3W7OA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with tt2-3-165
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with TT2-3-165
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 105
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7oA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7oA01
4IMDA 1OJXA 3LV5A 3GDLA 3H53A 3BG5A 1JQXA 4JEQA 4JGDA 3W1PA 1AMKA 2FPYA 4HNTA 4O17A 4OE7A 1JRBA 2BZNA 2A4AA 2RH9A 3G18A 4UNLA 2BTMA 4IPJA 4UFHA 2CLHA 3S1VA 5HWNA 1J4EA 2ALDA 4FNRA 2O7QA 1L6WA 1W3IA 2OCZA 4EVZA 2QJHA 1GVQA 1F5ZA 4PL2A 2BXVA 3QPZA 1F7BA 5F4XA 3FKRA 3MWAA 4AHOA 1I4NA 4LVGA 3N73A 2QCLA 3WJWA 3GDRA 3O8AA 4WQ6A 2CLFA 4IJBA 1ZALA 4FNTA 1IXNA 3RLUA 5I3FA 4W9TA 2RDTA 1O60A 3PF3A 4WJEA 4GNJA 3G1FA 3DI0A 3I65A 2H8ZA 3W7NA 2C3ZA 2TMDA 2DORA 4NU7A 3A24A 2VEKA 1P0NA 3KVKA 3OHIA 4ICNA 5BOOA 2ZZ1A 2JKAA 3MJYA 4PTNA 2GQ9A 4GUJA 4LRTA 1W3TA 3L21A 3IIVA 3WK0A 3DGRA 1ZJIA 3A9IA 4DEFA 1K3UA 1LOQA 4EF8A 4AWUA 3EKZA 5DLCA 3HGSA 3CEUA 2EKCA 1GQNA 3QW4B 1I2OA 3O15A 4ML9A 5FF4A 3S1XA 3PC0A 4DPPA 5DY2A 4YLWA 4ZL1A 4DELA 3P80A 1VYRA 2C18A 3LGEA 5G4EA 3O06A 5BMXA 4DO6A 3TMLA 1FWRA 1JCLA 1FX6A 4JTUA 5MHBA 2YW3A 3KRSA 5J5DA 1R2TA 1RD5A 4AWTA 2YFOA 4ZQNA 4IPIA 1TCDA 3TQ0A 5D30A 4HNUA 3PG9A 3FYPA 5AYZA 3T78A 2F7FA 2A7NA 1GYNA 2VXNA 3FJ6A 3LXCA 2CLEA 2NUXA 3H55A 4XKYA 3OA3A 4YXGA 1H63A 1O95A 1H62A 3RF9A 2WSYA 1QR7A 3G1DA 3NL2A 2QCCA 4RZ5A 2VKZG 3VNDA 1PVNA 2G5WA 2CZDA 1PL9A 1TPDA 4NZJA 1QPRA 2FFCA 4PODA 2JKPA 2F84A 2YPIA 4HHPA 2DJXA 2NUYA 1FWWA 3L66A 3NQ2A 1K02A 4B5NA 3FLUA 4WXZA 3RMJA 5G5IA 1SW3A 3UXAA 1ZAJA 3IRDA 2ZZ6A 3CLMA 5E93A 3W3OA 5F2IA 1PE1A 4MPQA 4MZ1A 2ZTKA 4O19A 4OGZA 3W7RA 4BWLC 1K03A 1YDOA 3O63A 3G1HA 3UY8A 1KTNA 3HGOA 3I7RA 2WNZA 3PS7A 1HFBA 3EXTA 4EF9A 1A53A 3HQ1A 2X1RA 3LRKA 3UXDA 1Z48A 5KZDA 1FWNA 1NF7A 4JY8A 1RZMA 4O50A 5AYXA 2G97A 2C15A 3DH7A 1QO2A 3SFKA 3W76A 1TPUA 1W5OA 2X1TA 3M1ZA 1JR1A 5EL1A 2WO5A 3N2XA 3LTYA 3P84A 3LCWA 3QZEA 3DZ1A 2PE4A 1KBJA 4Z1DA 3W7DA 1UJPA 3M5ZA 3W73A 1KM2A 3DAQA 3W7HA 2WQPA 2NLIA 3B0VC 3TJLA 3LCIA 3M7WA 3GKAA 1WX0A 4RLIA 5A8GA 1EIXA 1VC4A 3FKKA 4WUIA 4E38A 1JCYA 2A5HA 2RDWA 1H7RA 2YYTA 3P8IA 3R13A 2B7OA 5CZJA 3TE9A 2FDSA 4NJGA 3GNNA 5F2LA 5H91A 2Y70A 3M5XA 2E77A 1SSGA 1RVGA 2E6AA 1SR9A 3EWXA 3ZWTA 1OK4A 3HBLA 1VQTA 2J24A 1W8SA 1GVRA 2ZYFA 4K6AA 1H51A 3A22A 4A2RA 5FEPA 1QCWA 3NEVA 4XWUA 4WOZA 3T44A 3VE9A 3T4CA 2A7RA 4N4PA 1XM3A 4E2DA 3CC1A 3R12A 2VFDA 4DF0A 4YCPA 3DFQA 1OHLA 3LM7A 3EXSA 2WSRA 3C2EA 1G7UA 1X7FA 1G7VA 1ME8A 4NT0A 3QSTA 4TMCA 3QEZA 3S5ZA 4BF9A 1D3HA 5AHIA 1FCQA 2VFHA 1H7NA 3BW4A 1DHPA 4O54A 4YCOA 4LTSA 2Y63A 1H7OA 1LBFA 5CG7A 5AB3A 3NXFA 3NOEA 4MZ8A 1ALDA 4UTIA 1AL7A 3MHGA 3KOFA 1OFRA 1FBAA 2QDGA 2GVJA 1T8XA 3NZ1A 1HUVA 4AWSA 3LHYA 4O8RA 2C1HA 2GPTA 2Q3RA 4NJHA 2GOUA 2QEZA 4LNYA 3PUOA 4NJKA 3G1XA 5I3KA 3VCRA 2CW6A 4BI7A 4UFMA 4TX9A 1A5CA 3QSRA 1R30A 3LI1A 4K39A 3FOKA 4H6KA 4BI5A 3KRUA 1PV8A 1K8XA 3THQA 3W72A 4KWWA 4RV8A 5D2YA 1KFEA 3MI3A 3E0IA 1L2UA 3C2VA 2Z6JA 3DHFA 1TPFA 1WBJA 2E6YA 2ZBTA 1O4UA 2P10A 1R47A 4UXDA 5ABTA 5HQEA 3W7MA 5EA9A 3W71A 1I2QA 3W7CA 4UR8A 1KV5A 4NNAA 1VH7A 1RV8A 2R8WA 2C19A 2ZA2A 5AHFA 4IQLA 3FS2A 2VEIA 4CQ9A 2A7PA 2QUTA 1QO5A 1KLYA 1I2NA 2H6RA 4RXGA 2QAFA 4WY0A 4IMEA 2ZRXA 4IUOA 5D2TA 3O05A 3HG2A 4FNUA 3CHVA 1ICSA 3LHZA 3WJZA 4AXKA 3Q94A 5IM51 2PC4A 4Y6GA 3UPWA 2DJLA 4UTWC 3B04A 3EWUA 4HSOA 2QCDA 4R34A 1F2JA 2Y7FA 3I7QA 2E5DA 3DFTA 4JTHA 1VPXA 3GYEA 3NQ6A 1XDLA 2A21A 1NEYA 2ABBA 1ICPA 3CQ0A 1RQEA 3NR0A 1MEHA 1TPH1 1TTQA 1XC4A 1MEIA 3EB2A 3LCFA 3WFAA 3DFOA 4QQ3A 4KFNA 3SI9A 4QNWA 1ML1A 1S3HA 4Z0SA 1DORA 1NSJA 1XXXA 1DJQA 1B9BA 3TXZA 5F4SA 3WK3A 3GX9A 4HNVA 2CZ5A 3CWNA 1YDNA 3TR2A 1R46A 4E2BA 1VHCA 3CU2A 2JGQA 3HG3A 4FNQA 4JTLA 1M7PA 2RHGA 2WOQA 3QRHA 1GPWA 1KFCA 4LRSA 3TAOA 3QPYA 4OBTA 2I1OA 4N9DA 4XTDA 1D3GA 3R8RA 2LLEA 5HMSA 4HPJA 4MY9A 3DU0A 3C52A 4MYAA 2OJPA 1BKSA 3L2IA 4U28A 3LHUA 1HO1A 3PB0A 1Z44A 1RQBA 4TU1A 1X1ZA 1PHQA 1L6YA 4OT7A 2YSWA 1XBXA 4CQAA 4LC6A 1F73A 1OFAA 2CLIA 4UMCA 1D9EA 5HR6A 1LZOA 4DF1A 4AF0A 3NPUA 3EWWA 4E0CA 4WOQA 3BG3A 3W7JA 1PS9A 1OFOA 3DFSA 4JX5A 4K7VA 2JK2A 3NDOA 3LRLA 5K4XA 1ZCOA 3A5VA 1C9DA 4GE8A 4O14A 3NZRA 3RNDA 3V1PA 3DENA 1Q6OA 1LM1A 5DCBA 3GVGA 4UR7A 4RK8A 1PIIA 3G1YA 5K3VA 5K9DA 3NQFA 4UTUA 1YLVA 4PL1A 3CTLA 6TIMA 3FYOA 3M5YA 1OFQA 2QUVA 1GG0A 1OYBA 4LS2A 3G0UA 8TIMA 1SO4A 1ICQA 1FDJA 1XUZA 4UTMA 5K7JA 3QMRA 2YYUA 5AC8A 4JIPA 4WZHA 1EWEA 4NXSA 1FCVA 3GDTA 3L0GA 4Z1AA 4JTGA 2DP3A 2W0UA 4NJJA 2V5LA 4JX6A 3BG9A 1NF0A 3KVMA 3B03A 1U83A 1KLZA 5E1QA 1GVSA 2PCQA 3G0SA 3QMSA 1GVOA 1JVNA 1MEWA 1YTKA 2E5CA 2YR1A 4N6FA 4RXFA 2FB3A 3TKFA 3DFPA 4O4WA 3GAYA 1I45A 1OYCA 5K2ZA 3C6CA 1OK6A 1FWTA 4FXSA 3S5OA 3HJZA 2QF7A 3N2MA 5L9FA 3UWQA 3TC7A 1FCUA 4NVTA 3PUEA 1O5XA 4FNPA 3G1VA 3IIPA 1W56A 2G96A 5DXXA 1RPXA 1TTJA 4ADTA 3MHFA 4IMFA 3C3NA 1K7EA 1XCFA 3M44A 4JTFA 3FFSA 5LHEA 3W22A 4CNNA 3T7VA 4LC8A 4O16A 3W6YA 1VLWA 3PBYA 5CSSA 5HWJA 2NV1A 1ZNNA 5I3HA 3CIWA 4ZQRA 3W7IA 5FF0A 3HG4A 3W84A 1M7OA 3HPZA 3W1RA 4GUFA 3NQMA 1TV8A 4QNEA 3LBMA 1TRDA 2C0AA 3SW6A 4IMGA 3LTSA 1IIHA 4Y90A 4JYFA 5DXYA 3C8FA 3N9RA 5CZSA 1Z41A 1G67A 1RQHA 4MY8A 2W6RA 3TJXA 4M19A 2YDAA 1DVJA 5C5YA 3SZ8A 4L4MA 2Y7GA 3LDVA 4GFSA 2D73A 4BWLA 2J9ZA 2NWRA 3GAKA 1TJRA 3PULA 1DL3A 1TMHA 3L9CA 1A5SA 2BWGA 4IMCA 5LNRA 2V2HA 1W37A 1JJKA 4A29A 4FHAA 4CQ8A 3STEA 3GB6A 3TU9A 5I3GA 4XUGA 1I2PA 2NX3A 3K30A 2ISSA 2ZCGA 2XFWA 1KTBA 3S9YA 3NM3A 3ATZA 3TNOA 4DQWA 4MOZA 3PBVA 1H7PA 3R89A 2E5BA 5L6UA 4LVFA 4S2CA 2TRSA 4PEKA 5TIMA 1K7FA 2ZFAA 3IIXA 1SSDA 5AHEA 2ZZ7A 3A23A 3PM6A 3SIZA 1YDVA 1KFLA 3E9AA 2QKFA 4Q4KA 3QF0A 3W1QA 5DCDA 2CWNA 1NFBA 1FDYA 4MLJA 3IVUA 3QQ1A 3TC6A 3FIGA 3W7PA 1LRNA 3HPXA 3PWAA 5BMWA 2V30A 1VYSX 3W07A 5I3JA 2H3DA 1YXDA 4UTLA 2ZQ0A 4DF2A 4FXRA 2AQWA 4RX0A 1TSIA 1THFD 4HSNA 4DBEA 4N02A 4N6EA 3EX3A 3OVRA 3KRZA 2J9XA 3EWZA 4GBUA 3W83A 4S1FA 1K7XA 4LV4A 3S0CA 4N9BA 4BK9A 3TROA 2FJKA 4O0KA 2E6DA 2GJNA 3KHJA 5KSWA 1FY6A 4NX5A 3ABRA 3TH6A 1LCOA 3QYQA 5FEWA 4A3UA 3YPIA 3P60A 3MBDA 2VEMA 4KFOA 4QAIA 3TX9A 2Y7DA 4DXVA 4XBKA 3NL5A 5HINA 3LHTA 1MXSA 3VKJA 4OQVA 2J6XA 3G24A 1BEUA 1VCVA 2J88A 4IWWA 3BLEA 5CPNA 4UTJA 3NPWA 5KZEA 4UFJA 5CPLA 4UNKA 1C8VA 2EGZA 2Y7EA 4MFDA 5KINA 5C6MA 2A85A 4JD4A 2VOMA 1SZFA 2WKJA 5F4WA 2H8XA 3NQCA 4GUHA 5BNKA 3HOJA 3W23A 1VLIA 1WBHA 1SO6A 4BR1A 2DZVA 1H5YA 3PBWA 4I9AA 2CU0A 3CEPA 4FIQA 3UWZA 2VFIA 2OT0A 1Q45A 3SJ3A 3DI1A 3PSWA 2HSAA 2I14A 3GK0A 1OFEA 3IGUA 3A5FA 1G4EA 4POCA 4YL2A 5D05A 3DBPA 3IGSA 2V5BA 3TFXA 3P74A 4DO5A 3W70A 1GZGA 1SZEA 1XFBA 2QCMA 4H4IA 1ADOA 4M6QA 2P1FA 4O0ZA 1GT8A 3HGJA 4RCXA 5GVJA 2FIQA 4CCCA 2FLIA 1WXJA 2JKEA 4K38A 4Z1BA 3NA8A 1IGSA 3O6YX 3LCLA 2JBMA 1GEQA 1M5WA 3GXTA 1LYXA 3CIXA 3CWOX 4PH6A 2C13A 4AH7A 4LVDA 3AJXA 5K4ZA 1X8FA 5KTLA 2TYSA 3THAA 3GZ3A 2VFEA 2OZ0A 3CM4A 4MVAA 3QQ0A 1EP3A 3LXAA 4LVBA 1TV5A 4ZQMA 2NUWA 3W9ZA 1X6UA 4TR9A 3O07A 4RZ6A 3TQKA 2A2IA 3LB0A 4JTEA 5HULA 4CNPA 5DELA 4N4QA 1OX4B 4M7TA 2GQ8A 4UTWA 5G2WA 3UQNA 5HJLA 1UUMA 4FB7A 3C2OA 1WDWA 1OG0A 4LU0A 3LCXA 1VR6A 2NXGA 3MP3A 5SWUA 1YYAA 3ZS4A 3STCA 1Q6RA 4R7JA 1TQXA 4N9EA 2X30A 1HO4A 2PRMA 3N34A 4MYXA 1H50A 3F03K 2QR6A 1U5JA 3NQGA 2ZZ2A 1CX9A 1XKYA 3OIXA 3FEMA 3QW3A 1GYLA 3B4UA 3HGRA 2QUUA 3GXNA 3IVTA 3S5NA 1YXYA 3SGUA 5DCEA 1B3OA 1L6SA 4NNCA 3GDMA 1SUXA 5H2ZA 4R53A 3WK1A 1G4SA 2X2GA 3L0KA 4FEZA 5EYWA 4GWEA 4PCFA 4I7UA 1LROA 1H7XA 1OF6A 3QFEA 2GUUA 4GXMA 3TA6A 7TIMA 4AHPA 1W0MA 4XBSA 2ZRUA 4ONVA 3GR8A 4FIRA 4O10A 4NX0A 5C2XA 3NNTA 3R5EA 3D0CA 3NQEA 3UPBA 2PRHA 1OFBA 1W5NA 3L65A 4O4VA 2DU2A 3OVPA 1TJPA 2Y89A 4MLRA 2IQTA 2GJLA 4LWWA 3NAVA 5DBUA 1WQ5A 2J9YA 5D04C 1H1ZA 2ZZ4A 4A2SA 1DKWA 5G2IA 3G8RA 4O1DA 3M43A 5KITA 1K8ZA 4JDYA 1A5AA 2EF9A 4Y96A 2EAWA 1KFKA 3GLCA 4Y8FA 2WNQA 3O6CA 4O53A 1DQXA 1ZFJA 4JR5A 4IX0A 3V75A 2C14A 1XL9A 4ADUA 3NM1A 3MI2A 5LGXA 3TW7A 3MP5A 2ATSA 3KVLA 4UFIA 3I6RA 3ANYA 4L4LA 4K7YA 3LRMA 3HB9A 1JQVA 2V81A 4S2BA 1KM0A 4BI6A 4QISA 5D33A 2YCEA 1JCMP 3BW3A 1P1XA 1W31A 1XI3A 1LTDA 3KAOA 3E12A 4ORMA 2V9DA 3LLFA 3W2KA 1V7YA 4JTJA 5LNVA 4WXYA 4MFEA 3TSMA 3OG3A 2H90A 1PCKA 1R2RA 4FF7A 3OEXA 3BO9A 3TMQA 3NPXA 1XBYA 5D37A 4O1BA 2Q8ZA 3PR2A 1F74A 2C6QA 3M16A 3KFTA 4X9SA 1VCFA 1QMLA 1PHWA 1P0KA 3G3MA 1KTCA 2NZLA 4D2JA 2AAMA 2ZRVA 3E49A 1T99A 3EWYA 3NGJA 5F2GA 1A5BA 1W54A 4K36A 4N9CA 3QM3A 3S1WA 1UCWA 2FPTA 3TQVA 4R33A 4UFKA 3H54A 4FNSA 1BTMA 1OX4A 3QMTA 2V2DA 2CZFA 1Y0EA 2CLOA 4CLMA 3HIJA 3OVQA 1VHNA 3JR2A 2V82A 5TQLA 3UWUA 3O6DA 3LLDA 1YXCA 1TPB1 1YADA 2QCFA 3EWBX 4K8HA 1K8YA 3NQDA 4FX6M 3W74A 2VFGA 3C4UA 5EPDA 4UFLA 2P0OA 3B8DA 4LT9A 2CFFA 4GJ1A 3PUDA 1NAL1 5AYYA 4ZQOA 3W1TA 1H61A 5E0KA 4EIVA 1P4CA 3N19B 1EWDA 5LKYA 2Y61A 1IXOA 1TPEA 1MSSA 4AB4A 2QCGA 3NVTA 3QC3A 2YXGA 3RFAA 4RJEA 2ZZ5A 3UY7A 1N8FA 3MYOA 3VE7A 3C2FA 1EUNA 1FXPA 5FF2A 3ZFHA 4A22A 5AHLA 1KM5A 3EXRA 3NQ8A 1SFJA 3PAJA 2Q3OA 2YFNA 3UZJA 3KX6A 4XKYB 4O57A 1E51A 3I7SA 4PA8A 4QITA 5TBOA 1UUOA 4UTTA 4NQ1A 2KZHA 1SZGA 4GC4A 2FB2A 3TIMA 3PY2A 5CPMA 3LTPA 1LRTA 4GUIA 4QM1A 2I9EA 5FF3A 3HPSA 5HNRA 5T26A 3SY5A 1H60A 3MBFA 3P82A 4HN4A 4UMAA 4HT3A 3C61A 4MKNA 3PBUA 2DZUA 5LGZA 1B57A 1JCJA 2QJGA 1SFLA 1XBVA 3N9SA 1LOSA 3G3DA 4AMAA 1H7WA 1KFBA 3IVSA 1KM6A 3Q58A 1C29A 1LP6A 3HF3A 4MJZA 4LVAA 4GUGA 2R91A 4QSHA 3W1MA 1IXPA 3HMJG 5EY5A 2Z2UA 4KFPA 1QOQA 4MZYA 2DZSA 1KM1A 2QCHA 2V8ZA 2ZRYA 4RKAA 2J27A 1AW1A 3NQVA 3MMTA 3P62A 2ZTJA 1WAUA 4J9JA 2E09A 4LOCA 4K8EA 1Q6LA 2Z6IA 4OU1A 2V2CA 3EKLA 3NG3A 3HO8A 2FPVA 2B7NA 1VYPX 4O1AA 2FTPA 2FQIA 3W2NA 5CZ0A 6ALDA 1TQJA 3ABOA 4JYDA 5F1VA 1RR2A 3ELFA 3W2MA 5LSMA 3RK8A 3T55A 3HG5A 1L9WA 2CLMA 2B4GA 5IBXA 1JUKA 1XDMA 1LDCA 3MUXA 2Z0IA 4UTTC 2VC6A 1KM3A 5HR7A 4DBDA 1GG1A 1IXQA 1OX5A 1WOBA 4Z0JA 5AFDA 3W2UA 4MUZA 4XZ9A 4TO8A 3STGA 3UNDA 3U8GA 1IIGA 3TXVA 1BWKA 4JTKA 1TO3A 3MP4A 2C16A 3LCGA 5LHFA 4UMBA 3L0NA 3LBCA 1KFJA 1F6PA 4XTIA 2GVGA 3B0UX 1ONRA 4LY8A 1SW0A 2Y85A 3BGJA 4LUIA 4NXKA 3L68A 5F2MA 2H3BA 4DO4A 2TPSA 4MIMA 4X3ZA 2XN0A 1ZENA 5HUPA 4A21A 4X2RA 3ATYA 4JIQA 3TK7A 3W7OA 2NX9A 1YTDA 3SGZA 1F76A 2ZDRA 1R2SA 3IIZA 4IGHA 4G1KA 4O52A 5AHMA 1Q6QA 4O18A 1O94A 3LOTA 4AEOA 3LHWA 1W5PA 4PC8A 5DBTA 2QDHA 1AW2A 2R14A 3TW6A 1OX6A 3WJSA 3W88A 1G6CA 5HUOA 3GIYA 3L5AA 4M5PA 2TSYA 3P7YA 4OV9A 5I3IA 3Q37A 4EOUA 1EA0A 3F1QA 4RZ4A 3KVJA 3W2JA 4OV4A 2EPHA 3BK0A 5U4NA 2DZWA 2DZTA 4O11A 3QH2A 5F1UA 4IX2A 4BFAA 1TYGA 5IBXC 5EBUA 3TV8A 1TV7A 3EX6A 5D38A 3P5YA 1O5KA 1GWJA 4C1KA 3TFCA 4MJMA 4RR4A 4HNNA 3G0XA 3P81A 2XN1A 3CT7A 4YWIA 2A1YA 4GRSA 3LXBA 2XN2A 3W1XA 3NL6A 1GJPA 4JY9A 1SQ7A 1I2RA 5EMUA 4AHQA 4OHQA 1FXQA 3DXIA 1GTHA 3DKLA 5KZMA 1JRCA 2WSQA 1W5MA 5LNWA 1SW7A 2YX0A 1ZY9A 1Q3NA 3M47A 1XUUA 3E02A 2NX1A 3INPA 5K9CA 1TB3A 1QDSA 5CGQA 5DY3A 2A6LA 2E68A 1QPQA 3TUUA 3UWVA 2GQAA 2ZRZA 3O1NA 1TPC1 1DQWA 1H1YA 4JDBA 3LI0A 5LZLA 1UBSA 2QAPA 4YMZA 1VJIA 2W79A 4WY0B 3RLVA 3L5LA 3MW7A 1MZHA 1GTEA 2Y6ZA 1JCNA 3W7LA 2CLKA 1BWLA 5G2HA 3LHVA 1B4EA 1CW2A 1QNVA 3USBA 4TIMA 1DOSA 3KXQA 3UD6A 2QJIA 2QCDB 3CPRA 3BPWA 1WYIA 3GDKA 4UIOA 3F4NA 3W7EA 3IIOA 1SZNA 1DBTA 4UTKA 5AC7A 1LLZA 1Z42A 3S5YA 3M41A 1JUBA 3EEGA 4DPQA 1OFDA 2NWSA 2G95A 5D2WA 4OWGA 1J5TA 1B4KA 1VZWA 2Y88A 3P61A 3ZWSA 4P2VA 5AOUA 4M6PA 4JNMA 2VENA 4JS3A 5G1YA 3C2RA 5G4WA 3T40A 5K9XA 3W7QA 1HL2A 1V5XA 1OFPA 1F6KA 2BSLA 5FF7A 4KKXA 4JICA 3I68A 2ISWA 3UZ5A 1JCXA 3M6YA 3U6WA 3G1SA 2A0NA 1AW5A 5D09A 3STFA 4UC5A 5KMYA 3NO5A 1GVFA 4ZZ9A 1TPWA 3TAKA 4NJIA 4UTHA 5FEZA 3R2GA 3W1NA 4IXHA 2O7SA 3LX9A 1SU5A 3S6DA 1G4PA 5AHNA 4WX2A 1W3NA 2YZRA 3O16A 5DN1A 1I8JA 1LBMA 5D32A 1N7KA 3PG8A 2ZA3A 2V0TA 2BLEA 3BLIA 3IEBA 5C54A 5HWMA 4QJ1A 4JTSA 1QPNA 3S1UA 4AF0B 3B05A 3NQAA 4U4MA 3ZR4A 4LW7A 3EX1A 4XQ6A 3GXPA 2Q8LA 3S8HA 5FESA 4HPXA 1GOXA 1ZAHA 4CCEA 4ORIA 1JULA 4JYEA 1FUYA 3W85A 1PCWA 1AK5A 2EHHA 5FI8A 4JN6A 4IXXA 5CZTA 2PURA 3BVJA 3P67A 2B7QA 4P61A 5D2XA 1TIMA 5D2VA 3MHUA 4FX8A 4H3DA 3SECA 3BV4A 2ZRWA 3BLFA 3ABSA 1TREA 4O15A 3LERA 4ZQCA 2HMCA 4X22A 3MYPA 1ZAIA 1OYAA 3BARA 3WK2A 5LNSA 4JTTA 1WA3A 1S5TA 5BW6A 1WOAA 1ZHAA 2B7PA 4WD0A 5FEXA 5BRBA 3W7KA 1DV7A 1S5WA 2NXHA 1LOLA 3LCHA 3NL3A 1VS1A 4UUIA 3G22A 5CSRA 4N2YA 2ZZ3A 1SO5A 4Z08A 3PSVA 1LORA 3W1AA 1LLWA 2ATMA 3E96A 3W7GA 1F05A 1QWGA 1OABA 4TMBA 1QPOA 1AL8A 1ME7A 3GKFA 3LV6A 3IGXA 2DZXA 3JRKA 2OT1A 4NNBA 4PFMA 2R94A 2GVLA 4CNOA 1UB3A 3TCEA 3TSBA 3W86A 3S42A 2PRLA 1W5QA 2UV8G 4ZQPA 2X16A 1EP1A 4HKPA 1KA9F 5D03A 3DHDA 1QFEA 3MI6A 1YPFA 2RDUA 2VEPA 3UYCA 1SO3A 4O1CA 4FX7A 4AAJA 3TDFA 1FQ0A 3M9YA 3C0JA 2DZPA 1VCGA 4QIUA 4C1LA 1WV2A 4ZMGA 4HIBA 1VRDA 5AC6A 3P5ZA 3EX2A 4ADSA 1LRQA 5CKSA 4CCDA 3WJXA 5A5WA 2WV8A 4Q32A 1LBLA 2QCEA 1X1OA 3N3MA 4ALDA 4LV9A 4O12A 2HS6A 4JX4A 2VFFA 3DFNA 2Y62A 4LUJA 1UASA 2AGKA 2HTMA 4JXCA 3JS3A 3NPVA 2ISVA 1VGAA 2BX7A 4K37A 1T0OA 1YTEA 3B06A 3G1AA 1HG3A 1EB3A 2OMAA 3BGGA 3NQ7A 4LS1A 3TSDA 5AN7A 1M6JA 4O13A 3A21A 3B0PA 3SR7A 2WPBA 3NYZA 2RKXA 1IF2A 1G4TA 1TRIA 1EX5A 5U7SA 3SSJA 4I7VA 3P8JA 2WNNA 2JGYA 2HS8A 3M0ZA 1TTPA 4O28A 3OBKA 1G69A 3MO7A 4AVFA 3ABQA 4NZFA 3RU6A 5EKYA 3UWYA 3QJAA 1MO0A 2E1DA 2NV2A 3G8EA 5LNUA 1FDZA 1TPVA 2A6NA 3W87A 2YW4A 4LS0A 4FO4A 4IOTA 2E6FA 2YGYA 1A50A 1FWSA 1N55A 1EPXA 1ME9A 3FJLA 3L67A 4M7SA 4Y9AA 3GNDA 4EWND 5D02A 5CPOA 3EX4A 5C55A 3M5VA 3W1LA 1AG1O 3VI2A 3DKJA 2CLLA 4WY0F 1OVDA 3GR7A 3N14A 1DJNA 1KM4A 1P5BA 2WJZA 1TTIA 4JTIA 1W1ZA 2X1UA 2CZEA 3Q2DA 2RFGA 2B0MA 1KV8A 2ABAA 1NVMA 2Z1BA 3PB2A 3L5MA 1JUEA 3W1UA 3BW2A 4MY1A 1QOPA 4Z1CA 3FA5A 3W75A 1KBIA 3UWWA 1KW1A 1OF8A 1CI1A 1YPIA 5G1TA 1SPQA 1J2WA 2OX1A 4UCGA 1T96A 3AO0A 2NXIA 3IV3A 3C56A 2VELA 1EEPA 4NUWA 2QCNA 3PVFA 3VFLA 2ZA1A 1QAPA 4Q33A 1EP2A 5J5RA 3U2OA 4ZVJA 3WJYA 3F4WA 3CB8A 1EUAA 4I7WA 3W2LA 2X1SA 1S5VA 4KWVA 1HTIA 1FCBA 4M6VA 1XBZA
chains in the Genus database with same CATH superfamily
1OJXA 1H11A 2VD9A 1BRLA 2FKPA 1RBOB 1WDRA 4Y7EA 1TWDA 3BG5A 1JQXA 4JGDA 4LUTB 2FPYA 2A3CA 3LPFA 2D3NA 5H8UA 4J3SA 2A4AA 3A3XA 3QV7A 4IPJA 4UFHA 2CLHA 5HWNA 2ALDA 1AFSA 4GVGA 3MDUA 1GVQA 3UU0A 4PL2A 2BY1A 1B5TA 3O2LA 1J10A 4US5A 3WBWA 4UQ9A 4AHOA 3GBDA 3WJWA 3PHAA 1ZALA 4GQQA 4IIEA 5AC5A 3MV01 3OA5A 2OTDA 1A80A 3G1FA 3I65A 3V4BA 2H8ZA 1UP2A 2C3ZA 3OLDA 2TMDA 2VEKA 2J7GA 4AISA 3OHIA 5BOOA 4UOJA 1E9ZB 1YBQA 5CJMA 2Y8VA 2I5IA 3WK0A 5CCZA 1K3UA 1LOQA 3OQ8A 5BU9A 3E6EA 3EOOA 5F7UA 2EKCA 1WZLA 3DIPA 3ONBA 5FF4A 3E0WA 1EQCA 1V0KA 4PMDA 4ZL1A 4DELA 1XQLA 1CXFA 3GVQA 4KIEA 3TMLA 3E3HA 3MPGA 2YW3A 1RJPA 1R2TA 4AWTA 4IJRA 1E1CB 4DM2A 4PYSA 2FZ9A 4WDUA 4H8UA 1G94A 4EXAA 3CT2A 3M0JA 3FYPA 3I6TA 5AYZA 1DIEA 3CQKA 3CJPA 3FJ6A 2XIJA 4NAFB 3GY1A 4YXGA 3F2CA 3HU7A 3CLWA 3ABXA 2Q09A 3NL2A 1EC8A 4WGXA 2CZDA 2XUCA 4DXKA 4PUEA 1GOQA 4GZIA 3EZ4A 5EB8A 2JKPA 4XB3A 2F84A 2YPIA 4AQLA 3PBGA 3AHTA 4RE3A 3NQ2A 4OTKA 3RMJA 1EH9A 1C91A 1ZAJA 3IRDA 2ZZ6A 3B40A 1PE1A 5DQPA 4OGZA 4XZIA 2VL4A 1OADA 1EJ7L 3O63A 3GVWA 4BQ5A 2GWNA 3TOYA 3DG6A 1W9XA 3WLSA 2C1IA 2POZA 2Z27A 1A53A 3I3DA 1A0DA 1E4IA 2R1MA 4JNYA 1PWLA 2HXUA 1Z48A 6REQA 1NF7A 1RZMA 2Z1SA 4QJ3B 2G97A 1BYCA 1P6CA 8XIAA 4KCWA 3LPOA 3SBFA 3N4EA 1PTGA 2J62A 4GI8A 3MANA 2X1TA 4CVWA 4L1XA 1RD6A 4Q4RA 1E6SM 3P84A 2IUZA 1E5JA 2XIMA 3QYSA 3IUDA 1UJPA 3KOYA 4ZSTA 3AZSA 2AQVA 3LCIA 4DWSC 1JD7A 4B5UA 5A8GA 3VYLA 4QDWA 1EIXA 4CNUA 2A5HA 2R9RA 5M17A 3RUBL 3RDKA 3SO7A 1YNPA 1Q2SA 1V3MA 5CZJA 1XD1A 2DSWA 3W6LA 5H91A 1U2YA 2E77A 2CBUA 3EWXA 1QU4A 1WE5A 3PFMA 4L7ZA 4B5WA 1W8SA 2ZYFA 4MNJA 2DQWA 2VM8A 4MB3A 3EOLA 3NEVA 3V36A 4FA3A 1IZJA 2J7FA 1V6TA 3KZPA 3SUWA 3TEVA 3VNJA 3R12A 3DFQA 5C9RA 2WSRA 3CYVA 3VA8A 3KBWA 3PN8A 1XSJA 3L2MA 3TTSA 4NT0A 3QSTA 1G1YA 3EDKA 1H49A 5AHIA 3BW4A 3CHCA 3LSCA 2Y63A 4K3ZA 4DWDA 5HPCA 3NOEA 1JL8A 2VQUA 3NZ1A 4AWSA 4O8RA 2C1HA 4BZYA 1ESWA 2UBPC 1SJBA 2DH3A 4J40A 5I09A 4LNYA 3SGGA 3GXMA 2GQ3A 2A3HA 5I3KA 3WG6A 1R30A 3LI1A 4GYPA 1JDEA 4K39A 3KRUA 3GHRA 3RRAA 3S9IA 3W4RA 1UUQA 5CGMA 2E8YA 5D2YA 3UXLA 3E0IA 4DYJA 1L2UA 2YCLA 2Z6JA 1XYCA 4EPEC 4DJDA 2P10A 5PTDA 4XSLA 1CXHA 4XVEA 3W7MA 1TX0A 3VM5A 2R1PA 3W7CA 2OFJA 4B5SA 3OYZA 5A2BA 2ZADA 4NNAA 2BOGX 1VH7A 3APYA 3UXIA 1V79A 2C19A 4CQ9A 2VEIA 1X39A 1QO5A 1KLYA 1J6OA 1MRQA 1RCOB 2WLYA 3AYRA 1AODA 3UCDA 3VDHA 4U10A 1SJCA 5D2TA 4FNUA 1RAKA 2VC7A 1M53A 3CO8A 2PLJA 4Y6GA 3AXKA 3WLTA 3NYDA 4R34A 3SCVA 2Y7FA 1XGZA 3I7QA 4KCVA 4DBWA 2F8QA 3VIFA 1NWTA 1VPXA 3O0KA 3NQ6A 4FSAA 1XDLA 1NEYA 1HQTA 3HTWA 2BHZA 1TTQA 5CJ5A 3LCFA 1E1FA 5I24A 1XPGA 4QQ3A 3PPGA 3SI9A 3ZJKA 1E6XM 1DORA 4LB3A 3IANA 4DAIA 2DZAA 4AC7C 5F4SA 3WK3A 2L5HA 4LB4A 2XHYA 4MJ4A 3TTQA 1J0KA 2ZX5A 3HG3A 3BDKA 4XBJA 2WOQA 1KGUA 3QPYA 1RCXB 1K77A 2LLEA 2PWDA 1G5AA 3HFYA 1R38A 1NQKA 3V7PA 3MKKA 3BQ6A 3WN6A 1ADDA 3PNUA 1SZRA 1XLJA 1KKRA 5BROA 3GNRA 3GZAA 2YXOA 4B3ZA 2ZXBA 1L6YA 2RGLA 1M7XA 4WHBA 5M03A 3E2SA 3MUCA 5EBAA 1OFAA 1X6LA 2CLIA 2XDFA 4D72A 2HPMA 2PUZA 1XISA 3RG6A 4AF0A 4AZGA 3NPUA 4CVUA 4E0CA 3IUHA 3BG3A 3CHDA 4IT1A 1KXVA 3PFRA 3B9OA 2ZDSA 3NZRA 3RNDA 1OC6A 2VURA 3WQDA 5DCBA 4R3UA 5ABGA 4AD3A 5K3VA 3IJ9A 1XH2A 3WD0A 1UROA 1RH9A 1PO9A 5BOFA 3WF4A 3VZXA 2G3IA 2E9LA 4LS2A 2ZUMA 1UD4A 3VZZA 3GO2A 2XIBA 1NFPA 4JTGA 3CZLA 5BXSA 1I1WA 4GI6A 3BG9A 2EKGA 2IKIA 1D3CA 1NDZA 3A64A 4PCSA 1MW0A 4R9XA 3CUXA 3WLIA 3OW1A 4HYVA 2E3ZA 3AU6A 1TWWA 4YN5A 1P43A 2PFHA 1DTNA 4IFOA 4PMJA 1PIFA 2YR1A 1ZQ5A 2FB3A 4JKKA 4NYYA 5L9FA 3N2MA 4GQGA 3W81A 4JOMA 3ES8A 3B8VA 4HCDA 4JQ4A 5JQ9A 3BJFA 3V16A 4FXJA 5DXXA 1TTJA 5MF5A 3UJEA 1NTHA 3HURA 2VCBA 1XCFA 1Q85A 4CNNA 1DE6A 1VLWA 5CJNA 4AG0A 3PBYA 5CSSA 2BMBA 5A95A 4FP1A 2NV1A 3NVDA 4ZQRA 1KNWA 3HG4A 3QOKA 1TV8A 1GZ1A 2AL1A 4I9TA 4WIWA 4CEXC 2C0AA 3BQ5A 3WLHA 3LTSA 2ZC8A 4P5UA 4NL1A 4LANA 4V1YA 1PX4A 1VEMA 3MS8A 1T40A 3F4CA 3KOXA 1ZB5A 1RQHA 3RR4A 5C5YA 3SZ8A 1XRTA 2G50A 3BWWA 1A5MC 5AKQA 3GAKA 1TJRA 1A5SA 3K8KA 4P7RA 5LNRA 3QHOA 4A29A 1TR9A 4ECLA 2PDCA 1IE7C 2OO0A 5I79A 2BODX 4PUJA 4BJHA 2OOFA 2ZX9A 1I2PA 3K30A 2XZ9A 3WUFA 5T8GA 2R1LA 5HXMA 3PBVA 4GXPA 1H7PA 2MNRA 2A3AA 1HJXA 2E5BA 3QY8A 4OKDA 1BGGA 2OQHA 2TRSA 4YPJA 3HA1A 3SFWA 5HMDA 3IIXA 4DWSA 2GJXA 4X0VA 2DEPA 1JZ3A 1WXZA 1K6AA 3ZVHB 1OGGA 2UY4A 3KLLA 2OO6A 2VC9A 3THCA 2X40A 4B91A 3H4WA 3TC6A 3FIGA 1VYSX 5I3JA 3KTXA 1FHLA 3B9AA 5CPQA 4I6KA 2E67A 4HSNA 4DBEA 5D9OA 3KRZA 2J9XA 3AMCA 1CGVA 4GBUA 4XIAA 3W83A 3S0CA 3EKGA 4V27A 4DBSA 3LK6A 4N9BA 4BK9A 2GK1B 2IPJA 2OB3A 3USZA 1LCOA 3QYQA 3IWPA 4KFOA 3TX9A 2Y7DA 4XBKA 3S1GA 3WCZA 3VKJA 2J6XA 2EJ1A 1BEUA 2GVEA 3H70A 7TAAA 3M07A 4IWWA 2X0YA 4ACZB 3R58A 2NT1A 2A85A 1SZFA 2X05A 3W23A 2WC3A 4I9AA 3DHPA 4UQDA 3B8IA 3ALFA 3CEPA 1UPPA 2PPGA 2VFIA 4NI3A 1Q45A 2HSAA 4POCA 5D05A 1JZ5A 3QQWA 1SZEA 1XFBA 2ZE0A 1LG2A 5GNZA 4O0ZA 4CU7A 1Q7ZA 4AMCA 1BTCA 1JPDX 4CCCA 1HJSA 4K38A 3EYPA 4QDMA 3EEZA 2JIEA 1ZZMA 3PAOA 3WNPA 1M04A 4JIEA 2DSZA 4R7WA 1KD0A 4AVOA 1S2UA 3CWOX 2GSHA 1B3WA 1RALA 3CZEA 3KE0A 3FVDA 1W1YA 5AYBA 1JXKA 4MVAA 1ISYA 3TYEA 4ATDA 1EP3A 4HBKA 4LJ3A 1MW3A 3LXAA 4LVBA 1X6UA 3PWGA 1DJGA 4RZ6A 2A2IA 3UP8A 1OX4B 3RHGA 2GQ8A 5G2WA 1PXGA 1UUMA 1WDWA 1SMDA 1OG0A 3TLQA 1VR6A 3ZS4A 1QOXA 3STCA 5JUVA 1UD5A 1TQXA 2PBOA 3MVIA 2X30A 1HO4A 2PRMA 5CAHA 3N34A 1S2AA 1H50A 4QE4A 1XLIA 1U5JA 3NQGA 3OIHA 5BYWA 3L4YA 4RNIA 1CX9A 1JZ2A 1H09A 2P3EA 3FEMA 1GYLA 2VUYA 2BB0A 1XLHA 4HZ7A 3SUSA 3GU9A 3GXNA 3IVTA 2YIHA 5DCEA 1B3OA 4D6JA 1SJAA 3VILA 3WK1A 2D2GA 3L0KA 3E2VA 4I7UA 4Q8PA 2PWFA 3U5UA 1KQZA 3TA6A 4E4UA 3VNIA 3QR3A 2GK1A 4WVXA 4ONVA 3TP4A 1ZJHA 1A5UA 2YLLA 3NNTA 2QHAA 4O4VA 1BWVA 2DU2A 1TJPA 1S1RA 3RAOA 3H7UA 3EOSA 1Y5VA 1QW8A 4H2HA 1ONXA 3LD5A 4A2SA 4KQNA 1WZMA 4JIHA 3M43A 1A5NC 3WD4A 3QV6A 3AS0A 2EAWA 3AYVA 4KGLA 2WVSA 1ZFJA 3MT1A 4WKAA 3BMXA 1MUWA 1UKQA 1XF0A 3V75A 4HPGA 4QCEA 1CIUA 3B0YA 3WLLA 2EPNA 1NDYA 3ITOA 3RN6A 4QFUA 3TW7A 5REQA 3VK5A 4KEVA 4K7YA 3HB9A 3POHA 4C6OA 4IM4A 4QISA 1JCMP 3BW3A 3CUFA 1BVNP 3VIJA 1W31A 3JU2A 5E0CA 1Z9AA 2Z2BA 4AZIA 3A4AA 3VM7A 2VWTA 1V7YA 5LNVA 3CUHA 4BQ4A 1P0EA 1V6VA 2ODOA 3VDAA 3CZGA 2D1ZA 1GHRA 3OEXA 3P6LA 3FXYA 1XBYA 4O1BA 1IGWA 3PR2A 4IFKB 1VCFA 2QIIA 1PHWA 1PYFA 4TQTA 2NZLA 3T0BA 3W26A 1XKJA 4AY8A 3E49A 2ZKMX 1PDZA 4N9CA 1VB9A 5HJXA 1KRMA 2OLSA 1BXNA 3ITTA 3GU2A 2XFFA 1OX4A 4S3CA 3A47A 2CLOA 4QS5A 4CQCA 1POJA 1REQB 3O6DA 3VVGA 1YADA 2QCFA 3EWBX 4K8HA 3IAPA 3RPTA 3C4UA 4ZODA 5EMKA 3VC6A 4KWOA 4EACA 1NAL1 3MUIA 3RJYA 5LIWX 5E0KA 4EIVA 1D7FA 5LKYA 2Y61A 1IXOA 4ZGYA 3ABZA 2HRWA 2GFTA 4IMAA 3PTKA 1UWQA 3TYAA 3VE7A 2C91A 4XVDA 2PTXA 3IACA 5C9UA 1SM9A 1FXPA 2Z25A 3IJ8A 4A22A 5AHLA 1KM5A 4NZ5A 1MUMA 5M2FX 4XAPA 2YFNA 2MANA 2WCAA 4H04A 1E51A 3J7HA 3W82A 2VX6A 2DDXA 1UZ4A 3E2QA 2PWHA 3GBEA 4Q4PA 4L9XA 5FF3A 4C1NB 3ZMRA 4W88A 1H5VA 5HNRA 4GABA 3SY5A 2P50A 4NHVA 3T1GA 4EK7A 4HT3A 2DZUA 5LGZA 1B57A 3VIGA 2QJGA 2QVHA 1SFLA 2VEFA 4KF1A 3OYXA 4HOWA 4AMAA 2OEMA 2O0TA 1C29A 4LVAA 4GUGA 1GYMA 1IXPA 1KCXA 5GNXA 3KWXA 2Z2UA 2FZDA 3SRHA 5LXXA 1EL3A 3KCJA 3WQ4A 2V8ZA 4RKAA 5JU6A 1PKNA 3KDNA 3UBPC 3MMTA 3P0XA 5C7VA 3QC0A 1Q6LA 1V4YA 2Z6IA 5FD0A 3ZQ9A 4JFVA 3W6MA 1V3KA 3EKLA 3NZGA 2B7NA 5ABFA 2SFPA 4HQVA 1UYQA 2FQIA 1RA5A 6ALDA 3TYDA 4YVPA 1TQJA 5F1VA 4NSBA 5TD4A 1XP3A 1OIMA 2V5JA 2B4GA 3IPWA 3MUXA 3BSHA 2OSYA 2GGIA 3RM8A 1GG1A 2AKZA 2O9RA 3BTNA 4Z0JA 3K4AA 4MUZA 2PODA 1TO3A 1BSLA 1LWIA 2C16A 3MP4A 5LHFA 1JDDA 1XYBA 1AJ2A 3Q67A 4CN4A 4LAZA 3AMDA 3WMLA 1OCNA 1IWAA 1HZYA 4DO4A 5LA1A 2TPSA 2VD8A 3URQA 5E09A 5HUPA 2DIEA 3CMGA 3F7JA 1V3LA 4YTRA 3W7OA 4PBEA 4IGHA 4MWAD 3OZYA 4JIRA 5AHMA 5BXRA 1IEQA 1O94A 1R3QA 4UOQA 4AEOA 1O7AA 5DBTA 1A5KC 3UVIA 3LS9A 1AW2A 2QMJA 2HE5A 2R14A 1ELSA 3TTOA 3WJSA 5HNTA 3WD1A 3VMPA 2TSYA 3P7YA 4OV9A 2QVNA 4P8VA 4RZ4A 2BY3A 5FA5A 4OV4A 3BK0A 4HMCA 2DZTA 1MUCA 1MQPA 3WH5A 1TYGA 4OJYA 5IBXC 1TV7A 3ARWA 3EX6A 5D38A 5I03A 1QI4A 3DBNA 2V3GA 1Q4WA 1FH7A 2H9AB 4H19A 2Z7KA 5G4HC 3P81A 2OKOA 2XN1A 2BGQA 2DPEA 2A1YA 3BAYA 4GY0A 4HHLA 3LXBA 3VD4A 2XN2A 3BUVA 5LA0A 3NL6A 1GJPA 4S3KA 4AHQA 4OHQA 4URIA 1F3TA 1JRCA 2WPGA 5LNWA 2XSXA 4J4KA 3M47A 4PB5A 5HNUA 4XAFA 5K9CA 4BF5A 1QDSA 5DY3A 1QPQA 2PDFA 2V5DA 3UCCA 1QI3A 1DJXA 1EX1A 2WK2A 1DQWA 1H1YA 4JDBA 3C0QA 2VR2A 4KMQA 5LZLA 4JKLA 2IKGA 4WY0B 3AIQA 3WENA 2DW6A 1MZHA 3R11A 4Z2LA 4L1WA 2P53A 2QGHA 4WSJA 3GXIA 2VR5A 1BVWA 2QJIA 3GE7A 3DERA 2QCDB 4L61A 2BY0A 2GZXA 3S3GA 1HJQA 4JEJA 3W7EA 3SCPA 1SZNA 1DBTA 4UTKA 5AC7A 3R79A 3ZJ8A 1MQQA 1BXCA 1M1BA 3VU2A 2UY3A 2J25A 1OFDA 5IHRA 4TVDA 3N9KA 3FCPA 4M6PA 2VENA 4IQEA 1HL2A 1V5XA 4UR9A 1F6KA 1S5MA 5FF7A 1CECA 3W25A 1QBBA 4KKXA 3WYZA 1UD8A 3I68A 5CBIA 1AJZA 4BQ3A 3M6YA 3U6WA 1V02A 3G1SA 3CUZA 1RPKA 3N6JA 3IJ6A 5D09A 4R7OA 1PZ0A 3B8TA 4HD5A 4UTHA 1TELA 1WKFA 5FEZA 3GVVA 3W1NA 4LAOA 4KWSA 5HDRA 4FR6A 4KRUA 1JYNA 3QOMA 1G4PA 3EAUA 3SURA 4ZE5A 2VZSA 5DRCA 4GKTA 1XLDA 2FHBA 3DC8A 5DN1A 2DH2A 5D32A 2MUCA 5JVLA 1A5OC 2V0TA 4AW7A 3S2NA 1D8CA 3SN4A 5C54A 5RUBA 1XIIA 3NQAA 4XAYA 4U4MA 4ZBCA 3ZR4A 1E3ZA 4AY7A 4LW7A 1K9TA 3PZNA 3EX1A 4PMQA 5FESA 2J75A 5C2CA 3WMBA 4HPXA 3K4WA 4JTCA 2Z1VA 3OJGA 1TMQA 1FUYA 2H9AA 2XPKA 1PCWA 1AK5A 1VPYA 4Z42C 5FI8A 1W1A1 5CZTA 2PLCA 3BVJA 2VHLA 3P67A 3M64A 3L2LA 1JYVA 1TIMA 3KS6A 1Q6FA 1HP4A 2ZRWA 3BLFA 2P0IA 4IG2B 4ZQCA 3KDOA 4X22A 5DMMA 1PZ2A 4CD7A 1WA3A 4WD0A 4JFSA 5BRBA 3S46A 1UPMB 3HJEA 1VFMA 4UB9A 4AD5A 1J0ZA 2BHYA 4OECA 3NL3A 1L6GA 2CEQA 1JI1A 3N29A 4PTWA 4K68A 1LLWA 2ATMA 2OGJA 1QWGA 3WQGA 3LGDA 1F9CA 1AL8A 3LA4A 3L12A 2OSWA 4RE2A 3IGXA 2DZXA 1PZ1A 3T8QA 2WMHA 1W9DM 2R94A 2GVLA 1UB3A 3TZFA 4CD8A 3PUGA 4RW5A 3R8HA 3DHDA 1QFEA 3MI6A 2WQDA 5LIXX 4O1CA 4JFUA 4AAJA 1RCQA 4I5RA 3C0JA 1XQKA 1WV2A 3PZVA 4HIBA 1SFTA 1VRDA 2IXUA 3UJ2A 3TA9A 1HNYA 1X1OA 4HJFA 4ALDA 4K1WA 4LV9A 4NAEB 4XD4A 3V0SA 2FYMA 3DFNA 1UASA 1JZ4A 2HTMA 2ISVA 1VGAA 2BX7A 1UH3A 3TTEA 1YTEA 5D8WA 3B06A 1O1HA 1E3XA 1HG3A 3NQ7A 1XIDA 1UW9A 5FAJA 2HE8A 2J7DA 4O13A 3A21A 5FJPA 5HAOA 4F3HA 4REQA 4RE0A 1UQYA 3P8JA 5H8PA 1TTPA 4ZCWA 3MO7A 4AVFA 1VJZA 3ARQA 5EFDA 3ABQA 3MWCA 2OPJA 3UWYA 2E1DA 2NV2A 3TN3A 3G8EA 1FDZA 1FOBA 4HYWA 1VAHA 1EIBA 1VPQA 1E0WA 4AIEA 4HCHA 3FJLA 5EGRA 4M7SA 2Q01A 3QLLA 1EJUC 4DI8A 2VJXA 5C55A 1CLKA 3W1LA 3FY1A 7PTDA 2NLYA 3DKJA 2CLLA 2WJZA 1TTIA 3NOYA 2X1UA 2FGLA 5DMYA 1KV8A 3PB2A 2W63A 3L5MA 4IG2A 3SY8A 4ICMA 1QOPA 4Z1CA 2Y0FA 3H22A 4FK9A 1LQ2A 1E0XA 4N0RA 4EP8C 1OF8A 2TODA 5G1TA 1M3UA 3LPGA 2OX1A 3F2DA 2WMIB 5FJJA 3AO0A 1CWYA 3PANA 4ZEPA 2D2OA 2ACUA 2QCNA 4IPLA 4GNKB 4GYJA 4RPQA 4Q33A 4ZVJA 5I02A 1QHPA 4M80A 2A3EA 1Q6DA 4DBUA 1EUAA 3UG3A 3COTA 2HCVA 3N15A 1XBZA 4IMDA 3RM4A 3C5QA 3GD6A 4JEQA 3IAQA 4AWEA 3G1RA 4O17A 5CC6A 1K1DA 2FTYA 3G18A 3GC2A 5KEZA 3GG1A 1HKKA 2O7QA 1B3YA 1UWRA 2OCZA 4EVZA 3QZAA 2QJHA 1P6WA 2Q02A 4P7OA 3QPZA 3ITLA 4U3AA 4RDVA 1TZZA 3DFHA 1ZP4A 5CG0A 4LVGA 2QCLA 4YYFA 3BLLA 3O8AA 4NAEA 4JQAA 3XINA 4J3TA 1IXNA 1E71M 2ALRA 1XLCA 4LUSA 3IARA 4J3VA 4WJEA 4MSSA 4QTGA 3DI0A 3W7NA 2Z1WA 3KVKA 4ICNA 1QATA 2JKAA 3R0DA 3MJYA 4PTNA 3HZ3A 2GQ9A 3ZYZA 4L4PA 4M29A 1W3TA 2WVVB 2OVLA 2XWEA 3DGRA 1ZJIA 2O4QA 4WKHA 1KRBC 4AWUA 3HGSA 5HNNA 1XLBA 3CEUA 3O15A 4ML9A 3S1XA 5DY2A 5A6LA 5T9CE 2C18A 3LGEA 5G4EA 5BXTA 3O06A 5GNYA 1BAGA 3EMQA 5BMXA 5HPOA 1JCLA 1FX6A 4JTUA 3KRSA 1KO0A 4RPPA 1RD5A 3GH5A 1IQ8A 4HB7A 4AIUA 3TN5A 4IPIA 5FCZA 4HNUA 3WQPA 3UA3A 1GYNA 1GJUA 2VXNA 4MWAB 1PAMA 2NUXA 4XKYA 3H55A 1PWMA 1V03A 3OA3A 1H1NA 1H63A 1H62A 5M3WA 2WSYA 2PGRA 1QR7A 3G1DA 2QJNA 4PE8A 4RZ5A 1PVNA 2G5WA 1TPDA 4ATWA 1AZ1A 2FFCA 2WKLA 1EF3A 1TG7A 3L66A 2FDMA 1K02A 1R7AA 4C6EA 1J96A 3UXAA 3MMUA 2ZE3A 4PFHA 4MPQA 4O19A 3AHVA 1R9YA 3QV8A 4AIBA 1UZ1A 3URNA 4S3FA 4ZO6A 3I7RA 1ADSA 1JF5A 1E72M 3HQ1A 5C9XA 1GOWA 3LRKA 3CPUA 1IR2A 2C15A 3P14A 2F6XA 1V08A 1H0IA 3W76A 1FWCC 1W5OA 3AQUA 4PUWA 3M1ZA 3S2CA 5EL1A 1FHVA 5JH2A 5JMUA 3LCWA 3QZEA 3BJTA 2R1NA 1NWUA 1KM2A 3DAQA 3B0VC 1Z7AA 1C9WA 2XISA 3TJLA 2W3ZA 1D2KA 3M7WA 4ACYA 3DYPA 4JTQA 4DLFA 3ECQA 2RDWA 2YYTA 4PN2A 4UWMA 3H7RA 4LEFA 2B7OA 4CKQA 3TOPA 4NJGA 1I0BA 1RHCA 1EEXA 4A8RA 4JHZA 5F2LA 3M5XA 2IPFA 1RVGA 1HXJA 2E6AA 1SR9A 5DRIA 1Q6EA 2J24A 1GVRA 4M24A 3CBWA 2F2HA 2WVVA 5A2AA 1EC7A 2XH4A 5HJYA 4OOZA 5FEPA 2VZUA 2BVYA 1T6MA 1VFOA 4ZSUA 3OGSA 3VE9A 3FNDA 2A7RA 4N4PA 3CC1A 2CKSA 1OHLA 4MAZA 3EXSA 1J2BA 3K13A 2VMFA 3QR1A 1G7UA 1CDGA 1MW1A 1D8WA 1X7FA 1AZ2A 3W53A 1XV8A 3QEZA 4E2VA 2XGZA 4CD4A 2VFHA 5HANA 1MI3A 1NP2A 2HISA 4LTSA 3LM3A 5CG7A 5A6KA 3UNTA 4IICA 4UTIA 1ALDA 3MHGA 2QDEA 3WBYA 1HUVA 2GPTA 2GVYA 2Q3RA 2GOUA 2QEZA 2P8CA 1OWQA 1Q7QA 3PUOA 4UFMA 3TONA 3V5FA 1ZPTA 4NRRA 1YNYA 3HFTA 4U5KA 1B3XA 2HPIA 5BU6A 3THQA 4C65A 1XIFA 3ERPA 3WH6A 4GJJA 3DHFA 3WLMA 2XINA 4QBXA 2I57A 4HZMA 2YL6A 3AHYA 5ABTA 3N12A 5HQEA 1J18A 5C2GA 2QV5A 5EA9A 3W71A 4JCLA 3UESA 4DJEC 4XZBA 3AS3A 5JBDA 4D9PA 1KV5A 5B7YA 3JW7A 1OSEA 5AHFA 3VGBA 3FS2A 3N18A 1J6PA 2QUTA 1UIOA 4RXGA 1A47A 3TJIA 5J04A 3WQVA 1Q65A 4IUOA 1UA3A 3CHVA 3LHZA 4AXKA 4E3VA 2PDKA 1QXLA 3SCUA 2PC4A 4UTWC 4L6HA 5EMYA 1ISVA 3AIBA 4HSOA 2B81A 2E5DA 3DFTA 3ZLHA 3TZNA 4LF2A 1Y65A 3S4TA 3GC4A 2ABBA 1RQEA 1KKOA 4AZ5A 2ZOXA 3G6MA 3WO8A 1MEIA 2G4JA 3WFAA 4KFNA 3SUTA 1YX1A 1ML1A 1S3HA 2HZGA 1F4HA 3AZTA 3IJQA 1NSJA 1Y5XA 4Q7BA 1DJQA 3FSTA 1A3XA 2UY2A 1CB2A 3H2CA 3OZMA 4LX4A 2CZ5A 1JCTA 3IUIA 3N6HA 3TR2A 3F2BA 1OC5A 4Q6XA 1JFXA 1J01A 2JGQA 4ZXLA 4DZAA 3B8UA 3PJUA 2BASA 4FNQA 3WQEA 4JTLA 4YHEA 1M7PA 4HMDA 3WX7A 3QRHA 1GPWA 1KFCA 4LRSA 3TAOA 2WMFA 4MKSA 2BDQA 3F4VA 3XISA 4MY9A 1DIOA 3DU0A 1L8PA 3O9NA 4HA3A 4MYAA 2V68A 4HN8A 5AY7A 4HP5A 4Z17A 1D7KA 4U28A 3LHUA 1HO1A 3PB0A 1RQBA 1X1ZA 2ZX8A 4OT7A 1XIHA 2YSWA 4CQAA 1NP0A 4PUKA 4UMCA 4ILSA 4Q3MA 5IFTA 3EWWA 1KQYA 4G56A 1J12A 3WNMA 4B5VA 1OFOA 4JX5A 4E8GA 1CGWA 4HPHA 4K7VA 1FWJC 1BYDA 1XG4A 3LRLA 3WSUA 4O14A 3DENA 4XAGA 3GVGA 3HPAA 3AIWA 2Z4GA 3G1YA 3NQFA 1FH9A 3FYOA 1A3HA 1OFQA 1ZS2A 4C5ZA 3EPMA 1PTAA 5MKGA 1SO4A 1ICQA 3GHTA 4UTMA 5K7JA 4EE9A 5AC8A 4XD5A 4AC1X 1EWEA 3TR9A 1FCVA 3GDTA 3L0GA 2XVNA 4Z1AA 4Q4QA 4O0QA 2DP3A 4NJJA 3OPSA 4ZA0A 1NF0A 3KVMA 3B03A 1B90A 1U83A 3SCSA 1KLZA 1GVSA 1GZJA 1GOMA 3QMSA 3T9PA 1GVOA 4H9UA 2C71A 2E5CA 2X7WA 5IHSA 3BJSA 4RXFA 3TKFA 3QGVA 3KUMA 1I45A 1K6WA 1OYCA 5K2ZA 2JIWA 3AXIA 4FXSA 4F2BA 1ENUA 1MDLA 1RK6A 4ERGA 4JFWA 4HNCA 3WFZA 1MRAA 3PPCA 3TC7A 4TXEA 3K1GA 1ECEA 3CASA 5I00A 2OQYA 5AC4A 3ARVA 4FNPA 3G1VA 1QVBA 1W56A 2VYOA 3IIPA 3KL0A 4GIEA 5DFAA 5LIKX 4ZOAA 3MU7A 4W8LA 2DUXA 3PJXA 1UR8A 1FFRA 4IMFA 3V5OA 5ENLA 3M44A 4JTFA 5T91A 4A3RA 4LC8A 5IDZA 1EDQA 2IXVA 1ZNNA 1WZAA 5I3HA 3CIWA 1PX8A 5FF0A 1M7OA 3HPZA 4C6JA 1VFLA 3UGVA 2VVNA 3WNLA 1NH6A 1TRDA 2HK0A 3SW6A 4CQDA 1C8XA 4JYFA 2OSXA 1BF6A 3N9RA 5CZSA 3UYIA 4MY8A 2W6RA 4R9OA 1DVJA 5DMLA 2VO5A 4L4MA 4UQCA 3KRBA 1UR1A 3GTHA 3KBVA 3SRFA 3AFBA 4CNSA 4IMCA 3OGVA 1NWSA 3MKVA 1E0TA 4GC3A 1B30A 3UERA 4FHAA 2X7VA 4IIBA 3TU9A 2WM1A 5I3GA 4F2TA 2NX3A 1M7JA 3KBJA 3RMEA 2OWCA 3QZ6A 2ZCGA 3SN1A 2Y24A 3ATZA 4GY1A 1N8WA 4DQWA 3WF3A 2GDUA 4RNFA 1JG9A 2RGMA 4W7VA 3WQ8A 2PU0A 2WSPA 4J3XA 1FWAC 3R43A 1SMAA 3C86A 3WBXA 1SSDA 5AHEA 1EJSC 3G2GA 3A23A 4TTGA 3SIZA 1XYMA 1YDVA 1TUXA 2WZTA 4HNOA 4H9XA 1PSCA 1RY0A 4Q4KA 4W89A 4X60A 4C60A 1GHSA 1NFBA 3IVUA 5FJOA 3HPXA 3PWAA 2V6AA 2YA0A 2DV0A 1B3VA 1YXDA 4J28A 2VRQA 1HKJA 2VRJA 3HQOA 2AQWA 1QHOA 4RX0A 4KERA 3EX3A 2O9TA 4YTTA 4DJDD 2ZUNA 3EWZA 4S1FA 4UTFA 4LV4A 3A4XA 4O8AA 3TH6A 1AD4A 1ZCCA 2FH6A 3L4VA 4C7DA 1XIGA 3MBDA 4S38A 1XH0A 4QAIA 3SADA 2DSVA 3OHMB 4OQVA 4UNIA 1JF6A 5CSUA 3MUY1 4ASTA 3A6OA 3GWQA 2J88A 3BLEA 5CPNA 4UFJA 5CPLA 4UNKA 2EGZA 2PB1A 3II1A 5KINA 1OT1A 4QSFA 1GORA 2WKJA 1T8QA 3MV11 2JF6A 3NQCA 4GUHA 3HOJA 2OELA 4BR1A 2DZVA 1H5YA 3RR1A 3RRXA 3TQPA 4S3JA 1KGXA 2OT0A 5D9NA 3UXKA 3WKZA 3PSWA 3VIIA 3MZNA 4HHMA 1EXPA 4U3CA 3DBPA 4DO5A 4Z1YA 4F0SA 3W70A 4RNJA 2YCIX 1TV2A 1ADOA 1EBGA 3O6AA 7REQA 2YA2A 2GUYA 2IPGA 3HGJA 1H41A 2WCGA 4BS0A 1UD6A 2FIQA 2FLIA 2DVTA 2V3FA 4Z1BA 4HVXA 5D9PA 2JBMA 4PUMA 2J7EA 3GW3A 4DJEA 4I5XA 4FR1A 1FTXA 4PH6A 2C13A 2P3ZA 4AH7A 2HXTA 4LVDA 1EJVC 3AJXA 5K4ZA 1X8FA 5KTLA 4OUIA 4B3LA 3GZ3A 5E6ZA 4Z2KA 3WNOA 4C7FA 2OZ0A 3QR0A 2NQHA 1OGSA 4US6A 1TV5A 3AZRA 4H9ZA 3W9ZA 3TQKA 4DRSA 5CPSA 3LB0A 3BMWA 3GR4A 1WDQA 2CHOA 5HULA 2YDRA 1BG9A 4CNPA 2VQTA 4M7TA 4UTWA 5HJLA 1UHVA 3C2OA 2W67A 4NP7A 4GI4A 2W62A 3WH8A 1WUEA 2Y1HA 4LU0A 4DY1A 5A6JA 1J0JA 2PSNA 1FKXA 3MP3A 4MB4A 5SWUA 2YBUA 5FL1A 3ISIX 4ERAA 3AAMA 4Q8OA 4N9EA 1KR0A 4AY1A 1NU5A 3F03K 1QUMA 5FJUA 3JZEA 2VGFA 4QCFA 4FPSA 3B4UA 3HGRA 2QUUA 1YXYA 3GDMA 5H2ZA 1U5HA 2P8BA 1G4SA 4FEZA 3VGHA 4GWEA 4G7EB 1DJYA 1H7XA 1EZ2A 1W9UA 1VF8A 3CK5A 4AHPA 1GOIA 4A8NA 4BCEA 5TF0A 1NQ6A 2WCSA 1XICA 3GR8A 4GYFA 4FIRA 3ALGA 4BEQA 1W9VA 4G1NA 3NQEA 1X38A 3OVPA 3PP7A 1UOZA 2IQTA 2XTKA 3CXOA 1MW2A 4LWWA 1BHGA 5I77A 3NAVA 4LFYA 5DBUA 1WQ5A 3MCNA 4D6HA 2D22A 1DKWA 3B0XA 3DESA 4O1DA 3IJDA 1R3WA 3NZPA 2EF9A 2GGHA 1ISWA 3O6CA 1DQXA 1X8CA 1KRCC 2ZUTA 2PLMA 4WDWA 1XL9A 4QG8A 1GNXA 3AWNA 1HN1A 4GHRA 3RGTA 2ATSA 5JXQA 3ANYA 5E6YA 4DJFC 1KRAC 2GOKA 1BRLB 5FJRA 2WMKA 4CCZA 4Y9MA 4HU3A 3KAOA 3E12A 3VD7A 4ORMA 5I7GA 3LLFA 1A4LA 2ISFA 4WXYA 1VENA 4J3ZA 3TSMA 1EC9A 3N3TA 3ZT6A 1PCKA 1R2RA 5LA2A 4F8XA 3BL3A 3NPXA 5A1AA 2Q8ZA 3KFTA 2YLAA 1P0KA 2XVPA 3G3MA 3MY9A 1QJWA 3NGJA 5F2GA 1W54A 4DYKA 1F3WA 3QM3A 3S1WA 2XSAA 3C8NA 2YZ5A 5CH9A 1K70A 3QMTA 2V2DA 1Z89A 1XLAA 2Y8KA 1YBQB 1ZJBA 2J47A 3GG8A 2V82A 3GNOA 3ZXWA 5TQLA 4PMYA 3CL8A 4MB1A 1YXCA 4U33A 3W74A 3SM0A 3OZPA 3I3BA 3WQCA 3VX0A 4F79A 1HF6A 1O5RA 2J8FA 3DYOA 5AYYA 4EPDC 3CAQA 3HQPA 3BAKA 5C7HA 4TX6A 1P4CA 3N2CA 1W1B1 2X8RA 4DWSD 4G7EA 4M6UA 1MSSA 4AZ6A 3OO2A 3WMCA 3NVTA 4WR3A 2YXGA 4QQUA 3UY7A 1N8FA 4CUCA 2V63A 1EUNA 3NQ8A 1W1IE 4GPNA 3NDZA 4DUXA 1XGDA 3KX6A 2F61A 1US3A 4WDXA 1EOKA 2DUZA 3IJIA 3NQBA 4F0KA 1MFUA 3CPGA 3B3DA 4NASA 3GTIA 1Q63A 3TIMA 2E9MA 2Z24A 1EA9C 5CPMA 1LRTA 2X42A 2I9EA 3UR2A 1KCZA 2VGGA 4B5TA 4L6OA 3U7BA 1OQFA 3H23A 2XIIA 3H26A 2HQAA 1UH2A 1SFSA 4UMAA 5CSYA 2PDPA 1UWSA 1EZWA 1I60A 1XBVA 2JE8A 2VZVA 3N9SA 3V1HA 2ZVRA 3AWOA 1KFBA 1KWKA 3NWRA 3RLHA 1LP6A 4QS6A 1UR0A 2R91A 4H9YA 4KFPA 1QOQA 3FHQA 1KC7A 2DZSA 4IGNA 6REQB 2ZRYA 1HVXA 2J27A 1P6BA 5E70A 3NQVA 3EDDA 4JL1A 1WAUA 5CQ1A 1KBLA 1MFVA 4OU1A 4PMOA 5BRQA 4H8HA 2ADAA 3VGEA 1YEYA 2W92A 3HO8A 3M7SA 3URBA 1A0EA 1H2JA 4RUBA 3PK7A 5AECA 4HTYA 1H4PA 3LPPA 1NARA 3HG5A 3T55A 4NG3A 2CLMA 4UQBA 4L56A 2Z0IA 3AIRA 1E43A 4UTTC 1XLFA 3R7MA 1OX5A 2WBKA 2RAGA 5AFDA 3W2UA 3UNDA 4XZ9A 4ZXOA 3AUOA 2WW5A 1E4NA 3U8GA 1A3WA 1DIDA 1UWTA 4UMBA 4ZE4A 4F0LA 4JAWA 4XTIA 2ZUSA 2X0SA 1ONRA 4D1IA 1SW0A 5FOOA 3KTSA 3BGJA 3VKBA 2Y5SA 2WSKA 4MIMA 5C70A 2IPWA 4X3ZA 1J5SA 1E9IA 5FSEC 4JIQA 3SGZA 2ZDRA 3IIZA 3OBAA 4JTAA 4O52A 1Q6QA 1HL9A 1AUSL 4O18A 4EPKA 1N8IA 4NIRA 1UKOA 1NIUA 2DFAA 3LHWA 1W5PA 4PC8A 3CV2A 3T2OA 2QDHA 1AH0A 1TA3A 4LH8A 1ZRQA 3TW6A 3W88A 4M5PA 2GDVA 3VGGA 3Q37A 4QRNA 1JPKA 3BAIA 1JZ8A 4UCFA 3KVJA 5U4NA 3K1DA 1JDAA 1RA0A 1WKEA 1XYAA 3AROA 4BFAA 3TV8A 1EGVA 3P5YA 2PTWA 1X96A 4FLSA 2PBGA 1RLCL 4MJMA 4RR4A 4HNNA 3CT7A 4YWIA 1JIBA 2Z1XA 3E5BA 4GRSA 3VOJA 1S2VA 2YCLB 2NV9A 1W3KA 1GONA 3CH0A 4B16A 4KEZA 4LEQA 1SQ7A 3IS4A 3KCOA 3DXIA 2WSQA 3N04A 3OLGA 4JL2A 3ZT5A 2YX0A 8XIMA 1FWFC 2E7FA 3ITXA 2NX1A 2VCAA 3E74A 1TB3A 1XYZA 3GU1A 3BCFA 2E68A 4PTXA 4EAYA 4C91A 1FWGC 3UWVA 2GQAA 3DN5A 3WLPA 5B80A 1EJWC 1TPC1 3LI0A 3MKCA 2QAPA 2ICSA 4FLOA 3MW7A 4GLEA 4HK7A 3SQMA 2BY2A 3JZUA 3FGCA 1VP5A 5G2HA 3TN4A 1B4EA 1CW2A 4HJWA 4TIMA 3TWAA 4QLJA 3UD6A 3L4ZA 3CPRA 4C6DA 3SAZA 1GKRA 4UIOA 3IIOA 4B4FA 4S23A 3S5SA 3NCOA 1LLZA 4PMVA 3WBAA 3S5YA 4J1OA 1UP3A 3QHNA 2G95A 2C0HA 4GMEA 3KCLA 1VZWA 3ARZA 2Y88A 3P61A 5AOUA 4P7QA 5G1YA 4JNMA 4JS3A 3NFUA 3NIYA 4Q8TA 3T40A 4A8LA 4H9TA 2UY5A 3ICJA 1F61A 4JICA 3EGJA 1ISZA 1RSCA 1XLGA 2ISWA 2INFA 1LL6A 5DX7A 1JCXA 3R6IA 5A69A 3GDBA 1TVPA 1Q66A 5E0FA 3STFA 5KMYA 2R6OA 4F0HA 4MNMA 3S6DA 3BURA 2ZIDA 1VD6A 3VKKA 5H1WA 1I8JA 4W7WA 1LBMA 1N7KA 1U33A 3U2ZA 3SIMA 4H6EA 4DJFA 4H9MA 4JIIX 2BLEA 3U2CA 3D5HA 3IEBA 5HWMA 4QJ1A 4JTSA 4J35A 3DYMA 2XWDA 3S1UA 4AF0B 3ZLFA 6XIMA 1CCWB 1UMYA 1GEHA 3S8HA 2Q8LA 4HHHA 2AMXA 2PCEA 4ORIA 3FXGA 1C7SA 4JYEA 4IP7A 1BVZA 4AZCA 1FWIC 4IP5A 2EHHA 4DXXA 2Q71A 4JN6A 2GGJA 3IK2A 4FX8A 4H3DA 2HVMA 4LCQA 2OX4A 1RLDA 1TMLA 1K9EA 3MYPA 1ZAIA 3KL3A 1NFGA 4JTTA 1Z6KA 2E1WA 1S5TA 3N11A 1WOAA 4KESA 2PF8A 1DV7A 1S5WA 2NXHA 3UPMA 3HMCA 1UR3M 3W38A 1VS1A 2IQDA 3G22A 5CSRA 3HV8A 2ZZ3A 3E2RA 2PZNA 4PTVA 3WF2A 3W1AA 3BSGA 4S3BA 3W7GA 2PGEA 1XIJA 1OABA 2WKGA 4RNHA 4AFYA 2VEGA 4GGBA 2JFEX 4W85A 4G6CA 1IEVA 3JRKA 2OT1A 1Q7MA 4NNBA 1DWHM 4PFMA 3ITCA 4OOUA 4KRTA 5JIWA 3FV9A 3WDRA 2E28A 3W86A 3EOEA 1JYXA 3LN3A 2EG8A 2YA1A 1W5QA 4ZQPA 2X16A 1RJRA 1YPFA 2QUMA 2EPKX 2DZPA 4C1LA 2HVOA 1DEDA 3SCOA 3QLDA 4GKLA 5CKSA 3STPA 4CCDA 3WJXA 1OZMA 3CQHA 3EWDA 3MCOA 5A5WA 2PP1A 4Q32A 1R3VA 2VCCA 4R27A 2QCEA 3N3MA 4G7FA 4L4OA 3HPFA 2PTDA 2BGNE 1M41A 3HN3A 2AGKA 3AIEA 4JXCA 1PDYA 5H6HA 4K37A 1T0OA 4B9YA 1UMLA 5A6MA 3BGGA 2VP8A 2QXWA 4X9YA 3TSDA 3ARUA 3LNMA 3TTYA 3MJMA 4X2PA 5U7SA 1EX5A 3SSJA 4BKNA 3I6EA 3OBKA 1G69A 1ZBCA 1SGJA 4YS1A 1TFVA 5AZ1A 5EKYA 3AMLA 1QNQA 1TPVA 2A6NA 3W87A 4ZO9A 4FO4A 1TWZA 4IOTA 3LMZA 2E6FA 2NT0A 2YGYA 4Y9AA 3RX2A 2EG6A 4DI9A 1ZJAA 3EMCA 3KBNA 3N4AA 3EX4A 3M5VA 4KEUA 3UF9A 4XZMX 4WY0F 1OVDA 1JDFA 1DJNA 4W4QA 3WLRA 4MF4A 2XFRA 4DWSB 2GJXB 4K1GA 3Q2DA 3W00A 1JFHA 1BKHA 1V6UA 2ABAA 2Z1BA 3W1UA 1MXDA 1KBIA 3UWWA 1B0IA 1QNPA 1GVIA 4DUOA 1SPQA 4NI8A 3MUAA 4PB4A 3WEZA 3F5JA 4G8TA 3S2MA 3PVFA 4CQBA 2FZNA 3OLIA 2A3BA 4Y9PA 1TJ0A 4B90A 3VNZA 4J7RA 3K8LA 4I7WA 2X1SA 2BVDA 2OWWA 1S5VA 1OEPA 4KWVA 4NKCA 5A94A 5A6SA 4INFA 4ICCX 4Q4OA 3W1PA 1AMKA 4DZHA 4HNTA 3MO4A 4OE7A 1WDDA 3L4TA 1JRBA 1TZ7A 1B31A 2BZNA 2RH9A 4UNLA 2EPMX 2DW7A 4JQ1A 1J4EA 3HQNA 3CAKA 4JNZA 1OIFA 3W0KA 2BXVA 1F7BA 5F4XA 3FKRA 1I4NA 9XIAA 2EJAA 3WFLA 3LUTA 3N73A 4H6RA 3GDRA 1TVLA 1GPFA 2CLFA 4QHRA 5A2CA 4IJBA 2HJPA 5I3FA 2RDTA 1O60A 3PF3A 4GNJA 1FKWA 3BOFA 4KCUA 2DORA 3A24A 3EA2A 1P0NA 1BFNA 2CHRA 3MSYA 2ZZ1A 1E55A 2NW0A 4LRTA 3AIVA 3L21A 1XH1A 3ZJ7A 1E6RA 3SRKA 3LSBA 4DEFA 1YMYA 4EF8A 4YNGA 4AYSA 5DLCA 2CYGA 4OBSA 5A6TC 2NQ5A 2YKKA 1ECQA 1GQNA 1DWJM 3SEPA 2WMGA 3VABA 4YLWA 2XFYA 3OGRA 3P80A 1PBGA 1W91A 2PWVA 3GFZA 4DO6A 3M0KA 1FWRA 3AXXA 5MHBA 3H6OA 3SUVA 3JUGA 4QAWA 4UZUA 4F0RA 2G3NA 4QJ5B 4B3KA 2F7FA 3NO3A 1JI2A 1O95A 1UR9A 3RF9A 2VUNA 3AJ7A 2VKZG 3VNDA 3BCDA 3KP0A 1PL9A 5E9XA 5D8ZA 5E5CA 1T5AA 3SCQA 4GQRA 4HHPA 2DJXA 2HBVA 4QGCA 3W01A 1XGEA 3KWSA 4B5NA 3FLUA 1IT0A 4WXZA 5G5IA 3D46A 3UVAA 2WYSA 5E93A 4GFIA 3W3OA 1GOOA 4MDPA 2ZTKA 2WZIA 1YDOA 3AU2A 3G1HA 1YRRA 1GQKA 3UY8A 3HGOA 4GY7A 2WNZA 1Y7VA 4EF9A 1YE4A 2X1RA 1IV8A 4EAMA 3M0MA 3QPEA 4Y9OA 3CHEA 1QRQA 5A6BD 4JKMA 5KZDA 1CT5A 5AYXA 2PDLA 3DH7A 3PZMA 4B92A 7ENLA 4DUVA 4D6CA 3SFKA 1V3IA 1TPUA 2VWSA 1US0A 1JR1A 1W2PA 4WJXA 2WO5A 3N2XA 2QJMA 4GIRA 5DMNA 3BZJA 4Z2IA 3M5ZA 3W7HA 2CHNA 2WQPA 2G8ZA 2NLIA 3EB4A 3N13A 3T81A 4GZJA 4GQ0A 2PLKA 1WX0A 4RLIA 4PB3A 2FMNA 2CBJA 3A12A 2PP3A 2QV4A 3R13A 3SUUA 3OU8A 1NOWA 4H8NA 3TE9A 2FDSA 5REQB 2WHKA 5CLTA 3GNNA 3CMFA 2D24A 5DANA 5CLWA 1VQTA 3SCTA 4C5YA 2E9BA 1EGMA 5B7ZA 2PDNA 4K6AA 1H51A 3ORWA 1IWPA 1U30A 2JEPA 4A2RA 3WDHA 3B9NA 1QCWA 4GO8A 2WXDM 1Q8AA 3ARYA 1XM3A 4LUYA 4E2DA 2O56A 4YCPA 4DF0A 3E0VA 2O92A 3K5XA 1Q2RA 3C2EA 1XLKA 3SRDA 1ME8A 1WKDA 4YTUA 4GQBA 3S5ZA 1D3HA 3KM8A 1QBAA 4KS0A 4YCOA 4D6EA 3FAWA 1H7OA 1LBFA 3FW6A 3ANUA 4A6GA 3NXFA 4MZ8A 4AU0A 1FBAA 3KOFA 4C90A 1M03A 1BG4A 4NJHA 2PZ0A 3D3AA 2YL8A 4NJKA 3G1XA 4UQEA 3VCRA 4BI7A 4OZOA 1A5CA 2WZMA 4HPNA 4H6KA 1LQAA 4BI5A 1B3ZA 3N1AA 1K8XA 3PPFA 4RV8A 3U9IA 4PULA 1KFEA 1PUDA 4PCNA 1WBJA 3MUZ1 2INZA 1R47A 3S6TA 4B4HA 1L0PA 2RDXA 3CV7A 1BQGA 3OVGA 3ZSSA 1EJTC 5EMMA 4HCLA 1I2QA 2PMQA 4DAFA 3TW9A 2J8TA 3VPLA 3EOUA 1RV8A 3BAWA 4KIRA 2OOGA 4M1RA 2A7PA 2VGBA 2H6RA 3IJLA 2FVKA 2QAFA 4C6MA 2DVXA 1CENA 4I8YA 3O05A 4LSBA 1ICSA 1XR2A 2UWFA 1JXJA 2DJLA 3KBSA 2DT0A 4YJ5A 4JBRA 3B04A 1F2JA 1Z8AA 2EPOA 2FHCA 1R3YA 4GNVA 4JTHA 3GRIA 3GS6A 1WDSA 1W17A 4JN8A 3VD5A 3TCSA 1YW1A 1VJSA 4IIDA 1LF1A 1XC4A 1JNEA 4MNKA 2W61A 2O55A 4Z2JA 3PTMA 4GYPC 4DHGA 2ESCA 3GC5A 1UKSA 2BGSA 1B9BA 2IKHA 4XUYA 4R5EA 3TXZA 4D71A 4Y2WA 2ONEA 4HMEA 4AZBA 1QNRA 1WKYA 3CWNA 1OD8A 1YDNA 1O68A 1R46A 3BXWA 3W24A 2FZ8A 4DM1A 4HA1A 4GVFA 5ABFB 3U4FA 2I1OA 3SSZA 4XTDA 1D3GA 1IT8A 3R8RA 2HWGA 3AHZA 3RU8X 5HMSA 2V5KA 4HPJA 2G3FA 1XRVA 4PSPA 1YHTA 1JAKA 2BOFX 2VT0A 2HROA 1F6YA 1I1XA 3L2IA 2OU4A 3WUBA 2BVWA 4V15A 4TU1A 1PHQA 2D3LA 1BD0A 2V5CA 3RYSA 4LC6A 1F73A 3R25A 3M0IA 1P48A 1S3TC 3EPOA 4DF1A 3LYEA 4WOQA 3ZLGA 4DN1A 1Y8BA 2CNCA 2JK2A 2PDGA 2G4FA 5K4XA 1ZCOA 3A5VA 1C9DA 3V1PA 2BXZA 2J7HA 2GYIA 3CS2A 1P7TA 5FL0A 4D8ZA 1YIXA 5K9DA 4UTUA 1YLVA 1GKPA 4PL1A 6TIMA 3FDKA 1OGBA 3LQLA 4A05A 2QUVA 1GG0A 1OYBA 1OY0A 8TIMA 4C6CA 1FDJA 1XUZA 3QMRA 2YYUA 1XIEA 3BGAA 3T8LA 1R9XA 2ACSA 3WL1A 1V0MA 4IL2A 2PD5A 2W0UA 3BZGA 2XVKA 2VTFA 4LYPA 2V5LA 2YBVA 4JX6A 4M81A 4TVUA 1WP6A 3FDGA 3W37A 3QV9A 5E1QA 4HOZA 1R85A 5HATA 1JVNA 1VKFA 1MEWA 1YTKA 4W8BA 5DF0A 1JGIA 2XG9A 4AZ7A 1HGYA 4N6FA 1XLMA 4NY2A 1TWIA 4O4WA 4S3GA 1FWTA 1JPMA 4E3TA 3S5OA 1VFSA 3HJZA 2RJHA 1UR2A 4B9ZA 3CB3A 4NVTA 5CC5A 4HA4A 1B1YA 1BYBA 3PUEA 1O5XA 3G77A 4J2PA 3MDWA 4N7QA 1RPXA 1EDTA 4ADTA 4FXFA 1VBRA 5I5RA 3VGFA 4DLMA 2DT3A 1F8IA 1V77A 4I9JA 3GIPA 4FZIA 1EJRC 3FFSA 3W22A 1E6PA 2RJGA 3T7VA 4O16A 4KETA 3PZOA 3NURA 3TYUA 5HWJA 1A4MA 3W84A 3W1RA 4GK8A 4HSHA 3NQMA 3LBMA 2HVNA 3PZGA 4IMGA 4DO7A 1IIHA 3ME3A 4Y90A 2V69A 3IGHX 4XSMA 4BHYA 2I9UA 4RDZA 3E5PA 3WD3A 4M19A 4ATLA 1Q5MA 2YDAA 4ZB2A 3LDVA 2Y5EA 2GSEA 2D73A 4F40A 2J9ZA 2NWRA 3MTWA 4OFCA 3PULA 3E1F1 3L9CA 1RVKA 2BWGA 4AEFA 3UJFA 5XINA 3WQFA 4C6FA 2V2HA 4WSHA 1JJKA 1J8VA 4CQ8A 3M0VA 4RL3A 4AD2A 3H2EA 1ZLPA 4XUGA 4HMNA 4ROQA 1VBHA 2XFWA 1KTBA 3WD2A 4MOZA 2YL9A 1GOKA 2C79A 3OTRA 2IKJA 4U31A 5CAKA 5L6UA 4S2CA 4PEKA 2NVAA 1K7FA 5TIMA 1JAEA 3KS5A 3NSNA 2ZFAA 2OKTA 3GG0A 4C7GA 2ZZ7A 3VNMA 1E6ZA 1W9PA 3PM6A 2XIQA 4LALA 1KFLA 3N17A 1W32A 2QKFA 3E9AA 1SJDA 4CN1A 3FHAA 3LBOA 5DCDA 1KGWA 3WIJA 2CWNA 3AALA 2ZUWA 1FDYA 4MLJA 3RCNA 3QQ1A 1EJXC 1FWHC 1LRNA 1Q8JA 1J0HA 2V30A 3W07A 2H3DA 4OIFA 2WWCA 1XPYA 2ZQ0A 1U5VA 4AEEA 3WY1A 4DF2A 2W27A 3QVQA 2ACRA 4N6EA 3VMOA 3W28A 4HA0A 1K7XA 3A13A 4EXBA 4O0KA 2E6DA 5CXPA 2GJNA 3KHJA 3H2NA 5KSWA 1FY6A 3GIQA 3ABRA 5FEWA 4A3UA 3YPIA 1BF2A 4KW2A 7A3HA 3CUGA 4Q8VA 1RK5A 1KXQA 1LJYA 3R1ZA 3NL5A 1ONWA 3ZR6A 3G24A 4LUTA 4PUNA 3B4YA 4AUBA 3CAVA 5GQBA 3EDEA 1MYRA 3RIKA 1C8VA 2Y7EA 1HJWA 4MFDA 5AYIA 4JD4A 1S5NA 1ZSXA 1XW8A 3FAXA 5F4WA 2H8XA 1A0CA 5EFFA 1K4HA 5CBJA 5BNKA 1VLIA 1SO6A 4QE5A 3FSUA 3ES7A 3RPMA 3PBWA 2VI0A 3K2GA 1MVYA 4L1GA 2XU2A 4KH2A 3SJ3A 4F9JA 3F5LA 1TR1A 2I14A 3GK0A 1OFEA 3A5FA 1G4EA 3UJRA 4YL2A 3IGSA 2V5BA 2WHLA