3W8IA

Crystal structure of ccm3 in complex with the c-terminal regulatory domain of mst4
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
193
structure length
184
Chain Sequence
MVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKLEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Unique Heterodimeric Assembly between Cerebral Cavernous Malformation 3 and Germinal Center Kinase III.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
molecule keywords Programmed cell death protein 10
total genus 75
structure length 184
sequence length 193
ec nomenclature
pdb deposition date 2013-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1950 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3w8iA00
3W8HA 4GEHA 3W8IA
chains in the Genus database with same CATH superfamily
5COFA 2LSEA 4JW1A 3QVYA 2Q7RA 2YLGA 2GFHA 2KC3A 4XLPF 2LIGA 5DS4A 2JX0A 3C7JA 4U5GA 5JP7A 2Q9AA 1Q0KA 4YN0B 1M2VB 3FAJA 4PACA 1N1CA 4MTFA 1U89A 2PX0A 1BZ4A 2HS5A 2QE9A 3Q7LA 4Z9IA 5JLIA 2YL0A 3SXMA 2H7BA 3DMDA 1JPJA 3ZTZA 3AJMA 2EIJC 2GDCA 3SZRA 1C02A 5BUOA 2QNLA 2Q9CA 4DRIB 4RD9A 1IZMA 2W45A 4YL0A 1HY5A 2LD6A 4LLCA 4E0IA 3HNKA 1SF8A 3FVYA 5L0DA 1Y6DA 4Q4ZF 4Z9JA 4L6RA 5KYYB 1GQAA 1PCXA 3AGUA 3OWTA 1YVIA 4AK9A 2ICWG 5KYXB 3EH1A 4MVMA 4CS9A 1Z23A 4DVYP 3UMIA 3U9MA 1FNTc 3IEEA 3SXKA 1MQVA 1O87A 2VH3A 4CJOA 3SP1A 2OJQA 3EHNA 3L34A 5F28E 1OW8A 1E83A 5BQHA 1ZHZA 2CNWD 2HFIA 1XZQA 2YL3A 4HE8D 3U5SA 4EBBA 1OR2A 5TJ5E 3M15A 2KW3C 2R02A 3TQOA 2GAQA 1T6UA 4OIRF 2HV7A 3DM9B 2P1AA 3PMRA 1Z6AA 4JCZA 4ANJA 3B0UX 2HMZA 1HE9A 2H7VC 5JUAA 2XLEA 3RYLA 1K05A 1LM3B 4JZAA 4DOZA 4DXWA 1UG7A 2C04A 2PFDA 3I5PA 1MMGA 3VYWA 1HW1A 1QZXA 2OKUA 2ZXPA 2XS8A 4GEHA 4U9DA 2HJ3A 3L1MA 1MNEA 3V7OA 3VM6A 4IAQA 3F47A 1LVKA 4ONSA 2G62A 1DOWA 1KU2A 3LJBA 4I1OB 3GANA 2F22A 5B1AC 1AEPA 2QTVA 2G3KA 3W4YA 1ORYA 1E84A 4AX2A 3WODF 4IRUA 4ER9A 2KJGA 3KKBA 5E3AA 4C3DA 1ZVZA 2P7VA 3UNGC 1SYQA 4U5DE 1YAUO 1H6GA 2GA0A 4XPYA 3TJ6A 4W8PA 3EG9B 4BJ6A 2B0HA 4FESA 3IHUA 3RH3A 3C8GA 1TWHA 1Z7Qc 2HMQA 2HZ8A 2NUTB 4G7ZF 2P6VA 3K6BA 2ZXRA 4BPMA 2XM4A 2O9XA 1TWCA 3KPHA 3CQZA 4MW3A 1YYXA 3CZ6A 1BDJB 2R25A 3JRTA 1M56C 2IXMA 2OG2A 3RQEA 1VMAA 4CS9C 3V5YA 2HKVA 1RJ9A 1XZPA 5EGYA 5B1BC 3GORA 4K0DA 4CBEA 1Q0DA 4E0HA 1J8MF 1Z3IX 2AP3A 3H65A 4YT2A 3BEHA 2X0CA 3BRJA 2BL2A 4IB4A 1YYJA 2HSBA 3LESA 1PD0A 2LFDA 1BR1A 4YT5A 2XLDA 4I44A 3HJCA 3PDMP 4YWQA 2V3CC 1ZHYA 3JZ0A 4KNWA 1KTMA 3B29A 3O10A 4HEAJ 4AL0A 4XTKA 4AE4A 1I4YA 1SR2A 4C3BA 4E7ZA 5DQTA 4NTFA 5DS6A 2Q00A 1V4AA 2CNWA 1M2OA 2DYRC 5COMA 1OCRC 1U0BB 1FTSA 1PD1A 5COGA 3G4ZA 3V5ZA 2YZSA 3C8GD 3LAYA 1M57C 4O6NA 3RQGA 2RSEB 2EILC 2J8WA 3J06A 5GPGB 4JEAA 3RKOF 3T9OA 1ZZPA 3AGTA 5FCLA 4Q5SF 5KYUA 2PX3A 2LCHA 2WZLA 2XL6A 3B9QA 1BR4A 3QTHA 1LPEA 5EK0A 1FMWA 3RVZA 2RD9A 2AVKA 5DQZA 1OCOC 4R32A 3POVA 4DVZA 1LKXA 2MHRA 2WB7A 5DS5A 4BJ6C 3PCVA 3HKKA 1JAFA 3LUTB 3SYNA 3LNRA 3L8JA 5L0HA 3FAPB 4J7TA 1QSPA 4N4WA 1S7ZA 4BJ1A 4HFKB 1YARO 4CDVA 3QVZA 4I1MA 4MVRA 4EBJA 2Q9BA 3ZQVA 4QI0A 1V54C 1M6TA 4JEBA 2W9YA 4YL1A 3TULA 2OCCC 1QLEC 3N24A 1EKYA 3HTKC 2XS1A 3UR3C 1VYIA 2VASA 4CDAA 1RMVA 4QI2A 2YWAA 1CGOA 2J9VA 3M4CA 1Q0MA 1H9TA 2VB6A 2Y3DA 3EZHA 3LLKA 1A7DA 3T6GB 2XM0A 4BJ5C 2L6FA 1ZW3A 2DB4A 5KYUB 3LS0A 4O6YA 4G78A 4OINF 5D92A 2EIKC 3RQFA 3DI5A 2W4MA 1TQGA 3DD7A 3DZAA 5KYXA 4W8KA 5A6KA 4IGGA 4M63A 4FAPB 5KYYA 1E2XA 3B0VC 1V74B 1LIHA 1VLSA 1Y4CA 3GWLA 5CI9A 4CSAC 3FOPA 2IYLD 3GODA 1NG1A 4U5CE 4BJ5A 4CJGA 2E87A 2BE5F 2MWQA 1OW7A 4YT8A 1XWJA 2P61A 4ZLDA 3KYJA 1WGWA 3DM5A 4U9EA 4JJFA 5EHHA 3MX3A 5T3WA 3O6XA 3K7DA 4MVOA 4U5FE 2BC5A 2XLMA 3TK0A 3ZWIA 5AC4A 4NTBA 3EGXB 2MYSA 2QLAA 4CSAA 2XLOA 4MNDA 3C63A 3DE8A 2R7RA 2ASRA 3GEIA 5JSLA 3TJ5A 1NLXA 2PP4A 3NYJA 5JRAA 1ZU4A 4MVUA 1MNDA 3KYIA 5AC5A 3ASNC 3AQCA 3MYFA 2R7TA 4PR9A 4RDAA 3DWWA 3RW0A 3K1HA 4ZLCA 5IY5C 3L8IA 4LDKA 3JSZA 2L81A 2OQMA 4DRHB 2R7UA 1A41A 2ETSA 2AWCA 5AGFA 4WGYA 3C8GB 4XLNF 1IW7F 2I15A 4C7OB 3EH2A 1ST6A 4CIHA 4UDVA 4KC9A 2XL4A 3EQLF 3L0IA 3KL4A 1YJGA 1T6QA 3JTLO 4DBQA 5A6BD 2WL8A 4N6CA 5D91A 2HSQA 1JR8A 3AG4C 5BQIA 3AOUA 4YK5A 4BEJA 4CIPA 5L0FA 1S05A 2KGOA 3I4UA 3RVYA 3SXZA 1Z5ZA 3MFNA 2NUPA 2VC9A 3E9VA 4NQFA 2JPUA 4PJJA 4DJ9A 2J9BA 2W4BA 2P0NA 5BQGA 1TWAA 3QMKA 2A0BA 3ZIBA 2ZXOA 3T6BA 4PK4A 2J7PA 2AWYA 5A6AA 2KQ9A 1FMVA 4XEFA 2C03A 5KYWB 2WVNA 2NSFA 4J32B 3WHNA 2J9WA 3GEHA 3U2MA 1SZIA 2WZGA 4WABA 1Z63A 4DRJB 1HE1A 1EI7A 4PJNA 5L0IA 5L0JA 1ZYRF 1U6HA 3U8PA 4OD4A 3OEOA 3DKAA 2Q4FA 3GM1A 3ZQYA 1NZEA 3Q7GA 4JTDB 2G3VA 3JYHA 1NFNA 3AG1C 1ZHTA 3EFOB 4NCQA 4MVQA 4NY3A 4O6MA 2PNOA 4JTAB 1WATA 3FOOA 3FMSA 4U5HA 2IOQA 4GYTA 4RBNA 3GEEA 3HNIA 3DXJF 4LLEA 2L6HA 2IBFA 3A9CA 4XPXA 4KNVA 4MQ9F 1OQCA 2J46A 2IXNA 2XLWA 4JCHA 4YT4A 3DAFA 2M4EA 4LERA 3U0CA 4FX5A 3FDQA 1M2VA 1SMYF 4MW8A 1PV3A 3H2UA 4K7BA 1OR3A 5B3IA 3UGPA 2IXOA 2YVKA 4MS2A 3LS1A 1T9KA 1LI5A 2VCAA 4U5BE 4C3EA 5A6JA 1VLTA 5DVWA 4LACB 1E86A 1OXBA 2EPLX 4K1OA 2Y3BA 1R4TA 4OIPF 2UUIA 4G7OF 2A69F 4KI2A 5A69A 3AQBA 3GM3A 1VTMP 3PHF2 3EHMA 1VOMA 2NPUA 3QW0A 4NTAA 1NFOA 3U3BA 3W8IA 3CSKA 1JRAA 1QVXA 4YJWA 3U9JA 1YA7O 2R05A 3A11A 1OCCC 2A6EF 1OKKD 4D4NA 4E7SA 4XQ1A 2DGJA 1LS4A 2B0JA 2YEVA 3NMIA 3TOMA 2XL8A 1ZHWA 2GWWA 1RKEB 2L6GA 3DE9A 3LEVA 3ZSUA 3G4XA 2NUPB 2XRHA 4JRZA 4PFOA 1LE2A 1G8XA 2FAPB 4LDQA 4BJTA 1FR0A 2YL7A 3LNMB 4IWBA 1NU7D 2EPMX 2WVOA 3IQCA 3EPVA 4AL1A 1RKCA 4J30B 5F5FA 1OKKA 1T01A 5T1DB 2HUJA 2XLVA 3ZDLA 3N0TA 4Q7CA 1ORSC 1DOVA 4PJLA 3FHDA 1JOGA 1CGME 2Y39A 3CEXA 4MVSA 5K0IA 1CPRA 2EIMC 1A7VA 3JCUQ 3OA1A 1V55C 4IAOA 3EZIA 4JE9A 2FFHA 3S9OA 3HNLA 1HW2A 4P9TA 4NC3A 3EFOA 3C18A 1AVOB 2VCCA 1K40A 4QDLA 1KNYA 5T3TA 3US6A 4EWCA 1MMDA 3S28A 1G4US 2A0UA 4C7OA 2X51A 3C8ZA 4JIOA 1RKEA 1ZU5A 3HLZA 2Z15A 5CIVA 5A6BA 1GGQA 3M1CB 3IPMO 4XPWA 3ITFA 4G0HA 2XXAA 2IXPA 1FFTC 3EGXA 2EPKX 3T6JA 2V26A 3M4BA 2CYDA 4CDYA 2LK4A 3G50A 1UFBA 4I3MA 1T6IA 3ABKC 3EGDB 1I4ZA 1I5NA 4JVSA 5E2QA 1RCPA 2HJMA 1VB5A 4N6HA 3UGOA 1QQ3A 4X0RA 4KBLA 5HV9A 2TMVP 3O39A 4MTGA 1YDIA 3X2QC 3S84A 1YA9A 2Y3HA 4DBRA 3GWNA 2J9UA 5DLJA 1YZAA 1HMDA 1OW6A 4JJGA 4BEMJ 1G4WR 1ZHXA 2R7QA 3ZG1A 1JPNA 2VCBA 3MLGA 1WASA 1WN0A 2EINC 3QZCA 3TD7A 2CW0F 3C62A 3KH2A 3SNHA 3W2VA 2YLIA 5L3QA 4OIQF 3M79A 3UMKA 4JTCB 4N06A 1TKNA 2H8AA 5JVEA 4BG0A 3NKDA 5B3SC 1TFOB 2OOCA 3RF3A 2OEXA 3ASOC 3ABMC 3IQTA 3U2LA 5FZTA 3SEOA 2H7OA 5JS5A 3ZTMA 1HMOA 3AG2C 4IJJA 1FAPB 2QUPA 2ZXWC 1NBBA 1AUEA 5E3CA 3UMHA 1TWGA 2EPNA 4B6IA 2KK1A 3E70C 4WGZA 3T4RA 1LI7A 1O3UA 3W2WA 4MVZA 1BR2A 2FGYA 2L7AA 5KYNA 3TOLA 4IARA 1G5ZA 2YQYA 3W8HA 5KYWA 2PF4E 1B68A 3N2ZB 1MMAA 1YZCA 5F5HA 2D4UA 2PBEA 1RXQA 1T5OA 3S0XA 2A6HF 1F1MA 1WWPA 3EGDA 4ULVA 4EHPA 1K04A 1LS1A 4EKWA 2D5RB 4D4XA 1Q0GA 3SXYA 2JD3A 2WVQA 2A68F 256BA 3JYYA 1W2WA 3B0PA 3NYMA 3F46A 3NYLA 3NDBB 1OCZC 2M64A 3H2VA 2CDQA 4XWJA 4E17A 1CPQA 2NG1A 3EJNA 3I5QA 4YL3A 2ZPAA 1D1CA 4O7GA 1TR2A 3K66A 2DYSC 1E85A 3AG3C 2EPOA 2XSEA 2ZD9A 3JSEO 4MTOA 1ZW2A 1Q0FA 2R7XA 1A0BA 2UUHA 5JT4A 1C17M 1R5ID 2YLDA 1VYKA 1H9GA 4HFFB 2R9RB 3X1OA 3O55A 2J0XA 2XLHA 3U3FA 4WJ0A 1L3PA 1H7IA 1QPUA 1O5HA 3V5XA 2Y69C 2OJED 3U8VA 3Q6NA 4FWVA 4E18A 3RIPA 3JRMO 5L0CA 1MMNA 2KNHA 3GM2A 2IM8A 4GQHA 1VK5A 3S27A 3NKEA 4P6IC 3DJNB 1L7CA 3K1IA 4LDRA 4AE4B 1C03A 2YL1A 1EA8A 3DJUB 4P9FA 1ORJA 1CGNA 2J0WA 5HSWA 4JC7A 2YKZA 3WAQA 1D0XA 3QW1A 2J7PD 3KMIA 3MYIA 1YLMA 2NUTA 4H4KC 1APCA 4O79A 3R7CA 3ZC4A 1QKRA 3K33A 3S90A 3K1IC 1BBHA 2CCYA 3FXHA 5L0GA 2QY9A 1OXKA 3NMJA 3EG9A 3JT1A 2DI3A 1RJ9B 1GM5A 3RFYA 2AU5A 2R03A 3ABLC 2YRFA 4Z9HA 3NRHA 2I8BA 3VAYA 2R7OA 1A7EA 1D1AA 2LP4A 4PFPA 5L3VA 2KSFA 4PJMA 4EIYA 1JMWA 2NSGA 3LLIA 2CGEA 2L9JA 3NMKA 4CS8A 1D1BA 1D0ZA 3ECSA 4CX9A 2Y3GA 3ATPA 5CI8A 3S29A 1D0YA 4F4BA 2OEVA 4XEKA 4CS7A 1NU9C 2LFFA 2Q3TA 1LE4A 2J45A 3Q6MA 2WZFA 3CAXA 3LEOA 3VF0A 3R2PA 3B71A 2R7WA 4XEVA 4OIOF 2A1DD 4J7YA 4CS8C 4JKVA 3WG7C 1GS9A 1WTYA 2YHSA 2HV6A 3HNJA 5E33A 4JURI 2KYHA 4EUKB 2R7VA 1FFHA 4A4AA 2OU6A 3IQ5A 1EQ1A 3DAGA 4A2NB 3MBGA 4OD5A 4U5EE 3VRCA 4EBKA 4G7HF 2R7SA 3ZVRA 2XXAB 1WOLA 2LQGA 3IQ6A 3NG1A 4ULWA 4H54A 1J8YF 1NSGB 1TFKB
chains in the Genus database with same CATH topology
2LSEA 4JW1A 2GFHA 4XLPF 5DS4A 4U5GA 2Q9AA 4YN0B 1M2VB 3FAJA 4CIHA 1N1CA 3Q7LA 2PX0A 2H7BA 3DMDA 1JPJA 2EIJC 3SZRA 5BUOA 2Q9CA 4RD9A 1IZMA 2W45A 4LLCA 1SF8A 3FVYA 4Q4ZF 5KYYB 1PCXA 3OWTA 4AK9A 5KYXB 3EH1A 4CS9A 1Z23A 4DVYP 3UMIA 3IEEA 1O87A 2VH3A 3SP1A 3L34A 3EHNA 1ZHZA 2CNWD 4HE8D 4EBBA 2KW3C 4OIRF 2HV7A 3DM9B 3PMRA 3B0UX 1Z6AA 4ANJA 2H7VC 3RYLA 4JZAA 4DOZA 2C04A 2PFDA 3I5PA 1MMGA 3VYWA 1QZXA 2ZXPA 4GEHA 1MNEA 3V7OA 3F47A 1LVKA 2G62A 1KU2A 3LJBA 4I1OB 3GANA 5B1AC 2QTVA 2G3KA 4AX2A 3WODF 4IRUA 2KJGA 3KKBA 5E3AA 4C3DA 2P7VA 3UNGC 4U5DE 4BJ6A 3EG9B 4FESA 3RH3A 1TWHA 4G7ZF 2NUTB 2P6VA 3K6BA 2ZXRA 2O9XA 1TWCA 3CQZA 3CZ6A 3JRTA 1M56C 2IXMA 2OG2A 4CS9C 1VMAA 1RJ9A 5EGYA 5B1BC 4K0DA 4CBEA 1J8MF 1Z3IX 3H65A 4YT2A 3LESA 1PD0A 4YT5A 1BR1A 4I44A 3HJCA 2V3CC 4YWQA 1ZHYA 4KNWA 4HEAJ 4XTKA 4AE4A 4C3BA 4E7ZA 5DQTA 5DS6A 2DYRC 2CNWA 1M2OA 1OCRC 1FTSA 1PD1A 2YZSA 3LAYA 1M57C 4O6NA 2EILC 3RKOF 5FCLA 4Q5SF 5KYUA 2PX3A 2WZLA 3B9QA 1BR4A 1FMWA 3POVA 5DQZA 1OCOC 4DVZA 1LKXA 2WB7A 5DS5A 4BJ6C 3SYNA 3LNRA 4BJ1A 1S7ZA 4HFKB 4I1MA 2Q9BA 4QI0A 1V54C 2W9YA 2OCCC 1QLEC 3N24A 3HTKC 3UR3C 1VYIA 2VASA 4QI2A 2J9VA 2VB6A 2Y3DA 3EZHA 3LLKA 4BJ5C 5KYUB 3LS0A 4O6YA 4OINF 5D92A 2EIKC 2W4MA 3DZAA 3DD7A 5KYXA 4W8KA 4M63A 5KYYA 3B0VC 5CI9A 4CSAC 4U5CE 2IYLD 3GODA 1NG1A 4BJ5A 2E87A 2BE5F 2MWQA 4YT8A 4ZLDA 1WGWA 3DM5A 5EHHA 4JJFA 3MX3A 5T3WA 3O6XA 3K7DA 4U5FE 3EGXB 2MYSA 4CSAA 4MNDA 2R7RA 3NYJA 2PP4A 1ZU4A 1MNDA 3ASNC 3AQCA 2R7TA 4RDAA 3K1HA 4ZLCA 5IY5C 3JSZA 2L81A 2R7UA 4XLNF 1IW7F 4C7OB 3EH2A 1ST6A 4KC9A 2XL4A 3EQLF 3L0IA 3KL4A 4DBQA 2WL8A 5D91A 3AG4C 4BEJA 2KGOA 3I4UA 1Z5ZA 2NUPA 3E9VA 4PJJA 2W4BA 1TWAA 3QMKA 3ZIBA 2ZXOA 3T6BA 4PK4A 2J7PA 2KQ9A 1FMVA 2C03A 5KYWB 2WVNA 4J32B 2J9WA 1Z63A 1SZIA 2WZGA 4PJNA 1ZYRF 4OD4A 3OEOA 1NZEA 3Q7GA 2G3VA 3JYHA 3AG1C 1ZHTA 3EFOB 4NY3A 4O6MA 4U5HA 2IOQA 4GYTA 4RBNA 3DXJF 4LLEA 4KNVA 4MQ9F 2J46A 2IXNA 4JCHA 4YT4A 3DAFA 2M4EA 4LERA 4FX5A 3FDQA 1M2VA 1SMYF 4K7BA 3UGPA 2IXOA 3LS1A 4C3EA 4U5BE 5DVWA 4LACB 2Y3BA 4OIPF 4G7OF 2A69F 4KI2A 3AQBA 3PHF2 3EHMA 1VOMA 3W8IA 3CSKA 4YJWA 1OCCC 2A6EF 1OKKD 4E7SA 2DGJA 2B0JA 2YEVA 1ZHWA 3ZSUA 3LEVA 2NUPB 2XRHA 4PFOA 1G8XA 4BJTA 4IWBA 1NU7D 2WVOA 3EPVA 4J30B 5F5FA 1OKKA 5T1DB 3N0TA 4Q7CA 4PJLA 3FHDA 2Y39A 2EIMC 3JCUQ 4IAOA 3OA1A 1V55C 3EZIA 2FFHA 3EFOA 4QDLA 4EWCA 5T3TA 1MMDA 3S28A 2X51A 1ZU5A 3HLZA 2Z15A 3M1CB 3ITFA 4G0HA 2XXAA 2IXPA 1FFTC 3EGXA 3T6JA 2V26A 4I3MA 3EGDB 3ABKC 3UGOA 4JVSA 5E2QA 4X0RA 4KBLA 3O39A 3X2QC 2Y3HA 4DBRA 2J9UA 5DLJA 4JJGA 1ZHXA 2R7QA 3ZG1A 1JPNA 3MLGA 2EINC 3QZCA 3TD7A 2CW0F 3KH2A 3SNHA 3W2VA 5L3QA 4OIQF 4C7OA 3UMKA 4N06A 1TKNA 4BG0A 3NKDA 5B3SC 3ASOC 3ABMC 3SEOA 2H7OA 3AG2C 4IJJA 2ZXWC 3UMHA 5E3CA 1TWGA 4B6IA 3E70C 3T4RA 3W2WA 1BR2A 2FGYA 5KYNA 3W8HA 5KYWA 2PF4E 3N2ZB 1MMAA 5F5HA 3S0XA 2A6HF 3EGDA 1LS1A 2D5RB 2JD3A 2WVQA 2A68F 1W2WA 3B0PA 3NYMA 3F46A 3NYLA 3NDBB 1OCZC 4XWJA 2CDQA 2NG1A 3EJNA 3I5QA 2ZPAA 1D1CA 4O7GA 1TR2A 3K66A 2DYSC 3AG3C 2XSEA 2R7XA 4HFFB 1VYKA 3X1OA 2J0XA 4WJ0A 1O5HA 2Y69C 3Q6NA 4FWVA 3RIPA 1MMNA 2KNHA 1VK5A 3S27A 3NKEA 4P6IC 3DJNB 4AE4B 3DJUB 2J0WA 5HSWA 1D0XA 2J7PD 3KMIA 2NUTA 4H4KC 4O79A 3ZC4A 3K33A 3K1IC 2QY9A 3EG9A 3JT1A 1RJ9B 3RFYA 3ABLC 3NRHA 2I8BA 3VAYA 2R7OA 1D1AA 4PFPA 5L3VA 4PJMA 3LLIA 2CGEA 2L9JA 4CS8A 1D1BA 1D0ZA 3ECSA 2Y3GA 5CI8A 3S29A 1D0YA 4F4BA 4CS7A 1NU9C 2Q3TA 2J45A 3Q6MA 2WZFA 2R7WA 4OIOF 2A1DD 4CS8C 3WG7C 2YHSA 2HV6A 5E33A 4JURI 2R7VA 1FFHA 3DAGA 4A2NB 4U5EE 4OD5A 4G7HF 2R7SA 3ZVRA 2XXAB 3NG1A 4ULWA 1J8YF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W8H A;  4GEH A;  3W8I A; 
#chains in the Genus database with same CATH topology
 5COF A;  2LSE A;  4JW1 A;  3QVY A;  2Q7R A;  2YLG A;  2GFH A;  2KC3 A;  4XLP F;  2LIG A;  5DS4 A;  2JX0 A;  3C7J A;  4U5G A;  5JP7 A;  2Q9A A;  1Q0K A;  4YN0 B;  1M2V B;  3FAJ A;  4PAC A;  1N1C A;  4MTF A;  1U89 A;  2PX0 A;  1BZ4 A;  2HS5 A;  2QE9 A;  3Q7L A;  4Z9I A;  5JLI A;  2YL0 A;  3SXM A;  2H7B A;  3DMD A;  1JPJ A;  3ZTZ A;  3AJM A;  2EIJ C;  2GDC A;  3SZR A;  1C02 A;  5BUO A;  2QNL A;  2Q9C A;  4DRI B;  4RD9 A;  1IZM A;  2W45 A;  4YL0 A;  1HY5 A;  2LD6 A;  4LLC A;  4E0I A;  3HNK A;  1SF8 A;  3FVY A;  5L0D A;  1Y6D A;  4Q4Z F;  4Z9J A;  4L6R A;  5KYY B;  1GQA A;  1PCX A;  3AGU A;  3OWT A;  1YVI A;  4AK9 A;  2ICW G;  5KYX B;  3EH1 A;  4MVM A;  4CS9 A;  1Z23 A;  4DVY P;  3UMI A;  3U9M A;  1FNT c;  3IEE A;  3SXK A;  1MQV A;  1O87 A;  2VH3 A;  4CJO A;  3SP1 A;  2OJQ A;  3EHN A;  3L34 A;  5F28 E;  1OW8 A;  1E83 A;  5BQH A;  1ZHZ A;  2CNW D;  2HFI A;  1XZQ A;  2YL3 A;  4HE8 D;  3U5S A;  4EBB A;  1OR2 A;  5TJ5 E;  3M15 A;  2KW3 C;  2R02 A;  3TQO A;  2GAQ A;  1T6U A;  4OIR F;  2HV7 A;  3DM9 B;  2P1A A;  3PMR A;  1Z6A A;  4JCZ A;  4ANJ A;  3B0U X;  2HMZ A;  1HE9 A;  2H7V C;  5JUA A;  2XLE A;  3RYL A;  1K05 A;  1LM3 B;  4JZA A;  4DOZ A;  4DXW A;  1UG7 A;  2C04 A;  2PFD A;  3I5P A;  1MMG A;  3VYW A;  1HW1 A;  1QZX A;  2OKU A;  2ZXP A;  2XS8 A;  4GEH A;  4U9D A;  2HJ3 A;  3L1M A;  1MNE A;  3V7O A;  3VM6 A;  4IAQ A;  3F47 A;  1LVK A;  4ONS A;  2G62 A;  1DOW A;  1KU2 A;  3LJB A;  4I1O B;  3GAN A;  2F22 A;  5B1A C;  1AEP A;  2QTV A;  2G3K A;  3W4Y A;  1ORY A;  1E84 A;  4AX2 A;  3WOD F;  4IRU A;  4ER9 A;  2KJG A;  3KKB A;  5E3A A;  4C3D A;  1ZVZ A;  2P7V A;  3UNG C;  1SYQ A;  4U5D E;  1YAU O;  1H6G A;  2GA0 A;  4XPY A;  3TJ6 A;  4W8P A;  3EG9 B;  4BJ6 A;  2B0H A;  4FES A;  3IHU A;  3RH3 A;  3C8G A;  1TWH A;  1Z7Q c;  2HMQ A;  2HZ8 A;  2NUT B;  4G7Z F;  2P6V A;  3K6B A;  2ZXR A;  4BPM A;  2XM4 A;  2O9X A;  1TWC A;  3KPH A;  3CQZ A;  4MW3 A;  1YYX A;  3CZ6 A;  1BDJ B;  2R25 A;  3JRT A;  1M56 C;  2IXM A;  2OG2 A;  3RQE A;  1VMA A;  4CS9 C;  3V5Y A;  2HKV A;  1RJ9 A;  1XZP A;  5EGY A;  5B1B C;  3GOR A;  4K0D A;  4CBE A;  1Q0D A;  4E0H A;  1J8M F;  1Z3I X;  2AP3 A;  3H65 A;  4YT2 A;  3BEH A;  2X0C A;  3BRJ A;  2BL2 A;  4IB4 A;  1YYJ A;  2HSB A;  3LES A;  1PD0 A;  2LFD A;  1BR1 A;  4YT5 A;  2XLD A;  4I44 A;  3HJC A;  3PDM P;  4YWQ A;  2V3C C;  1ZHY A;  3JZ0 A;  4KNW A;  1KTM A;  3B29 A;  3O10 A;  4HEA J;  4AL0 A;  4XTK A;  4AE4 A;  1I4Y A;  1SR2 A;  4C3B A;  4E7Z A;  5DQT A;  4NTF A;  5DS6 A;  2Q00 A;  1V4A A;  2CNW A;  1M2O A;  2DYR C;  5COM A;  1OCR C;  1U0B B;  1FTS A;  1PD1 A;  5COG A;  3G4Z A;  3V5Z A;  2YZS A;  3C8G D;  3LAY A;  1M57 C;  4O6N A;  3RQG A;  2RSE B;  2EIL C;  2J8W A;  3J06 A;  5GPG B;  4JEA A;  3RKO F;  3T9O A;  1ZZP A;  3AGT A;  5FCL A;  4Q5S F;  5KYU A;  2PX3 A;  2LCH A;  2WZL A;  2XL6 A;  3B9Q A;  1BR4 A;  3QTH A;  1LPE A;  5EK0 A;  1FMW A;  3RVZ A;  2RD9 A;  2AVK A;  5DQZ A;  1OCO C;  4R32 A;  3POV A;  4DVZ A;  1LKX A;  2MHR A;  2WB7 A;  5DS5 A;  4BJ6 C;  3PCV A;  3HKK A;  1JAF A;  3LUT B;  3SYN A;  3LNR A;  3L8J A;  5L0H A;  3FAP B;  4J7T A;  1QSP A;  4N4W A;  1S7Z A;  4BJ1 A;  4HFK B;  1YAR O;  4CDV A;  3QVZ A;  4I1M A;  4MVR A;  4EBJ A;  2Q9B A;  3ZQV A;  4QI0 A;  1V54 C;  1M6T A;  4JEB A;  2W9Y A;  4YL1 A;  3TUL A;  2OCC C;  1QLE C;  3N24 A;  1EKY A;  3HTK C;  2XS1 A;  3UR3 C;  1VYI A;  2VAS A;  4CDA A;  1RMV A;  4QI2 A;  2YWA A;  1CGO A;  2J9V A;  3M4C A;  1Q0M A;  1H9T A;  2VB6 A;  2Y3D A;  3EZH A;  3LLK A;  1A7D A;  3T6G B;  2XM0 A;  4BJ5 C;  2L6F A;  1ZW3 A;  2DB4 A;  5KYU B;  3LS0 A;  4O6Y A;  4G78 A;  4OIN F;  5D92 A;  2EIK C;  3RQF A;  3DI5 A;  2W4M A;  1TQG A;  3DD7 A;  3DZA A;  5KYX A;  4W8K A;  5A6K A;  4IGG A;  4M63 A;  4FAP B;  5KYY A;  1E2X A;  3B0V C;  1V74 B;  1LIH A;  1VLS A;  1Y4C A;  3GWL A;  5CI9 A;  4CSA C;  3FOP A;  2IYL D;  3GOD A;  1NG1 A;  4U5C E;  4BJ5 A;  4CJG A;  2E87 A;  2BE5 F;  2MWQ A;  1OW7 A;  4YT8 A;  1XWJ A;  2P61 A;  4ZLD A;  3KYJ A;  1WGW A;  3DM5 A;  4U9E A;  4JJF A;  5EHH A;  3MX3 A;  5T3W A;  3O6X A;  3K7D A;  4MVO A;  4U5F E;  2BC5 A;  2XLM A;  3TK0 A;  3ZWI A;  5AC4 A;  4NTB A;  3EGX B;  2MYS A;  2QLA A;  4CSA A;  2XLO A;  4MND A;  3C63 A;  3DE8 A;  2R7R A;  2ASR A;  3GEI A;  5JSL A;  3TJ5 A;  1NLX A;  2PP4 A;  3NYJ A;  5JRA A;  1ZU4 A;  4MVU A;  1MND A;  3KYI A;  5AC5 A;  3ASN C;  3AQC A;  3MYF A;  2R7T A;  4PR9 A;  4RDA A;  3DWW A;  3RW0 A;  3K1H A;  4ZLC A;  5IY5 C;  3L8I A;  4LDK A;  3JSZ A;  2L81 A;  2OQM A;  4DRH B;  2R7U A;  1A41 A;  2ETS A;  2AWC A;  5AGF A;  4WGY A;  3C8G B;  4XLN F;  1IW7 F;  2I15 A;  4C7O B;  3EH2 A;  1ST6 A;  4CIH A;  4UDV A;  4KC9 A;  2XL4 A;  3EQL F;  3L0I A;  3KL4 A;  1YJG A;  1T6Q A;  3JTL O;  4DBQ A;  5A6B D;  2WL8 A;  4N6C A;  5D91 A;  2HSQ A;  1JR8 A;  3AG4 C;  5BQI A;  3AOU A;  4YK5 A;  4BEJ A;  4CIP A;  5L0F A;  1S05 A;  2KGO A;  3I4U A;  3RVY A;  3SXZ A;  1Z5Z A;  3MFN A;  2NUP A;  2VC9 A;  3E9V A;  4NQF A;  2JPU A;  4PJJ A;  4DJ9 A;  2J9B A;  2W4B A;  2P0N A;  5BQG A;  1TWA A;  3QMK A;  2A0B A;  3ZIB A;  2ZXO A;  3T6B A;  4PK4 A;  2J7P A;  2AWY A;  5A6A A;  2KQ9 A;  1FMV A;  4XEF A;  2C03 A;  5KYW B;  2WVN A;  2NSF A;  4J32 B;  3WHN A;  2J9W A;  3GEH A;  3U2M A;  1SZI A;  2WZG A;  4WAB A;  1Z63 A;  4DRJ B;  1HE1 A;  1EI7 A;  4PJN A;  5L0I A;  5L0J A;  1ZYR F;  1U6H A;  3U8P A;  4OD4 A;  3OEO A;  3DKA A;  2Q4F A;  3GM1 A;  3ZQY A;  1NZE A;  3Q7G A;  4JTD B;  2G3V A;  3JYH A;  1NFN A;  3AG1 C;  1ZHT A;  3EFO B;  4NCQ A;  4MVQ A;  4NY3 A;  4O6M A;  2PNO A;  4JTA B;  1WAT A;  3FOO A;  3FMS A;  4U5H A;  2IOQ A;  4GYT A;  4RBN A;  3GEE A;  3HNI A;  3DXJ F;  4LLE A;  2L6H A;  2IBF A;  3A9C A;  4XPX A;  4KNV A;  4MQ9 F;  1OQC A;  2J46 A;  2IXN A;  2XLW A;  4JCH A;  4YT4 A;  3DAF A;  2M4E A;  4LER A;  3U0C A;  4FX5 A;  3FDQ A;  1M2V A;  1SMY F;  4MW8 A;  1PV3 A;  3H2U A;  4K7B A;  1OR3 A;  5B3I A;  3UGP A;  2IXO A;  2YVK A;  4MS2 A;  3LS1 A;  1T9K A;  1LI5 A;  2VCA A;  4U5B E;  4C3E A;  5A6J A;  1VLT A;  5DVW A;  4LAC B;  1E86 A;  1OXB A;  2EPL X;  4K1O A;  2Y3B A;  1R4T A;  4OIP F;  2UUI A;  4G7O F;  2A69 F;  4KI2 A;  5A69 A;  3AQB A;  3GM3 A;  1VTM P;  3PHF 2;  3EHM A;  1VOM A;  2NPU A;  3QW0 A;  4NTA A;  1NFO A;  3U3B A;  3W8I A;  3CSK A;  1JRA A;  1QVX A;  4YJW A;  3U9J A;  1YA7 O;  2R05 A;  3A11 A;  1OCC C;  2A6E F;  1OKK D;  4D4N A;  4E7S A;  4XQ1 A;  2DGJ A;  1LS4 A;  2B0J A;  2YEV A;  3NMI A;  3TOM A;  2XL8 A;  1ZHW A;  2GWW A;  1RKE B;  2L6G A;  3DE9 A;  3LEV A;  3ZSU A;  3G4X A;  2NUP B;  2XRH A;  4JRZ A;  4PFO A;  1LE2 A;  1G8X A;  2FAP B;  4LDQ A;  4BJT A;  1FR0 A;  2YL7 A;  3LNM B;  4IWB A;  1NU7 D;  2EPM X;  2WVO A;  3IQC A;  3EPV A;  4AL1 A;  1RKC A;  4J30 B;  5F5F A;  1OKK A;  1T01 A;  5T1D B;  2HUJ A;  2XLV A;  3ZDL A;  3N0T A;  4Q7C A;  1ORS C;  1DOV A;  4PJL A;  3FHD A;  1JOG A;  1CGM E;  2Y39 A;  3CEX A;  4MVS A;  5K0I A;  1CPR A;  2EIM C;  1A7V A;  3JCU Q;  3OA1 A;  1V55 C;  4IAO A;  3EZI A;  4JE9 A;  2FFH A;  3S9O A;  3HNL A;  1HW2 A;  4P9T A;  4NC3 A;  3EFO A;  3C18 A;  1AVO B;  2VCC A;  1K40 A;  4QDL A;  1KNY A;  5T3T A;  3US6 A;  4EWC A;  1MMD A;  3S28 A;  1G4U S;  2A0U A;  4C7O A;  2X51 A;  3C8Z A;  4JIO A;  1RKE A;  1ZU5 A;  3HLZ A;  2Z15 A;  5CIV A;  5A6B A;  1GGQ A;  3M1C B;  3IPM O;  4XPW A;  3ITF A;  4G0H A;  2XXA A;  2IXP A;  1FFT C;  3EGX A;  2EPK X;  3T6J A;  2V26 A;  3M4B A;  2CYD A;  4CDY A;  2LK4 A;  3G50 A;  1UFB A;  4I3M A;  1T6I A;  3ABK C;  3EGD B;  1I4Z A;  1I5N A;  4JVS A;  5E2Q A;  1RCP A;  2HJM A;  1VB5 A;  4N6H A;  3UGO A;  1QQ3 A;  4X0R A;  4KBL A;  5HV9 A;  2TMV P;  3O39 A;  4MTG A;  1YDI A;  3X2Q C;  3S84 A;  1YA9 A;  2Y3H A;  4DBR A;  3GWN A;  2J9U A;  5DLJ A;  1YZA A;  1HMD A;  1OW6 A;  4JJG A;  4BEM J;  1G4W R;  1ZHX A;  2R7Q A;  3ZG1 A;  1JPN A;  2VCB A;  3MLG A;  1WAS A;  1WN0 A;  2EIN C;  3QZC A;  3TD7 A;  2CW0 F;  3C62 A;  3KH2 A;  3SNH A;  3W2V A;  2YLI A;  5L3Q A;  4OIQ F;  3M79 A;  3UMK A;  4JTC B;  4N06 A;  1TKN A;  2H8A A;  5JVE A;  4BG0 A;  3NKD A;  5B3S C;  1TFO B;  2OOC A;  3RF3 A;  2OEX A;  3ASO C;  3ABM C;  3IQT A;  3U2L A;  5FZT A;  3SEO A;  2H7O A;  5JS5 A;  3ZTM A;  1HMO A;  3AG2 C;  4IJJ A;  1FAP B;  2QUP A;  2ZXW C;  1NBB A;  1AUE A;  5E3C A;  3UMH A;  1TWG A;  2EPN A;  4B6I A;  2KK1 A;  3E70 C;  4WGZ A;  3T4R A;  1LI7 A;  1O3U A;  3W2W A;  4MVZ A;  1BR2 A;  2FGY A;  2L7A A;  5KYN A;  3TOL A;  4IAR A;  1G5Z A;  2YQY A;  3W8H A;  5KYW A;  2PF4 E;  1B68 A;  3N2Z B;  1MMA A;  1YZC A;  5F5H A;  2D4U A;  2PBE A;  1RXQ A;  1T5O A;  3S0X A;  2A6H F;  1F1M A;  1WWP A;  3EGD A;  4ULV A;  4EHP A;  1K04 A;  1LS1 A;  4EKW A;  2D5R B;  4D4X A;  1Q0G A;  3SXY A;  2JD3 A;  2WVQ A;  2A68 F;  256B A;  3JYY A;  1W2W A;  3B0P A;  3NYM A;  3F46 A;  3NYL A;  3NDB B;  1OCZ C;  2M64 A;  3H2V A;  2CDQ A;  4XWJ A;  4E17 A;  1CPQ A;  2NG1 A;  3EJN A;  3I5Q A;  4YL3 A;  2ZPA A;  1D1C A;  4O7G A;  1TR2 A;  3K66 A;  2DYS C;  1E85 A;  3AG3 C;  2EPO A;  2XSE A;  2ZD9 A;  3JSE O;  4MTO A;  1ZW2 A;  1Q0F A;  2R7X A;  1A0B A;  2UUH A;  5JT4 A;  1C17 M;  1R5I D;  2YLD A;  1VYK A;  1H9G A;  4HFF B;  2R9R B;  3X1O A;  3O55 A;  2J0X A;  2XLH A;  3U3F A;  4WJ0 A;  1L3P A;  1H7I A;  1QPU A;  1O5H A;  3V5X A;  2Y69 C;  2OJE D;  3U8V A;  3Q6N A;  4FWV A;  4E18 A;  3RIP A;  3JRM O;  5L0C A;  1MMN A;  2KNH A;  3GM2 A;  2IM8 A;  4GQH A;  1VK5 A;  3S27 A;  3NKE A;  4P6I C;  3DJN B;  1L7C A;  3K1I A;  4LDR A;  4AE4 B;  1C03 A;  2YL1 A;  1EA8 A;  3DJU B;  4P9F A;  1ORJ A;  1CGN A;  2J0W A;  5HSW A;  4JC7 A;  2YKZ A;  3WAQ A;  1D0X A;  3QW1 A;  2J7P D;  3KMI A;  3MYI A;  1YLM A;  2NUT A;  4H4K C;  1APC A;  4O79 A;  3R7C A;  3ZC4 A;  1QKR A;  3K33 A;  3S90 A;  3K1I C;  1BBH A;  2CCY A;  3FXH A;  5L0G A;  2QY9 A;  1OXK A;  3NMJ A;  3EG9 A;  3JT1 A;  2DI3 A;  1RJ9 B;  1GM5 A;  3RFY A;  2AU5 A;  2R03 A;  3ABL C;  2YRF A;  4Z9H A;  3NRH A;  2I8B A;  3VAY A;  2R7O A;  1A7E A;  1D1A A;  2LP4 A;  4PFP A;  5L3V A;  2KSF A;  4PJM A;  4EIY A;  1JMW A;  2NSG A;  3LLI A;  2CGE A;  2L9J A;  3NMK A;  4CS8 A;  1D1B A;  1D0Z A;  3ECS A;  4CX9 A;  2Y3G A;  3ATP A;  5CI8 A;  3S29 A;  1D0Y A;  4F4B A;  2OEV A;  4XEK A;  4CS7 A;  1NU9 C;  2LFF A;  2Q3T A;  1LE4 A;  2J45 A;  3Q6M A;  2WZF A;  3CAX A;  3LEO A;  3VF0 A;  3R2P A;  3B71 A;  2R7W A;  4XEV A;  4OIO F;  2A1D D;  4J7Y A;  4CS8 C;  4JKV A;  3WG7 C;  1GS9 A;  1WTY A;  2YHS A;  2HV6 A;  3HNJ A;  5E33 A;  4JUR I;  2KYH A;  4EUK B;  2R7V A;  1FFH A;  4A4A A;  2OU6 A;  3IQ5 A;  1EQ1 A;  3DAG A;  4A2N B;  3MBG A;  4OD5 A;  4U5E E;  3VRC A;  4EBK A;  4G7H F;  2R7S A;  3ZVR A;  2XXA B;  1WOL A;  2LQG A;  3IQ6 A;  3NG1 A;  4ULW A;  4H54 A;  1J8Y F;  1NSG B;  1TFK B; 
#chains in the Genus database with same CATH homology
 2LSE A;  4JW1 A;  2GFH A;  4XLP F;  5DS4 A;  4U5G A;  2Q9A A;  4YN0 B;  1M2V B;  3FAJ A;  4CIH A;  1N1C A;  3Q7L A;  2PX0 A;  2H7B A;  3DMD A;  1JPJ A;  2EIJ C;  3SZR A;  5BUO A;  2Q9C A;  4RD9 A;  1IZM A;  2W45 A;  4LLC A;  1SF8 A;  3FVY A;  4Q4Z F;  5KYY B;  1PCX A;  3OWT A;  4AK9 A;  5KYX B;  3EH1 A;  4CS9 A;  1Z23 A;  4DVY P;  3UMI A;  3IEE A;  1O87 A;  2VH3 A;  3SP1 A;  3L34 A;  3EHN A;  1ZHZ A;  2CNW D;  4HE8 D;  4EBB A;  2KW3 C;  4OIR F;  2HV7 A;  3DM9 B;  3PMR A;  3B0U X;  1Z6A A;  4ANJ A;  2H7V C;  3RYL A;  4JZA A;  4DOZ A;  2C04 A;  2PFD A;  3I5P A;  1MMG A;  3VYW A;  1QZX A;  2ZXP A;  4GEH A;  1MNE A;  3V7O A;  3F47 A;  1LVK A;  2G62 A;  1KU2 A;  3LJB A;  4I1O B;  3GAN A;  5B1A C;  2QTV A;  2G3K A;  4AX2 A;  3WOD F;  4IRU A;  2KJG A;  3KKB A;  5E3A A;  4C3D A;  2P7V A;  3UNG C;  4U5D E;  4BJ6 A;  3EG9 B;  4FES A;  3RH3 A;  1TWH A;  4G7Z F;  2NUT B;  2P6V A;  3K6B A;  2ZXR A;  2O9X A;  1TWC A;  3CQZ A;  3CZ6 A;  3JRT A;  1M56 C;  2IXM A;  2OG2 A;  4CS9 C;  1VMA A;  1RJ9 A;  5EGY A;  5B1B C;  4K0D A;  4CBE A;  1J8M F;  1Z3I X;  3H65 A;  4YT2 A;  3LES A;  1PD0 A;  4YT5 A;  1BR1 A;  4I44 A;  3HJC A;  2V3C C;  4YWQ A;  1ZHY A;  4KNW A;  4HEA J;  4XTK A;  4AE4 A;  4C3B A;  4E7Z A;  5DQT A;  5DS6 A;  2DYR C;  2CNW A;  1M2O A;  1OCR C;  1FTS A;  1PD1 A;  2YZS A;  3LAY A;  1M57 C;  4O6N A;  2EIL C;  3RKO F;  5FCL A;  4Q5S F;  5KYU A;  2PX3 A;  2WZL A;  3B9Q A;  1BR4 A;  1FMW A;  3POV A;  5DQZ A;  1OCO C;  4DVZ A;  1LKX A;  2WB7 A;  5DS5 A;  4BJ6 C;  3SYN A;  3LNR A;  4BJ1 A;  1S7Z A;  4HFK B;  4I1M A;  2Q9B A;  4QI0 A;  1V54 C;  2W9Y A;  2OCC C;  1QLE C;  3N24 A;  3HTK C;  3UR3 C;  1VYI A;  2VAS A;  4QI2 A;  2J9V A;  2VB6 A;  2Y3D A;  3EZH A;  3LLK A;  4BJ5 C;  5KYU B;  3LS0 A;  4O6Y A;  4OIN F;  5D92 A;  2EIK C;  2W4M A;  3DZA A;  3DD7 A;  5KYX A;  4W8K A;  4M63 A;  5KYY A;  3B0V C;  5CI9 A;  4CSA C;  4U5C E;  2IYL D;  3GOD A;  1NG1 A;  4BJ5 A;  2E87 A;  2BE5 F;  2MWQ A;  4YT8 A;  4ZLD A;  1WGW A;  3DM5 A;  5EHH A;  4JJF A;  3MX3 A;  5T3W A;  3O6X A;  3K7D A;  4U5F E;  3EGX B;  2MYS A;  4CSA A;  4MND A;  2R7R A;  3NYJ A;  2PP4 A;  1ZU4 A;  1MND A;  3ASN C;  3AQC A;  2R7T A;  4RDA A;  3K1H A;  4ZLC A;  5IY5 C;  3JSZ A;  2L81 A;  2R7U A;  4XLN F;  1IW7 F;  4C7O B;  3EH2 A;  1ST6 A;  4KC9 A;  2XL4 A;  3EQL F;  3L0I A;  3KL4 A;  4DBQ A;  2WL8 A;  5D91 A;  3AG4 C;  4BEJ A;  2KGO A;  3I4U A;  1Z5Z A;  2NUP A;  3E9V A;  4PJJ A;  2W4B A;  1TWA A;  3QMK A;  3ZIB A;  2ZXO A;  3T6B A;  4PK4 A;  2J7P A;  2KQ9 A;  1FMV A;  2C03 A;  5KYW B;  2WVN A;  4J32 B;  2J9W A;  1Z63 A;  1SZI A;  2WZG A;  4PJN A;  1ZYR F;  4OD4 A;  3OEO A;  1NZE A;  3Q7G A;  2G3V A;  3JYH A;  3AG1 C;  1ZHT A;  3EFO B;  4NY3 A;  4O6M A;  4U5H A;  2IOQ A;  4GYT A;  4RBN A;  3DXJ F;  4LLE A;  4KNV A;  4MQ9 F;  2J46 A;  2IXN A;  4JCH A;  4YT4 A;  3DAF A;  2M4E A;  4LER A;  4FX5 A;  3FDQ A;  1M2V A;  1SMY F;  4K7B A;  3UGP A;  2IXO A;  3LS1 A;  4C3E A;  4U5B E;  5DVW A;  4LAC B;  2Y3B A;  4OIP F;  4G7O F;  2A69 F;  4KI2 A;  3AQB A;  3PHF 2;  3EHM A;  1VOM A;  3W8I A;  3CSK A;  4YJW A;  1OCC C;  2A6E F;  1OKK D;  4E7S A;  2DGJ A;  2B0J A;  2YEV A;  1ZHW A;  3ZSU A;  3LEV A;  2NUP B;  2XRH A;  4PFO A;  1G8X A;  4BJT A;  4IWB A;  1NU7 D;  2WVO A;  3EPV A;  4J30 B;  5F5F A;  1OKK A;  5T1D B;  3N0T A;  4Q7C A;  4PJL A;  3FHD A;  2Y39 A;  2EIM C;  3JCU Q;  4IAO A;  3OA1 A;  1V55 C;  3EZI A;  2FFH A;  3EFO A;  4QDL A;  4EWC A;  5T3T A;  1MMD A;  3S28 A;  2X51 A;  1ZU5 A;  3HLZ A;  2Z15 A;  3M1C B;  3ITF A;  4G0H A;  2XXA A;  2IXP A;  1FFT C;  3EGX A;  3T6J A;  2V26 A;  4I3M A;  3EGD B;  3ABK C;  3UGO A;  4JVS A;  5E2Q A;  4X0R A;  4KBL A;  3O39 A;  3X2Q C;  2Y3H A;  4DBR A;  2J9U A;  5DLJ A;  4JJG A;  1ZHX A;  2R7Q A;  3ZG1 A;  1JPN A;  3MLG A;  2EIN C;  3QZC A;  3TD7 A;  2CW0 F;  3KH2 A;  3SNH A;  3W2V A;  5L3Q A;  4OIQ F;  4C7O A;  3UMK A;  4N06 A;  1TKN A;  4BG0 A;  3NKD A;  5B3S C;  3ASO C;  3ABM C;  3SEO A;  2H7O A;  3AG2 C;  4IJJ A;  2ZXW C;  3UMH A;  5E3C A;  1TWG A;  4B6I A;  3E70 C;  3T4R A;  3W2W A;  1BR2 A;  2FGY A;  5KYN A;  3W8H A;  5KYW A;  2PF4 E;  3N2Z B;  1MMA A;  5F5H A;  3S0X A;  2A6H F;  3EGD A;  1LS1 A;  2D5R B;  2JD3 A;  2WVQ A;  2A68 F;  1W2W A;  3B0P A;  3NYM A;  3F46 A;  3NYL A;  3NDB B;  1OCZ C;  4XWJ A;  2CDQ A;  2NG1 A;  3EJN A;  3I5Q A;  2ZPA A;  1D1C A;  4O7G A;  1TR2 A;  3K66 A;  2DYS C;  3AG3 C;  2XSE A;  2R7X A;  4HFF B;  1VYK A;  3X1O A;  2J0X A;  4WJ0 A;  1O5H A;  2Y69 C;  3Q6N A;  4FWV A;  3RIP A;  1MMN A;  2KNH A;  1VK5 A;  3S27 A;  3NKE A;  4P6I C;  3DJN B;  4AE4 B;  3DJU B;  2J0W A;  5HSW A;  1D0X A;  2J7P D;  3KMI A;  2NUT A;  4H4K C;  4O79 A;  3ZC4 A;  3K33 A;  3K1I C;  2QY9 A;  3EG9 A;  3JT1 A;  1RJ9 B;  3RFY A;  3ABL C;  3NRH A;  2I8B A;  3VAY A;  2R7O A;  1D1A A;  4PFP A;  5L3V A;  4PJM A;  3LLI A;  2CGE A;  2L9J A;  4CS8 A;  1D1B A;  1D0Z A;  3ECS A;  2Y3G A;  5CI8 A;  3S29 A;  1D0Y A;  4F4B A;  4CS7 A;  1NU9 C;  2Q3T A;  2J45 A;  3Q6M A;  2WZF A;  2R7W A;  4OIO F;  2A1D D;  4CS8 C;  3WG7 C;  2YHS A;  2HV6 A;  5E33 A;  4JUR I;  2R7V A;  1FFH A;  3DAG A;  4A2N B;  4U5E E;  4OD5 A;  4G7H F;  2R7S A;  3ZVR A;  2XXA B;  3NG1 A;  4ULW A;  1J8Y F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...