 1H1YA 4FIQA 3SI9A 3DFNA 3DFOA 4ZL1A 3WK1A 3DGRA 2I14A 5K4XA 4OV9A 4O57A 2CZDA 3TNOA 2A2IA 3JS3A 1BTMA 4AHQA 1SW7A 2OMAA 3PBWA 3M5XA 3UWYA 1H7XA 3RF9A 1QPOA 4N9CA 1M5WA 3FOKA 3N2XA 4UTJA 3TC7A 5CPMA 1S5TA 1EUAA 3BK0A 2OZ0A 3QH2A 3R8RA 2YZRA 3C6CA 3MBDA 4JEQA 1LOSA 4AF0B 1UCWA 3EWXA 1P0KA 4Q4KA 5I3GA 3NVTA 3IIVA 4LS1A 3C4UA 5CGQA 2ISVA 1AG1O 4IMFA 2QCGA 1YXYA 3C2OA 3LCLA 4JTJA 1THFD 1LM1A 1GPWA 1TPC1 3NM1A 4GUIA 2QCCA 4HHPA 4IXXA 4HNNA 1TTQA 3G1SA 3TMLA 4XBKA 3G1FA 4FIRA 4JTGA 5EMUA 3PSVA 3A22A 3FYOA 3MW7A 2NUWA 3TAKA 5TIMA 1SO5A 4JYFA 3O15A 3IEBA 1RPXA 3GNDA 1H51A 1G6CA 3GIYA 2ABAA 5AHEA 1E51A 2R14A 3P7YA 3PBYA 2VEKA 2NX3A 3TSDA 5LNUA 4FNSA 3G1YA 5MHBA 1GT8A 3P8JA 4XKYB 2EF9A 5SWUA 3GXNA 4KFOA 4DF0A 1SO3A 4UTTC 3Q94A 1N55A 4U4MA 2X1RA 3DFPA 1Q6LA 1K3UA 4UTLA 3CEPA 2E5BA 1KLZA 5DCEA 5I3KA 1ALDA 1LBFA 2PRLA 4Q32A 3ZR4A 2DZPA 2X1TA 3LRLA 4N9EA 3T44A 4O1CA 3VI2A 3M6YA 1Z48A 3C0JA 3TSBA 5A5WA 2RDTA 2NXGA 3TV8A 2B7OA 1OFDA 2Z0IA 3IGXA 3P81A 5BW6A 2C0AA 5CSRA 1D9EA 4L4MA 3LM7A 3F03K 4K7YA 2QUVA 3NL6A 3IRDA 4UR7A 1ME7A 2ZRVA 4CCDA 1KFLA 1YPFA 2AQWA 3VE9A 3G24A 4AHPA 5BMWA 3W1LA 4TMBA 2O7QA 1QDSA 2DZWA 2A4AA 3QPZA 1F05A 1EB3A 3NQFA 3A21A 1EA0A 1A5CA 3BLFA 5AC7A 1W31A 3PVFA 1Q45A 2J6XA 3QW3A 1M7PA 2DZTA 1G4SA 4K39A 1H60A 3MMTA 1DV7A 3S1VA 1KBJA 3NZ1A 4P61A 3NL2A 4DBEA 3RU6A 4EIVA 2EKCA 4TIMA 1DJNA 1DJQA 4GRSA 4NX5A 4DPPA 1D3HA 3VNDA 1VJIA 5L9FA 1JUBA 3OEXA 2OT1A 2W79A 4P2VA 3S6DA 4JTEA 3W75A 3ELFA 2OJPA 1TQJA 5C54A 1TJPA 3O6CA 3GAKA 4UTWC 2V2DA 1WDWA 3W70A 4JYEA 1YXDA 3LX9A 4J9JA 2J9XA 2HSAA 4UFMA 5FF7A 4Y90A 2NUYA 4O4VA 1HG3A 4NJJA 3W83A 3N73A 2VXNA 4FF7A 2Q8LA 4S1FA 1FY6A 2YR1A 3S9YA 3PBUA 1HO1A 3PAJA 1X8FA 1K8XA 1FDYA 3QRHA 3UWVA 2C19A 1ZENA 3LCIA 5E93A 3L5MA 1Q3NA 3MI6A 4JTSA 1KA9F 2ABBA 1ME9A 3DENA 4BK9A 3B03A 1FDJA 3W2JA 2Y7EA 1SFJA 3FKKA 2ZZ2A 3P67A 2E68A 2ZZ6A 2CZEA 4LWWA 4MJZA 3ZFHA 3QQ0A 4MFDA 5CZSA 3EWZA 2VEIA 4S2BA 4O16A 5TQLA 3HOJA 1AL7A 1QCWA 1YDNA 4UTKA 3C56A 4TU1A 2VFEA 2Y62A 2ISSA 3W1TA 2GPTA 3DBPA 3LRMA 4BWLC 3JR2A 1PCWA 3W88A 1JCMP 3MHGA 3HQ1A 1I2QA 3I7RA 3W86A 2RDUA 2A5HA 2VKZG 5K2ZA 1NSJA 5I3HA 1XL9A 1NVMA 4FNQA 4O17A 5DELA 1F73A 1W56A 1KFEA 2VC6A 3B04A 3KVJA 5D2TA 3UZJA 1O60A 5LSMA 1H7RA 3LB0A 1W0MA 1U83A 2DZXA 4LUJA 3DI1A 3SZ8A 3LCXA 5LKYA 4C1LA 2QUUA 1VYPX 3BV4A 2VFDA 4JTKA 3N14A 1LBLA 3LCGA 2A7PA 1IXPA 3H53A 3LOTA 1G67A 1WQ5A 3W2UA 3B0UX 2E6DA 3R5EA 1TIMA 3LXCA 2PRMA 2QCEA 4LT9A 3STCA 2VEPA 3HIJA 2PC4A 1V5XA 4RR4A 3Q2DA 1JCXA 3P74A 4JTUA 2ZZ4A 3I65A 3W7NA 3LDVA 1W5MA 3W7KA 3O63A 1GEQA 4XTIA 1KFKA 1OYAA 3G1HA 3G3DA 1A50A 3NM3A 4IQLA 5EYWA 3S5YA 3QSRA 4WY0B 3TH6A 2Y6ZA 3IVSA 3QMRA 2R8WA 2ZRWA 4UMBA 3S5OA 3TW7A 4JD4A 3DFQA 5BNKA 3S0CA 2FB2A 1DVJA 3LBCA 3W22A 4UR8A 1P1XA 1ONRA 3NOEA 3RK8A 2WPBA 1QPQA 1O5XA 4IWWA 3GDMA 1C9DA 3PS7A 4MY9A 2RH9A 1KM5A 1I8JA 3DXIA 3A23A 1F2JA 2CLOA 1FXQA 4O19A 5AYZA 3FIGA 4WXYA 3E02A 3PB2A 5KZEA 1F6PA 1LRQA 5HUPA 1PV8A 3GDTA 3KVKA 3ABRA 4H4IA 2Y7DA 3S1XA 2GUUA 4QSHA 3GYEA 1OFPA 1TSIA 4JTFA 4WOZA 4ZQNA 4WXZA 5CKSA 3RLUA 3U2OA 2V5LA 5CZ0A 3NAVA 5LNRA 3QW4B 3GDRA 3DZ1A 3IIXA 1R46A 3W7JA 4UFLA 3TK7A 4C1KA 5EY5A 5D32A 3EX3A 3HB9A 3LCWA 5CPOA 4HSOA 4O18A 3TSMA 2A6LA 2YFNA 3W6YA 2JKAA 2G96A 3FJLA 1NAL1 1CW2A 4MIMA 1KM3A 4QAIA 1QFEA 5IBXA 5K9XA 3PR2A 2WOQA 5LNSA 3EXSA 4DO6A 1OK6A 4OT7A 5K4ZA 4W9TA 1P0NA 4JTHA 3TFCA 2ZA1A 4N6FA 1ICQA 3MI2A 1WAUA 1UASA 3EB2A 1FCBA 2QCDA 5IM51 4BR1A 1F6KA 2ZA2A 1VYRA 3GKFA 3T40A 3UWUA 3UPBA 1NF0A 1VLIA 1EPXA 3P82A 2P0OA 3K30A 2DZVA 1H7PA 3SFKA 3SJ3A 1GVSA 1XUUA 1O94A 1X7FA 1RD5A 4CCEA 3G18A 5LZLA 3OG3A 4N02A 4DF1A 1FBAA 5D2VA 3LHTA 4QM1A 1SZFA 1TPFA 1MO0A 5C5YA 1LCOA 2Z6JA 3HG2A 1EUNA 4O53A 4R33A 2TSYA 3R89A 1AL8A 3MP5A 3BGGA 3CHVA 3LLFA 4DPQA 4RXFA 4ZQMA 4ADUA 3AJXA 3KVMA 5DN1A 3PUDA 2JGYA 1QMLA 4NUWA 5E0KA 2NUXA 1B57A 3W23A 3TAOA 1K03A 1XBVA 3PM6A 4HSNA 1JCJA 3C3NA 3S42A 2Y7FA 1MEWA 3DFSA 2E09A 2ZZ1A 1SSDA 3DI0A 2CLEA 2V0TA 1LORA 4KWVA 3NNTA 1TPWA 4XKYA 3R12A 1K8YA 1IXOA 4IPIA 4EOUA 2ZDRA 4FNTA 1XI3A 1QPRA 3L66A 4NJHA 3IIOA 1OX5A 1H7WA 4GE8A 1GTEA 4IMCA 4O13A 4CNNA 4N9BA 5I3JA 1XDLA 4NNAA 1Z44A 1LP6A 3PF3A 2VFHA 3L9CA 4JNMA 5HJLA 4HPJA 3TU9A 3DKLA 2WNNA 3RMJA 4GJ1A 1B4KA 1F74A 4LU0A 1G7VA 3SR7A 4YL2A 4LVGA 5KTLA 5ABTA 3M1ZA 4FO4A 2Y70A 3EXRA 3P80A 1KV8A 1YXCA 3SY5A 2CLKA 4LNYA 4DQWA 1W54A 1SQ7A 1EWEA 4JIQA 2Z6IA 3BARA 2DP3A 4A2SA 1SFLA 3NR0A 4GBUA 1P4CA 3BW4A 1ZY9A 1QOQA 4YWIA 1W1ZA 2Y7GA 3M5ZA 4NNCA 5F4XA 3LV5A 4PEKA 2H8ZA 3IV3A 4O28A 1GG0A 1M7OA 1GYNA 1W3IA 4RV8A 2W6RA 1KFJA 3SIZA 5HUOA 1OFBA 1UJPA 1R47A 5LGZA 4CCCA 3DFTA 3CIWA 3UD6A 2YDAA 4FB7A 5D04C 1JCYA 1OFAA 3GNNA 3T4CA 3N9RA 3E9AA 1IIGA 3E49A 3FFSA 1LBMA 3KAOA 5CG7A 2P1FA 3NO5A 4E38A 2G97A 5G5IA 4POCA 4XZ9A 2H3BA 2YW3A 4YMZA 3N2MA 3L2IA 1BEUA 2YSWA 4XQ6A 4TX9A 2H8XA 3TR2A 3CQ0A 4NZJA 2IQTA 1GVOA 3W2LA 3STEA 4HNVA 2RKXA 4JDYA 1I4NA 5C2XA 3A24A 3FS2A 4Y96A 4WQ6A 4AB4A 4UTUA 1S3HA 3LHVA 3S5NA 4MPQA 3MI3A 4M5PA 3NPVA 5FF0A 4Q33A 5CPLA 2Z1BA 3NQ7A 4YLWA 1R30A 4O1AA 1TTJA 1OHLA 3CT7A 1K8ZA 2TMDA 5BMXA 2E77A 1XM3A 2ISWA 1YTEA 4FNUA 1SO4A 1GZGA 3NL5A 1PE1A 4O11A 4YXGA 2E6AA 1I2OA 1RV8A 1KLYA 1V7YA 2HS6A 3PC0A 1UBSA 4ZMGA 3MHUA 1L6WA 1BWKA 2QJHA 2RDWA 4H3DA 4R53A 3NGJA 4ADTA 1H1ZA 3MHFA 4RZ6A 3M47A 5D2WA 3TIMA 5BRBA 4KWWA 2HS8A 2RFGA 2VEMA 1ZNNA 3I7QA 4MLRA 2C14A 1OABA 5K9CA 1PCKA 2QCHA 3I6RA 1AW2A 4QJ1A 2GQAA 1G4TA 1QOPA 1ZJIA 1VH7A 1YTKA 3M5VA 2TPSA 1PL9A 3EWYA 1RQHA 2ZBTA 3OVPA 1LLWA 2YYUA 3KFTA 2C15A 5D03A 1TTPA 5FEXA 1EP1A 3W7IA 4JTTA 1M6JA 3EWBX 5G2IA 3DKJA 2F7FA 3TUUA 5EA9A 1T0OA 4NU7A 4QITA 1WA3A 1HTIA 3G22A 3VFLA 3LRKA 1XKYA 4MLJA 2FPYA 4MJMA 3TQ0A 4WD0A 2CLMA 2E6YA 2WSYA 1WOBA 3HG4A 3WJWA 3C2VA 3E12A 3STGA 4H6KA 4IMGA 1JUKA 2V81A 3W07A 3LHWA 3WJXA 2GJLA 1ME8A 3P5ZA 3O05A 3MYOA 3PBVA 2ZTJA 4LOCA 4BF9A 5K3VA 3P8IA 5HMSA 3M16A 3MUXA 3HGSA 1WBJA 4JIPA 3G0SA 1Z42A 4Z08A 4NX0A 4DO5A 4IPJA 3UNDA 1OYBA 3NQ8A 4WY0A 1J2WA 3TW6A 3IVTA 3BVJA 4UXDA 5F2LA 3LBMA 3QM3A 1GG1A 4AAJA 3UWZA 2PCQA 1K7FA 1L6SA 4FXSA 4TR9A 2ZZ5A 4ZQPA 2DJLA 1EX5A 1GOXA 2EAWA 3W1XA 1YYAA 2QUTA 1VCGA 3W76A 1SW0A 1OVDA 1ZAHA 3HGJA 4FX8A 4D2JA 1SO6A 3W87A 5EBUA 2GJNA 3NL3A 5D02A 4EF8A 4CQ9A 1IF2A 5HINA 3HGRA 3ZWSA 2R91A 5LNWA 3W72A 3INPA 2P10A 3B06A 2DJXA 2I9EA 5FEPA 1FQ0A 1GVQA 3VKJA 5DCBA 3EXTA 4UIOA 1QNVA 1B9BA 3TXZA 2RHGA 1EP2A 3W7DA 1JCNA 4IXHA 1EWDA 2OCZA 4PODA 3NPXA 5IBXC 1FDZA 1F76A 3MYPA 1DORA 2ZRXA 4ZQCA 3HG5A 1W8SA 3WJSA 4S2CA 3W7EA 1HO4A 1JR1A 3B4UA 4IX0A 2VOMA 5FEZA 3A9IA 2PRHA 3L5LA 4AMAA 3NEVA 3W9ZA 4AH7A 2QKFA 3ABOA 3QJAA 1VS1A 5DBUA 3QQ1A 1OX6A 3O07A 5HULA 3KRUA 1OG0A 4NJKA 1TV5A 1TPEA 1ZFJA 1O4UA 5T26A 3A5VA 5AC6A 3TJXA 2Y89A 3IVUA 1KW1A 3C2FA 4KKXA 4HNUA 5DY2A 3UXAA 3NQAA 1TCDA 3TE9A 4O50A 1LROA 3THAA 1LRTA 1LOQA 3QZEA 1I2NA 4GUGA 1J4EA 4ORMA 4M6QA 4HN4A 3T55A 3DH7A 2FJKA 2J24A 4NXSA 3QPYA 3S1UA 3FYPA 3HF3A 1W3NA 5G2WA 1MXSA 5G1TA 2H90A 1A5SA 5F2IA 3MBFA 1XBXA 3QMTA 5FF3A 3W1MA 4O10A 3QMSA 5J5RA 4RZ5A 5KZDA 3HO8A 5HNRA 1KM4A 4OBTA 1PIIA 2Q8ZA 5I3IA 3G1VA 3P62A 3GLCA 5FF4A 2UV8G 1IGSA 5HR6A 1I2PA 4O1BA 4ZVJA 3PUEA 4YCOA 4A22A 5DCDA 3N34A 2O7SA 1G4PA 1U5JA 3SECA 1GWJA 2NWRA 2CZFA 1LTDA 3EKZA 3N3MA 1FWNA 1TPDA 4LVAA 1OFRA 2V9DA 2JBMA 4NNBA 4JN6A 2WJZA 1VPXA 3NDOA 4JR5A 4BI7A 4FEZA 1LZOA 1LDCA 2BTMA 3C52A 5D37A 4R34A 3LXAA 1NF7A 4LVBA 3KRZA 3MP3A 2ZCGA 2QDGA 3F4WA 1VLWA 2QJGA 3UWWA 4Y8FA 4N9DA 2V30A 3CM4A 3G8EA 4RXGA 1I2RA 5D30A 1ICPA 1DL3A 4MOZA 4UFIA 3HGOA 5HWMA 2DORA 4IMDA 5LGXA 1QWGA 1TYGA 4RK8A 4JX6A 4ORIA 2YX0A 5AHLA 1R2SA 3HJZA 1KFCA 1OF8A 3S1WA 2C18A 1MEHA 2DU2A 1QO2A 4PA8A 2B0MA 2VFGA 4LC8A 1W5QA 3O1NA 1K02A 1TV8A 1EEPA 2NV1A 3QC3A 5FF2A 2NXIA 1XBYA 3M43A 4A2RA 1QPNA 1AMKA 5FEWA 3T7VA 4OU1A 5AHNA 2AGKA 3KRSA 3L65A 1VHNA 4BI6A 1DQXA 1T8XA 3GDKA 2AAMA 1VYSX 2WSRA 4GUHA 1FWRA 4RKAA 1FWSA 3EX1A 3NQGA 2NLIA 3UYCA 1H50A 3Q37A 2ZQ0A 3MP4A 5HWJA 3GVGA 2ATSA 3IGUA 3NA8A 1JQXA 1FWTA 2JKPA 4AF0A 1JVNA 1WX0A 2J88A 4I7VA 3M5YA 2A85A 2A6NA 3USBA 2BSLA 1W37A 4K37A 1JQVA 4JICA 5D09A 1K7EA 3ZWTA 4LV9A 7TIMA 1X1OA 5F1UA 1QR7A 4LY8A 1ZAIA 1CX9A 2BXVA 1C29A 2CW6A 2JK2A 4B5NA 3CC1A 3BGJA 3ABSA 3BLEA 1G7UA 4MZ1A 2A7RA 2C1HA 4JX4A 5EPDA 3EEGA 3NQMA 3W74A 3NQEA 2VFFA 3GK0A 3U8GA 3W7HA 1SZNA 3NYZA 2XN0A 2OX1A 3O06A 4K36A 3GXPA 3TKFA 4PC8A 2V5BA 1TRIA 1RR2A 4GXMA 5K7JA 3QEZA 3NQ2A 2ZYFA 4JS3A 1KTNA 4CNPA 1UB3A 5AN7A 3ANYA 3BPWA 4N6EA 1ML1A 4JDBA 3H55A 3KXQA 2CU0A 3UY7A 1DBTA 1VQTA 1TPB1 4LS0A 5F2GA 4HT3A 2CFFA 4LRTA 2ZRYA 4UFKA 5I3FA 3NG3A 1VHCA 4X3ZA 3EX2A 4ZZ9A 4E2BA 3KX6A 3LXBA 2QAFA 2EHHA 4FHAA 5E1QA 2QDHA 1TRDA 4XTDA 4Z1CA 3W84A 5DXYA 2E6FA 3DHFA 4LW7A 4N4QA 5L6UA 2VELA 2D73A 4CNOA 4LVDA 1TPH1 3W3OA 1MZHA 4K8EA 4UMCA 4I9AA 4PL1A 3SGZA 1DOSA 1SR9A 1MSSA 4UTIA 3T78A 4LS2A 4WX2A 2Y63A 3W1AA 3LLDA 1RQBA 3MO7A 1T99A 3PG8A 4IJBA 4ZQRA 3W7OA 3HBLA 2BX7A 1MEIA 3PSWA 1LLZA 2GOUA 3LHYA 1XC4A 5U7SA 3ATYA 4Z1AA 4HPXA 1H61A 4KFPA 1WYIA 4WZHA 2FDSA 1KTCA 2ZFAA 3W7GA 4AHOA 1SUXA 4E2DA 4Y9AA 1EIXA 5HWNA 2ZZ3A 3WFAA 4AVFA 5LNVA 4A3UA 1J5TA 3KHJA 4LUIA 1F7BA 4JYDA 3CU2A 1IIHA 3TC6A 3EX6A 3IIPA 3W7RA 1OX4B 5AC8A 2BZNA 1YTDA 2QCFA 4MY8A 5U4NA 3FLUA 5AOUA 1R2TA 2HTMA 4PFMA 5C6MA 1XUZA 2G5WA 5KZMA 1HL2A 1N8FA 3NQ6A 3M41A 2Y88A 2QCLA 4IX2A 3R2GA 1O5KA 1B3OA 1XCFA 3NPUA 3A5FA 1FUYA 2G95A 2V2CA 3B05A 3RLVA 2QCDB 3LV6A 5H91A 2CZ5A 4LC6A 5G1YA 5CZJA 3FJ6A 2W0UA 5DLCA 1L6YA 2X1UA 5BOOA 1FCUA 2H6RA 4OQVA 4NQ1A 2ZRZA 4K38A 2QEZA 5DY3A 3HPXA 1PHWA 2ALDA 1JJKA 3B0PA 3W7LA 1NEYA 2YFOA 3M9YA 3OHIA 2HMCA 3I68A 4MVAA 3M0ZA 4O15A 4OWGA 5CZTA 3LCHA 3TXVA 1XFBA 8TIMA 3MWAA 1QO5A 2YPIA 1FXPA 4QQ3A 3GZ3A 4XUGA 1SZEA 5D33A 5G4WA 4HIBA 2WSQA 3G3MA 3STFA 3F4NA 3G1DA 4Z0JA 1ZALA 2X1SA 3TFXA 2GQ8A 4Z0SA 2YW4A 1R2RA 4BI5A 3C61A 3HPSA 1FCVA 5C55A 1TREA 3S5ZA 2CLHA 3LI0A 3W2NA 2B7PA 4M6VA 1TPUA 4PL2A 4Y6GA 2QJIA 3H54A 4I7WA 2Q3RA 4MZ8A 4CLMA 5HR7A 3OVQA 4UFJA 3O6DA 2A0NA 1GVFA 4I7UA 3JRKA 3L0KA 2R94A 1UUOA 2WKJA 1A5BA 3LTSA 2X16A 3TCEA 3KVLA 3PWAA 4XWUA 4EWND 1AW1A 1ADOA 3W2MA 5AHIA 3W1UA 5EKYA 4WY0F 3OVRA 3FA5A 2XN1A 3P5YA 1VGAA 1NFBA 4L4LA 1GQNA 4NZFA 3OA3A 3IIZA 5FI8A 1JRCA 2C13A 1LOLA 4O12A 3HMJG 1C8VA 4NJIA 1PVNA 3M7WA 4Z1DA 5EL1A 1TO3A 1CI1A 1BWLA 2LLEA 5J5DA 3L0NA 3SGUA 1OFQA 4UC5A 3W7MA 3N9SA 5GVJA 1YDVA 3TQVA 2QCNA 2DZUA 1H7NA 2ATMA 4GUJA 1VCVA 4IMEA 2DZSA 1TB3A 4OHQA 4FXRA 1S5WA 1T96A 3M44A 1TTIA 3CB8A 2F84A 3B8DA 4AEOA 2GQ9A 5CSSA 5D2YA 4GNJA 3UWQA 2EGZA 4DXVA 3N19B 4MFEA 4N2YA 3WK0A 3GXTA 2V82A 4DF2A 4DO4A 2V8ZA 2B4GA 2H3DA 4JGDA 4K7VA 3NQDA 4X2RA 4Z1BA 1KFBA 4A29A 4FNPA 2FFCA 4TO8A 4DBDA 3CIXA 2PE4A 1SU5A 3SSJA 2VFIA 3IGSA 4ZQOA 3ABQA 1VZWA 3WK2A 1WXJA 1XBZA 2JGQA 1XDMA 3TX9A 1Q6RA 5AFDA 2Y85A 1H7OA 1H62A 1W5OA 2Q3OA 4WJEA 1ZAJA 2FTPA 3PG9A 5K9DA 3C2EA 4UCGA 3HPZA 4UFHA 1VC4A 3L5AA 4MYXA 2FB3A 4GC4A 4LV4A 1UUMA 3TDFA 4JY8A 3CWOX 1LRNA 1PS9A 1HFBA 1H5YA 1JRBA 5CPNA 2CWNA 3GR8A 3BG9A 3ATZA 4X9SA 1OFEA 1TMHA 4PTNA 1P5BA 1X6UA 1Y0EA 4AXKA 3EKLA 2WV8A 1I45A 2WNQA 4JTIA 3NQVA 3TJLA 1X1ZA 2Z2UA 2XN2A 2QR6A 4O0ZA 1QAPA 3O8AA 1F5ZA 2GVJA 3QF0A 5AYXA 3LTPA 3D0CA 4RCXA 2QCMA 1JULA 4M19A 4RZ4A 1KM6A 3I7SA 4LRSA 3B0VC 2NX9A 3PUOA 2VENA 3P60A 3GDLA 1AW5A 3BG5A 3TMQA 5D05A 2NZLA 4UTTA 1IXNA 2FPVA 3LTYA 3TQKA 5KITA 4DEFA 3V1PA 2J9YA 3NQCA 2TYSA 1VR6A 3BO9A 3DHDA 1OYCA 3P61A 2XFWA 4ICNA 1YLVA 2QAPA 4O14A 1D3GA 3G1XA 3E0IA 2E5CA 1RVGA 4LVFA 6ALDA 1WV2A 4ML9A 3VE7A 4MYAA 2BLEA 3U6WA 4PH6A 3UPWA 3QSTA 3CTLA 4HKPA 3MJYA 2QF7A 4UTMA 1G4EA 2CLLA 3L0GA 3UXDA 3W71A 2E5DA 1GYLA 4G1KA 1FX6A 5LHFA 5A8GA 4RX0A 4O4WA 3WK3A 4YCPA 2WO5A 1ZCOA 1YADA 4CQAA 1GVRA 2B7NA 5G2HA 4LTSA 1XXXA 3VCRA 1G69A 4MKNA 4RJEA 1SPQA 1JUEA 5FESA 1W5NA 3C8FA 4AWTA 2J9ZA 4RLIA 2YYTA 4QISA 1OFOA 3V75A 3W7PA 4PCFA 1SSGA 3WJYA 1FWWA 3OIXA 1WOAA 2JKEA 4O52A 3F1QA 4UUIA 4WOQA 4JTLA 3GR7A 1KM1A 4NVTA 2ZA3A 4M6PA 2GVLA 4JY9A 4A21A 1K7XA 4ALDA 2FQIA 1W5PA 1JCLA 3EWUA 3PULA 2Y61A 4GWEA 3PB0A 2ZTKA 1L2UA 4FNRA 4O8RA 3W85A 3W1QA 4IOTA 1YDOA 3LGEA 1SW3A 3BW3A 3NPWA 4FX7A 1Q6QA 2C6QA 4NT0A 4CQ8A 4UTWA 5DBTA 4O0KA 2NV2A 5F4SA 2OT0A 3G0UA 4IGHA 3RFAA 2X2GA 1EP3A 4UNKA 1IXQA 3RNDA 1PHQA 5LHEA 5KSWA 1DKWA 5KMYA 4UTHA 3W73A 3LHZA 3QFEA 3SW6A 4NJGA 3L21A 4KFNA 5D38A 1TQXA 1OK4A 2C16A 1KTBA 1O95A 4TMCA 1OX4A 5F2MA 3FEMA 3BG3A 1TV7A 3LCFA 3BLIA 1LYXA 4JXCA 3QYQA 2GVGA 3C2RA
chains in the Genus database with same CATH superfamily
3W2KA 3CLMA 2FLIA 3MUY1 4O1DA 1HJSA 3FA4A 4TOQA 1EOMA 2J27A 1EJUC 3DU0A 1F4AA 3AYTA 3KLLA 1D2KA 5F1VA 4FR6A 5A8QA 4HQVA 1HP5A 3LHUA 1GTHA 1PB0A 4JHMA 1RQEA 3WD4A 2PTYA 1OCQA 3UGRA 3SUWA 3KOFA 3GX9A 3CAQA 4C7DA 4BWLA 3FEQA 4HP5A 1WBHA 3P84A 3BLOA 1TZ9A 6TIMA 2P8CA 4V27A 5C2GA 3GU2A 4O54A 4ADSA 1Z41A 4NY2A 2NXHA 2PDBA 3PTMA 3DC8A 3VPLA 2V2HA 1RZMA 3L68A 3S8HA 2QXWA 4XBSA 4F0SA 3KS5A 1BTCA 3LGGA 5TBOA 2HV5A 4FLQA 3AWOA 1EHNA 2DIJA 1ODUA 4IUOA 4XAPA 1BF2A 3SN0A 1UKSA 1IEQA 2ZUTA 4TVDA 3CUGA 4HHLA 5HNUA 4FX6M 4DZHA 5LIKX 5IHSA 1S5VA 2DY3A 3IJLA 1OF6A 3NZRA 2J66A 1R3RA 4YU1A 3EDDA 1SZGA 4LCRA 3UJEA 4PMZA 4JL2A 4MWAC 4N4PA 3W7QA 1GOIA 4AEEA 2C3ZA 3MT1A 2A21A 1I1XA 3WUBA 2WNZA 4QNWA 2BOEX 3R13A 5A8NA 4GKLA 4LEQA 5DXXA 5CBBA 2YGYA 5AHFA 4BFAA 3GB6A 2GUBA 3HJEA 3CPRA 4JX5A 2A7NA 4UQ9A 1QI0A 3W1NA 4M7TA 1TZZA 3SI9A 3DFNA 4K68A 1JFXA 3FSUA 3DGRA 3B8IA 4RW3A 2HVMA 2YDQA 1NH6A 1UWRA 4ATLA 3S6TA 1H11A 4BEQA 3AXMA 1SW7A 3ZR5A 1UKQA 1W1VA 4QDPA 3RF9A 3HTWA 1J96A 4N9CA 1ZZMA 1EUAA 4TXEA 2OZ0A 3QH2A 3MZNA 3R8RA 6A3HA 1RCQA 3SB0A 1LOSA 3GD6A 1ISYA 1CLKA 1P0KA 3T0DA 4Q4KA 3IIVA 4LYRA 3NVDA 4JN8A 4OFCA 3WCZA 1YXYA 4XB3A 5JU6A 4IFKA 1THFD 4DUVA 1A0EA 1GPWA 1TPC1 5I00A 2PDUA 4GUIA 2QCCA 3TYDA 4IXXA 1TTQA 2NT1A 3G1SA 4JTGA 4M29A 1H41A 1X8CA 4DWSC 3OZOA 3V0TA 3MW7A 3ALFA 1RAKA 1RY8A 4B4HA 4GVHA 5E9XA 1CGTA 3O15A 1XG4A 4LANA 4FS9A 1H51A 3GIYA 5GPRA 2DVUA 2R14A 1JNEA 4ZB5A 1A5OC 2BBFA 3TSDA 1V0MA 3G1YA 1B90A 2WBKA 1UZ1A 5DF0A 1UHVA 4F3HA 4XKYB 5SWUA 1X97A 4DF0A 1SO3A 3H4GA 4UTTC 1XLLA 2V69A 4U4MA 1Q6LA 5XINA 1FHLA 2ALRA 3SN4A 3T2PA 1LBFA 2I57A 4JKKA 1DEDA 1PKYA 1RJQA 4O1CA 3M6YA 1EKOA 3TN4A 1YEYA 3TSBA 5JXQA 2RDTA 1F61A 3SY1A 1XIMA 4DI8A 3H7UA 3KDOA 1KO0A 3CUJA 3UVAA 3ZR6A 2YCLB 4EXBA 2FTYA 3AHTA 4WVXA 1XYZA 5C9XA 3W1LA 4U10A 1RA0A 2DZWA 1GHSA 2WSPA 2FDMA 5HPCA 1XYMA 2DUXA 1F05A 1EB3A 3NQFA 3A21A 4S3JA 3AZSA 2PLMA 3BLFA 1CDGA 2I5IA 2J6XA 3GTXA 2DZTA 2WVVA 3S1VA 4E8GA 4EPBC 3NZ1A 3C0LA 5EGRA 3W81A 4HNLA 2EKCA 4US5D 4DPPA 1LL6A 1UC5A 2VR5A 3VNDA 1UR0A 1JUBA 1JGIA 3NDZA 3CL7A 3UF9A 1GK8A 3F4CA 3W75A 4JTEA 3ELFA 2OJPA 1HKWA 3MSGA 1DHKA 3UU0A 1TJPA 3O6CA 1XD1A 3CUIA 3DHUA 3GAKA 2V2DA 1YXDA 3LX9A 1XSKA 2J9XA 1Z32X 4Q8TA 4UFMA 1OM0A 2W63A 2NUYA 4EPDC 5I7GA 3U3HA 4FF7A 2IKGA 1QBAA 4S1FA 3S9YA 2I9UA 3WG6A 3PAJA 1K8XA 3QLLA 1V6UA 4KWSA 1Y5VA 3QV9A 3MI6A 4NG3A 4ZTYA 1QNSA 1XF0A 3H2OA 2YA1A 3N25A 4F2UA 3DYOA 4JEJA 4L1GA 2Y7EA 1KRBC 4GIAA 2X7VA 2E68A 3ZFHA 3QQ0A 2PUZA 4IGNA 4S2BA 5TQLA 3HOJA 2IPGA 1CBGA 2BOGX 2Y62A 3OP2A 2BS9A 2ISSA 3W1TA 3MHGA 3KL3A 3I7RA 3QR0A 4KCWA 5HXMA 4C6CA 2VKZG 4Q4PA 2MANA 1ZSXA 1F73A 3B04A 1AQHA 2EPLX 5H8MA 5FKYA 3TOPA 3DI1A 3OZYA 4PE8A 3LCXA 3AJ7A 5LKYA 1BVZA 2DUZA 2QUUA 2W91A 4JTKA 3LLXA 4KEMA 2H9AB 4CKQA 3LOTA 1PO9A 1DJXA 3LXCA 4HTBA 4KBXA 3PK7A 4LUTB 3KTSA 2VEPA 2WANA 3SDOA 3Q2DA 4LBRA 1R87A 2I17A 1A3XA 3LDVA 1W5MA 3UZWA 2PTXA 1IEVA 1DWJM 3VOCA 3LBOA 5J8LA 2CYGA 3NM3A 4IQLA 3THUA 2NSOA 1DE5A 2GGJA 2Y6ZA 2C91A 3IVSA 3TW7A 1X1NA 3UJSA 3TP4A 2NV9A 4UR8A 3LYEA 1UYQA 3RK8A 4J1OA 1K9EA 4RDZA 1R3TA 1CXHA 1GVEA 1C9DA 4MY9A 4JPGA 3GXFA 1EJWC 1FWGC 1E4NA 3GIPA 1PIFA 3PB2A 2UBPC 4GFIA 3BQ6A 3C86A 5A1AA 1G1YA 1PV8A 3AU2A 2GGGA 1TV2A 2WZMA 4KRZA 1WB0A 4R85A 3R4IA 4WOZA 4F79A 2GDVA 3U2OA 2ZUNA 5CZ0A 5E9AA 1HGWA 3GDRA 1UQYA 1R3YA 2VTFA 4NSBA 4X63A 2GJPA 5D32A 3F2DA 2OSYA 3ZSTA 3VDAA 1B3YA 3GTIA 3FJLA 1QFEA 2VCAA 4XZWA 3VGHA 5K4ZA 1OK6A 4W9TA 1P0NA 4JTHA 3AMGA 1NDZA 5MKGB 2P8BA 3BSHA 3EB2A 5CAKA 4IJRA 1DJHA 4RE4A 3T40A 4F2BA 1NF0A 1VLIA 3P82A 2P0OA 2J8TA 3F5LA 2ZWZA 3EGJA 3FJNA 3F7JA 4X2PA 1XUUA 4C90A 1RD5A 4AZIA 4YJ5A 3M0JA 4PUUA 3OG3A 1FBAA 1OINA 5D2VA 3VZZA 1OD0A 4QTGA 1XX1A 1TPFA 3DBNA 1MO0A 2YDSA 2Z6JA 1ZBVA 4MADA 3Q4DA 4O53A 2TSYA 3BUVA 3QGKC 3VIKA 3CTTA 1AL8A 4PMQA 3TQPA 1DIOA 4INFA 4ZB0A 1K70A 1GKPA 1IGWA 1E0XA 1WE5A 2PTZA 3U7BA 1O1ZA 2Y7FA 1MEWA 2E09A 5M3WA 3DI0A 3L7RA 1C91A 1GVYA 4KRTA 2V0TA 4KWVA 3ZVIA 4XKYA 3B9NA 3R12A 1ZU8A 1OCNA 4IPIA 4J5NA 3ZMRA 2A3EA 4GKTA 1QPRA 3IAQA 4DI9A 4HYWA 4GE8A 1GTEA 3T0BA 4JQ1A 1R3WA 4NNAA 2O4MA 1ZJAA 2Q02A 4HBKA 3PF3A 4GIRA 1JIBA 1K8CA 3N6QA 3H4XA 2NQ5A 3CO4A 4IISA 2EEXA 4XG1A 2PWEA 2INFA 4GJ1A 3I3EA 1B4KA 3PP7A 3WMSA 2VGIA 1PYFA 1Q6GA 2Z26A 2PTWA 1HJUA 1M3UA 3RRAA 3VKBA 4CQCA 1R85A 3ES8A 2YCLA 4A2SA 1OCBA 3BW4A 1ZY9A 4YWIA 2Y7GA 5F4XA 4PEKA 4KERA 4LBSA 3SFWA 4FA3A 1QJWA 1GG0A 2VGGA 2G8ZA 3HURA 1GYNA 2GJRA 4Q3MA 4IHCA 1OFBA 4LUSB 5D04C 3E0LA 1UP3A 3T4CA 3N9RA 4GJJA 1V93A 3E9AA 4S3AA 1LBMA 1JF6A 3NZGA 5CG7A 4ZOCA 1QI5A 4G7FA 5G5IA 4G1NA 4XZ9A 1A4MA 3WQEA 1GPFA 2YW3A 1W9DM 4PR4A 1VEOA 3N2MA 2YSWA 3TR2A 5A6MA 2ZE3A 2RKXA 1I4NA 4Y96A 4PMJA 4WQ6A 1S3HA 3LHVA 1X6NA 4HK7A 3RG6A 3MI3A 4HA4A 4Q33A 5CPLA 4QE4A 1C92A 4JZ5A 4O1AA 3H2EA 1BYCA 3B4YA 4BHYA 3E2VA 1KRAC 3WLIA 4FNUA 5JIPA 1QI4A 2ANUA 4IGMA 1PE1A 3V5OA 4YXGA 1I2OA 4PSPA 4ZMGA 1V7YA 2HS6A 1UPPA 1UJQA 1BWKA 2E9MA 2TODA 1RBOB 1RPKA 1VPYA 3FDGA 1W17A 3W27A 4E8CA 4OOUA 2IKHA 3M47A 2ZXQA 1FH9A 1PZ0A 3TIMA 3DC0A 1H09A 1J8VA 2HS8A 4GYPC 2RFGA 4PUMA 2D3NA 2C14A 3LNMA 1AW2A 1XIHA 4QJ1A 3ZM8A 4HJFA 4NF7A 1XLJA 2TPSA 1PL9A 3EWYA 1RQHA 3SUSA 3OVPA 3EKGA 3IK2A 2BXZA 2YYUA 3WBAA 3UG5A 4CGTA 4BEUA 1P6WA 2F7FA 3GVQA 4ZGYA 4NU7A 4PSRA 4W7WA 5A8OA 1HTIA 3KCLA 2WQDA 4I6VA 1XKYA 4MJMA 3TQ0A 2E6YA 2VD9A 4HPGA 2H9AA 3KBNA 1JI2A 1UD3A 4H6KA 3ANVA 3E38A 3GM8A 4IMGA 2OQHA 3WLNA 3LSBA 4XD6A 1CB2A 3LHWA 4IFOA 1ME8A 4LUTA 3MYOA 4MDPA 4MB3A 1EBGA 4S3KA 3MUXA 3PTKA 1Z42A 3COTA 3O0FA 5DEZA 1B30A 4Z08A 4NX0A 3FV9A 4IPJA 3URNA 1Q6EA 4PMXA 1AJZA 3ICJA 1J6PA 4UXDA 1UBPC 2PP0A 1GQLA 4AAJA 1ZP3A 3UWZA 2PCQA 3M0HA 3CS2A 1K7FA 2ZZ5A 2PPGA 1KC7A 4GINA 4CNSA 3S5SA 1VCGA 5C9WA 4MF4A 4JIEA 1GOKA 4D6FA 1XSIA 3LPGA 1O5RA 1I9CB 5EBUA 4DYKA 4UQBA 2J79A 3HGRA 3ZWSA 3UT0A 1JPDX 3FXYA 3H2FA 2Z2BA 1HIZA 5FEPA 3JVAA 5FL0A 5DCBA 4UIOA 3MJMA 4B3ZA 3E6EA 4IXHA 4W8AA 1A3HA 4ZENA 4PODA 3WMLA 3MYPA 4ZQCA 4KCTA 3GW0A 1W8SA 2J7BA 1XQLA 2DQWA 3T09A 4GY7A 3U9IA 4UQDA 4DUOA 2HNEA 1CIUA 1ZBKA 3A9IA 4C65A 1OGSA 3GBEA 3BICA 1H4PA 3GXIA 3EDKA 2W92A 5DBUA 2Z27A 3O07A 1J0IA 1TPEA 1B5TA 1ZFJA 4A8IA 3A5VA 3CV6A 3R0KA 5MKGA 4KKXA 4Z2IA 5DY2A 2ZOXA 4WJXA 1TCDA 4WKAA 1BXBA 4O50A 3QHOA 5EMKA 1LOQA 1ZP4A 5H1WA 1J4EA 3ID7A 4J2PA 3VD4A 1O6IA 2X0SA 4M6QA 5KEZA 3F4VA 2OVLA 2BGSA 5DT5A 5LIYX 4M0XA 3QPYA 4BQ3A 5AZ0A 3FYPA 1W3NA 2VZUA 4MB1A 1AH3A 5DRCA 3W1MA 1E1CB 3TNBA 4RZ5A 1FFRA 1JDDA 5KZDA 3GHRA 4LPCA 4HB7A 6REQB 1PIIA 3N4AA 4J35A 3N6HA 3WLSA 5C2CA 3GVVA 1TZ7A 4TVUA 4B2DD 2XSAA 3GLCA 3VC6A 2UV8G 3GUGA 1UD8A 4O1BA 4PCPA 1H1NA 2GL5A 3WNPA 1BLIA 2WMKA 3B9OA 3N34A 2O7SA 4ZTXA 1G4PA 1U5JA 3SCVA 3SQLA 2CZFA 3MMDA 3EKZA 5I5RA 2WM0A 1FWNA 3WNNA 3THCA 1V3HA 4IP5A 1TPDA 2PTDA 1OFRA 1BQCA 2V9DA 4NNBA 4JN6A 2WJZA 4MGGA 4FEZA 1LZOA 7PTDA 4B3KA 4B9YA 5A2AA 1YBQB 3KRZA 5FAGA 3V1HA 1MYRA 3UR5A 1ZGDA 3AHYA 1GJWA 4TX6A 1VLWA 4GH1A 3FAWA 3UWWA 3VK5A 3G8EA 4H01A 4H9TA 3QV8A 5HWMA 2Z1SA 4UZSA 4IMDA 3HM7A 3VYLA 1YKWA 3IARA 4JX6A 3NFUA 1UROA 2POTA 1GQJA 5AHLA 5HJXA 4HOWA 3FSTA 3EYPA 3S1WA 4UQAA 1ITQA 2PLKA 3NUKA 1IEIA 4LC8A 3O1NA 4MB5A 2OX4A 4Q7NA 4GZ7A 3VCNA 3UXKA 1E6PA 4Y9MA 5XIAA 3M43A 1QNRA 4Q8NA 4K8GA 4HTYA 1TWZA 3L65A 2CXGA 3ARYA 3CYVA 4EKJA 4LUSA 4RKAA 3EX1A 3EOSA 4XVDA 3UYCA 3BCDA 3MP4A 3GTHA 4CNTA 2PDHA 1R9ZA 4LAOA 3NA8A 1FWTA 4C6BA 3PZVA 2A85A 2A6NA 1US2A 2BSLA 4FOJA 4JICA 4C6LA 3SQMA 4GG9A 5KZ6A 1QR7A 3BOFA 1CXIA 3AZTA 3WF3A 3OOQA 1R0MA 3P3BA 3RYSA 3BGJA 3BLEA 1M9HA 2A7RA 1LG1A 2C1HA 3TYUA 1W8GA 1VB9A 4GO9A 1BRLB 3QGVA 4ZOBA 2XN0A 2OX1A 3T9PA 3RGTA 4XZHA 4PUEA 5K7JA 1Q85A 1XD0A 3A3WA 1KTNA 1NDYA 3NCOA 1ITUA 2XFRA 5A6AA 5BZAA 2EPMX 3VMNA 3R79A 1PZ1A 5AN7A 5FAJA 1EXPA 3CZKA 1YMYA 2CBUA 3TN6A 3AYVA 2CU0A 1ISXA 3UY7A 1DBTA 3BAYA 1TPB1 5JUVA 2WWCA 4LRTA 1ZPTA 5I3FA 3NG3A 1VHCA 1CXLA 2VVSA 3TZFA 4ZZ9A 4KWOA 3QY7A 3V5CA 4IL0A 3PTQA 3VDCA 5FOOA 2QDHA 4R7OA 4XTDA 4Z1CA 3S2JA 2E6FA 3DHFA 4HZ7A 4XV0A 4XK2A 3V5FA 2D73A 2J7GA 1OD8A 1VEPA 3VGDA 2Y4SA 4PL1A 4WX2A 3WFLA 4OUIA 4C6MA 3W1AA 1FRBA 3BSGA 1XG3A 3LLDA 2C0HA 2P88A 2BX7A 3PSWA 1LLZA 4QE5A 5CGMA 4L61A 4WCJA 5U7SA 1XC4A 3WIJA 4MJ2A 3KP1A 3BLKA 4DJFD 5EMYA 3W7GA 2Q6ZA 4Y9AA 5LNVA 3TTSA 4FAMA 3WLKX 5M17A 4AX6A 3I10A 3WDHA 1IIHA 5HNTA 3ABZA 2W3ZA 1GVIA 1UD5A 1OX4B 3V0UA 5AC8A 2WBGA 1PWMA 3AIQA 4W86A 4AIBA 3FLUA 4WKFA 1R2TA 5C6MA 4PFMA 5FJPA 4Q4SA 5I07A 5BYWA 2XM2A 1MMFA 3W25A 4IX2A 3PNUA 1B3OA 1XCFA 3PZ9A 1Y5XA 3AIEA 1FUYA 1ZBWA 3B05A 2CZ5A 1VFFA 4LC6A 2D3LA 1E71M 3NO3A 1FCUA 2AKMA 4IQJA 4C1NB 2ZRZA 4BS0A 3LEPA 3AFBA 3WQ6A 2QEZA 2GVYA 1R38A 1D8WA 3T4WA 3HPXA 3A47A 4JIHA 2VI0A 3W7LA 1NEYA 3NQBA 3I68A 1V6YA 4GGHA 5CZTA 1LT7A 4IUGA 2XGZA 4J40A 3RPDA 1XFBA 1KWKA 3B8WA 2YCIX 1K9FA 2YB1A 3RLHA 3WQDA 4Z0JA 4B4FA 3RILA 3C61A 1FCVA 1TELA 1IYXA 5IOBA 4PUDA 3AIUA 3PJTA 3WF4A 3VD9A 1O5QA 3EA2A 1V3KA 2VRKA 2QJIA 3QOMA 4I7WA 5HA7A 1W1PA 2Q3RA 2IXVA 4MZ8A 4CLMA 1XRTA 2FH6A 5CAHA 1AD1A 4GI8A 3LS9A 3JRKA 3L0KA 5G4HC 4DBWA 4HOXA 4XVEA 3WH8A 2E9LA 3KVLA 2ZE0A 4XWUA 1OC6A 4BKNA 1AW1A 3W82A 2F2HA 1RSCA 3ITTA 3LD5A 4FMVA 4LAZA 4QCFA 1E1CA 1KNWA 4WY0F 2BP1A 3S4TA 1E5NA 1T40A 4H83A 3P5YA 1VGAA 4XD4A 6REQA 1NFBA 1GQNA 2UY5A 2ZUUA 4NZFA 3OA3A 1JRCA 4I5UA 5HOSA 1CI1A 1X38A 1BWLA 4MSSA 1PUDA 1OFQA 4M80A 2VX6A 5IDZA 4L6OA 4DWDA 2HPMA 2DZUA 2E8ZA 2RGMA 3RPMA 3AHXA 4OHQA 1F07A 3M44A 3B8DA 2VRQA 2CEQA 2W27A 5CSSA 1UPMB 4FZIA 4AIUA 4MFEA 2PB1A 4DF2A 1YBQA 3WD2A 2HXUA 3IANA 4OKDA 3NQDA 3SGGA 1E1FA 2PCEA 2PE4A 1XJBA 5IXEA 1FKXA 4ZQOA 1VZWA 1WXJA 1Q6RA 4X9YA 4FXFA 4J7RA 1XLHA 4JL1A 1HT6A 3ITGA 5E0CA 3VZXA 1T7LA 1W5OA 4BF7A 1IHIA 4CEXC 3CZGA 3C2EA 4UCGA 1I6NA 1ONWA 1VC4A 3HPZA 4ZE5A 4MYXA 1SYTA 4GC4A 4LV4A 3CWOX 3P0WA 1HFBA 4IIHA 1H5YA 2ACQA 4HZ8A 2PD5A 4J27A 1OT1A 2G3MA 1OFEA 1IE7C 3IAPA 1QUMA 1X6UA 1UWAA 2ACSA 4AXKA 3KOXA 3EKLA 4F0LA 4A8RA 3RDKA 3TJLA 1KGXA 1AVAA 2QR6A 3ARQA 3UG4A 3VX1A 2IXUA 4XO6A 4NZ5A 4RCXA 1NWTA 4GNKB 4ZCWA 4RZ4A 1KM6A 3B0VC 3OZPA 3VKDA 3CUHA 3EPNA 5D05A 3STPA 1IXNA 3LTYA 1LQ0A 2Z7KA 3W37A 2UWFA 2J9YA 3GNRA 2PWGA 4H9VA 4PULA 3UXLA 4O14A 1E6XM 1P7TA 4WSHA 1BRLA 2PDGA 3MCOA 3TA9A 6ALDA 3WZ0E 4NI3A 3XINA 3U6WA 1A5MC 2Y5JA 2C7FA 5HK4A 4UTMA 2W61A 4J3TA 5T9CE 1EA9C 2DDXA 5C7HA 3M0LA 1PWLA 4MM1A 3EDFA 2RDXA 2GGEA 2WSKA 5A8GA 2FZNA 4F8XA 4YCPA 1FKWA 3WH5A 2WO5A 1E6SM 1J9YA 4G56A 4K2SA 2OO0A 1M7XA 1YADA 2VWTA 3O3RA 5G2HA 4B9ZA 5LA2A 3VCRA 2BHYA 5FESA 4AMCA 3C8FA 4PBEA 4QEEA 2WCAA 4QISA 2VUYA 1WOAA 4YHEA 4UQEA 1VFSA 2JKEA 3PPHA 3AAMA 1VKFA 3GR7A 4NVTA 2WKLA 3QR1A 4QE1A 4GNVA 5CQ1A 3PULA 4CD7A 4ZO8A 3PB0A 1BXCA 2ZTKA 2PFHA 3VKAA 4O8RA 3W85A 3FCPA 1Q6FA 3S1GA 2C79A 1S38A 2X8RA 4ZOAA 5DBTA 3OYZA 4O0KA 5EMMA 4C6NA 3RFAA 3ZLHA 1FWAC 1QI3A 1Q63A 1JZ6A 2NQJA 1DKWA 3W73A 3QFEA 3DGBA 4B5XA 5DX7A 4H9UA 4JTAA 6XIAA 1Q6CA 1HKKA 1OX4A 1TR9A 1OB0A 5F2MA 3FEMA 1QHZA 3BG3A 1GYMA 3LCFA 4ILSA 1LYXA 4JXCA 2RJHA 1V3MA 2CLFA 2PURA 1WKYA 2YXGA 1VCFA 3AS2A 1KM0A 1EGVA 2XU2A 5AHMA 5I6SA 3WLJA 3W1RA 3TLQA 4U28A 4K8HA 2BVYA 4KW2A 1HUVA 2ZX8A 1H63A 1EX1A 1QHPA 4AWSA 2CC0A 2XM1A 3LPFA 1UWUA 1HJXA 5H2ZA 4C1NA 1ICSA 1AZ1A 2CLIA 3CEUA 1QT1A 2XSBA 2FZ8A 3YPIA 2GLKA 2Y5SA 1T41A 1KV5A 1A5AA 3G0XA 2ONEA 4OV4A 3CWHA 4UNLA 1AK5A 3S3GA 1G01A 1JPIA 2DT1A 1UZ4A 2PA6A 2Y2WA 2PGRA 4UWMA 3E96A 1FP9A 2WLYA 2PP3A 1E0VA 4MUZA 2QJJA 3Q58A 3KOYA 5T9BG 3FKRA 3PY2A 3UY8A 3ZLFA 2QLYA 1QTWA 4R9OA 1TV3A 2I1OA 1VRDA 5HQEA 4H6EA 3G8RA 1Q2SA 2CHOA 4GFSA 4H8VA 3L4VA 2BWGA 1TJRA 3OBKA 1U5VA 4NYUA 4MY1A 1WKFA 3UJRA 2VDIA 2DT3A 2TRSA 4U2YA 2FHCA 5HAOA 1ELSA 3W4RA 4QJ4B 2VL4A 4DJDD 4K1GA 5AB3A 4KCUA 3BMWA 1NELA 1BVNP 3AOFA 3UBPC 1W3TA 1Q6OA 2NX1A 1TWWA 1R9YA 3QTGA 2PMQA 1GONA 4PTVA 3GR4A 2KZHA 4GUFA 2A1YA 3GG7A 3AMKA 1BSLA 1E6QM 1UG6A 2BHUA 3WK1A 3CB3A 2I14A 1OBAA 4HD5A 3TNOA 4WK9A 1W6TA 4RNHA 3PBWA 1LLOA 3WLRA 3GH5A 1QPOA 1M5WA 5CPMA 1M03A 1W1YA 4RPPA 4AD1A 3CMJA 1NP2A 3MBDA 4AIEA 2ZKMX 4AF0B 3HQNA 5DMNA 3NVTA 4LS1A 1XKJA 2BVWA 2ISVA 4IMFA 2QCGA 4HU8A 2D2JA 1WDPA 1LM1A 3NM1A 3CZ8A 5JBEA 4HNNA 3BAXA 3SRHA 1M1BA 3TMLA 2ODOA 3MMWA 4EACA 4L1XA 3U5YA 2VHLA 3PSVA 2HXTA 1O12A 1E72M 4E3VA 2MNRA 3ZSSA 3L2MA 3WDQA 4G2DA 4JYFA 1B3VA 1CGYA 5F7UA 1RPXA 1JZ5A 3AROA 1VP5A 1W9VA 3SCRA 2WKGA 5AHEA 3EMCA 4KCVA 3P7YA 2NX3A 4IF2A 4E4UA 3RO6A 1RALA 3T05A 2YZ5A 2EPKX 2ZUMA 2CHNA 1GT8A 2FZMA 2EF9A 3KBJA 4RV3A 3Q94A 2X1RA 1E9YB 1K3UA 5FJJA 2E5BA 1KLZA 5DCEA 1ALDA 1UQZA 2V5CA 1XYBA 2DZPA 2VC7A 3RLGA 3LRLA 4N9EA 1LWJA 3KDNA 3C3UA 4NZ3A 3AIWA 2NXGA 4A6GA 2B7OA 2EJAA 5CLTA 3P81A 1S46A 5BW6A 1A5LC 4PTXA 4JAWA 3RCYA 1D9EA 2XINA 3GNXA 5I78A 3LM7A 3F03K 3IRDA 2ZC8A 1KFLA 2AQWA 3G24A 1J79A 5FJOA 5A69A 4AHPA 3EDJA 3MZ2A 2O7QA 3UFYA 4DBUA 1J10A 2OB3A 4PZVA 1E55A 2WB5A 3H2AA 3QPZA 2V68A 1A5CA 1W31A 3PVFA 4GX8A 4A3QA 4K39A 3KZSA 3MMTA 1DV7A 3BLPX 4PBGA 4M51A 3KBSA 1NFPA 2GK1B 4Z17A 4P61A 3QYSA 3NL2A 4B91A 4DBEA 4EIVA 3K8MA 2A79A 2X41A 1DJNA 1CGUA 1DJQA 2DIKA 1CLXA 1UC4A 1VJIA 2QGYA 2WZIA 3OEXA 3VDGA 1DXIA 2XHYA 3OU8A 1TQJA 5C54A 4L9XA 1WDWA 2EJ1A 4LB3A 2D2GA 2HSAA 3GC5A 4Y90A 4L7ZA 4O4VA 3ERPA 3WN6A 1M65A 1BYBA 3W83A 2VXNA 3R6IA 4OUEA 1BYDA 3WBXA 4C6EA 1V08A 2J7CA 1A49A 3WDPP 2C19A 3BLLA 4AYGA 4B90A 4LUYA 4JTSA 1KA9F 2ABBA 1ME9A 2HPIA 1PKNA 3GHSA 2ZZ2A 3P67A 4LWWA 3VOJA 2ZWYA 2Y0FA 1POKA 4QDMA 3BCJA 1QCWA 3ARSA 3WBEA 3RCNA 1YDNA 1A3WA 1A80A 3EPOA 2GPTA 4D6DA 3LRMA 4DN1A 3VNJA 3W88A 1ONEA 5IRPA 2OO6A 4HU0A 1G5AA 2RDUA 2A5HA 1V03A 5E5CA 3SUTA 3LMZA 1W56A 3KVJA 4B2DA 1H7RA 1W0MA 2PP1A 1U83A 2WVSA 4Y7EA 2QQ6A 2HCVA 2E67A 1VFOA 4C1LA 1WDSA 4JBRA 4RDVA 3N14A 4MUPA 1G67A 2WZHA 3W2UA 3B0UX 3WEMA 4AEFA 4H00A 1QHOA 4JTQA 2PRMA 2QCEA 2QIWA 4LT9A 1E43A 1V51A 1UZDA 2PC4A 3HIJA 3KHDA 4D8ZA 1BYAA 4AWEA 2HVNA 1OYAA 4W84A 1UH4A 5EYWA 4A4AA 3QSRA 1P0DA 4CCZA 4WY0B 3TH6A 2Y5EA 3RJXA 2ZRWA 4UMBA 4JD4A 4QG6A 1MUMA 4Q8VA 2FB2A 3LENA 4CD5A 3LBCA 3GHUA 2NT0A 1H5VA 2D20A 3NOEA 1B0IA 2DGAA 2G4JA 4E2VA 3LPOA 2VDHA 4PMUA 1HVQA 4I8YA 3PS7A 2RH9A 1KM5A 1FWCC 3DXIA 4FALA 4QQUA 2SFPA 3BGAA 2CLOA 2FJUB 5AYZA 4ENLA 3B97A 3K8LA 5HUPA 3G6MA 3GDTA 1EEXA 2W67A 1Z89A 1DWGM 1GEHA 4RNIA 3ABRA 4H4IA 1I1WA 1OZQA 8XIAA 1QPKA 4JTFA 4ZQNA 5AVNA 4WXZA 3QBUA 5CKSA 1EJ7L 3NAVA 3VU2A 3K5XA 3DZ1A 3IIXA 1R46A 1S1RA 3OYXA 3EX3A 3HB9A 3LCWA 1XIDA 4P5UA 3W6YA 4ZEPA 3N2OA 4GY1A 5K9XA 3EXSA 4OT7A 5M5DA 4U5IA 2ZA1A 4D6EA 3L2LA 1RJRA 4UZUA 3MI2A 1YX1A 4JIIX 5I03A 2XZ7A 6PTDA 2AL2B 2BFGA 3HA1A 1XYCA 1F6KA 2F6UA 2GSJA 4H9MA 3KE0A 1EPXA 2QPUA 5GQBA 1F8IA 3ZT5A 2BHZA 5LZLA 4N02A 5AVHA 5FIPA 4DF1A 2YBTA 3VKCA 3LHTA 1W3LA 2VVNA 4H1ZA 2P5NA 4R33A 1KCZA 2GUYA 4DJED 3KBVA 1GZ1A 3BGGA 4PRTA 3LLFA 3VGBA 3GU1A 4RXFA 4DPQA 1PX3A 3AJXA 2PDCA 2Z1XA 2VD8A 1FWJC 3KVMA 1K9DA 5EU9A 5FSEC 2YIHA 4JIRA 3PUDA 1E5JA 3AYSA 5AYBA 1U33A 5E0KA 1CYGA 3TAOA 1TV4A 1JCJA 4Y2WA 3S42A 4V15A 2O9RA 2ZZ1A 1BQGA 4M3PA 5H8PA 3VVGA 1WZLA 2IKJA 1TPWA 2X7WA 1SFSA 4XUYA 2D0HA 1MFVA 4QLLA 2OR2A 1GHRA 1OX5A 1M53A 5I3JA 1EGZA 1XDLA 2D69A 4G9PA 1Z44A 3WL0A 3SCTA 1XYFA 2HBXA 1EF2A 2QGHA 1LL4A 3EWCA 1Q8JA 3BDKA 1TMLA 3AXIA 2QF8A 3ZLGA 2CZVA 1G7VA 4LVGA 5KTLA 5ABTA 1JGMA 4QR6A 1JDCA 3EXRA 3P80A 1KV8A 3DCPA 3GSMA 1SR0A 4LNYA 4O0QA 3WNLA 4BF5A 3IK4A 3OG2A 1EWEA 5BRPA 3BARA 2DP3A 1HGYA 4GBUA 3UZZA 3LV5A 3ARVA 5JIWA 2VWSA 3IV3A 3VIHA 3ONCA 2W6RA 4US6A 3VABA 1UJPA 1R47A 5LGZA 3VNMA 3BOXA 3DFTA 2YDAA 3MC5A 4WGXA 3MKVA 3ZVHB 3B0XA 5AY7A 1IIGA 3FFSA 2ACRA 2XFYA 5T8GA 1FHDA 3W26A 2GK1A 4E38A 3APGA 1DIDA 1GNXA 3MWCA 3L2IA 2DH2A 1EYEA 4GXWA 4TX9A 3CQ0A 2XWDA 3WLOA 3W2LA 3M7SA 4XD5A 1MW3A 4UTUA 3GRIA 3S5NA 5CSUA 4MHBA 3UZXA 3CUXA 4RE0A 3ITOA 4PYSA 3G6LA 3CIVA 1TTJA 1OHLA 4UR9A 3VIOA 1K8ZA 2TMDA 4ATDA 1XM3A 2ISWA 3ZZ1A 3NXLA 4Y9OA 1SO4A 1GZGA 3NL5A 2E6AA 4XSLA 1RV8A 4ROQA 3PC0A 1UBSA 1JYNA 3MHUA 2XIBA 4MMWA 4H3DA 1R5YA 3NGJA 4GCXA 4ADTA 3WDRA 2AQVA 3U7VA 1B9ZA 5D2WA 3E0WA 1HX0A 1RLCL 4KWWA 1OADA 3URQA 2VEMA 1MDLA 3I7QA 1OABA 5K9CA 1WNOA 3M64A 2HE8A 3LG3A 4HPHA 1A5UA 1G4TA 2GQAA 1R86A 1YTKA 1U30A 4QRNA 3F2CA 1P6CA 2FVMA 5LA1A 2C15A 3SRDA 1K6WA 4JTTA 3EWBX 1D3CA 5G2IA 4NZ1A 3DKJA 5EA9A 3HV8A 2ZDSA 1T0OA 4PCNA 1K77A 4QITA 1WA3A 2XH2A 5FACA 4OTKA 1NDVA 1CGVA 4WD0A 1WOBA 2CLMA 2WSYA 3DESA 3HG4A 3WJWA 3C2VA 3WLMA 3QY8A 1V77A 4IZGA 1KKRA 3C2YA 2X40A 3USZA 4CVUA 3R25A 4Q6XA 4HOZA 3P5ZA 2JEQA 3O05A 2X42A 4OVXA 1O68A 1SM9A 3MA8A 1CXKA 3M16A 3RX3A 3HGSA 3OO2A 4JIPA 1QOXA 4HMNA 3G0SA 1DWAM 2P76A 4B3LA 4WY0A 2O92A 4J3WA 3PZTA 3IVTA 3BVJA 3PJXA 5F2LA 4ASTA 1GG1A 1FWDC 1TE1A 4FXSA 2EAWA 4S3EA 3TYBA 2QUTA 5HJYA 3W76A 4PB4A 2HZGA 1Q7ZA 1OVDA 3HGJA 1PTDA 4HHHA 4D2JA 2XFFA 5D02A 1IF2A 5JBFA 1ISVA 1S5MA 3B06A 2I9EA 1FQ0A 1GVQA 2WJDA 1QNVA 1B9BA 4I9JA 1H49A 1N82A 2EPOA 3RRXA 4R88A 5IBXC 3WQGA 2ZX9A 4XZBA 1DORA 2DEPA 1V02E 3BL3A 2VNCA 3PBGA 3B8SA 4F48A 5I23A 1W1B1 4S38A 1XIJA 5FEZA 2XVKA 5M2FX 2Y8VA 3NEVA 3VNKA 2QKFA 3ABOA 4C6QA 4EK7A 1VS1A 1OX6A 1MW0A 3KRUA 1OG0A 4H9ZA 2Y24A 4H19A 1TV5A 3N15A 5T26A 3TJXA 1C3FA 1FWFC 1F3XA 3NYDA 1KW1A 3C2FA 1Z9AA 3UXAA 1BXNA 4QP0A 3NQAA 2AL2A 3VNYA 3THAA 1TJ2A 3LQLA 5CG0A 4S3GA 1PYMA 4B5SA 4GUGA 1C90A 3B0YA 3CGTA 4WSKA 4AUBA 5M03A 2FJKA 3RMEA 3RX4A 2PGFA 1KCKA 4R5EA 4J4KA 3W6MA 2H90A 1O7AA 4W93A 1XBXA 5FF3A 5J5RA 1E0WA 1WKDA 2ZXAA 1XH2A 2CITA 1J93A 3HO8A 5HNRA 2Q8ZA 1XPGA 2J78A 3PZOA 4MWAB 3P62A 1ZJBA 4QS5A 1UKTA 5FF4A 3QZAA 1C7SA 1MVYA 2V6AA 4XZIA 2YB4A 3PUEA 3WQ5A 3K4WA 2VEFA 5DCDA 3MSDA 2PDYA 4PBFA 1H0GA 1NQKA 3H2MA 1KKOA 2PF8A 2EXOA 1XLEA 2BTMA 3HFYA 2R9RA 4R34A 1NF7A 3BQ5A 4GZEA 4J2MA 2R1PA 3MP3A 1CLVA 4B92A 3VKKA 5JBDA 4Y8FA 3CM4A 2Z24A 4MKVA 1I2RA 2OFJA 1F3WA 5CSYA 3DYPA 5D30A 3IWPA 1U1JA 4MOZA 4IIGA 1TYGA 2YX0A 2ZADA 4YYFA 1YIXA 1KFCA 2C18A 2O0TA 1W5QA 4GQBA 3KBWA 3CMFA 3QC3A 1ZB5A 3DG7A 3MS8A 5C8BB 3CZJA 1K9TA 5HPOA 1QPNA 4ZO9A 3B9DA 4V1YA 5FEWA 4QHRA 3T7VA 4OU1A 2J7DA 3AHZA 4WDWA 1DQXA 2BY1A 5I06A 3ZXWA 4U31A 4AZ6A 3VD5A 4GUHA 3S2LA 3BMXA 4W85A 4AVNA 1DIKA 3ZVHA 3RO8A 3CV7A 2DV0A 4S3BA 5JH2A 5IHRA 2ATSA 3AIVA 3IGUA 1GKRA 3VNZA 1QW8A 1UR1A 1JVNA 1XISA 2PZNA 1KB3A 3VA8A 4K37A 4GX9A 2IQDA 4XISA 2TAAA 2WJEA 5F1UA 4OZOA 4LY8A 3V36A 1CX9A 4FLSA 4KEZA 3W38A 2BVDA 2JK2A 4MKSA 1P43A 3ABSA 1G7UA 3UW6A 1GOOA 3KOZA 4Q4QA 4HSHA 3QV7A 5AYIA 3EEGA 1FP8A 5DO8A 3NQEA 1EJTC 1F3EA 2VFFA 3W7HA 1MFUA 1SZNA 2WCGA 2FGBA 1JPHA 2WHJA 5DANA 1RR2A 4GXMA 3NQ2A 5H8UA 3CPUA 3U2ZA 4OBRA 5I2UA 1MNZA 1U1HA 2J47A 2V3GA 3L4UA 1Q8AA 4Q22A 3EOLA 4N6EA 3DDMA 3PZIA 3ZYZA 1OG6A 2ADAA 3KXQA 2ZVRA 1VQTA 5F2GA 2CFFA 1S2WA 1MZRA 4UFKA 4PEEA 4QXIA 3W29A 3EX2A 4E2BA 3KX6A 4ZFMA 2QAFA 4DJDA 4Z2LA 3GWQA 3LSCA 1FWIC 1HP4A 1A5NC 4H6QA 4RNFA 1Y5WA 2VELA 4K8EA 1DOSA 1SR9A 3AS1A 1MSSA 4UTIA 4LS2A 1J0YA 1G0CA 2BOFX 2Y63A 2WMGA 2WCSA 4F0RA 2Q09A 1EJXC 2DSUA 4HA1A 3P6LA 4YWSA 4IJBA 1MEIA 3VOGA 2VQUA 4A3YA 2HWGA 5CCZA 4U3AA 4HPXA 3H2NA 3WF2A 1WYIA 3EA3A 5C71A 3QPEA 4WZHA 1DTUA 2FDSA 2ZFAA 2RJGA 1EIXA 3M0KA 5HWNA 4AVFA 1KQZA 2GGIA 3KHJA 4LUIA 1KD0A 1JF5A 3CU2A 2QZRA 3CQIA 3IIPA 4IICA 2BZNA 3CYJA 4MY8A 5U4NA 2CLPA 4ACYA 2HTMA 2IKIA 5KZMA 1HL2A 1JXJA 4UQCA 2QCLA 3R2GA 3U57A 1O5KA 4ERAA 1YNYA 3WMCA 1G9HA 3CNYA 5E70A 3W01A 2QS8A 2R1KA 3GTFA 2V2CA 3SUUA 4AD4A 2D2HA 2W0UA 3KTXA 3FVMA 3ANUA 5DLCA 5FCZA 1L6YA 1QRQA 1UWQA 4LB4A 4E4FA 2H6RA 1TR1A 1JZ8A 4AZHA 1YDYA 1RH9A 1H3GA 3F5KA 5DY3A 3RUBL 2JEPA 4DRSA 1DXEA 1L0PA 1IT7A 2WHKA 3JZUA 2HISA 3H6OA 3WH9A 3FNDA 1U1UA 4JQ2A 3SRFA 2EQDA 3M9YA 2HMCA 4LBUA 3GG8A 3M0ZA 4O15A 2Z28A 4PMRA 2AOSA 3TXVA 4IMAA 1QO5A 2YPIA 3R10A 1N8WA 4QQ3A 3GZ3A 4XUGA 3BOLA 2WSQA 3G3MA 3VOFA 2GQ8A 4Z0SA 1XQKA 1OCJA 1R2RA 5G1MA 4G7EB 1HXJA 2Y8UA 2C1GA 1T5AA 1TREA 1TA3B 1MXDA 2CLHA 3MCMA 3LI0A 1DXFA 4IPPA 2E3ZA 3GXMA 1I0BA 3MSRA 3IRSA 3W53A 3E2RA 3VXGA 3T8QA 1LF1A 1DJWA 1GVFA 2D22A 3DIPA 3WQOA 1UUOA 1PEZA 1RCXB 1F8MA 2CBIA 3PWAA 1QI2A 2PD9A 1ADOA 1US0A 3ZJ8A 1D7KA 5EKYA 3CHFA 3CBWA 3SCNA 3MV11 3FA5A 4KMQA 3A4WA 4MWAA 1LOLA 4O12A 3SADA 1PVNA 1Z69A 1TO3A 3N11A 3L0NA 2G3JA 2JF7A 4UC5A 1YPXA 3N9SA 1FH8A 1YNPA 2OOGA 2QCNA 1BD0A 2VGBA 4GI6A 1P0BA 1H7NA 1Q4WA 3G5EA 4ZXLA 4AD3A 4GUJA 5E09A 2DZSA 4LQ1A 4AZCB 1J5SA 3CB8A 3ZIZA 4AEOA 3ARRA 4AC7C 5D2YA 1D7FA 1IQ8A 1JD7A 4K7VA 3KWSA 1QK0A 4X2RA 1KFBA 2PDXA 3DG3A 2MUCA 2FFCA 3CMGA 4LAMA 2BGNE 2G41A 2VP8A 3ABQA 1JCTA 3WK2A 4BJHA 2XUCA 1EDGA 3FX4A 3ENLA 4Q8WA 4KGLA 3TX9A 1H7OA 3OZMA 2Q3OA 4WJEA 1ZAJA 2FTPA 3PG9A 1LQ2A 5DMLA 5CC6A 1T8QA 3IJDA 1MRAA 2WW5A 1IR2A 4UFHA 3L5AA 1UUMA 3O6AA 4JQ4A 1LRNA 3EDEA 3GNPA 2E25A 4FXJA 2CWNA 1FWHC 3BG9A 3NEHA 2VC9A 3ATZA 4DWSA 1XIBA 1TMHA 4O8AA 4PTNA 1X96A 3ZO9A 1Y0EA 2XYLA 4JCLA 4C6PA 4UBPC 1I45A 1PAMA 1HKIA 1VAHA 3O2LA 3PFMA 4JTIA 4TV5A 3J7HA 3NQVA 1X1ZA 4IM4A 2Z2UA 3WNKA 2XN2A 2INZA 2DSVA 3O8AA 3QF0A 1GCYA 4WHBA 3U4FA 3D0CA 3WUGA 3WSUA 4JFWA 1NU5A 3TZNA 2IPWA 3AXHA 3BJFA 3W02A 3H24A 4LRSA 3PUOA 2VENA 1XC6A 3GDLA 1AW5A 1CZ1A 4DY1A 4UTTA 2FPVA 5KITA 2J7FA 3TTYA 2QJMA 1HW6A 2TYSA 3BO9A 3P61A 3QV6A 2XFWA 1FWEC 2HQAA 4Q6JA 1D3GA 1C9WA 3FDKA 1RVGA 5AC4A 4B5TA 4XAYA 3VE7A 4MYAA 5CZKA 2XIQA 4GK8A 3BURA 1G4EA 3L0GA 3W71A 2DVXA 5DRIA 4ZB2A 4RX0A 2NVAA 2OU4A 4LYQA 3WK3A 1YW1A 1TWSA 7A3HA 3WQ4A 5HBFA 4QROA 1ZCOA 4DJFC 4E8DA 2VZSA 2WPGA 2BVTA 4CQAA 2WWDA 4RJEA 1DPMA 1SPQA 3T2OA 2R1LA 1Z7AA 3WEOA 4AWTA 4RLIA 3MANA 2BGQA 3R43A 5LYRA 1OFOA 3W7PA 1SSGA 3VIGA 3OIXA 4C60A 3U2EA 3F1QA 1GORA 2FVLA 4UUIA 4JTLA 3UYIA 3ALGA 4M6PA 5FJTA 4JY9A 4A21A 3EZ4A 4JQAA 2FQIA 2VZTA 2J8GA 1PPIA 4HCLA 1YDOA 1EZ2A 3LGEA 3NPWA 1XLFA 1Q6QA 2C6QA 2XPKA 4CQ8A 5F4SA 4J3UA 2OT0A 3K1GA 1KXTA 3P93A 2NVDA 1PHQA 2YL9A 2X1IA 5BXSA 5KMYA 1BAGA 3ONBA 3SW6A 4HK6A 5I02A 1K4GA 1TQXA 2UY4A 5C70A 2FZ9A 4CN1A 1FWBC 5FA5A 3I3DA 1TV7A 4YN5A 3EA1A 4DAIA 3R11A 5BRQA 2UY2A 4GZJA 3VOIA 3C2RA 4OGZA 3T42A 1DQWA 1TPVA 1A47A 3K8KA 1LWIA 4EXAA 3B8VA 2OYLA 3HQPA 1FCQA 2PDMA 1SJDA 4JFTA 4H8UA 4Q8UA 1KM2A 1SMDA 4X22A 3BMVA 3EX4A 1N7KA 3HN3A 2WZEA 1N2VA 3G1AA 4PCSA 4DJEA 1IWAA 4EVZA 2YL5A 7XIMA 2P0IA 1KGUA 1PXGA 4NXKA 2X30A 2VMFA 4S23A 3KUMA 4M1BA 4DXXA 3L67A 3OLGA 5HQLA 4NASA 4EF9A 2WYSA 3D47A 3L4WA 3UA4A 3ZS4A 1G94A 2RUSA 5D2XA 3GAYA 4AWUA 3TA6A 1E6RA 1L9WA 2FPTA 3CUZA 3FW6A 3POCA 3LERA 3T8LA 4MG4A 3NXFA 1A53A 3GY1A 5G4EA 5BXTA 4G7EA 3WJZA 2NQZA 3MPGA 4AISA 4MZYA 1GJPA 3IGHX 2QVHA 3BLDA 3H22A 1J0JA 1TA3A 5KINA 2YOCA 2WQPA 3Q45A 2QYGA 3VTRA 4HNTA 5IFPA 2PI6A 5GNYA 1EJSC 3JW7A 2VX7A 2B7QA 1PX4A 4I3GA 2YCEA 4WUIA 5DMYA 2OSWA 1XS2A 1UIPA 5F4WA 4GYKA 4TTGA 2FHBA 3REQB 1XLAA 3UQNA 1BG4A 4LFYA 3O6YX 4L9ZA 1IZJA 3UCQA 1A0CA 1OGGA 4QIUA 3AUOA 2GQ3A 4GACA 1B4EA 4XAFA 1KXQA 5TAOA 4DO7A 3GW3A 2HROA 3DAQA 1C93A 3CV1A 1JDAA 2GGHA 2DFAA 1ITXA 5A8PA 5CBIA 1PZ3A 4O57A 2CZDA 3V4BA 7REQA 3WY1A 2A2IA 4AHQA 2WC7A 3M5XA 4H8HA 4YYCA 1TX0A 4M6UA 4V33A 1I0DA 3URAA 5ABFB 3FOKA 3N2XA 3TC7A 3F5JA 4HPNA 1S5TA 3OB8A 1E1EA 4AZCA 2YZRA 3C6CA 3T0CA 1VEMA 3SCSA 1V79A 4JNZA 5CGQA 4ERIA 4LF2A 3M46A 1J0ZA 3WQ8A 2HK1A 2D1ZA 1MUWA 2WNWA 3TJIA 1I75A 1BKHA 1HQTA 2GOKA 1DP0A 4FIRA 3FYOA 1DQUA 3QTPA 3WNOA 3UJ2A 3OJGA 4GGBA 3IEBA 1RP9A 4XAZA 5LIXX 3B9AA 1E51A 2V5JA 2VEKA 3WDJA 5LNUA 2X05A 3S6OA 1XCXA 4I5RA 3BAIA 2E9BA 3P8JA 3CV2A 2CBVA 3GXNA 2WZTA 5BROA 1N55A 1UZHA 3CQJA 3WLLA 3DFPA 5LIUX 2OYMA 2CCRA 5JH1A 1V3JA 4D1JA 1LQAA 2PRLA 3NGFA 3ZR4A 2AL1A 2XDFA 4HVXA 1YHTA 3VI2A 7CGTA 1Z48A 4WJ8A 4AFYA 4KIRA 2BV9A 2C0AA 3WD3A 2QUVA 3NL6A 4UR7A 3KCOA 1UP0A 1XLMA 1ME7A 3RM8A 1YPFA 4L80A 4PTMA 3E74A 3P2VA 2ZUWA 1WUEA 1NDWA 3TVAA 2QPXA 4D6JA 2A4AA 4HCHA 4W8BA 5C9RA 1EA0A 1VBRA 4GI4A 1NP0A 3S46A 2EPNA 3QW3A 1M7PA 3GC4A 1UD4A 3GTNA 1H60A 4S3FA 4H7ZA 1BSIA 3CASA 1NFGA 4IQEA 1XIGA 3OQEA 3RU6A 1RJPA 3WQCA 2E1WA 4XKMA 1XGEA 1WPCA 4GRSA 2F6KA 3MU7A 1JAEA 1W91A 5ABEA 2X2YA 2OODA 4W8LA 3K1DA 3PJUA 2W62A 4UTWC 1W9PA 1QW7A 5FF7A 2YJQA 4IIDA 1S1PA 2PGEA 3ZJ7A 4L4OA 3OLDA 4M1RA 3QVQA 5A6KA 2KX9A 3M07A 2Q8LA 4UTFA 1FY6A 1WDRA 3QRHA 1ZENA 4OJYA 2QNEA 3L5MA 2Y1HA 3EOOA 3LY0A 4GH3A 2DIEA 1REQB 1UR3M 2CETA 2V3FA 1A0DA 3H70A 2V63A 3W2JA 1S2CA 4MNJA 3DERA 3FKKA 4F0MA 1BGAA 2CZEA 4G6CA 3SAZA 1QNQA 4MJZA 5CZSA 3EWZA 3VGEA 3BZJA 2VEIA 3VINA 3T0TA 4ZOEA 3BXWA 3D5HA 4JKLA 1EC9A 2GJXB 4UTKA 3C56A 4TU1A 1JI1A 3ZOAA 3DBPA 4BWLC 3JR2A 1UR8A 1PCWA 1JCMP 3WBWA 3HQ1A 3WDIA 2HEJA 4QSFA 1NSJA 5I3HA 1TMQA 1XL9A 4FNQA 2OWXA 5DELA 5C9UA 2QIIA 1O60A 1XGDA 3EOUA 4C6IA 5LSMA 4LALA 4PMNA 2GSEA 2DZXA 4LUJA 3SZ8A 4C6FA 1MW1A 2XVPA 4KQNA 4DYEA 2VFDA 4K1WA 4YTSA 1LBLA 3LCGA 3MB9A 2J25A 1IXPA 3H53A 5B7ZA 4YNGA 4Q4MA 3N17A 1H2JA 1TIMA 1RK5A 1UR9A 3NDYA 3GQYA 5CEWA 5BXRA 3L4YA 3STCA 4CQDA 4RR4A 1JCXA 4DJDC 4JTUA 2JIWA 4TVCA 3M0IA 3W7NA 1IT0A 1PDYA 3W7KA 4P8UA 3O63A 1GEQA 2WAGA 4XTIA 3G1HA 3R8HA 3S5YA 3LM3A 4XZLX 3RIKA 2AGTA 2Q8XA 3DFQA 5BNKA 3S0CA 1KBBA 3TN5A 1DVJA 3VM5A 1P1XA 1ONRA 1Z8AA 2E7FA 2WPBA 1O5XA 4IWWA 3IUHA 1I8JA 4A3RA 1CEOA 1F2JA 5D9NA 1FXQA 4O19A 3FIGA 3E02A 4ZO7A 1F6PA 4DZAA 4GQQA 8A3HA 2F9RA 3KVKA 2Y7DA 3S1XA 3REQA 4QSHA 4KESA 3GYEA 1TSIA 2J8FA 5H6HA 3UP8A 2WMHA 2V5LA 4JTDA 5LNRA 3QW4B 3T6CA 4CQBA 1TVPA 4GBDA 3R1ZA 4RPQA 5EY5A 1PKLA 4GQRA 2PBOA 4GJIA 1E9IA 4O18A 3AUJA 4L65A 4J3ZA 1YQ2A 1NAL1 2BY0A 4JTCA 1CW2A 1KM3A 2ESCA 2B81A 4QAIA 3PR2A 4N0RA 5LNSA 4DO6A 4IP7A 3LQGA 2XG9A 4W88A 2XZ9A 5ABFA 1TE6A 1HL9A 4N6FA 5C0QA 4NP7A 1ICQA 5MF5A 1UASA 4O1EA 5B80A 6TAAA 2QCDA 2V3DA 3FHQA 3SCUA 4BR1A 3BWWA 3B40A 1VYRA 3WLQA 3GKFA 2C71A 3UPBA 3K30A 3ZT7A 2A3LA 3DG6A 3SFKA 4GXPA 1O94A 2PWFA 1E4IA 4D1IA 1MW2A 1U22A 1J18A 2OZ8A 4FF5A 3GG0A 4Z2GA 4BY3A 2V67A 3E2QA 4QM1A 1SZFA 4MDOA 1P7TB 5FSDC 3SEPA 3MKKA 3N4EA 2PDQA 2XIIA 1OC5A 4LYKA 4ADUA 4E3TA 1NWSA 3Q65A 4AZBA 4PUJA 1SVDA 2JGYA 3VIJA 1TWIA 2PDLA 2OZ3A 2NUXA 3W23A 2E28A 1XBVA 3PM6A 4HSNA 5GJNA 3MUCA 4PB5A 5CPSA 3M0YA 3CO8A 3DFSA 1OC7A 3CZEA 1NY1A 3N29A 3BAJA 1U5HA 3CHEA 1WXYA 2WC3A 3WUFA 1CB7B 1LORA 4QFUA 1SZRA 3TWBA 3NNTA 1K8YA 1IXOA 2PWVA 1OSEA 1VFUA 4FNTA 4J3VA 3L66A 2YCKX 3VNLA 3POHA 1CECA 3D3AA 2F38A 3GS6A 4WRHA 1H7WA 4IMCA 3T81A 1TWDA 4NILA 4H9XA 3TW9A 3TYEA 4JHOA 1BFNA 4ERGA 2VFHA 3B8UA 3L9CA 5HJLA 5D9OA 4EAYA 3TU9A 2WNNA 3RMJA 1UWIA 4LU0A 3SR7A 4YL2A 3NIYA 3M1ZA 3UESA 4FO4A 1V7AA 5REQA 4UOJA 3SY5A 1UMYA 1SQ7A 1Y65A 4JIQA 1RK6A 2Z6IA 1SFLA 3NR0A 2QDDA 3CQKA 3UJFA 3M5ZA 4KRUA 1MQQA 2PODA 2H8ZA 2FMNA 3LZ3A 4O28A 1M7OA 3QLDA 1W3IA 1RP8A 1J11A 4RV8A 3DECA 3V16A 5HUOA 3WD0A 2I7GA 3UD6A 1JCYA 1OFAA 3WD1A 1XIFA 5LA0A 3P14A 3KAOA 1SFTA 2CNCA 2P1FA 3SBFA 2PWDA 1NARA 3KRBA 3RJYA 4POCA 4S3CA 4EAMA 4QLJA 2HK0A 3MSYA 1U2YA 1XFCA 4XQ6A 2EG7A 3EAUA 3VMPA 2H8XA 2DZBA 1XLBA 2X0YA 2WM1A 3CUFA 4H6RA 3IJ6A 2QV4A 1UMLA 1XW8A 1J01A 3S47A 1RUSA 3NPVA 5FF0A 5GJPA 1R30A 1M04A 3CT7A 1WDQA 1TX2A 3UCCA 5BMXA 3PAOA 4BCEA 1ZL1A 2Z25A 1YTEA 4EWJA 1ECEA 4H7VA 1NJJA 4O11A 4CUCA 1KLYA 3W00A 1WDDA 1LT8A 1REQA 3QR3A 1FOBA 1JZ7A 1J2BA 3UGVA 4H8NA 3MHFA 4PRRA 1UOZA 1JYVA 5BRBA