3W7OA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with tt2-3-165
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with TT2-3-165
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7oA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7oA01
1X1ZA 4CQAA 3EKZA 3M6YA 1I2RA 1ME9A 3DHFA 5HULA 5G4WA 1UUOA 2YFNA 3O05A 1VPXA 3PG8A 4LTSA 3DHDA 3LTPA 3TAKA 1PV8A 3KAOA 4LRTA 2E6YA 3T7VA 1Q3NA 1IXPA 3BLFA 3PBVA 5E93A 2NXGA 4NT0A 4BI5A 5FF4A 1VJIA 3N34A 4GUGA 1WBJA 3FKRA 2QKFA 3CWNA 3B0VC 5FEPA 3USBA 4HPXA 4WOZA 1LBMA 4DF1A 4K38A 1DOSA 6TIMA 3O6CA 4JTKA 1K02A 3S5OA 3PBUA 1A5CA 3NG3A 4O13A 4LV4A 3FLUA 1MZHA 4NU7A 1IXNA 1R2TA 1M7OA 4Z1BA 3L9CA 1ADOA 1XBZA 1GTHA 1Q6RA 1VCVA 3GNNA 4XTIA 3TR2A 4N4PA 4CNNA 4CNOA 4H6KA 3IIOA 3MHGA 5U4NA 1G7UA 2ZCGA 3LHWA 4Y9AA 5F1VA 2QUVA 3GDTA 3CEPA 2QUTA 2H90A 4FNPA 1TYGA 2VEMA 4UUIA 3DAQA 4JIPA 3SGZA 1EB3A 1W37A 4A29A 3UWUA 2YW4A 2X1RA 2VOMA 4AB4A 2YSWA 1W0MA 4QITA 3LHTA 1I2PA 1XM3A 3TE9A 3W07A 4N02A 5MHBA 3W76A 4JYEA 3NPWA 1S3HA 3I6RA 3LCGA 3NM1A 4IMGA 1VYRA 3FEMA 4ONVA 2PRLA 2QR6A 4PC8A 3QEZA 3SW6A 3E96A 5D38A 3NYZA 4OV4A 4UFKA 3TMQA 1GVRA 4QJ1A 3MHFA 1UUMA 3NQAA 4RZ4A 2HS8A 4K39A 1R47A 1M6JA 3CQ0A 3QMTA 5J5DA 2R91A 3W2NA 3THQA 1UBSA 2DZUA 1QDSA 5G4EA 3DGRA 2ZQ0A 2TRSA 4AAJA 2GVJA 1A53A 5KZEA 4MIMA 1TPFA 1OFOA 2ZFAA 3RU6A 2ZBTA 1UCWA 5SWUA 3NQ7A 4FNUA 1ZFJA 1JVNA 2QCCA 2YGYA 4GUJA 1L2UA 2J9ZA 1SR9A 5G1YA 2DJLA 3MP3A 4ZQPA 4FNRA 2DZVA 1GYNA 2CLLA 3LGEA 2E77A 3S1UA 2YYTA 3W2UA 3ABOA 3LDVA 3GXTA 5LKYA 2GJNA 4ORMA 4UC5A 3LHVA 3HPXA 4MY8A 4C1LA 5AOUA 3W2LA 2WJZA 2ZRZA 4JYFA 3WK1A 1SZGA 5HWNA 5DELA 3EB2A 3MYOA 1ZAJA 3GKFA 4P61A 1LORA 2G95A 3T44A 2YXGA 3PB0A 1KM6A 1H7PA 1J5TA 4DELA 1VLIA 1GG1A 1LBLA 3NZRA 3Q2DA 2WNNA 4WY0B 1GYLA 3RF9A 5HQEA 7TIMA 4O4WA 1AL8A 1TB3A 3OEXA 3M5YA 3QPYA 2VFGA 3L0NA 1TV5A 2ABAA 2P0OA 3C4UA 1TCDA 1FY6A 4MKNA 2V2HA 5FEZA 1Z48A 1H7NA 4EVZA 2NX9A 3W1PA 3PSVA 2A6LA 4BI6A 1BKSA 3TQVA 2F84A 3OBKA 4UR7A 2X1SA 4RV8A 1OVDA 3R89A 1W3TA 5AFDA 2ATSA 3THAA 4FNQA 3BLIA 1Z41A 1XXXA 1KM3A 3MP5A 1B3OA 2H8XA 2I1OA 3T78A 4N9EA 2VFHA 2NV2A 3TUUA 1EPXA 2JGQA 5FF0A 4HNNA 2YDAA 1WA3A 1X6UA 4JNMA 4Y96A 1TO3A 4MLRA 2FPYA 1TPH1 1OFPA 3HG2A 3NL2A 1BEUA 3AJXA 3BW3A 1M5WA 1TPUA 4K7VA 3W2JA 1V7YA 2TSYA 4NNAA 4WXZA 4ADTA 4O1BA 3M1ZA 4RKAA 3LCWA 1YDNA 2WKJA 1OYCA 3O16A 4TO8A 1KLZA 3UWVA 4N9BA 4AH7A 1IF2A 3IVTA 4UR8A 1TQJA 4TU1A 2NZLA 1F6PA 4JTLA 2B7PA 5BRBA 3LB0A 5TIMA 4IJBA 3NXFA 1R2SA 3G22A 4FXRA 3M43A 4WX2A 3DENA 4MY1A 5HWMA 5BOOA 2A7PA 5CPLA 3EWBX 1ML1A 3PG9A 4GE8A 5KSWA 1GQNA 3LXAA 3BO9A 2E6FA 5FF3A 2P1FA 3PBWA 5AYXA 2Y7DA 4E38A 3MYPA 3R5EA 2NWSA 1ME7A 3C2OA 3LCIA 5CG7A 2CLKA 3STFA 4MOZA 1L6WA 1YADA 3TMLA 1H7WA 4MFDA 3G3DA 5HINA 3T4CA 3QC3A 1FXPA 1MEIA 3I7QA 2B7NA 3FS2A 5KITA 3VFLA 1YXYA 3F03K 1GVFA 4OE7A 4JY9A 5F2GA 4R34A 1VZWA 2A2IA 3BPWA 3TKFA 1ZCOA 2AAMA 1QMLA 4Y6GA 1H7XA 3P5YA 2ZZ1A 3NQEA 5AB3A 3W6YA 3P8IA 3GKAA 3UY7A 1Z42A 3N9SA 3GZ3A 1TPB1 3KVJA 3HPSA 3TAOA 1AG1O 3W2MA 3U6WA 4J9JA 3O6DA 3MP4A 1T96A 2FTPA 1AW2A 1HTIA 3CLMA 1ME8A 4LU0A 4A2SA 4AHQA 3T55A 4O19A 3NL5A 3W73A 5DXYA 3BG9A 3HB9A 1MO0A 1VQTA 5LZLA 1N8FA 4K8HA 3LX9A 3F4WA 4DPPA 2YPIA 1JUBA 2VFEA 4FXSA 4IUOA 1H61A 3AO0A 3WFAA 2V5BA 2NXIA 2ZA1A 4K37A 3PSWA 4X3ZA 1O5XA 2A85A 1IGSA 1ZNNA 2CZEA 4TMBA 2ZZ6A 5K4ZA 3W1RA 3SGUA 4FX7A 1NF0A 2E5BA 3KRZA 3E02A 4JYDA 3GR7A 3P84A 4ZQOA 3MHUA 1OFDA 3N3MA 4MPQA 1SZNA 1T99A 3RFAA 1L6SA 1PHWA 2Z2UA 2FFCA 3L5LA 3TSDA 3SY5A 4WZHA 8TIMA 2YW3A 5K2ZA 5G2HA 3KHJA 1EP1A 1OF6A 4M19A 1DKWA 2FDSA 3SFKA 1AL7A 1WOBA 4AHOA 4Y90A 4LC6A 2CLOA 1OFBA 1VYSX 1DHPA 1QR7A 1TTIA 1XFBA 3DZ1A 1VCFA 4S2CA 4LV9A 3FIGA 3N73A 3B0PA 3LBMA 3QJAA 5AYZA 2OZ0A 4GUFA 2BTMA 3HQ1A 1SO3A 2H8ZA 3BG5A 3TCEA 1K8YA 3DXIA 4Q4KA 4NQ1A 3C6CA 4U4MA 4HT3A 2BXVA 4HHPA 2J9YA 2YFOA 4G1KA 1AK5A 3YPIA 2QAFA 1XUZA 2JKPA 4LWWA 4IMEA 3O07A 3W1XA 1OK6A 2QUUA 2NXHA 3CM4A 3L2IA 3P67A 1GVQA 2G97A 3C0JA 3M5XA 5F2MA 5K4XA 1I2NA 3UWYA 4FX6M 4O1DA 3ELFA 5LNVA 3NVTA 4LVAA 3B0UX 2J88A 4YLWA 5AHMA 3P8JA 2VEKA 5J5RA 2W0UA 3ZWSA 2ZTKA 4O17A 1OFQA 3VE7A 3EX4A 3PS7A 5DBUA 4ZVJA 2CLIA 4IGHA 1W5OA 3PVFA 5HJLA 5F4XA 3GYEA 4QIUA 3L0GA 3NEVA 3IGXA 5D32A 4O57A 4JD4A 5EL1A 1OX4B 4R53A 1YYAA 3W1UA 2NUXA 4GNJA 3W84A 4FX8A 3P74A 3LXBA 1B9BA 3BV4A 3EXTA 1LRQA 1LTDA 4XZ9A 4YXGA 3OIXA 4KFOA 3W7JA 1LOSA 1ZALA 2A7RA 5EMUA 4N4QA 4QM1A 3C3NA 3WK0A 5LHFA 1CX9A 4FIQA 1ONRA 3W7GA 2W79A 5IBXC 5ABTA 5A8GA 1S5VA 5KTLA 3KRUA 1XBYA 1EX5A 4QNWA 5BW6A 4ZMGA 1HG3A 3HGRA 2VELA 4FO4A 3W9ZA 4O54A 2A5HA 3C52A 2PRHA 3PM6A 4O15A 2VFFA 4A2RA 4OT7A 3EWXA 3TIMA 4KKXA 2UV8G 2V9DA 3TW6A 1RR2A 3G1YA 2B4GA 3M47A 3PAJA 1O60A 2Y89A 3QMSA 1WAUA 2XN0A 3TV8A 1W5PA 3GIYA 1TTQA 2YX0A 3GDKA 5K3VA 1C9DA 3S42A 4UNKA 3GAKA 1OFAA 4HNTA 3L5AA 2DZXA 5D03A 3TU9A 3NR0A 3R2GA 4NX0A 2YCEA 1VCGA 2G96A 5HMSA 2ATMA 1TRDA 2X2GA 2NX3A 1EIXA 1KM0A 1X8FA 3WJWA 4BFAA 5IM51 5HR7A 2CFFA 3M5VA 1FXQA 4UTMA 4YCPA 2C16A 2R8WA 2V30A 3EXRA 2D73A 3CEUA 2ZZ5A 2Y70A 4UFJA 2Y7EA 5D2WA 3S5ZA 1G69A 5LGXA 3FKKA 3L0KA 2X30A 1GOXA 2I9EA 1CW2A 5HWJA 4TIMA 5FF7A 3NL6A 1PCKA 3Q37A 1KV5A 4PODA 3IGUA 3G1XA 4UTLA 5FI8A 5I3GA 4UCGA 3H54A 4MZYA 3FA5A 3LCXA 4O1AA 3LI1A 1KBIA 5HNRA 1O4UA 4HKPA 1G4TA 2BX7A 1B57A 3G1DA 1WX0A 5L6UA 3ATYA 1U5JA 3W1QA 4NZFA 1JQXA 2XN2A 3NQ2A 1PL9A 1HFBA 1M7PA 3GDLA 4QQ3A 2ZZ7A 3WK2A 1SZEA 4AWTA 2XN1A 1DL3A 2C18A 1TREA 4HN4A 1ZENA 3C2EA 4XTDA 4IX2A 5DY3A 5D30A 4X22A 1DJQA 1KM2A 3UWQA 3FJLA 2C15A 5I3KA 4O50A 1EWDA 3DI0A 3GXNA 3G24A 4BR1A 2WO5A 4JS3A 3C2VA 3G0XA 1JRBA 3LI0A 3O8AA 4N2YA 4R33A 4XWUA 3S5NA 2Y6ZA 1RVGA 4UFIA 1A5SA 3NZ1A 3HOJA 4M6QA 5AHNA 2B7QA 4A21A 1NF7A 1QPOA 1KA9F 4O53A 4UFMA 4Q32A 3UWWA 4MFEA 1KFLA 5D2YA 1IIGA 4NJGA 4JTFA 4UTTA 2C3ZA 2FPVA 2VFIA 1DV7A 4LS1A 3EWZA 3NPUA 3P7YA 3W85A 2WOQA 1KBJA 4I7VA 2W6RA 3NL3A 4UMBA 5HUOA 1OFRA 4RZ6A 1O5KA 1RD5A 3W86A 1JCLA 1FWRA 5DCDA 3TJXA 3STCA 5KINA 2OMAA 3VKJA 2E09A 3LHZA 4K6AA 3UNDA 1EA0A 3LV5A 2EKCA 4JDYA 1FX6A 2ZZ4A 2RDTA 4GFSA 1YLVA 4ZL1A 3HGSA 1Q6OA 4CQ8A 3A23A 4HPJA 1F5ZA 1N55A 1G4SA 1TQXA 4LUJA 4A3UA 5LNWA 2TMDA 2DU2A 2A7NA 3PUEA 4GWEA 4HSNA 3U8GA 5CGQA 1YTKA 2VKZG 3UZ5A 1Q45A 3ABQA 3MW7A 4NNBA 2JKEA 2Q3RA 2QDGA 4JTJA 2DZTA 4TX9A 1LBFA 1WDWA 3M5ZA 3NGJA 1DQXA 4LOCA 5DCBA 1TPVA 3ANYA 3PF3A 3CWOX 3UYCA 3IVUA 3FFSA 4DBDA 4E2BA 2ZRWA 3P61A 4BWLC 1LROA 4CQ9A 3QM3A 4LS0A 3EWWA 3Q94A 1PS9A 3S1WA 3A5FA 5BNKA 4IXXA 1I4NA 3G1FA 1LLZA 3M7WA 4LY8A 1NEYA 4FNSA 3NA8A 4N6EA 3W83A 3EX1A 4OHQA 5F4WA 4UTKA 4H3DA 3NPVA 1NAL1 4NNCA 5EPDA 2GUUA 4Q33A 4FHAA 3N14A 2H6RA 3JRKA 2C14A 4CCEA 5F2IA 1XKYA 3NQ8A 5TQLA 2V82A 4I7UA 2GQ8A 3NO5A 1W5MA 1BTMA 2J24A 3PULA 1EEPA 4CCDA 1H1YA 1TTPA 3IV3A 1L6YA 3KXQA 3M41A 4NXSA 3V75A 4UXDA 3LRMA 3RNDA 3S8HA 2Z1BA 4WOQA 4AWUA 3NQVA 3QZEA 1OYBA 1WYIA 3O6YX 2ZTJA 2Y7GA 1K3UA 4UFLA 2VXNA 4N6FA 3QF0A 2Q8LA 4XQ6A 5LNUA 4X2RA 3FYOA 3HJZA 1YPIA 4O16A 3W7KA 1EUNA 5LNRA 3HO8A 4ZQRA 3DKJA 4UTWA 1XCFA 4AVFA 5EYWA 2CZFA 2GQAA 4PEKA 5E1QA 3ATZA 1TMHA 1T0OA 1PIIA 1NFBA 3CHVA 4JXCA 3CB8A 1WBHA 1YDOA 5BMXA 4O0ZA 2BZNA 4A22A 4S2BA 3VI2A 5L9FA 4FNTA 3TROA 3TFCA 1P5BA 2QDHA 4E2DA 1ZY9A 4JTIA 3CTLA 1H1ZA 1X1OA 3HPZA 3W7DA 3F4NA 4KFPA 4I7WA 1AMKA 5K9CA 3SJ3A 2PCQA 4BI7A 3EX6A 3MI2A 5KZMA 3OVQA 3TA6A 4NX5A 1F6KA 2CZDA 2V2DA 1KFKA 5IBXA 2ALDA 1IIHA 1K8ZA 5D09A 4LC8A 5K7JA 4O14A 1LOQA 3O06A 2TPSA 1ZHAA 4NUWA 1TJRA 3W23A 1I2OA 3UPWA 4LNYA 2VEPA 3W70A 1FCQA 1RZMA 2EAWA 4ALDA 1XI3A 1NSJA 3MI6A 2GVGA 2DJXA 1DBTA 2VC6A 3T40A 1X7FA 4ZZ9A 3WK3A 3R8RA 4FB7A 1TPWA 1EP3A 3P80A 4JTHA 2NX1A 3ABSA 2A0NA 3TQ0A 4MJZA 4QISA 2GQ9A 3C8FA 2WV8A 4BF9A 3UPBA 1A5AA 1P1XA 3H55A 3B04A 3MWAA 2ZA2A 4EOUA 1P0NA 3MBDA 4XBSA 4UTIA 1FWWA 3NQMA 4WJEA 1QCWA 4DF2A 1OG0A 5LHEA 3W7RA 3WJYA 3B03A 3OVRA 1B4KA 3SSJA 4Z1CA 1DORA 4GUIA 2J27A 3IVSA 1QPNA 4UTHA 1W3IA 2X1UA 4IMDA 1F7BA 1XL9A 1EWEA 3IGSA 4MUZA 3ZFHA 4MLJA 4DO5A 5K9DA 3EX3A 5CZJA 1GVSA 5AYYA 1GTEA 1YXCA 3PWAA 1LDCA 1FDZA 1SUXA 2E5DA 3GAYA 3R13A 3V1PA 4OQVA 4WXYA 1TRIA 3RLVA 4PH6A 3M44A 4KWVA 2NV1A 4N9DA 1K8XA 2QJGA 3W87A 4H4IA 4O4VA 1G4EA 3W71A 1R30A 4KFNA 5CPNA 2JKAA 5DLCA 3DFSA 1WQ5A 3EXSA 4HNVA 4JGDA 3NAVA 2GOUA 4POCA 2WQPA 3KVLA 4L4LA 5I3FA 4NZJA 5AC6A 1W1ZA 1JCYA 4JX6A 3B8DA 4DXVA 3G8RA 3G8EA 3TSBA 1F05A 3LV6A 1RQEA 3PB2A 2FLIA 1ICQA 1VHNA 2Q3OA 3W7LA 2VEIA 1FWTA 3JR2A 1GJPA 3E12A 3NNTA 4JR5A 4K8EA 4O0KA 1XBVA 4LVFA 1L9WA 3EKLA 3VCRA 2E1DA 4JTSA 3TW7A 2BLEA 1TPDA 1MXSA 3LOTA 3W7NA 1JULA 5DBTA 1SU5A 2F7FA 1K7XA 4WUIA 3TFXA 3S1VA 2QJHA 1OF8A 3W1MA 1EP2A 3HG3A 4NVTA 4OWGA 3A21A 3MUXA 2CWNA 3B4UA 4WQ6A 1GEQA 3M16A 5CZ0A 1JRCA 1W5NA 1J4EA 5CPMA 1A50A 3G1VA 1KFJA 3G0UA 2QCFA 1KTNA 3BK0A 1VLWA 3GVGA 2QCHA 3LHYA 3TK7A 1Y0EA 1ALDA 3QH2A 1F76A 5C55A 1I8JA 1N7KA 2C0AA 3TQKA 4MYXA 4IMFA 3NQFA 2ZYFA 3SIZA 4RXGA 4IOTA 3W7PA 4CLMA 2O7QA 3MMTA 5G1TA 1QWGA 1QO5A 2RKXA 2YR1A 1OX5A 3LTYA 5F2LA 4JTTA 4MZ8A 4UNLA 4IPJA 4Z1AA 1FDJA 2PRMA 1SZFA 2HMCA 4ADSA 4O1CA 1H7OA 4ZQCA 3SI9A 1JCXA 1YPFA 2WSRA 1W3NA 3LERA 4JIQA 2ISVA 4MZ1A 5C2XA 4DO4A 1JUEA 4JY8A 1OK4A 4PTNA 3C61A 2Z6JA 1ZJIA 3LLFA 3WJZA 4K36A 3IRDA 5CZTA 3IIVA 4EF9A 2AQWA 4UMAA 2QCMA 3LBCA 2C19A 1UB3A 4O52A 2XFWA 1TV8A 2EF9A 2QEZA 1VGAA 2ISWA 5H2ZA 3GXPA 1MEWA 2QF7A 2GVLA 1FDYA 1YTDA 3G1AA 2R14A 3LRLA 3SZ8A 2R94A 3LM7A 2OT1A 3L68A 1FCBA 3RMJA 3S0CA 3PBYA 2V0TA 2Y88A 1LLWA 4DEFA 3UY8A 4DPQA 3TH6A 1SO6A 3HMJG 3W7HA 3LCFA 4JTEA 3QW3A 3TC7A 1O95A 5D2VA 2RHGA 3Q58A 5AN7A 1RV8A 1BWKA 1G6CA 3GR8A 1G4PA 1XUUA 4YL2A 4BWLA 3QMRA 4I9AA 3K30A 1HO1A 1XBXA 3I65A 3QFEA 3P82A 2B7OA 3L66A 3BARA 3DBPA 1V5XA 4ICNA 1KM4A 2WSYA 3ZWTA 3A22A 4QSHA 3BGJA 1SW0A 1PVNA 2GJLA 4MYAA 1FUYA 1KFCA 3DFPA 4AF0A 1SFJA 4Y8FA 2CLEA 4FEZA 1LP6A 3W88A 1P4CA 2J9XA 1YXDA 1MSSA 4GC4A 1QOQA 2WPBA 4XKYA 3LTSA 5D05A 4AXKA 2ZRUA 3W3OA 3P81A 1UJPA 3BW2A 3LLDA 3OA3A 4P2VA 1JCMP 1KTBA 5CSSA 2QCEA 1QAPA 2JGYA 4EWND 1W8SA 3PUOA 3E0IA 4JX5A 1K03A 3QW4B 1TIMA 3W7QA 1D3HA 1THFD 2FQIA 1SFLA 5HUPA 4BK9A 4GUHA 2CLMA 2ZRVA 3G0SA 4M6VA 2TYSA 3W1TA 4KWWA 3OG3A 2QCLA 5BMWA 3KVMA 5T26A 4RZ5A 1T8XA 4YMZA 3UD6A 3L67A 3TDFA 3GK0A 3WJSA 3G1SA 5U7SA 4JX4A 4CNPA 1GWJA 1H51A 2QCDB 3MBFA 2HSAA 2CZ5A 2Z0IA 1GG0A 4D2JA 3PUDA 1GVOA 2DZPA 3HBLA 3VE9A 3EWUA 4LW7A 4RJEA 2E68A 2FIQA 4AWSA 1PE1A 2ZDRA 1ZAIA 4ML9A 1K7EA 5AC7A 2ABBA 2DZSA 2ZRYA 1VH7A 4PFMA 1S5WA 1JCNA 5I3IA 4X9SA 1I45A 2QCGA 3DFQA 1Q6LA 4ORIA 2P10A 4RX0A 4YWIA 1LZOA 1OX6A 3HGOA 4K7YA 1GPWA 1QPRA 2V8ZA 3QQ0A 3B05A 2CLHA 3W1LA 1VRDA 3LCLA 3MO7A 3TX9A 1FCVA 3QRHA 4HIBA 2KZHA 3W7MA 4PCFA 4AEOA 2X1TA 3CT7A 5AHFA 3KVKA 1IXOA 4UIOA 3QSTA 5CSRA 2V81A 4JICA 1JUKA 3DU0A 3ZS4A 4GXMA 4QNEA 2RFGA 4LS2A 1IXQA 3QQ1A 3W7CA 5CZSA 4ADUA 3CC1A 4O8RA 1SO5A 3R12A 1JQVA 1H5YA 1KM1A 3RLUA 3BGGA 3P62A 3STGA 3INPA 2C6QA 3HIJA 4WD0A 3W22A 2QCDA 3GNDA 4DBEA 4MY9A 1D3GA 1Q6QA 1KV8A 1GT8A 2Y63A 1TPEA 1DQWA 3TXVA 2NWRA 1C8VA 2B0MA 3B06A 4AHPA 3QYQA 2EHHA 3UWZA 1LOLA 4W9TA 2O7SA 5C54A 2ZRXA 2VENA 3GLCA 5KZDA 1W5QA 1KW1A 1SQ7A 4NJHA 1ZAHA 5FF2A 1SSDA 4O28A 3ZR4A 1KLYA 1LYXA 3HG4A 5C5YA 3LRKA 1WV2A 3W2KA 3A24A 3IIZA 4U28A 3GDRA 4JTGA 1H7RA 1OJXA 1G67A 1R46A 2WSQA 1XC4A 4CCCA 1QOPA 1RPXA 3KFTA 3BG3A 4TMCA 3DKLA 2RH9A 3EWYA 1SSGA 2X16A 4IPIA 5D2XA 3L65A 1WOAA 1GZGA 1Z44A 2E6AA 2RDWA 3S6DA 4WY0A 3QSRA 4OU1A 2YZRA 3UQNA 5D04C 3N2XA 4IMCA 3OVPA 3NDOA 4DQWA 2OJPA 2ZZ2A 1SO4A 1UASA 1VYPX 4RLIA 3TXZA 4MJMA 2Y62A 4HNUA 1F2JA 3LXCA 4JTUA 4FIRA 5G5IA 1KFBA 4UTTC 3S9YA 2WNZA 2YYUA 3NQ6A 1PHQA 1YDVA 4LT9A 1HO4A 4UTUA 1DVJA 1LM1A 1OHLA 3C2RA 5K9XA 1OYAA 2RDUA 5D37A 3NQCA 3BLEA 3CIWA 2WNQA 3L21A 2E6DA 5FEWA 1LRTA 4DO6A 3W72A 1W31A 3PY2A 4EIVA 1JR1A 3STEA 1SPQA 5CPOA 3TSMA 4YCOA 3CPRA 4GJ1A 3TJLA 3H53A 2JBMA 3M9YA 1W56A 5DCEA 3DFOA 1RQHA 3DFTA 5G2IA 5H91A 2V5LA 1KFEA 4M5PA 2ISSA 1OABA 2QCNA 3G18A 2Z6IA 1LCOA 5EKYA 3UZJA 3W75A 3E9AA 4RK8A 3NQGA 4IX0A 1FWNA 3QPZA 4UTJA 4XBKA 1JCJA 4TR9A 5GVJA 3GX9A 1B4EA 4Z1DA 3F1QA 2I14A 5TBOA 2DP3A 3KOFA 1U83A 2PURA 4NJJA 2FJKA 4NJKA 2HS6A 4XUGA 2CW6A 1PCWA 4IWWA 2FPTA 2ZZ3A 3WJXA 1BWLA 2VFDA 2J6XA 3N19B 4GRSA 4PL1A 3I7RA 3W7OA 1QPQA 1SW7A 5AC8A 5HR6A 1NVMA 3E49A 2Q8ZA 4UFHA 3G3MA 2CU0A 3UXDA 3CIXA 2Y85A 5G2WA 5DY2A 1HL2A 2H3DA 2NUWA 5LSMA 3U2OA 2NUYA 3OHIA 3P60A 1ICPA 3I7SA 2G5WA 2A21A 1TPC1 3EEGA 3DFNA 3W1AA 4NXKA 4QAIA 3M0ZA 1SW3A 1AW5A 5A5WA 5D02A 3I68A 3A9IA 5DXXA 3SECA 3LHUA 3KX6A 5F1UA 1VR6A 1W54A 5I3HA 2A6NA 1TJPA 3TC6A 2GPTA 5EA9A 3BW4A 4Z0JA 2QJIA 2V2CA 1LRNA 2E5CA 3PC0A 3DH7A 2Y7FA 1KTCA 4RR4A 5AHEA 2FB2A 4S1FA 3CU2A 3C2FA 4JEQA 2IQTA 1A5BA 3HGJA 4JN6A 1E51A 1JJKA 1QFEA 1VS1A 2H3BA 3W7IA 3NM3A 4M7TA 2DORA 2FB3A 3NQDA 1VC4A 2BWGA 4OGZA 1H50A 4O12A 1MEHA 2EPHA 3W1NA 4M7SA 1K7FA 4LVGA 3C56A 3G1HA 4UTWC 3UXAA 1EUAA 4IXHA 3O15A 5AHLA 1F74A 4Z0SA 4GBUA 3GB6A 1D9EA 3FJ6A 5EY5A 2A4AA 1F73A 4RCXA 5CKSA 3NOEA 4O18A 4R7JA 3NPXA 2DZWA 2EGZA 1TV7A 4C1KA 4OV9A 1FWSA 5D2TA 4PL2A 3HG5A 2OCZA 1XDLA 2NLIA 2A1YA 3VNDA 2Y61A 3HF3A 2HTMA 1HUVA 2OX1A 3IEBA 4NJIA 1C29A 4ZQMA 1P0KA 1QNVA 3D0CA 1ICSA 1QO2A 4DF0A 3JS3A 5FEXA 1AW1A 2C1HA 5LGZA 1KM5A 1R2RA 1H62A 4HSOA 1H60A 5LNSA 1WXJA 2PE4A 4L4MA 4EF8A 1TTJA 1YTEA 2AGKA 3KRSA 4OBTA 2CLFA 1I2QA 3O63A 4ZQNA 2LLEA 3O1NA 3RK8A 1S5TA 2OT0A 3ABRA 3IIXA 4M6PA 5C6MA 2JK2A 4LVDA 3SR7A 3MJYA 3W7EA 1G7VA 3DI1A 4PA8A 3A5VA 1CI1A 3P5ZA 4LVBA 3L5MA 4E0CA 1OFEA 5KMYA 3FOKA 4O11A 4FF7A 2C13A 1O94A 4UMCA 1FQ0A 6ALDA 1TSIA 3S5YA 3EX2A 4JDBA 4O10A 3BVJA 3PR2A 3W74A 5D33A 5E0KA 3S1XA 5I3JA 5FESA 3TNOA 2QAPA 3LCHA 1FBAA 4B5NA 4N9CA 4AF0B 3GDMA 1H63A 5DN1A 3N9RA 4Z08A 4RXFA 1RQBA 4AMAA 4LRSA 1OX4A 1FCUA 5F4SA 1DJNA 2BSLA 4IQLA 4XKYB 1XDMA 4LUIA 1VHCA 4WY0F 5EBUA 1J2WA 2PC4A 5AHIA 3MI3A 3FYPA 3IIPA 2ZA3A 4MVAA 3N2MA
chains in the Genus database with same CATH superfamily
1E6ZA 1I0BA 1CXHA 3EKZA 1GORA 1L6FA 4XIMA 3M6YA 5I3DA 4QAWA 3LTPA 1PV8A 3KAOA 3DFYA 2CYGA 2YL9A 1Q3NA 3CQHA 3NO1A 1FWCC 4NT0A 4IPLA 4AUBA 4F66A 1MFUA 2J8GA 2V5JA 2YCJA 5A2CA 2HE8A 2XISA 1WBJA 4DJFA 3FKRA 1NM9A 2BMBA 3CWNA 4PCTA 4YHEA 1LBMA 3PUGA 4GA8A 4QEEA 3FDGA 2AKZA 5I07A 3NG3A 4LV4A 2YBTA 2AKMA 1R2TA 3U5YA 4HPHA 4HTBA 3RILA 1Q6RA 3TR2A 3T05A 2YZ5A 4EXQA 4CNOA 2ZCGA 3LHWA 2PD5A 3E2VA 3CEPA 2QUTA 4Q8OA 4FNPA 4U3CA 2QF8A 4UUIA 3DAQA 5A6BD 3UWUA 2VOMA 2YSWA 4XZNX 3WMSA 2AL2A 1XWYA 1I2PA 4NRSA 3W76A 1LUCB 2RDXA 4IMGA 2HNEA 4PC8A 2FZMA 2X7VA 4NYUA 4GGBA 3CJPA 4LY4A 2XWDA 3GS6A 1UUMA 3MHFA 4RZ4A 3R8GA 1R47A 4I5RA 1EJXC 1M6JA 3WDJA 5J5DA 2R91A 3IJ7A 3LA4A 1UBSA 4FK9A 1E0TA 5G4EA 5C9RA 1XGZA 1M65A 4AAJA 2X2YA 1TPFA 2CITA 2JEQA 1UCWA 1VD6A 5SWUA 5H8PA 4JNZA 3GFZA 4F2BA 1TUFA 2P8CA 3CZEA 2J9ZA 1SR9A 3EWDA 2BOEX 3GSMA 2JE8A 2CLLA 2E77A 3LDVA 3C3UA 4YYCA 4JKKA 4B91A 2WMHA 1AA1B 2GJNA 4QEHA 2BXZA 4UC5A 1NDVA 3HPXA 2ZRZA 3SJNA 3WK1A 1SZGA 5DO8A 5HWNA 4DJFD 3WD0A 3GKFA 4XD4A 3PB0A 2HPMA 1U1JA 4WY0B 7TIMA 1CXFA 1PPIA 1TB3A 2MNRA 3T0AA 4IG2B 3GHRA 1W6TA 3ARUA 1C8XA 2F6KA 7PTDA 1QOXA 1TV5A 1W9BM 2R1PA 1Z48A 4PBFA 1H7NA 3VNMA 5HATA 4IGNA 5CJMA 2DY3A 4GKTA 2R9RA 2F84A 3OBKA 3DECA 1TMQA 4RV8A 1W3TA 2ATSA 5LA0A 1F8IA 1KRMA 3UFYA 1Z41A 2CXGA 1KM3A 1B3OA 2B81A 2DSUA 1BWVA 4N9EA 1KRAC 5ABEA 1GOQA 2DSZA 2VFHA 4GC3A 4JNYA 3NDZA 2DQWA 2YDAA 5FF0A 2WBGA 4GXPA 1SYTA 1TPH1 2WCSA 4GNKB 1E71M 1MQQA 1OFPA 3HG2A 1BEUA 3AJXA 1M5WA 2C8NA 4GOAA 2OYKA 4ADTA 3UR8A 3GBDA 3GNPA 3WENA 4QHRA 3LCWA 4WKFA 3ARVA 1YDNA 3FVMA 5I02A 3AUOA 2A79A 1R38A 1IF2A 4UR8A 4TU1A 4D1IA 3VNLA 2B7PA 3KOWA 1DIEA 2XSXA 3DYMA 4S3CA 2OZTA 1EPVA 3NXFA 3G22A 4FXRA 3UJRA 2WHLA 3VNZA 4MY1A 4CU7A 4AWEA 2A3BA 4Q8MA 1XIHA 1PSCA 3OBAA 5CSYA 2NWSA 1ME7A 4F9JA 5MF5A 5CG7A 1ISVA 1B30A 1QXLA 2XH2A 3TMLA 3H8AA 4MFDA 1MXGA 2CBJA 2Z26A 3PZUA 3I7QA 4FI4A 1W9UA 3FS2A 2WHJA 1W3KA 2G3MA 1LQ0A 3UG4A 1OD8A 4R34A 1RXOB 1VZWA 1MQPA 1ZCOA 1T6MA 2AAMA 2VRQA 2R1LA 4LANA 3P5YA 1JAEA 3NQEA 4H9VA 2YB4A 1ZGDA 2V68A 1UR4A 1TPB1 3HPSA 4KRTA 3A47A 4CD5A 3CUHA 3T6CA 2FTPA 3A4WA 1DXEA 4LU0A 1YBQA 3T55A 2IUZA 4O19A 3C86A 2VJXA 1FHVA 4E3VA 3KE0A 3HB9A 2BV9A 3WF2A 4E4FA 1VQTA 3A3HA 3MCMA 1TWIA 3V3WA 1JUBA 3GIQA 1H61A 2QMJA 3APTA 3CZ8A 3UXKA 4X3ZA 4MM1A 2A85A 1IGSA 3EOUA 1J79A 1MRQA 5K4ZA 4FX7A 4JTAA 1NF0A 1ZJBA 1UIPA 4GFIA 1VRXA 3P84A 4QDPA 1BPLB 1SZNA 2CC0A 1CENA 3KW3A 4HZMA 4DI9A 4KF1A 2AL1A 3L5LA 2FFIA 3SY5A 2QW5A 2YW3A 1H5VA 5K2ZA 3AICA 2PSNA 2FDSA 3NXLA 3SFKA 1POKA 2FHCA 2J7GA 2CLOA 4B4FA 1WZMA 5CPSA 1NQKA 1PX3A 1UZDA 2G50A 1TFVA 1N82A 4JTDA 3SY8A 2I56A 3RM4A 4GUFA 3HQ1A 1SO3A 1QW9A 5G1MA 1VKFA 1H1NA 1Q7QA 2GGIA 4Q4KA 3RXZA 2UWFA 4LBUA 3MSDA 3OLEA 4CVWA 1T5AA 1O5QA 4RDVA 1DTUA 4G1KA 1WPCA 3WLJA 3POHA 2QAFA 1XUZA 5CBIA 1CGTA 4IMEA 3WNKA 2JIWA 3S3GA 2X40A 5HJXA 4LYKA 4Q7BA 2NXHA 3CM4A 3CO8A 4GZEA 3C0JA 4V1YA 1DJWA 4FX6M 4O1DA 3URBA 2O55A 3T4WA 1ZSXA 2J88A 4YLWA 1JYWA 2D22A 3EOLA 1S46A 1Q6EA 1V6YA 4R5EA 1A5UA 5JIWA 2CLIA 4IGHA 4REQA 3H7RA 5AZ1A 3PNUA 2ZUWA 2ZX9A 1G9HA 5CPQA 7XIMA 4G7EA 2IQ0A 4LUTA 4HU3A 4O57A 4R53A 3T42A 1Q8AA 4AD5A 3N6QA 1R6WA 3MC5A 4DJEA 1B9BA 3QC0A 4XZ9A 4FLQA 3W7JA 1P0DA 5EMUA 4N4QA 1GQJA 4QM1A 3C3NA 3WK0A 1UA7A 3DOPA 4FIQA 3W7GA 1D3CA 1UWSA 3HU7A 5KTLA 3KRUA 1XYCA 1HX0A 2C7FA 1HG3A 2XIBA 1R3QA 1TE1A 3RJYA 3HV8A 4Z17A 3VU2A 2X0YA 4A2RA 3TIMA 4RDYA 1ZLPA 2V9DA 3TW6A 3OVGA 4CD6A 3G1YA 4MHBA 4M29A 3M47A 1OT1A 1VBGA 3SEPA 2CESA 2XN0A 3AYTA 1QI4A 4PCPA 3GVWA 2ON3A 3BCDA 1TTQA 2PDPA 2XIQA 2IPGA 4PN2A 1C7SA 4XZIA 5K3VA 2XM1A 1C9DA 4H00A 4GH1A 3KZSA 3GY1A 3L5AA 3T0TA 3VFCA 2DZXA 4C7FA 1EEXA 3G77A 3R2GA 4NX0A 1BYDA 3R43A 3AZRA 1TVNA 5HMSA 3LUTA 1TRDA 2W91A 1X8FA 4BFAA 2OZ8A 3M5VA 4YYFA 4UTMA 1PKLA 5FL1A 3EPMA 2NQLA 1RJPA 2V30A 2AL2B 3DFHA 2D73A 1XSKA 3I4EA 1CGUA 1G69A 4CN6A 5HWJA 1D7FA 4AZCA 2DUZA 3PTQA 2GLKA 4LAOA 4L4PA 1F07A 1KV5A 2W5FA 3IGUA 4AY7A 1EZWA 3G1XA 3UR5A 1YHTA 3BL3A 5I3GA 4UCGA 4XZMX 4MZYA 3FA5A 3LCXA 4J3SA 1U5HA 3MMWA 1V03A 3KOZA 4HKPA 5L6UA 1B57A 3G1DA 4FLRA 3TA9A 3UA4A 4U2ZA 1M7XA 4UZUA 3G5EA 3UERA 1MNZA 2J66A 2NQZA 4HN4A 4FR6A 5EMKA 2HK1A 2YIHA 4LJ3A 2WJDA 3ITTA 4Q8TA 1KKOA 3VIJA 4BR1A 4JS3A 5DRIA 1E0VA 2OGYA 4HMCA 2QUNA 2W62A 1CIUA 3O8AA 1WB0A 3N9KA 1RVGA 4XAGA 1VFSA 1A5SA 3P2VA 4NF7A 4TV6A 3SCVA 5JVLA 4CNSA 5AHNA 3SCOA 4O53A 4WJXA 3GXIA 4UFMA 2CERA 2C71A 1J5SA 3W24A 3AMLA 1KFLA 4GYKA 1IIGA 4DBWA 4JTFA 1W8GA 4QE1A 3TNBA 4MB1A 4LS1A 3EWZA 1V4YA 4B5SA 4PMJA 1E40A 2PBGA 1WAWA 4UMBA 3COTA 1HJXA 3W86A 5DCDA 2RAGA 1B0IA 3K4WA 2BVWA 2D2GA 5KINA 1JGMA 4AQLA 4MB4A 1KO0A 3GHSA 4WSHA 5T9CE 4DXXA 5GNZA 3DYPA 2XIMA 3UESA 5EFFA 1F5ZA 1N55A 3ARYA 4LUJA 4EKJA 2A7NA 2EPMX 1JDEA 4V33A 4MWAC 2WW5A 1Q63A 4TX9A 3FHAA 9RUBA 1WDWA 1OGSA 1DQXA 3F5KA 3K13A 2P3EA 3ANYA 3ES7A 5FSDC 3VC5A 1GNXA 2ZUNA 3PF3A 3UYCA 3IVUA 3WNMA 4DBDA 2G3JA 2NV9A 2HEJA 4RV3A 1LROA 4LS0A 3EA3A 3ZQ9A 2ZKMX 3SCSA 3AS1A 3CXOA 3A5FA 3G1FA 4JTCA 1J0IA 5GJPA 3CV1A 3M7WA 4KCWA 1NWRA 3W83A 4OHQA 5F4WA 3NPVA 1NAL1 4NNCA 1GW9A 4B16A 4NIRA 1ZP4A 2QPSA 2GUUA 3N14A 5BXTA 3OLGA 3GTXA 2PGFA 2WHKA 4NZCA 2DW6A 2C14A 3MMUA 4GG9A 1XKYA 2F38A 3NQ8A 5TQLA 4IQEA 3SQSA 4I7UA 3VM7A 2GQ8A 2KX9A 1BTMA 2J24A 3V35A 4CCDA 5LYRA 1H1YA 1YBQB 1TTPA 3IK2A 3M41A 4GBDA 1IT7A 3NTYA 4FXJA 2F2HA 4IIEA 1XH2A 4ZE5A 4J3ZA 3THDA 1GCYA 5REQA 1EYEA 4ACZB 1CZ1A 1DWAM 3QF0A 3W81A 4XQ6A 4R7OA 1R3RA 2OO0A 3CZJA 3RU8X 1A4MA 2BXYA 3LS9A 2WMKA 1EUNA 4ZQRA 3Q45A 2DSWA 1XCFA 1VFTA 4PEKA 1PAMA 4JKMA 1ZBCA 4OIFA 5AKQA 1WBHA 3T08A 4AW7A 5I09A 4O0ZA 3KWSA 2WZTA 3APYA 2R82A 5L9FA 1JFHA 4YVXA 1VENA 2QDHA 1GQIA 4E2DA 4JTIA 3W7DA 1E0XA 1FFRA 1MMFA 4JIHA 2DW7A 4W8LA 1RALA 1ZBKA 1K8ZA 4BY3A 1G5AA 4PULA 3GO2A 5K7JA 1TV2A 3O06A 3PJWA 2CEQA 3EDEA 1BF2A 1RZMA 4ALDA 3HFYA 2GVGA 4TVUA 5BZAA 1DBTA 4IFOA 1LWHA 4ZZ9A 1TPWA 1EP3A 3R11A 5AYIA 1YIXA 2NX1A 3ABSA 4MJZA 3HM7A 2WV8A 1P1XA 2E40A 4DJDC 3AXIA 3ZZ1A 2GJXA 4Z1YA 5A3HA 1FWWA 3NQMA 4DF2A 3BLKA 1OG0A 1W1PA 3W7RA 3B03A 3R4IA 4Z1CA 2J27A 4REQB 3HQNA 5CZKA 1XIJA 1XX1A 1EA9C 3O6AA 2X1UA 3AIUA 3ZJKA 2A3CA 2J74A 4G7EB 4LUTB 2BGQA 2E67A 4W7VA 3IGSA 4MLJA 5K9DA 4R85A 4AIUA 4R9OA 4U10A 3AU6A 1O1ZA 3JUGA 2XSAA 1Q85A 1QT1A 2E5DA 4A3QA 3QN3A 5E70A 4LEQA 4F0SA 1Q6FA 1XH0A 5ECUA 4LAZA 2QJGA 3CL6A 1HJWA 3B0XA 4D72A 3CAWA 4KFNA 1NP2A 1P7TA 1S2TA 2G41A 1KXTA 5DLCA 2J8FA 3DFSA 2A3EA 1WQ5A 3RPMA 4C6FA 3NAVA 2D3LA 2WVUA 1WXZA 1W1YA 1ECEA 1HP4A 4PFHA 1LQ2A 2WQPA 3U7BA 5I3FA 1W1ZA 3ZR6A 3G8RA 1J93A 1F05A 3P3BA 4AX7A 2WZIA 1JD9A 1IEXA 2VEIA 4H7CA 1YW1A 4O0KA 1P6BA 4JBRA 5FAGA 2VWSA 4LF1A 1UD2A 3PWGA 1VPQA 2PODA 2E1DA 3H7VA 4KBXA 1V51A 4TVCA 3W7NA 3TC3A 3WQ5A 2OSXA 1K7XA 2R1KA 4W7UA 4WUIA 4A35A 3P0WA 4NVTA 4OWGA 3PN8A 4DLMA 1UH2A 3A21A 4WQ6A 3M16A 2XU2A 1UC5A 3KWXA 1W5NA 3SFWA 4B5UA 4JHZA 1Q13A 3EYPA 5LXXA 4W8AA 1A50A 4GD0A 1KBKA 1KFJA 5A8PA 3QY8A 4EPDC 1HKKA 3G0UA 4OJYA 3BK0A 3GVGA 2QCHA 3LHYA 3BH4A 3MANA 4AZCB 1F76A 1I8JA 4FMVA 3AYVA 4IMFA 4IIHA 3NQFA 1KWKA 1I9CB 4RXGA 4FP1A 1NDWA 3KBVA 2YR1A 3WSUA 2FHFA 4JTTA 4MZ8A 4AVOA 4EANA 1X1NA 4P8XA 2OODA 1FDJA 4MKSA 2HMCA 3GUWA 3JZUA 4GI9A 2ISVA 4MZ1A 1GVIA 1JUEA 3MQTA 3II1A 4HJWA 2E9MA 4IICA 3H21A 2XH4A 3KBWA 4YTRA 3R6IA 4QCEA 3IRDA 2PZNA 4UMAA 4M6UA 2QCMA 5ABFA 3I4KA 4O52A 9XIMA 2XFWA 2C1GA 5C9ZA 2EF9A 3KUMA 2YBUA 1PKNA 3ME3A 5JBEA 1GHSA 1VFMA 3F5JA 5IRPA 3LRLA 1EHAA 3VO0A 3WQGA 3L68A 1FCBA 3NUKA 3VNJA 3GD6A 2PCEA 2Y88A 1LLWA 1LL4A 1R87A 3IPWA 2G3FA 1S1RA 3HMJG 1XGDA 3QW3A 1F3XA 1O95A 2D69A 5D2VA 3Q58A 1CLKA 1PO9A 2VT0A 3VD9A 1G4PA 4QROA 4YL2A 3L23A 1HO1A 3I65A 4L9ZA 1BVNP 2Z27A 1E4MM 3UXIA 2OLSA 1VP5A 6TAAA 1J0HA 1V5XA 5D9OA 4HPGA 4ICNA 3L4TA 1KM4A 2NLYA 3T2QA 3BGJA 3QYSA 1SW0A 2IKJA 4H8NA 2QGYA 5FA5A 1QBBA 2CBIA 1PVNA 3N4EA 3T07A 5BU6A 1RBLA 1BVWA 3AWNA 1GYMA 4Z2LA 3W88A 3BJSA 5HAOA 3RG6A 1V3MA 3WUEA 1UZ1A 3WLQA 1QOQA 3LTSA 2W92A 4ATDA 2EJ1A 2ZRUA 1V0KA 1CECA 1UJPA 1JF6A 4PRRA 1KTBA 2RJGA 2GFTA 4D6EA 4B9ZA 4S3DA 3POCA 1W8SA 1WZKA 1TIMA 4BEQA 2XFYA 3E5PA 5JQ9A 3AHTA 4Z2IA 1FP8A 4DZ5A 2PWFA 4GPNA 4QDMA 5I79A 1PZ3A 4URIA 1JEZA 1EJWC 1VF8A 4G5DA 2O0TA 4YMZA 2NQHA 3L67A 3KZPA 4B92A 4X63A 5IFTA 1BVZA 3G1SA 1HNYA 1GWJA 1H51A 2QCDB 1OZQA 2HSAA 2CZ5A 2IPFA 3BOXA 2Z0IA 2OTDA 3G2GA 2X8RA 1W3LA 3PUDA 4ZOAA 4PMNA 3AS2A 2QVNA 5KZ6A 2WB5A 4ICCX 3S83A 1O12A 2FIQA 1ZAIA 1XH1A 4Q8WA 3QHMA 1V8EA 3IWPA 2PDBA 5I5RA 1I45A 3DFQA 2P8BA 4YWIA 2YCLA 2BVTA 3N17A 4R3UA 5REQB 4WVXA 3W7MA 2CZVA 3V16A 2X1TA 3GBEA 3KVKA 1IXOA 4UIOA 3QSTA 2CCRA 4KH2A 5MKGA 1JUKA 3BXWA 4IFRA 2RFGA 4FOJA 3QQ1A 4QLLA 5CZSA 4S38A 1V0NA 2Z1VA 4O8RA 2EPLX 3B8WA 3SY1A 3W0KA 3P62A 3NJ3A 4C6PA 3K5XA 4E8CA 4MY9A 1D3GA 2WJFA 1KV8A 1GT8A 2BGNE 1DQWA 4HZ6A 3B06A 2B0MA 3PAOA 1JFXA 2D2HA 4C5YA 1YE4A 4BZYA 1UBPC 5C54A 3I3EA 4F40A 1QHOA 3ZR4A 5E09A 4HMDA 4PMYA 3FSUA 3A24A 3IIZA 1K8CA 4U28A 4GIYA 4UQ9A 5I03A 4LGXA 3RGTA 1OCQA 3CPGA 5CAHA 3OG2A 3H2OA 3PTDA 2PTDA 2E6AA 3S6DA 3W01A 5BROA 1RSCA 5D04C 1HGYA 3NDOA 5FD0A 2OJPA 3TONA 4GXWA 2E1WA 3VIPA 3UU0A 2BDQA 1ZL1A 3KCJA 2GJXB 2OB3A 1P6WA 1VFHA 1S2CA 3PPCA 2PPGA 2XH7A 4PRWA 4TVDA 1WXYA 4DM1A 3NQ6A 4KGLA 1YKWA 2ZUUA 2IPWA 3SAZA 4PCSA 2PDYA 5JU6A 4D6FA 1I6NA 1OGBA 1DJZA 1CCWB 1J6OA 1UWIA 1UD4A 3GE7A 4F8XA 1LM1A 5D37A 4C6CA 4J5NA 3BLEA 4EXAA 1VBRA 3EPNA 4DO6A 3W72A 2WWCA 4HZ8A 1XYFA 2XFFA 3STEA 1SPQA 4MADA 1HF6A 1OEPA 5CPOA 1BKHA 3TLQA 4TOQA 3OLIA 4Z42C 2HNHA 4GJ1A 4S3AA 3TJLA 3H53A 2JBMA 3W82A 3GC5A 1UWUA 4LF2A 5DCEA 4BQ3A 5LXEA 1QRQA 2PUZA 1P7TB 3FA4A 1VBUA 3DFTA 5H91A 2GVEA 3VZZA 1KFEA 3B0YA 1LCOA 4ZB2A 3E9AA 3PFMA 3KBJA 2WC3A 2GGJA 4TR9A 3F1QA 5A2AA 2DP3A 2C91A 4GQGA 5IHRA 2P76A 4XUGA 1PCWA 2D0HA 2PGRA 4GRSA 1QI2A 4PL1A 3I7RA 2J6VA 3KOYA 4UQCA 2NVDA 2Q8ZA 3CASA 1EZ2A 2CU0A 4OTKA 1VEOA 2HZGA 3ZMRA 4F3HA 4PMUA 2CBVA 3CIXA 4GCXA 1KCLA 5G2WA 1VFOA 5DY2A 4YU1A 1RY8A 4MPKA 4LBSA 5LSMA 3U2OA 2R6OA 3W28A 3P60A 1Y65A 4GVGA 3KHDA 2ADAA 2G5WA 2X1IA 3SM0A 2Z28A 2ALRA 3AQUA 2WLZA 4NXKA 3M0ZA 5E5CA 4WCJA 3I68A 4QX4A 1J9YA 1VAHA 5HQLA 5AVHA 3ABZA 3LHUA 1ITUA 3KX6A 2W66A 4PZVA 2XUCA 1FH9A 4PSPA 3V5FA 3TC6A 3IV8A 3BW4A 4Z0JA 3CL7A 4NRRA 1KTCA 4RR4A 3U4FA 4S1FA 3C2FA 4F0MA 2Z2BA 1E51A 1TZ7A 3RYSA 5C9UA 1TIWA 3QV8A 1VC4A 3WQVA 2BWGA 1U2YA 4FXFA 3GW0A 1K7FA 2W27A 3HQPA 4RNIA 2ZUTA 2VCCA 1OCJA 4UTWC 3UXAA 3H2NA 4J40A 1KB3A 2NSOA 2GSHA 2VX7A 1D9EA 3FJ6A 3NOEA 2DZWA 2EGZA 3AUJA 2IXUA 2W63A 2A1YA 3URAA 5HJYA 3KLLA 3UG3A 2IXVA 3AHZA 2DVTA 4NJIA 1C29A 4B5WA 1QO2A 3VGBA 1FHLA 3USZA 3TYCA 3JS3A 3CLWA 1ODUA 1ITCA 1KM5A 3CUJA 1H60A 1WXJA 2PE4A 4ERGA 3IAPA 1YTEA 2AGKA 2V38A 3MVTA 3TN5A 1BGAA 2CLFA 4DWSA 4ZQNA 2LLEA 2QXWA 3IAQA 3IIXA 3ABRA 4N7QA 3MJYA 3W7EA 3CQJA 3UETA 4KIEA 1E3ZA 4D6HA 3VIIA 3VDHA 2QYGA 3FOKA 4HHLA 2C13A 4E6MA 4EACA 4D71A 1Z32X 3EX2A 1X38A 4QS5A 2ZX6A 5D33A 3KOXA 3GXFA 5EGRA 1SM9A 4OVXA 1XHGA 4N9CA 2MANA 2PDFA 5DN1A 4RXFA 3SN4A 3MDUA 1OX4A 4MWAA 1CGWA 1OCNA 4LUIA 3T8LA 2BHUA 1TG7A 1R9YA 4FLOA 2JF6A 5A5WA 2A3AA 1E43A 1X1ZA 3AAMA 1YNPA 1AD1A 2VGIA 1I2RA 1IZKA 1ME9A 3O05A 1VPXA 4LTSA 4DBSA 3WG6A 3TAKA 3CUXA 3AMKA 2POTA 2ZVRA 2GZXA 3BLFA 1W3HA 2GGHA 4GI8A 2NXGA 1OWQA 1OY0A 3T0CA 5FF4A 2PP0A 2PDGA 3IS4A 3N34A 4JHMA 4GUGA 1MDRA 2BHYA 1KXVA 4HPXA 3SRKA 1R3WA 3GU9A 3KS6A 5DF0A 1DOSA 6TIMA 3O6CA 2Z2AA 1K02A 3S5OA 3U2EA 1BG4A 3FLUA 1MZHA 1A0EA 1PTDA 3W4RA 4CKQA 1XBZA 1BXCA 3WLTA 3H22A 2VR2A 4CNNA 4DWSD 3IK4A 5F1VA 4AU0A 2H90A 3SGZA 4A29A 1EB3A 1UKTA 1HIZA 3D3AA 1A49A 3ZLHA 1W0MA 4QITA 4N02A 4I5XA 2OLAA 4JYEA 3NPWA 4XV0A 2Q8XA 3VD5A 1UH4A 2PRLA 2QR6A 2J47A 2H9AB 2O92A 1NWSA 5D38A 3NYZA 5CLTA 3TMQA 4GGHA 5MKGB 4PR4A 3ZT6A 3NQAA 4MAVA 3N12A 4CEUC 2HS8A 4K39A 4C6IA 4KQNA 4CN4A 1Q5MA 2DZUA 4U33A 3DBNA 3E0WA 4CNTA 1GOKA 2FZNA 2ZQ0A 1VIWA 4MIMA 4AZHA 1E6PA 4MWAE 4RE2A 1ZFJA 1L8PA 3M0IA 4WJ8A 2W67A 1JVNA 2QCCA 2QZRA 4GUJA 2OG9A 5H8MA 3ZM8A 2WMJA 4FNRA 2DZVA 3LGEA 3MUIA 2V5KA 5LKYA 1OZMA 4AYGA 1EJSC 3QHOA 4C1LA 1FHDA 3W2LA 2YB1A 4JYFA 1OG6A 3MYOA 1ZAJA 2GSEA 1LORA 3T44A 1BQCA 4MSSA 2HVMA 4L65A 5CJNA 4DELA 1VLIA 5BCAA 1AH3A 1DWJM 3NZRA 4S39A 3WUGA 3Q2DA 2WNNA 1GJUA 3PWIA 1XC6A 2WMIB 4B5TA 4QE5A 3WMLA 2VFGA 1XIDA 3L0NA 3C4UA 1TCDA 1FY6A 4Z2HA 5B7YA 5FEZA 1NH6A 4RE0A 4UR7A 3K4DA 2X1SA 2D23A 4J2MA 3Q67A 2HQAA 4E5TA 4FNQA 1WKDA 4QRNA 3O3RA 3RO8A 3A6OA 4ZODA 2NV2A 3TUUA 3XISA 1EPXA 3VOGA 3RLGA 1SFSA 4Q8UA 4UR9A 1A3HA 3ZXWA 4C6KA 3T9PA 3BW3A 4S3BA 4K7VA 4GY7A 1KGWA 4WXZA 2I9UA 1P0EA 5A6JA 1BD0A 2QS8A 1H41A 1KLZA 1C91A 3UWVA 1B5TA 1EO5A 4YVVA 1IWBA 1TQJA 2J79A 2I16A 1F6PA 3EOOA 3ITYA 3QOKA 3WBWA 3MKVA 1OB0A 1P43A 4IJBA 4R27A 3GTFA 3UJ2A 2PWHA 3M43A 4WX2A 5HWMA 5BOOA 1XLCA 3PG9A 4QGCA 5KSWA 1GQNA 1QW8A 3LXAA 5FF3A 3VAVA 2P1FA 2Y7DA 3N2TA 3R5EA 3LD5A 3TTEA 3C2OA 3LCIA 3QV6A 2CLKA 3AHXA 4MOZA 2VC5A 2ZX7A 5HINA 2A3LA 3QC3A 1FXPA 1MEIA 5A6AA 2HE5A 1K4HA 3UR2A 1YXYA 3F03K 1EO7A 1Z6KA 4JY9A 5DMLA 2DH3A 3BPWA 4AVNA 3F4CA 1Q4WA 1KRCC 1H7XA 5D9PA 3EDFA 2ZZ1A 3FXGA 2NQ5A 5AB3A 5IFPA 3W6YA 4KWSA 3W00A 3BLPX 3UY7A 1M03A 1Z42A 2XJ7A 2VGGA 1UOZA 1CB2A 3W2MA 3TTYA 3FK4A 4J9JA 3R79A 3MP4A 2NT0A 2R1MA 3G6LA 1HTIA 1EF2A 1POJA 3BMWA 1E9YB 2V3EA 4M1BA 3W73A 3ZLGA 5DXYA 2VYOA 1MO0A 1K6AA 1N8FA 3LX9A 4DPPA 3NEHA 2YPIA 2Q71A 2RGLA 5CEWA 3A3WA 2VFEA 3AO0A 3UCQA 2GUBA 2ZA1A 1Q6GA 2HWGA 3UWEA 2VO5A 5AVNA 4MNLA 1KGUA 2PWGA 1B9ZA 1HKMA 3MHUA 2EG6A 4DNMA 1EH9A 1FA2A 4MPQA 4B2DA 4BQ5A 1L6SA 6REQA 2FFCA 2FH6A 5FAJA 2QT3A 3KHJA 1OF6A 4NY2A 1WOBA 4JQ4A 5CC3A 1VYSX 3EB3A 3SUTA 1RBAA 1I0DA 3DZ1A 3B0PA 4LYPA 2YA1A 2DSKA 5AYZA 1IT0A 7TAAA 1GKQA 2BTMA 5HNNA 3BG5A 3CYVA 3ICJA 3H4WA 4HPNA 4DWSB 4HHPA 4ERIA 2YFOA 3ZT7A 3GG8A 1AK5A 3YPIA 3LLXA 1CLXA 4LEFA 1QBAA 1OK6A 2QUUA 2YKKA 2GSJA 3EMQA 4C6LA 1J11A 1S3TC 4IFKA 1QHZA 2F6XA 3UWYA 1WO2A 4IPPA 3CTTA 1R7AA 5C2GA 1B3VA 2VR4A 3M0XA 4H83A 2W0UA 2ZTKA 4O17A 1RP8A 2FVKA 3VE7A 3PS7A 3WLKX 2QQ6A 4LBRA 1IGWA 3TTSA 4KESA 3TN6A 5HJLA 3GYEA 4QIUA 4GYJA 3L0GA 4JIIX 3IGXA 4DYJA 4PMDA 3H4GA 4JFTA 1RK5A 1ONWA 2DFAA 1WDRA 2KAUC 1OX4B 4S3KA 3OQEA 2NUXA 4GNJA 1E70M 1MDLA 1LRQA 1LTDA 2EXOA 4KFOA 4MTVA 5CXPA 1HJSA 2A7RA 1AZ2A 2HBXA 4PTWA 3VKBA 2UZ9A 5IBXC 1S5VA 2EPOA 1XBYA 1EX5A 4QNWA 3FGCA 1A0CA 2ZC8A 3HQOA 1H0IA 2VUYA 3EDKA 4GCAA 3W9ZA 2E4TA 2J8TA 1NWUA 3UPMA 3PM6A 3BDKA 2OR2A 1V6XA 5CBBA 5I6SA 4TXEA 1RR2A 2NSXA 4GIEA 2WCGA 3PAJA 1O60A 3DHPA 4YTUA 2Y89A 2IMRA 3QMSA 4RUBA 3TV8A 1W5PA 3M07A 3GIYA 4AMCA 4F0LA 5HNTA 3S42A 3VGGA 4QQUA 4HNTA 4HVXA 3I3DA 4E2VA 2Z1SA 4XB3A 1UZ4A 5D03A 3PZVA 3TZFA 3VIFA 2YCEA 2G96A 4C90A 2XM2A 2NX3A 3SCPA 1EIXA 5DQPA 2VQUA 3WJWA 3I6EA 5IM51 1KXHA 1FXQA 3GR4A 1WP6A 1DJXA 1W9VA 3D6NA 4AG0A 3R0UA 4LB3A 8A3HA 5D2WA 4PUJA 3FXYA 5LGXA 1EX1A 3FKKA 3E0FA 2E8YA 3DC0A 3RAOA 3B4YA 3SQMA 3LSCA 2WVSA 1PCKA 3Q37A 2PWVA 3RIKA 1ECQA 1JDFA 1JL8A 2OU4A 3A3XA 1Q2SA 4UTLA 1AFSA 2E9BA 1V6VA 4AC1X 4P8WA 1VEPA 4O1AA 3LI1A 5HNRA 3WNNA 1JQXA 4AZ6A 1R85A 3R0KA 5DX7A 2OSWA 2PDKA 4XAZA 3BLDA 1DYSA 3GDLA 4QQ3A 2VC7A 3CQKA 2C1IA 4AWTA 1DL3A 3AWOA 1CB7B 5JH1A 2C18A 1FWEC 4UTFA 3MPGA 1XLDA 4LAMA 5DY3A 4C6QA 3MMDA 3FJLA 1E0WA 1RD6A 3CMGA 1M41A 5ECVA 2WLYA 5HMFA 1J0YA 4HHHA 1X7IA 3CMJA 3G24A 4AX6A 2EEXA 3C2VA 1XLIA 3WLOA 3L4ZA 3WUBA 4WDWA 1RPKA 4N2YA 2XVGA 3S5NA 2Y6ZA 2Y2WA 4UFIA 4AZ7A 3NZ1A 1OIFA 4QJ4B 4LFYA 4A21A 1NF7A 3UBPC 3GH4A 4MF4A 1L8NA 1CYGA 3WDQA 1Q66A 4Q32A 4MUPA 1GZJA 4NJGA 2FPVA 4GIAA 1TA3A 3H2CA 3AJ7A 5FJRA 3W85A 2WOQA 1FWHC 3MUZ1 1EC9A 1SMDA 1QNSA 1SZRA 1E9ZB 4I7VA 3NL3A 1PYMA 5HUOA 3DC8A 1FWRA 4PB4A 4EPKA 3STCA 3QR0A 2XGZA 2OMAA 2E09A 1EA0A 4WSKA 3SCRA 2RDTA 1V79A 5D4YA 1XG3A 4CQ8A 1AJ0A 1JZ5A 3A23A 3FHQA 3S1GA 1I1WA 2PS2A 2TMDA 1ZBVA 4GWEA 3VMOA 2ZWZA 2I5QA 5FJOA 3BAIA 5CGQA 1YTKA 2VKZG 4ZXOA 3ABQA 4NNBA 3TQPA 2PA6A 1VFUA 3OGVA 3H2MA 3V4BA 4IP7A 1HKWA 1B3ZA 3H2EA 7REQA 3BANA 2OQHA 2GVYA 4UZSA 4RW5A 3FFSA 4GKLA 5E9AA 3P61A 2OEKA 1TUXA 2QGHA 4BF5A 3QM3A 4DZIA 2WKLA 5CBJA 3Q94A 1WZAA 2DT3A 4KERA 2GOKA 2JFEX 4ZCWA 1UQZA 2TAAA 3B40A 1W9DM 3NA8A 4N6EA 3GVQA 3BURA 3EX1A 3AIVA 4D6JA 1WZLA 1Q2RA 1HKJA 2AOSA 8XIAA 5AC4A 4RW3A 4PB5A 4Q33A 1DXIA 4X0NA 1H2JA 2ZUMA 3ZJ6A 3H2AA 1CPUA 5F2IA 3DGBA 1EJUC 4Q6JA 4UWMA 1Y5VA 6XIMA 3PULA 1GUVA 2QJJA 2FKPA 4UXDA 1MRAA 3RNDA 3VMPA 1RP9A 3TLLA 4WOQA 2F61A 3W38A 4AWUA 1ZBWA 3NQVA 1S2VA 1K3UA 1S38A 3ALFA 1IEIA 4L64A 3VUPA 3HO8A 4UTWA 4XAYA 3EOSA 3TVAA 5E1QA 3ATZA 2NQ9A 1T0OA 5A8NA 1NFBA 2VL4A 3Q4DA 4DUXA 4JXCA 2INZA 1YDOA 2INFA 3TZNA 6REQB 2BZNA 4A22A 4S2BA 3VI2A 2VEGA 4E8DA 4ZSTA 4FNTA 1P5BA 3H7UA 3GVVA 1TX0A 2GWGA 4ZR8A 1UHVA 2GJPA 3HPZA 3F4NA 4W5UA 4I7WA 4RNJA 4NHVA 2HV5A 5B7ZA 4AY8A 3BZJA 2ZE0A 1XLMA 2PCQA 3OVQA 3NZQA 5DANA 1JI1A 4NX5A 1F6KA 2CZDA 2ALDA 1IIHA 2DV0A 4I90A 1E5NA 1KR0A 4O14A 1TMLA 1ZHAA 3AIWA 4Q8NA 1TR9A 1XGEA 1FCQA 3WH5A 3T2OA 4JFUA 1XI3A 1Q6DA 2DJXA 4NZ4A 3T40A 3ZSSA 3R8RA 3QHNA 1JYVA 1YNYA 3P80A 3TQ0A 3WD2A 3R25A 3UPBA 1A5AA 2O9PA 2YDSA 3H55A 3U48A 3B04A 2ZA2A 4XVEA 3M7SA 3L4XA 2ZOXA 4UTIA 1WKEA 1VBJA 5LHEA 3N4AA 3RX3A 1CNVA 2WCAA 1PB0A 3QGAC 4YJ5A 1QPNA 1DXFA 3KLKA 1UIOA 2V3DA 1W1TA 5TD4A 4UTHA 1GQLA 1EWEA 2FZ9A 2BP1A 4XO6A 2DVXA 4MUZA 3ZFHA 3A4JA 5A8OA 5CZJA 4GVFA 3E0LA 4G9PA 1PYFA 4YTTA 1AQ0A 1FDZA 4J4KA 1O66A 3R13A 2VX6A 4HCHA 4OQVA 5FJPA 4PH6A 3ABXA 4KWVA 4MB3A 1UP0A 1XG4A 1PWMA 4N9DA 1EGMA 4Q22A 2JKAA 4GO8A 3GTIA 2PMQA 3DESA 3WQOA 1W2PA 3DG7A 1DJIA 4M82A 4PMOA 3WCZA 1G01A 1C8YA 3B8DA 3N3TA 4KEUA 1RQEA 2ICSA 2FLIA 1U5VA 2XWEA 3W7LA 2PWEA 1V3LA 2W9MA 1NU5A 2PB1A 4JR5A 2OXNA 3NNTA 4P7OA 1TV3A 4LVFA 4D6CA 3L2MA 2OZ3A 2XVNA 4B3KA 3TW7A 1NDYA 1TPDA 2P53A 1AH4A 5DBTA 3GHUA 2Y1HA 2F7FA 3MUCA 3GFYA 4IUGA 4ROPA 2QJHA 2V5DA 3W1MA 4DVOA 1EP2A 4JTRA 2WC4A 2G4JA 1M9HA 4UQDA 3LM3A 3VNIA 4DI8A 3B4UA 2PDQA 3GH7A 4OOZA 3WEZA 2HVOA 3A13A 4R7WA 2WBKA 3UT0A 1VLWA 1WUEA 3CUGA 3QH2A 3UA3A 5C55A 1N7KA 4Q8QA 2XTKA 3STPA 1NP0A 4QR6A 4V27A 3R0DA 4CLMA 1ZTVA 2O7QA 2RKXA 2WANA 5F2LA 4RNHA 2ZDSA 2HROA 3SURA 4IPJA 2HK0A 2PRMA 1SZFA 3DDMA 4O1CA 2JEPA 3IUHA 1T41A 4ZQCA 1CBGA 2WSRA 1EQCA 3LERA 4NAFB 1PX8A 3V7PA 1OK4A 3OA5A 3WZ0E 4H6EA 1GZ1A 3VDGA 4K36A 2OYLA 1OT2A 4JQ3A 3AMCA 4GVHA 2C19A 2VZVA 3FW6A 2QEZA 1JD7A 3QXBA 1X8CA 4YNGA 2OO6A 1YTDA 3G1AA 4GZ7A 2R94A 2PBOA 3LM7A 3S0CA 3L4UA 2O9RA 4DPQA 3W7HA 3U57A 3E38A 2E0PA 5KETA 1J8VA 3ZIZA 4I9MA 1TA3B 2WZMA 1KQZA 3VILA 4BWLA 3QMRA 2Y8VA 2QMKA 3PZIA 3MWCA 1XBXA 4UOJA 2B7OA 2E7FA 3F2DA 4CD4A 1MW2A 5BRQA 5BOFA 3EDDA 3VZXA 3U9IA 5GNYA 3T1GA 2WSYA 3GRIA 3R1ZA 3ISIX 3A22A 4QSHA 3ZWTA 3SB0A 2EPKX 4L6OA 4P5UA 3BE7A 2GJLA 1XLKA 4MYAA 3QOMA 3DFPA 1YXDA 4S3GA 2OEJA 3B9AA 2XINA 4BS0A 2WPBA 4XKYA 5D05A 4O1EA 4AXKA 1PX4A 4QSFA 4W89A 5EMMA 1JDDA 2E3ZA 3DEQA 3OA3A 3KEHA 2AAAA 3LZ3A 1UR8A 2JGYA 4H7VA 4EWND 4QTGA 1TCMA 2REQA 4JX5A 4ZFCA 1C7TA 7REQB 5T91A 1R0MA 4YIWA 5A8MA 4XD3A 1SFLA 4BK9A 1BQGA 4GUHA 2CLMA 2ZRVA 2O56A 2TYSA 3SN1A 4KWWA 1J96A 5BMWA 7CGTA 2BFGA 3GNOA 4RZ5A 3UD6A 3KBNA 2E9LA 3C2YA 1KGXA 3LNPA 5U7SA 3S46A 1LL7A 2PU0A 3R58A 2VMFA 1OBAA 5H6HA 3OZYA 1V6WA 1RHCA 1D7KA 2DZPA 3HBLA 3EWUA 4RJEA 2VZTA 2E68A 3I6TA 2DZSA 2X0HA 4PFMA 4H9MA 3GXMA 1S5WA 5I3IA 3C0QA 4X9SA 5GQBA 2QCGA 1RBOB 3GTNA 1TZZA 4HCDA 4RX0A 1BYCA 1LZOA 3HGOA 1IYXA 3QQ0A 4U5IA 3W1LA 2DUAA 2D3NA 1UROA 4Z2JA 3MO7A 3NYDA 1JPIA 1B3WA 4C5ZA 3K46A 3CUZA 2A3HA 3FAWA 4YS1A 3TP4A 4TUFA 3LGDA 2CKSA 4JICA 1ODZA 3VOJA 3DU0A 4H8HA 4GXMA 1XLJA 4QNEA 4V28A 3WDIA 5M5DA 3W7CA 3NWRA 1SO5A 1MXDA 1KM1A 5I78A 1BYAA 4GYPA 4DJFC 1R9ZA 2GK1A 2OKOA 2PI6A 2C6QA 3HIJA 5EMJA 4DBEA 4EPEC 3F2CA 2R1NA 4M56A 3TXVA 3UYIA 3KL0A 2NWRA 4AHPA 2PDCA 3QYQA 2SFPA 1DIKA 2VWTA 3PZOA 4W9TA 4PMVA 3CMFA 2DT1A 4AZGA 4HQVA 5KZDA 1W5QA 1ZRQA 1VEMA 4IJCA 4QE4A 3W2KA 2I5GA 2W3ZA 2R24A 3TYBA 4ZENA 1G67A 1XC4A 3C8NA 1QOPA 1E6NA 3WLPA 3KFTA 3BG3A 1LLOA 3EWYA 1BG9A 5D2XA 1YEYA 5RUBA 2RDWA 4OU1A 5LIUX 2YZRA 1XIMA 3N2XA 4IMCA 4MGGA 2YOCA 3AC0A 2ZZ2A 1UASA 4RLIA 3VMNA 3S9IA 2WZHA 2HXTA 1K1DA 3R94A 1I1XA 4HNUA 3O9NA 5J04A 3PZMA 4QG6A 1TWWA 1KFWA 1B90A 1J0JA 4UTTC 3S9YA 2WNZA 1A5MC 3GG1A 3A4XA 3DHUA 5DMYA 3GG7A 1YDVA 3AISA 4UTUA 4H6RA 1DVJA 1OHLA 3EKGA 4H9UA 5BWAA 3NQCA 3L21A 5I24A 1LRTA 3AHVA 4C7GA 3H70A 3PY2A 4EIVA 2UY5A 2ZVIA 3SCWA 3BOLA 4LUYA 3ZVHB 2OWWA 4GY0A 5EB8A 3V0UA 1JZ4A 1RQHA 2VX4A 4ZB5A 4CVUA 4OOUA 1QNQA 4PB3A 3B97A 4IQDA 4CUCA 4ZTXA 5C7VA 4WLCA 5EKYA 2V67A 4RK8A 1EGZA 1AZ1A 1FWNA 3QPZA 4K1GA 1JCJA 3GX9A 1B4EA 2I14A 4NJJA 4NJKA 1EJTC 2X7WA 4DN1A 1W3JA 2CW6A 2BY2A 4S23A 2B31A 4P7LA 2FPTA 2ZZ3A 1BWLA 2J25A 4LAKA 1QPQA 5BXSA 1SW7A 5AC8A 2Z7GA 1XP3A 3CYJA 4Y8EA 2H3DA 5D8WA 3H6OA 3CPUA 4UOQA 3I7SA 1AQHA 3EEGA 3PJXA 3DFNA 3TYZA 3QFWA 5EFDA 1AW5A 1IEVA 1QW7A 4AD3A 2XVPA 6XIAA 1R9XA 3VIOA 3N29A 5C0QA 1W54A 1IZCA 2A6NA 1TJPA 5BRPA 2Z1XA 1P48A 2V63A 3GWQA 4HU4A 4UNIA 1W9PA 5AHEA 3CU2A 3LY0A 1A5BA 3HGJA 1OINA 3AIEA 4JN6A 1JJKA 3WL1A 1VS1A 2H3BA 4LCSA 3NM3A 4P7NA 1EQPA 2DORA 4XAPA 3NQDA 1E55A 1EIBA 1MEHA 2EPHA 1GGOA 3GDBA 3MCNA 2WWDA 1M53A 4XD6A 3G1HA 2G3NA 3AXKA 4GBUA 5EY5A 4H01A 4O18A 3NPXA 1S1PA 1JI2A 1TV7A 4C1KA 4HOXA 4BKNA 3N2CA 3AALA 5D2TA 3TWAA 3HG5A 3W26A 1EOMA 1TWDA 4ZGYA 3VNDA 1MQRA 5IOBA 3WDHA 3BAWA 3HF3A 4PUDA 5XIMA 2OX1A 3IEBA 3SGGA 2J78A 4L1XA 4L1WA 4LX4A 1AW1A 1FWIC 3QTPA 5LGZA 1RJQA 2ZADA 1H62A 5LNSA 4L4MA 1V0MA 4OBTA 2I17A 3ANUA 1K9TA 3RCMA 4NYYA 4E4PA 2Z4GA 2QJMA 1ZB5A 4K68A 2OT0A 4M6PA 1ISZA 2ONEA 5BU9A 4LVDA 3RRXA 4Y9MA 3AFBA 4DBUA 5TF0A 4PA8A 2OKTA 1OQFA 3MJMA 4DHGA 4HK6A 1JZ3A 2HDJA 3L5MA 1EXBA 2XVKA 3CH9A 1FQ0A 1M3UA 4ML4A 2G8ZA 3S5YA 4O10A 3W74A 5E0KA 3VIKA 1UR2A 5I3JA 2QAPA 2YBVA 3QTGA 3EAUA 1E6SM 1HL9A 3LCHA 4B5NA 4HOZA 4H9TA 4Z08A 2J7EA 1S5NA 3BMVA 4HB7A 4GLEA 4RPQA 3V0TA 1CWYA 4XKYB 3VKCA 1AVAA 4JCMA 3NVDA 5HMDA 3BAYA 1VHCA 2FVMA 1J2WA 2NVCA 5AHIA 3KBMA 3FYPA 3IIPA 1CGVA 2ZA3A 3N2MA 4CU6A 5BXPA 4CQAA 1H4PA 3PFRA 2QHAA 1PZ2A 3DHFA 5HULA 4NILA 3PG8A 1AMYA 3DHDA 4FAMA 3UXLA 4B9YA 1E4NA 4F2UA 1WDPA 3GC4A 2FZDA 4LRTA 1AODA 3T7VA 1SVDA 3UGVA 1IXPA 2BHZA 3SUWA 2GL5A 4Y7EA 1VJIA 4L5ZA 4AIEA 4RE4A 1GW1A 4DXKA 2WPGA 3B0VC 3USBA 2DSVA 1XLLA 4K38A 4JTKA 5CGTA 3GQYA 3LZ5A 4DJED 5E9XA 1HT6A 4GISA 4L9XA 3ZR5A 5C7HA 1A5CA 4O13A 4C6EA 4F0RA 2G3IA 1IXNA 1M7OA 4Z1BA 4CEXC 1GTHA 1QTWA 2ZXDA 4N4PA 1FWBC 2Q02A 2W4XA 1CXLA 3OGSA 4H6KA 2PLMA 3S2NA 3MHGA 5U4NA 2QUVA 4YPJA 1CXEA 4LUSA 5AC5A 1TYGA 2VEMA 2BASA 1W1VA 4ZOEA 4LB4A 1W37A 4JTQA 2YW4A 1K77A 1HJUA 4AB4A 4JQ2A 2NW0A 5HA7A 3LHTA 4AEEA 1V3JA 3TE9A 1O7AA 1UA3A 3I6RA 3NM1A 4LCRA 5DMNA 3ZOAA 4L1GA 3N13A 1VYRA 4ONVA 4HZ7A 4H19A 3NOYA 3SW6A 3E96A 4OV4A 4UFKA 4ZXLA 2QLYA 1F8MA 1A47A 2PDNA 1FH7A 3ZJ8A 1F3WA 2CHNA 3THQA 5HNUA 2OQYA 1QDSA 4ZO6A 4W4QA 2GK1B 3KM8A 1PKYA 4DO7A 2TRSA 3SN0A 2GDUA 4I8YA 1OFOA 2YCIX 3RU6A 2ZBTA 3CGTA 3NQ7A 4JQAA 4FNUA 3VK5A 3PZ9A 2PP1A 1L2UA 4G1NA 3SCUA 4JL1A 2EJAA 4P8VA 1GYNA 4GABA 3WQFA 3S1UA 3W2UA 4XBJA 1AUSL 3GXTA 3ONCA 4D6IA 3AHYA 4J3XA 3SBFA 3RO6A 2YXXA 3LHVA 3K8MA 3BCFA 4FOUA 3K8KA 5AOUA 4HBKA 3JZEA 3IJQA 1RCXB 2G95A 1BF6A 2YXGA 3GU1A 1FH8A 1KM6A 1J5TA 2UBPC 2EKGA 1LBLA 3WLMA 1GYLA 4EXBA 1XIBA 5HQEA 2FGBA 5IDIA 3S2CA 1CEOA 3OEXA 3M0VA 3M5YA 4C6JA 2P0OA 4MKNA 3CNYA 4PCNA 4PMXA 4EVZA 3C0SA 2NX9A 3PSVA 2A6LA 4C60A 4BI6A 2FHBA 1BKSA 4GI6A 2IW0A 4J3WA 3SQLA 5M17A 3PHAA 3U2ZA 1OVDA 3R89A 3OYXA 5AFDA 3E5BA 3WD1A 1XXXA 1KNWA 3VX0A 4PUUA 2H8XA 4GO9A 2FZBA 4NZ1A 2PLCA 3SUSA 1JGIA 2JGQA 5BOEA 1WA3A 1X6UA 3ITCA 1TO3A 3T8QA 1ISXA 4YN5A 3NL2A 4H9ZA 1TPUA 4BJHA 1V7YA 3H2FA 1XICA 1BXNA 5AYBA 3RCYA 3WNLA 3K4AA 4WDTA 2UY4A 1JDAA 2V6AA 4UOZA 4N9BA 4AH7A 3JVAA 4F48A 2NZLA 1MFVA 4JTLA 2FZ8A 3LB0A 5TIMA 4IG2A 1UWTA 3DENA 5CPLA 1JZ2A 3EWBX 3BO9A 1OC7A 4C6DA 4E38A 1EC7A 3BJTA 1L6WA 5H1WA 4MNMA 1H7WA 4YTSA 3T4CA 3AXHA 3RM9A 1NDZA 4XSMA 2B7NA 1UZHA 4CCZA 5KITA 1XDJA 1ZS2A 4X61A 2VZSA 2OSYA 1SR0A 3BTNA 1QMLA 4Y6GA 4H9YA 4DIAA 3OW1A 3HPAA 3P8IA 1TJ1A 2VRJA 4GJIA 1BRLA 4HTYA 2DVUA 3GKAA 3N9SA 5TNVA 3QGVA 3GZ3A 2POZA 2YLAA 5BXRA 1AG1O 1XD1A 4UCFA 2F6UA 4CQCA 1T96A 4FOKA 1AW2A 4M81A 2CBUA 1ME8A 3WEOA 4A3YA 2CHRA 3NL5A 5LA2A 1XISA 4K8HA 3VNKA 3F4WA 3WFLA 3G1RA 1XFCA 1KR1A 4D9PA 2YL6A 4FXSA 2YLLA 3BSMA 1MVYA 2V5BA 5JXQA 4Q3MA 3PSWA 1O5XA 1FWFC 1A80A 2CZEA 5T8GA 1JDCA 4TMBA 3W1RA 3SGUA 3KRZA 3E2SA 3CAQA 4E8GA 4HP5A 1PWLA 3GR7A 4R88A 1J18A 4O8AA 3SRFA 3N3MA 4GNVA 4H2HA 4B3ZA 1V3IA 2XIJA 2Z2UA 4NZ3A 4CNUA 3TSDA 4WZHA 5G2HA 4JHOA 2GUYA 4EE9A 4M19A 1DKWA 4QG8A 1W17A 2V5CA 3THUA 3WLIA 3IJ8A 4Y90A 4LC6A 5IDZA 1JPHA 1UKSA 1KRBC 1DHPA 1XFBA 1VCFA 4S2CA 3LPFA 4LV9A 4B5XA 3N73A 3QJAA 1ITXA 4BEUA 2OZ0A 3RUBL 1EDGA 4HK7A 3DXIA 3C6CA 2BXVA 3VOCA 2J9YA 3TN4A 3S2MA 2JKPA 4LWWA 3UNTA 5D9MA 3EWCA 3WH9A 3M4HA 1E6RA 3W1XA 4AIBA 1JNDA 3L2IA 3LYEA 2G97A 1M04A 4OZOA 3M5XA 5K4XA 1MW0A 3ELFA 3U2CA 4L80A 4G6CA 3SRDA 3NVTA 3B0UX 4A8IA 5A94A 4ZTYA 5J5RA 2VEKA 1L0PA 1OFQA 1S5MA 3TJ4A 3AYRA 5DBUA 2BGSA 4ZVJA 1QI3A 1W5OA 3IJ9A 3PVFA 5F4XA 1IR2A 3KS5A 1GOOA 4EAYA 4Q4SA 1HP5A 4DWDA 5EL1A 3EGJA 3CQIA 3W1UA 3RPDA 3W84A 4E3TA 4FX8A 2FH8A 3BV4A 3EXTA 4YXGA 1LOSA 1ZALA 4G2DA 3PPGA 2VP8A 5LHFA 1Q65A 1R3TA 4Q7IA 1CX9A 1ONRA 2W79A 3TTQA 2O4MA 5A8GA 2Z25A 4IT1A 3WH7A 2ZE3A 1EJRC 2HRWA 1GOIA 3L4WA 5BW6A 4ZMGA 3R8HA 2HJPA 4AD4A 4I6VA 4O54A 2A5HA 3C52A 2VTFA 2VFFA 3RR1A 5A6BA 1JZ6A 4OT7A 4L61A 2UV8G 4OBRA 2B4GA 1E6QM 3NGFA 2BODX 1VJSA 3MU7A 3NZGA 1EL3A 2D2OA 1XCWA 1BSLA 1XLFA 3V18A 2XSBA 2XZ9A 3HZ3A 3GDKA 2OFJA 3NCOA 1WKYA 4HK5A 4KCTA 3GAKA 5ABHA 1OFAA 3EPOA 1X98A 3B3DA 4ZE4A 1TE6A 2PEVA 3TU9A 4GZJA 2IQDA 3MT1A 3DYOA 2ATMA 2X2GA 4ZOBA 1BTCA 5E6YA 4S3FA 1TVPA 3WY1A 4D8AA 5HR7A 3LPGA 3MA8A 4YCPA 2R8WA 2PWUA 1B2YA 1TX2A 3CEUA 2ZZ5A 2Y70A 4XZLX 3UVIA 2X30A 2I9EA 1CW2A 3THCA 2JF7A 1A5NC 2XYLA 5FF7A 5HPCA 2ASHA 4YVPA 4Q8PA 4UQEA 3EOEA 4HA3A 4PBEA 4XZBA 3LQLA 1SFTA 3CUIA 4PODA 1K9EA 1DIOA 3U0HA 4M1RA 2AMGA 4N42A 2ZXQA 4IGSA 1KBIA 1O4UA 3AXMA 3ATYA 1U5JA 3F5LA 2VRKA 4NZFA 3NQ2A 4PMRA 3QGKC 1EBHA 1HFBA 3WK2A 3MB9A 2O4QA 1EF3A 1UD8A 1TREA 4PMZA 1RY0A 5B80A 1Y7VA 4J28A 4XTDA 4IX2A 4M3PA 1DJQA 3UWQA 2C15A 2CLPA 4O50A 1DQUA 3DI0A 3GXNA 2VQTA 1EDQA 3AS3A 3LPPA 1J0ZA 1ENUA 3S2JA 3PZQA 1JRBA 4R33A 4XWUA 3TWBA 1X97A 4W8BA 2VVSA 1PTAA 1UP3A 4C7DA 4WRHA 3BCJA 1QPOA 1KA9F 1QI5A 2Y24A 5JIPA 1IWPA 3UWWA 4MFEA 4UTTA 1CLVA 2VFIA 1DV7A 2OYMA 3P7YA 3RR4A 5A8QA 3WF3A 1KBJA 3U5UA 1O1HA 4M51A 2W6RA 3S47A 1OFRA 4X2PA 4GQQA 1RD5A 1HKVA 4K8GA 3S2LA 3TJXA 1QPKA 1QNOA 3K8LA 4HHMA 3WN6A 1UMLA 4HA4A 4BQ2A 5IXEA 4A3HA 1FFQA 3LHZA 3Q65A 4GH3A 4K6AA 2QIIA 2EKCA 4JDYA 1FX6A 2ZZ4A 1YLVA 3ITGA 1E6XM 4HYRA 2ZXAA 4MKVA 3UZWA 1G4SA 4A3UA 5LNWA 2DU2A 3PUEA 2X41A 3N04A 2CNCA 4BCEA 3DN5A 4QXIA 4R9XA 1PUDA 3NSMA 4JN8A 4XUYA 4HSNA 2J75A 4KWUA 3UZ5A 1Q45A 4QJ5B 3OYZA 1WE5A 2DZTA 2YA2A 2P0IA 1N8WA 4LOCA 5DCBA 1TPVA 2WXDM 1LL6A 2GQ3A 3TEVA 4TX6A 1NARA 2WSPA 4O1FA 3QZ6A 4A4AA 5EU9A 4E2BA 3CO4A 4D8ZA 5CSUA