3W8IA

Crystal structure of ccm3 in complex with the c-terminal regulatory domain of mst4
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
193
structure length
184
Chain Sequence
MVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKLEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Unique Heterodimeric Assembly between Cerebral Cavernous Malformation 3 and Germinal Center Kinase III.
pubmed doi rcsb
molecule keywords Programmed cell death protein 10
molecule tags Protein binding/transferase
source organism Homo sapiens
total genus 75
structure length 184
sequence length 193
ec nomenclature
pdb deposition date 2013-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1950 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3w8iA00
3W8HA 4GEHA 3W8IA
chains in the Genus database with same CATH superfamily
2I15A 4XPWA 2TMVP 4JEBA 2YLGA 3QW1A 1CGOA 3GM3A 4JTAB 4LLEA 5JLIA 2LQGA 4Z9JA 1QZXA 4JVSA 5T3WA 3Q7GA 4JCZA 2PX3A 2C03A 3EHMA 3EGXA 3EJNA 4PACA 4DBQA 4P6IC 2Z15A 3DMDA 3VM6A 4FAPB 5KYXB 3SXYA 1A7VA 1A7DA 3RYLA 4CS7A 3TQOA 4H54A 2L9JA 3H2VA 4JZAA 4N6HA 4R32A 5L0IA 4MTFA 1WN0A 3O39A 1H6GA 2L6FA 4LDKA 3C8ZA 4LDQA 1CGNA 3NDBB 2KGOA 3U8PA 4JRZA 2H8AA 3DM9B 3I5PA 4NY3A 4YT5A 2PFDA 2W4MA 1SYQA 1VOMA 3LAYA 5CI9A 5B1AC 3QZCA 1MMNA 4QI2A 2MYSA 4IARA 3LJBA 3TOLA 1TFOB 3B0PA 3JYHA 3VYWA 1XZPA 5EHHA 2PNOA 2NPUA 1D1AA 3GEIA 2HMZA 2F22A 4NCQA 1I4ZA 1M56C 3AG3C 2XM4A 1GGQA 1VTMP 1A41A 4G7HF 2R7VA 1JMWA 1HW1A 3DKAA 2J9WA 3CSKA 2V26A 5FZTA 4MVMA 1APCA 1AEPA 1QQ3A 4YT2A 2NUTB 2ETSA 1YYJA 2G3VA 3L1MA 3JCUQ 1VMAA 2Q3TA 3EPVA 3RQFA 4OIPF 3AOUA 3M1CB 4U5HA 2HSBA 2KQ9A 3LLIA 4MVQA 1MMAA 2Q4FA 3S0XA 4I44A 4CDYA 2R7QA 1OXKA 3EGDA 1OQCA 3FAPB 4MVZA 5JS5A 2XLOA 5F5FA 5JP7A 2NUPA 1BBHA 2ZXRA 2NSGA 2OCCC 2D5RB 2WZFA 1A7EA 2YQYA 1TWCA 3NG1A 5L0FA 1E86A 5E33A 3B71A 4DRIB 1EKYA 5DQZA 4KNVA 4JTCB 2XLVA 3EGXB 2XXAB 4JJGA 2P6VA 2JD3A 4G78A 2OQMA 4MQ9F 3W8HA 3GANA 3ZWIA 1GS9A 1LIHA 2VASA 4WJ0A 1E2XA 3ECSA 5DS6A 2XLDA 3C8GA 4LLCA 1LS1A 4DVYP 1RXQA 1C02A 1NZEA 2MHRA 2LFFA 1FMWA 2P0NA 3C62A 3SEOA 4MS2A 1LI7A 2ZXWC 5HSWA 2YL1A 1ZVZA 3JZ0A 4KBLA 3KKBA 4IAOA 4PJNA 5L0JA 5L3QA 3B0VC 2EPMX 4BJ1A 2A69F 3K1IA 4N4WA 1I5NA 1PCXA 1QLEC 3S29A 1PD0A 3FAJA 2XL6A 3G50A 2KC3A 1NFNA 4YL3A 4BG0A 3UGPA 2UUIA 2R25A 2YVKA 3DAFA 5L0HA 1PV3A 4XPXA 4W8PA 3X1OA 4LERA 4RDAA 4RD9A 1BZ4A 2ICWG 4XEVA 4O6NA 3IPMO 4PFOA 4YJWA 1JPJA 1LPEA 2JPUA 3DM5A 5JSLA 1IZMA 3PCVA 5JT4A 2KJGA 5KYXA 2V3CC 5T3TA 2Q9CA 1LKXA 3U9MA 4C3DA 2R02A 5KYUA 2B0HA 2FAPB 3EGDB 3G4XA 2GDCA 5F5HA 4OIOF 3E9VA 2NUPB 2MWQA 2P7VA 3K66A 4EBKA 4YWQA 1WWPA 2HZ8A 2IOQA 2EIKC 2A68F 4J30B 4M63A 5AGFA 5COFA 3CQZA 4NC3A 2DYSC 2VB6A 4FX5A 4MVOA 1OCZC 4OD5A 2M64A 3DJNB 1H9GA 3NMJA 4CS9A 4ONSA 2R7UA 3U8VA 4BJ5C 4PFPA 1S7ZA 2DI3A 3L0IA 3ZDLA 3ABKC 4XTKA 3C8GB 4IGGA 3AGTA 2CGEA 2Y69C 5AC4A 3FDQA 3UGOA 4N06A 2AVKA 2YEVA 1V54C 3GODA 2VCCA 5CIVA 3EZIA 2PX0A 2HSQA 1C17M 1L7CA 1T01A 1NBBA 3EQLF 4AE4A 1OW7A 3JRTA 4U9EA 5COGA 2W4BA 4E0IA 1IW7F 4JE9A 3KMIA 3FMSA 3MX3A 3NYJA 3IEEA 1J8MF 1YA9A 2XSEA 4CIPA 1YAUO 4NTFA 1TQGA 4JW1A 2HJMA 2J8WA 2LK4A 3AG4C 2NG1A 4NTBA 1E84A 1Q0DA 2XLHA 1SMYF 3DD7A 2XRHA 3IQTA 3ZQYA 4DRJB 4ULVA 4E7ZA 1G5ZA 3ABLC 3US6A 2VH3A 3TULA 1DOWA 3HNIA 1NG1A 4OD4A 3IHUA 4KC9A 3UR3C 1SZIA 1AVOB 3LNMB 5KYUB 3AJMA 1ZHYA 1YLMA 4N6CA 1RKEA 5FCLA 1Y4CA 1YZCA 2J9UA 3TD7A 2J7PD 1U6HA 3JRMO 4YT8A 2OEXA 4IWBA 5A6KA 4L6RA 2R7RA 2IXMA 3TJ5A 3GWNA 3V7OA 4XEKA 1D0XA 3FHDA 1TR2A 4DOZA 2LFDA 4DVZA 1ST6A 1TWGA 2YHSA 1B68A 3JSZA 4MTGA 3UNGC 2EPKX 3FOOA 2L6GA 3ITFA 2G62A 4F4BA 4CS8A 4PJLA 1OR2A 3GM1A 3PMRA 4XLNF 3C63A 1S05A 4A2NB 2WZLA 2PP4A 4IB4A 4CJOA 2ASRA 4G0HA 3J06A 1D0ZA 1QSPA 2BC5A 1WTYA 3L8IA 3DXJF 2PF4E 2L6HA 3VAYA 3V5YA 1W2WA 3C7JA 5DVWA 3LNRA 3NYMA 3VRCA 4AE4B 4NTAA 3AGUA 2DB4A 1Z23A 3HLZA 3O6XA 4EIYA 3PDMP 2P1AA 1LE4A 3ABMC 3RVYA 2R9RB 2GWWA 1D1BA 2L81A 4WGYA 4AL1A 3OA1A 5IY5C 4XPYA 1TKNA 2AWCA 1PD1A 2EPLX 4GQHA 4PK4A 4MW3A 1Z7Qc 2UUHA 2CDQA 1OCOC 4LACB 2EIMC 2W9YA 2KYHA 4U5EE 4Z9IA 4NQFA 2EPOA 3W4YA 1NU9C 2VC9A 1K04A 2XL8A 3HNJA 3WAQA 2R7WA 3L8JA 3LLKA 4JKVA 3HJCA 1FR0A 4MVUA 1RKEB 1LM3B 2OOCA 4MVRA 3TK0A 3OWTA 4U9DA 1ZU4A 4YN0B 4ULWA 2YWAA 3KH2A 3MYIA 3W2WA 2YL7A 1C03A 2LSEA 3IQ5A 3H2UA 4C7OA 1Q0FA 2H7BA 3T4RA 5A6JA 1T9KA 4OINF 2CCYA 1T6UA 3POVA 2H7VC 3RIPA 4BPMA 2IYLD 1FNTc 4XLPF 3FXHA 2OEVA 4J32B 4CSAA 2JX0A 3ASOC 4DBRA 5L0GA 1HE1A 4YT4A 3I4UA 2OKUA 3F46A 1YDIA 4QI0A 1UFBA 1FFTC 1Z3IX 1VYIA 2HUJA 3FVYA 2YZSA 1MMGA 4QDLA 3LS0A 4E0HA 4OIRF 3MYFA 2WVOA 3GWLA 3U5SA 3T6GB 1U0BB 4C3BA 1D0YA 4KNWA 3K1IC 4YL1A 1Z63A 1WASA 5L3VA 3EH2A 1HMOA 2CYDA 3M4BA 1G4US 4I1MA 2A6HF 1HE9A 2D4UA 3LEVA 4HEAJ 4BJ6C 2GA0A 1O87A 4BEJA 1KNYA 1ZYRF 2RD9A 1LVKA 4EBBA 3LESA 3B0UX 2HS5A 3JT1A 2CNWD 3LS1A 3K7DA 3FOPA 3JYYA 3QVYA 2ZXPA 2VCBA 2RSEB 3EHNA 3R7CA 4Q4ZF 4AL0A 1SF8A 2KK1A 3QW0A 3G4ZA 4EKWA 5A6BD 3DAGA 3U3FA 2YL3A 3BRJA 3B29A 2J45A 3DE9A 4JEAA 3U9JA 3W8IA 1EI7A 3QMKA 2YKZA 1KU2A 2HV6A 3MFNA 1HY5A 2XLWA 3AQCA 4YK5A 2X0CA 1RMVA 5BUOA 4HFFB 4C7OB 2KW3C 4JURI 4MW8A 4D4NA 4CS9C 1MMDA 5COMA 1LS4A 1OKKD 3WHNA 4AK9A 4MVSA 3EH1A 5E3AA 2AU5A 2C04A 3SZRA 2G3KA 2KSFA 2Y39A 3GORA 2OG2A 3NYLA 2NSFA 2GAQA 4X0RA 1YZAA 2XLEA 4JIOA 1RKCA 3DI5A 3ZQVA 4ER9A 3NRHA 5DQTA 5AC5A 5K0IA 3U2LA 1VK5A 1Q0GA 4O6MA 4DXWA 4E18A 3T6BA 5E2QA 3U0CA 3IQCA 2X51A 3RF3A 3ZVRA 5L0CA 2XXAA 1R5ID 2WVNA 2WVQA 1HMDA 4PJJA 3V5XA 4MTOA 2OJQA 2WZGA 2M4EA 1EQ1A 4FWVA 4CDAA 2EILC 2J9BA 2QLAA 2J7PA 2R7OA 4E17A 4E7SA 3RVZA 5A6AA 1VLTA 3WODF 3ZC4A 1TWHA 3KPHA 4W8KA 4Z9HA 4G7OF 3CAXA 3HNKA 1VB5A 2BE5F 3E70C 1CPRA 1MNDA 1Q0MA 3K1HA 3MLGA 256BA 5BQHA 4LDRA 1OCRC 2XM0A 5KYYA 4C3EA 3KYJA 2L7AA 2FFHA 3Q7LA 3A9CA 4U5DE 4CX9A 1ZHWA 3R2PA 3Q6MA 1E83A 1XWJA 2BL2A 1OCCC 2EIJC 3L34A 3CEXA 2VCAA 3NMIA 3SXMA 2LIGA 4EUKB 1RCPA 4PR9A 4O7GA 4D4XA 5T1DB 1H7IA 3O10A 2Y3GA 2OU6A 3W2VA 3WG7C 5KYWA 2Q7RA 1OW8A 1ZU5A 2GFHA 2QUPA 3VF0A 1SR2A 4Q7CA 3M15A 3S90A 4HE8D 3UMIA 1TWAA 2A0BA 4WABA 1YARO 2YL0A 5D91A 3RW0A 4CS8C 5L0DA 2QY9A 3RQEA 3LEOA 3NKEA 1FMVA 1QVXA 1RJ9B 3EFOA 1TFKB 2IBFA 1ZHTA 4U5FE 3SNHA 3N24A 2WL8A 1ZHXA 1T6IA 3GM2A 3M79A 1Z5ZA 2R7TA 2FGYA 4DJ9A 4OIQF 1UG7A 4U5GA 2W45A 2Q9BA 5E3CA 3SXZA 3UMHA 3NMKA 2OJED 3M4CA 2DYRC 1V74B 4AX2A 1Z6AA 2LD6A 5KYNA 1KTMA 2EPNA 2J0XA 3QTHA 1K40A 2HKVA 1M2VA 1M57C 2ZXOA 1ORYA 4H4KC 2Q9AA 1FFHA 4ZLCA 5B3SC 2YLDA 1BDJB 1YA7O 1D1CA 2ZD9A 2E87A 3I5QA 1OR3A 1T5OA 1WGWA 2I8BA 2J9VA 4ANJA 1BR2A 1YJGA 2YLIA 4UDVA 1VLSA 1M6TA 1I4YA 2CW0F 4U5BE 5JRAA 1A0BA 3EG9A 4B6IA 1ZW2A 4J7YA 3ZG1A 4JJFA 5KYYB 4YL0A 4RBNA 4WGZA 3RQGA 3T9OA 4DRHB 1JRAA 3LUTB 1EA8A 1F1MA 4O79A 3BEHA 3HTKC 4CBEA 2P61A 2Y3BA 4O6YA 3JSEO 3UMKA 1ZHZA 1OW6A 1FTSA 1AUEA 1E85A 2LCHA 3B9QA 1NLXA 1NU7D 1ORJA 1LI5A 4P9FA 3RH3A 3ZIBA 5KYWB 5DS5A 3C8GD 3JTLO 4JTDB 3C18A 3PHF2 4CSAC 2ZPAA 5A69A 3X2QC 3S27A 4XWJA 5BQIA 2XS8A 1G8XA 1JOGA 3N0TA 4EBJA 2IXNA 1XZQA 1NSGB 3KL4A 4K7BA 2Y3HA 1YVIA 4ZLDA 4GEHA 3EFOB 5EK0A 4G7ZF 2XS1A 2YRFA 2WB7A 5F28E 3SXKA 3T6JA 3RFYA 2CNWA 3OEOA 2IXPA 1Y6DA 1JPNA 3S28A 1BR1A 4EHPA 1HW2A 1BR4A 3CZ6A 3U3BA 3V5ZA 1WATA 3S9OA 4BJ6A 3K6BA 4JCHA 3SP1A 4CJGA 2QNLA 3DJUB 3GEEA 5TJ5E 5A6BA 3AG2C 1GM5A 2IXOA 4K1OA 5B3IA 4Q5SF 3A11A 1M2OA 2Y3DA 4BEMJ 3EZHA 3HNLA 2R05A 1M2VB 2B0JA 4IJJA 4I1OB 3F47A 1OXBA 4MNDA 3DZAA 1K05A 2R7XA 3H65A 2R7SA 4HFKB 1V55C 4FESA 3ZTMA 1MNEA 1QPUA 3ASNC 2A6EF 5DS4A 3GEHA 5D92A 3U2MA 5B1BC 2A0UA 4BJ5A 4IAQA 3TJ6A 2KNHA 5CI8A 4CIHA 1OKKA 4XEFA 4CDVA 2HMQA 3EG9B 1JR8A 3QVZA 1L3PA 4P9TA 1FAPB 2EINC 3DWWA 5EGYA 3ZSUA 5JVEA 3MBGA 1LE2A 1RJ9A 1NFOA 1MQVA 2J46A 3N2ZB 4IRUA 5JUAA 3KYIA 1CGME 1DOVA 1T6QA 3ZTZA 5DLJA 1YYXA 2A1DD 1QKRA 4PJMA 2QE9A 4U5CE 1H9TA 5BQGA 2AP3A 4KI2A 1GQAA 2LP4A 2J0WA 3HKKA 4K0DA 2AWYA 1J8YF 1O3UA 1O5HA 4GYTA 2DGJA 3O55A 1WOLA 3AG1C 5GPGB 1VYKA 2PBEA 3IQ6A 1R4TA 3AQBA 3TOMA 1V4AA 2H7OA 4XQ1A 2NUTA 1ORSC 1ZZPA 2HFIA 2XL4A 2XLMA 3K33A 4BJTA 2Q00A 3S84A 1N1CA 1Q0KA 2HJ3A 3ATPA 3SYNA 2QTVA 3DE8A 4I3MA 4J7TA 2O9XA 2R03A 4EWCA 1JAFA 2HV7A 5HV9A 2IM8A 3NKDA 1U89A 4JC7A 3RKOF 1G4WR 1ZW3A 4A4AA 1CPQA 3Q6NA
chains in the Genus database with same CATH topology
4LLEA 1QZXA 4JVSA 5T3WA 3Q7GA 2PX3A 2C03A 3EHMA 3EGXA 3EJNA 4DBQA 5KYXB 4P6IC 2Z15A 3DMDA 2XXAA 3RYLA 4CS7A 2L9JA 4JZAA 3O39A 3NDBB 2KGOA 3DM9B 3I5PA 4NY3A 4YT5A 2PFDA 2W4MA 1VOMA 3LAYA 5CI9A 5B1AC 3QZCA 1MMNA 4QI2A 2MYSA 3LJBA 3VYWA 3B0PA 3JYHA 5EHHA 1D1AA 1M56C 3AG3C 4G7HF 2R7VA 2J9WA 3CSKA 2V26A 4YT2A 2NUTB 2G3VA 3JCUQ 1VMAA 2Q3TA 3EPVA 4OIPF 3M1CB 4U5HA 3LLIA 2KQ9A 1MMAA 3S0XA 4I44A 2R7QA 3EGDA 5F5FA 2NUPA 2ZXRA 2OCCC 2D5RB 2WZFA 1TWCA 3NG1A 5E33A 5DQZA 4KNVA 3EGXB 2XXAB 4JJGA 2P6VA 2JD3A 4MQ9F 3W8HA 3GANA 4WJ0A 2VASA 3ECSA 5DS6A 4LLCA 1LS1A 4DVYP 1NZEA 1FMWA 3SEOA 2ZXWC 5HSWA 4KBLA 3KKBA 4IAOA 4PJNA 3B0VC 5L3QA 4BJ1A 2A69F 1PCXA 3S29A 1QLEC 1PD0A 3FAJA 3UGPA 4BG0A 3DAFA 3X1OA 4LERA 4RDAA 4RD9A 4O6NA 4PFOA 4YJWA 1JPJA 3DM5A 1IZMA 2KJGA 5KYXA 2V3CC 5T3TA 2Q9CA 1LKXA 4C3DA 5KYUA 3EGDB 5F5HA 4OIOF 3E9VA 2NUPB 2MWQA 2P7VA 3K66A 4YWQA 2IOQA 4M63A 2EIKC 2A68F 4J30B 3CQZA 2DYSC 2VB6A 4FX5A 1OCZC 4OD5A 3DJNB 4CS9A 4BJ5C 4PFPA 1S7ZA 3L0IA 3ABKC 4XTKA 2CGEA 2Y69C 3FDQA 3UGOA 4N06A 2YEVA 1V54C 3GODA 3EZIA 2PX0A 3EQLF 4AE4A 3JRTA 2W4BA 1IW7F 3KMIA 3MX3A 3NYJA 3IEEA 1J8MF 2XSEA 4JW1A 3AG4C 2NG1A 1SMYF 3DD7A 2XRHA 4E7ZA 3ABLC 2VH3A 1NG1A 4OD4A 3UR3C 4KC9A 1SZIA 5KYUB 1ZHYA 5FCLA 2J9UA 3TD7A 2J7PD 4YT8A 4IWBA 2R7RA 2IXMA 3V7OA 2R7UA 4DOZA 4DVZA 1D0XA 3FHDA 1TR2A 1ST6A 1TWGA 2YHSA 3JSZA 3UNGC 3ITFA 2G62A 4F4BA 4CS8A 4PJLA 3PMRA 4XLNF 4A2NB 2WZLA 2PP4A 4G0HA 1D0ZA 3DXJF 2PF4E 3VAYA 1W2WA 5DVWA 3LNRA 3NYMA 4AE4B 3HLZA 1Z23A 3O6XA 3ABMC 1D1BA 2L81A 3OA1A 5IY5C 1TKNA 1PD1A 4PK4A 2CDQA 1OCOC 4LACB 2EIMC 2W9YA 4U5EE 1NU9C 2R7WA 3LLKA 3HJCA 3OWTA 1ZU4A 4YN0B 4ULWA 3W2WA 3KH2A 2LSEA 4C7OA 2H7BA 3T4RA 4OINF 3POVA 2H7VC 3RIPA 2IYLD 4CSAA 4XLPF 4J32B 3ASOC 4DBRA 4YT4A 3I4UA 3F46A 4QI0A 1FFTC 1Z3IX 1VYIA 3FVYA 2YZSA 1MMGA 4QDLA 3LS0A 4OIRF 2WVOA 4C3BA 1D0YA 4KNWA 3K1IC 1Z63A 5L3VA 3EH2A 4I1MA 2A6HF 4BJ6C 3LEVA 4BEJA 4HEAJ 1O87A 1ZYRF 1LVKA 4EBBA 3LESA 3B0UX 3JT1A 2CNWD 3LS1A 3K7DA 2ZXPA 4Q4ZF 3EHNA 1SF8A 3DAGA 2J45A 3W8IA 3QMKA 1KU2A 2HV6A 3AQCA 5BUOA 4HFFB 4C7OB 2KW3C 4JURI 4CS9C 1MMDA 1OKKD 4AK9A 3EH1A 5E3AA 2C04A 3SZRA 2G3KA 2Y39A 3NYLA 2OG2A 4X0RA 3NRHA 5DQTA 1VK5A 4O6MA 3T6BA 5E2QA 2X51A 3ZVRA 2WVNA 2WVQA 4PJJA 2WZGA 2M4EA 4FWVA 2EILC 4E7SA 2J7PA 2R7OA 3WODF 3ZC4A 4G7OF 1TWHA 4W8KA 3E70C 2BE5F 1MNDA 3K1HA 3MLGA 1OCRC 5KYYA 4C3EA 2FFHA 3Q7LA 4U5DE 1ZHWA 3Q6MA 1OCCC 2EIJC 3L34A 4O7GA 5T1DB 3W2VA 2Y3GA 3WG7C 5KYWA 1ZU5A 2GFHA 4Q7CA 4HE8D 3UMIA 1TWAA 4CS8C 5D91A 2QY9A 3NKEA 1FMVA 1RJ9B 3EFOA 1ZHTA 4U5FE 3SNHA 3N24A 2WL8A 1ZHXA 2R7TA 1Z5ZA 2FGYA 4OIQF 4U5GA 2W45A 2Q9BA 5E3CA 3UMHA 2DYRC 4AX2A 1Z6AA 5KYNA 2J0XA 1M2VA 1M57C 2ZXOA 4H4KC 2Q9AA 1FFHA 4ZLCA 5B3SC 1D1CA 2E87A 3I5QA 1WGWA 2I8BA 2J9VA 4ANJA 1BR2A 2CW0F 4U5BE 3EG9A 4B6IA 3ZG1A 4JJFA 5KYYB 4RBNA 4O79A 3HTKC 4CBEA 2Y3BA 4O6YA 3UMKA 1ZHZA 1FTSA 3ZIBA 3B9QA 1NU7D 3RH3A 5DS5A 5KYWB 3PHF2 4CSAC 2ZPAA 3X2QC 3S27A 4XWJA 3N0TA 1G8XA 2IXNA 3KL4A 4K7BA 2Y3HA 4ZLDA 4GEHA 3EFOB 4G7ZF 2WB7A 3T6JA 3RFYA 2CNWA 3OEOA 2IXPA 1JPNA 3S28A 1BR1A 1BR4A 3CZ6A 4BJ6A 3K6BA 4JCHA 3SP1A 3DJUB 4Q5SF 3AG2C 2IXOA 1M2OA 2Y3DA 3EZHA 1M2VB 2B0JA 4IJJA 4I1OB 3F47A 4MNDA 3DZAA 2R7XA 3H65A 2R7SA 4HFKB 1V55C 4FESA 1MNEA 3ASNC 2A6EF 5DS4A 5D92A 5B1BC 4BJ5A 2KNHA 5CI8A 4CIHA 1OKKA 3EG9B 2EINC 5EGYA 3ZSUA 1RJ9A 2J46A 3N2ZB 4IRUA 5DLJA 2A1DD 4PJMA 4U5CE 4KI2A 2J0WA 4K0DA 1J8YF 1O5HA 4GYTA 2DGJA 3AG1C 1VYKA 3AQBA 2H7OA 2NUTA 4BJTA 3K33A 2XL4A 1N1CA 3SYNA 2QTVA 4I3MA 4EWCA 2O9XA 2HV7A 3NKDA 3RKOF 3Q6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W8H A;  4GEH A;  3W8I A; 
#chains in the Genus database with same CATH topology
 2I15 A;  4XPW A;  2TMV P;  4JEB A;  2YLG A;  3QW1 A;  1CGO A;  3GM3 A;  4JTA B;  4LLE A;  5JLI A;  2LQG A;  4Z9J A;  1QZX A;  4JVS A;  5T3W A;  3Q7G A;  4JCZ A;  2PX3 A;  2C03 A;  3EHM A;  3EGX A;  3EJN A;  4PAC A;  4DBQ A;  4P6I C;  2Z15 A;  3DMD A;  3VM6 A;  4FAP B;  5KYX B;  3SXY A;  1A7V A;  1A7D A;  3RYL A;  4CS7 A;  3TQO A;  4H54 A;  2L9J A;  3H2V A;  4JZA A;  4N6H A;  4R32 A;  5L0I A;  4MTF A;  1WN0 A;  3O39 A;  1H6G A;  2L6F A;  4LDK A;  3C8Z A;  4LDQ A;  1CGN A;  3NDB B;  2KGO A;  3U8P A;  4JRZ A;  2H8A A;  3DM9 B;  3I5P A;  4NY3 A;  4YT5 A;  2PFD A;  2W4M A;  1SYQ A;  1VOM A;  3LAY A;  5CI9 A;  5B1A C;  3QZC A;  1MMN A;  4QI2 A;  2MYS A;  4IAR A;  3LJB A;  3TOL A;  1TFO B;  3B0P A;  3JYH A;  3VYW A;  1XZP A;  5EHH A;  2PNO A;  2NPU A;  1D1A A;  3GEI A;  2HMZ A;  2F22 A;  4NCQ A;  1I4Z A;  1M56 C;  3AG3 C;  2XM4 A;  1GGQ A;  1VTM P;  1A41 A;  4G7H F;  2R7V A;  1JMW A;  1HW1 A;  3DKA A;  2J9W A;  3CSK A;  2V26 A;  5FZT A;  4MVM A;  1APC A;  1AEP A;  1QQ3 A;  4YT2 A;  2NUT B;  2ETS A;  1YYJ A;  2G3V A;  3L1M A;  3JCU Q;  1VMA A;  2Q3T A;  3EPV A;  3RQF A;  4OIP F;  3AOU A;  3M1C B;  4U5H A;  2HSB A;  2KQ9 A;  3LLI A;  4MVQ A;  1MMA A;  2Q4F A;  3S0X A;  4I44 A;  4CDY A;  2R7Q A;  1OXK A;  3EGD A;  1OQC A;  3FAP B;  4MVZ A;  5JS5 A;  2XLO A;  5F5F A;  5JP7 A;  2NUP A;  1BBH A;  2ZXR A;  2NSG A;  2OCC C;  2D5R B;  2WZF A;  1A7E A;  2YQY A;  1TWC A;  3NG1 A;  5L0F A;  1E86 A;  5E33 A;  3B71 A;  4DRI B;  1EKY A;  5DQZ A;  4KNV A;  4JTC B;  2XLV A;  3EGX B;  2XXA B;  4JJG A;  2P6V A;  2JD3 A;  4G78 A;  2OQM A;  4MQ9 F;  3W8H A;  3GAN A;  3ZWI A;  1GS9 A;  1LIH A;  2VAS A;  4WJ0 A;  1E2X A;  3ECS A;  5DS6 A;  2XLD A;  3C8G A;  4LLC A;  1LS1 A;  4DVY P;  1RXQ A;  1C02 A;  1NZE A;  2MHR A;  2LFF A;  1FMW A;  2P0N A;  3C62 A;  3SEO A;  4MS2 A;  1LI7 A;  2ZXW C;  5HSW A;  2YL1 A;  1ZVZ A;  3JZ0 A;  4KBL A;  3KKB A;  4IAO A;  4PJN A;  5L0J A;  5L3Q A;  3B0V C;  2EPM X;  4BJ1 A;  2A69 F;  3K1I A;  4N4W A;  1I5N A;  1PCX A;  1QLE C;  3S29 A;  1PD0 A;  3FAJ A;  2XL6 A;  3G50 A;  2KC3 A;  1NFN A;  4YL3 A;  4BG0 A;  3UGP A;  2UUI A;  2R25 A;  2YVK A;  3DAF A;  5L0H A;  1PV3 A;  4XPX A;  4W8P A;  3X1O A;  4LER A;  4RDA A;  4RD9 A;  1BZ4 A;  2ICW G;  4XEV A;  4O6N A;  3IPM O;  4PFO A;  4YJW A;  1JPJ A;  1LPE A;  2JPU A;  3DM5 A;  5JSL A;  1IZM A;  3PCV A;  5JT4 A;  2KJG A;  5KYX A;  2V3C C;  5T3T A;  2Q9C A;  1LKX A;  3U9M A;  4C3D A;  2R02 A;  5KYU A;  2B0H A;  2FAP B;  3EGD B;  3G4X A;  2GDC A;  5F5H A;  4OIO F;  3E9V A;  2NUP B;  2MWQ A;  2P7V A;  3K66 A;  4EBK A;  4YWQ A;  1WWP A;  2HZ8 A;  2IOQ A;  2EIK C;  2A68 F;  4J30 B;  4M63 A;  5AGF A;  5COF A;  3CQZ A;  4NC3 A;  2DYS C;  2VB6 A;  4FX5 A;  4MVO A;  1OCZ C;  4OD5 A;  2M64 A;  3DJN B;  1H9G A;  3NMJ A;  4CS9 A;  4ONS A;  2R7U A;  3U8V A;  4BJ5 C;  4PFP A;  1S7Z A;  2DI3 A;  3L0I A;  3ZDL A;  3ABK C;  4XTK A;  3C8G B;  4IGG A;  3AGT A;  2CGE A;  2Y69 C;  5AC4 A;  3FDQ A;  3UGO A;  4N06 A;  2AVK A;  2YEV A;  1V54 C;  3GOD A;  2VCC A;  5CIV A;  3EZI A;  2PX0 A;  2HSQ A;  1C17 M;  1L7C A;  1T01 A;  1NBB A;  3EQL F;  4AE4 A;  1OW7 A;  3JRT A;  4U9E A;  5COG A;  2W4B A;  4E0I A;  1IW7 F;  4JE9 A;  3KMI A;  3FMS A;  3MX3 A;  3NYJ A;  3IEE A;  1J8M F;  1YA9 A;  2XSE A;  4CIP A;  1YAU O;  4NTF A;  1TQG A;  4JW1 A;  2HJM A;  2J8W A;  2LK4 A;  3AG4 C;  2NG1 A;  4NTB A;  1E84 A;  1Q0D A;  2XLH A;  1SMY F;  3DD7 A;  2XRH A;  3IQT A;  3ZQY A;  4DRJ B;  4ULV A;  4E7Z A;  1G5Z A;  3ABL C;  3US6 A;  2VH3 A;  3TUL A;  1DOW A;  3HNI A;  1NG1 A;  4OD4 A;  3IHU A;  4KC9 A;  3UR3 C;  1SZI A;  1AVO B;  3LNM B;  5KYU B;  3AJM A;  1ZHY A;  1YLM A;  4N6C A;  1RKE A;  5FCL A;  1Y4C A;  1YZC A;  2J9U A;  3TD7 A;  2J7P D;  1U6H A;  3JRM O;  4YT8 A;  2OEX A;  4IWB A;  5A6K A;  4L6R A;  2R7R A;  2IXM A;  3TJ5 A;  3GWN A;  3V7O A;  4XEK A;  1D0X A;  3FHD A;  1TR2 A;  4DOZ A;  2LFD A;  4DVZ A;  1ST6 A;  1TWG A;  2YHS A;  1B68 A;  3JSZ A;  4MTG A;  3UNG C;  2EPK X;  3FOO A;  2L6G A;  3ITF A;  2G62 A;  4F4B A;  4CS8 A;  4PJL A;  1OR2 A;  3GM1 A;  3PMR A;  4XLN F;  3C63 A;  1S05 A;  4A2N B;  2WZL A;  2PP4 A;  4IB4 A;  4CJO A;  2ASR A;  4G0H A;  3J06 A;  1D0Z A;  1QSP A;  2BC5 A;  1WTY A;  3L8I A;  3DXJ F;  2PF4 E;  2L6H A;  3VAY A;  3V5Y A;  1W2W A;  3C7J A;  5DVW A;  3LNR A;  3NYM A;  3VRC A;  4AE4 B;  4NTA A;  3AGU A;  2DB4 A;  1Z23 A;  3HLZ A;  3O6X A;  4EIY A;  3PDM P;  2P1A A;  1LE4 A;  3ABM C;  3RVY A;  2R9R B;  2GWW A;  1D1B A;  2L81 A;  4WGY A;  4AL1 A;  3OA1 A;  5IY5 C;  4XPY A;  1TKN A;  2AWC A;  1PD1 A;  2EPL X;  4GQH A;  4PK4 A;  4MW3 A;  1Z7Q c;  2UUH A;  2CDQ A;  1OCO C;  4LAC B;  2EIM C;  2W9Y A;  2KYH A;  4U5E E;  4Z9I A;  4NQF A;  2EPO A;  3W4Y A;  1NU9 C;  2VC9 A;  1K04 A;  2XL8 A;  3HNJ A;  3WAQ A;  2R7W A;  3L8J A;  3LLK A;  4JKV A;  3HJC A;  1FR0 A;  4MVU A;  1RKE B;  1LM3 B;  2OOC A;  4MVR A;  3TK0 A;  3OWT A;  4U9D A;  1ZU4 A;  4YN0 B;  4ULW A;  2YWA A;  3KH2 A;  3MYI A;  3W2W A;  2YL7 A;  1C03 A;  2LSE A;  3IQ5 A;  3H2U A;  4C7O A;  1Q0F A;  2H7B A;  3T4R A;  5A6J A;  1T9K A;  4OIN F;  2CCY A;  1T6U A;  3POV A;  2H7V C;  3RIP A;  4BPM A;  2IYL D;  1FNT c;  4XLP F;  3FXH A;  2OEV A;  4J32 B;  4CSA A;  2JX0 A;  3ASO C;  4DBR A;  5L0G A;  1HE1 A;  4YT4 A;  3I4U A;  2OKU A;  3F46 A;  1YDI A;  4QI0 A;  1UFB A;  1FFT C;  1Z3I X;  1VYI A;  2HUJ A;  3FVY A;  2YZS A;  1MMG A;  4QDL A;  3LS0 A;  4E0H A;  4OIR F;  3MYF A;  2WVO A;  3GWL A;  3U5S A;  3T6G B;  1U0B B;  4C3B A;  1D0Y A;  4KNW A;  3K1I C;  4YL1 A;  1Z63 A;  1WAS A;  5L3V A;  3EH2 A;  1HMO A;  2CYD A;  3M4B A;  1G4U S;  4I1M A;  2A6H F;  1HE9 A;  2D4U A;  3LEV A;  4HEA J;  4BJ6 C;  2GA0 A;  1O87 A;  4BEJ A;  1KNY A;  1ZYR F;  2RD9 A;  1LVK A;  4EBB A;  3LES A;  3B0U X;  2HS5 A;  3JT1 A;  2CNW D;  3LS1 A;  3K7D A;  3FOP A;  3JYY A;  3QVY A;  2ZXP A;  2VCB A;  2RSE B;  3EHN A;  3R7C A;  4Q4Z F;  4AL0 A;  1SF8 A;  2KK1 A;  3QW0 A;  3G4Z A;  4EKW A;  5A6B D;  3DAG A;  3U3F A;  2YL3 A;  3BRJ A;  3B29 A;  2J45 A;  3DE9 A;  4JEA A;  3U9J A;  3W8I A;  1EI7 A;  3QMK A;  2YKZ A;  1KU2 A;  2HV6 A;  3MFN A;  1HY5 A;  2XLW A;  3AQC A;  4YK5 A;  2X0C A;  1RMV A;  5BUO A;  4HFF B;  4C7O B;  2KW3 C;  4JUR I;  4MW8 A;  4D4N A;  4CS9 C;  1MMD A;  5COM A;  1LS4 A;  1OKK D;  3WHN A;  4AK9 A;  4MVS A;  3EH1 A;  5E3A A;  2AU5 A;  2C04 A;  3SZR A;  2G3K A;  2KSF A;  2Y39 A;  3GOR A;  2OG2 A;  3NYL A;  2NSF A;  2GAQ A;  4X0R A;  1YZA A;  2XLE A;  4JIO A;  1RKC A;  3DI5 A;  3ZQV A;  4ER9 A;  3NRH A;  5DQT A;  5AC5 A;  5K0I A;  3U2L A;  1VK5 A;  1Q0G A;  4O6M A;  4DXW A;  4E18 A;  3T6B A;  5E2Q A;  3U0C A;  3IQC A;  2X51 A;  3RF3 A;  3ZVR A;  5L0C A;  2XXA A;  1R5I D;  2WVN A;  2WVQ A;  1HMD A;  4PJJ A;  3V5X A;  4MTO A;  2OJQ A;  2WZG A;  2M4E A;  1EQ1 A;  4FWV A;  4CDA A;  2EIL C;  2J9B A;  2QLA A;  2J7P A;  2R7O A;  4E17 A;  4E7S A;  3RVZ A;  5A6A A;  1VLT A;  3WOD F;  3ZC4 A;  1TWH A;  3KPH A;  4W8K A;  4Z9H A;  4G7O F;  3CAX A;  3HNK A;  1VB5 A;  2BE5 F;  3E70 C;  1CPR A;  1MND A;  1Q0M A;  3K1H A;  3MLG A;  256B A;  5BQH A;  4LDR A;  1OCR C;  2XM0 A;  5KYY A;  4C3E A;  3KYJ A;  2L7A A;  2FFH A;  3Q7L A;  3A9C A;  4U5D E;  4CX9 A;  1ZHW A;  3R2P A;  3Q6M A;  1E83 A;  1XWJ A;  2BL2 A;  1OCC C;  2EIJ C;  3L34 A;  3CEX A;  2VCA A;  3NMI A;  3SXM A;  2LIG A;  4EUK B;  1RCP A;  4PR9 A;  4O7G A;  4D4X A;  5T1D B;  1H7I A;  3O10 A;  2Y3G A;  2OU6 A;  3W2V A;  3WG7 C;  5KYW A;  2Q7R A;  1OW8 A;  1ZU5 A;  2GFH A;  2QUP A;  3VF0 A;  1SR2 A;  4Q7C A;  3M15 A;  3S90 A;  4HE8 D;  3UMI A;  1TWA A;  2A0B A;  4WAB A;  1YAR O;  2YL0 A;  5D91 A;  3RW0 A;  4CS8 C;  5L0D A;  2QY9 A;  3RQE A;  3LEO A;  3NKE A;  1FMV A;  1QVX A;  1RJ9 B;  3EFO A;  1TFK B;  2IBF A;  1ZHT A;  4U5F E;  3SNH A;  3N24 A;  2WL8 A;  1ZHX A;  1T6I A;  3GM2 A;  3M79 A;  1Z5Z A;  2R7T A;  2FGY A;  4DJ9 A;  4OIQ F;  1UG7 A;  4U5G A;  2W45 A;  2Q9B A;  5E3C A;  3SXZ A;  3UMH A;  3NMK A;  2OJE D;  3M4C A;  2DYR C;  1V74 B;  4AX2 A;  1Z6A A;  2LD6 A;  5KYN A;  1KTM A;  2EPN A;  2J0X A;  3QTH A;  1K40 A;  2HKV A;  1M2V A;  1M57 C;  2ZXO A;  1ORY A;  4H4K C;  2Q9A A;  1FFH A;  4ZLC A;  5B3S C;  2YLD A;  1BDJ B;  1YA7 O;  1D1C A;  2ZD9 A;  2E87 A;  3I5Q A;  1OR3 A;  1T5O A;  1WGW A;  2I8B A;  2J9V A;  4ANJ A;  1BR2 A;  1YJG A;  2YLI A;  4UDV A;  1VLS A;  1M6T A;  1I4Y A;  2CW0 F;  4U5B E;  5JRA A;  1A0B A;  3EG9 A;  4B6I A;  1ZW2 A;  4J7Y A;  3ZG1 A;  4JJF A;  5KYY B;  4YL0 A;  4RBN A;  4WGZ A;  3RQG A;  3T9O A;  4DRH B;  1JRA A;  3LUT B;  1EA8 A;  1F1M A;  4O79 A;  3BEH A;  3HTK C;  4CBE A;  2P61 A;  2Y3B A;  4O6Y A;  3JSE O;  3UMK A;  1ZHZ A;  1OW6 A;  1FTS A;  1AUE A;  1E85 A;  2LCH A;  3B9Q A;  1NLX A;  1NU7 D;  1ORJ A;  1LI5 A;  4P9F A;  3RH3 A;  3ZIB A;  5KYW B;  5DS5 A;  3C8G D;  3JTL O;  4JTD B;  3C18 A;  3PHF 2;  4CSA C;  2ZPA A;  5A69 A;  3X2Q C;  3S27 A;  4XWJ A;  5BQI A;  2XS8 A;  1G8X A;  1JOG A;  3N0T A;  4EBJ A;  2IXN A;  1XZQ A;  1NSG B;  3KL4 A;  4K7B A;  2Y3H A;  1YVI A;  4ZLD A;  4GEH A;  3EFO B;  5EK0 A;  4G7Z F;  2XS1 A;  2YRF A;  2WB7 A;  5F28 E;  3SXK A;  3T6J A;  3RFY A;  2CNW A;  3OEO A;  2IXP A;  1Y6D A;  1JPN A;  3S28 A;  1BR1 A;  4EHP A;  1HW2 A;  1BR4 A;  3CZ6 A;  3U3B A;  3V5Z A;  1WAT A;  3S9O A;  4BJ6 A;  3K6B A;  4JCH A;  3SP1 A;  4CJG A;  2QNL A;  3DJU B;  3GEE A;  5TJ5 E;  5A6B A;  3AG2 C;  1GM5 A;  2IXO A;  4K1O A;  5B3I A;  4Q5S F;  3A11 A;  1M2O A;  2Y3D A;  4BEM J;  3EZH A;  3HNL A;  2R05 A;  1M2V B;  2B0J A;  4IJJ A;  4I1O B;  3F47 A;  1OXB A;  4MND A;  3DZA A;  1K05 A;  2R7X A;  3H65 A;  2R7S A;  4HFK B;  1V55 C;  4FES A;  3ZTM A;  1MNE A;  1QPU A;  3ASN C;  2A6E F;  5DS4 A;  3GEH A;  5D92 A;  3U2M A;  5B1B C;  2A0U A;  4BJ5 A;  4IAQ A;  3TJ6 A;  2KNH A;  5CI8 A;  4CIH A;  1OKK A;  4XEF A;  4CDV A;  2HMQ A;  3EG9 B;  1JR8 A;  3QVZ A;  1L3P A;  4P9T A;  1FAP B;  2EIN C;  3DWW A;  5EGY A;  3ZSU A;  5JVE A;  3MBG A;  1LE2 A;  1RJ9 A;  1NFO A;  1MQV A;  2J46 A;  3N2Z B;  4IRU A;  5JUA A;  3KYI A;  1CGM E;  1DOV A;  1T6Q A;  3ZTZ A;  5DLJ A;  1YYX A;  2A1D D;  1QKR A;  4PJM A;  2QE9 A;  4U5C E;  1H9T A;  5BQG A;  2AP3 A;  4KI2 A;  1GQA A;  2LP4 A;  2J0W A;  3HKK A;  4K0D A;  2AWY A;  1J8Y F;  1O3U A;  1O5H A;  4GYT A;  2DGJ A;  3O55 A;  1WOL A;  3AG1 C;  5GPG B;  1VYK A;  2PBE A;  3IQ6 A;  1R4T A;  3AQB A;  3TOM A;  1V4A A;  2H7O A;  4XQ1 A;  2NUT A;  1ORS C;  1ZZP A;  2HFI A;  2XL4 A;  2XLM A;  3K33 A;  4BJT A;  2Q00 A;  3S84 A;  1N1C A;  1Q0K A;  2HJ3 A;  3ATP A;  3SYN A;  2QTV A;  3DE8 A;  4I3M A;  4J7T A;  2O9X A;  2R03 A;  4EWC A;  1JAF A;  2HV7 A;  5HV9 A;  2IM8 A;  3NKD A;  1U89 A;  4JC7 A;  3RKO F;  1G4W R;  1ZW3 A;  4A4A A;  1CPQ A;  3Q6N A; 
#chains in the Genus database with same CATH homology
 4LLE A;  1QZX A;  4JVS A;  5T3W A;  3Q7G A;  2PX3 A;  2C03 A;  3EHM A;  3EGX A;  3EJN A;  4DBQ A;  5KYX B;  4P6I C;  2Z15 A;  3DMD A;  2XXA A;  3RYL A;  4CS7 A;  2L9J A;  4JZA A;  3O39 A;  3NDB B;  2KGO A;  3DM9 B;  3I5P A;  4NY3 A;  4YT5 A;  2PFD A;  2W4M A;  1VOM A;  3LAY A;  5CI9 A;  5B1A C;  3QZC A;  1MMN A;  4QI2 A;  2MYS A;  3LJB A;  3VYW A;  3B0P A;  3JYH A;  5EHH A;  1D1A A;  1M56 C;  3AG3 C;  4G7H F;  2R7V A;  2J9W A;  3CSK A;  2V26 A;  4YT2 A;  2NUT B;  2G3V A;  3JCU Q;  1VMA A;  2Q3T A;  3EPV A;  4OIP F;  3M1C B;  4U5H A;  3LLI A;  2KQ9 A;  1MMA A;  3S0X A;  4I44 A;  2R7Q A;  3EGD A;  5F5F A;  2NUP A;  2ZXR A;  2OCC C;  2D5R B;  2WZF A;  1TWC A;  3NG1 A;  5E33 A;  5DQZ A;  4KNV A;  3EGX B;  2XXA B;  4JJG A;  2P6V A;  2JD3 A;  4MQ9 F;  3W8H A;  3GAN A;  4WJ0 A;  2VAS A;  3ECS A;  5DS6 A;  4LLC A;  1LS1 A;  4DVY P;  1NZE A;  1FMW A;  3SEO A;  2ZXW C;  5HSW A;  4KBL A;  3KKB A;  4IAO A;  4PJN A;  3B0V C;  5L3Q A;  4BJ1 A;  2A69 F;  1PCX A;  3S29 A;  1QLE C;  1PD0 A;  3FAJ A;  3UGP A;  4BG0 A;  3DAF A;  3X1O A;  4LER A;  4RDA A;  4RD9 A;  4O6N A;  4PFO A;  4YJW A;  1JPJ A;  3DM5 A;  1IZM A;  2KJG A;  5KYX A;  2V3C C;  5T3T A;  2Q9C A;  1LKX A;  4C3D A;  5KYU A;  3EGD B;  5F5H A;  4OIO F;  3E9V A;  2NUP B;  2MWQ A;  2P7V A;  3K66 A;  4YWQ A;  2IOQ A;  4M63 A;  2EIK C;  2A68 F;  4J30 B;  3CQZ A;  2DYS C;  2VB6 A;  4FX5 A;  1OCZ C;  4OD5 A;  3DJN B;  4CS9 A;  4BJ5 C;  4PFP A;  1S7Z A;  3L0I A;  3ABK C;  4XTK A;  2CGE A;  2Y69 C;  3FDQ A;  3UGO A;  4N06 A;  2YEV A;  1V54 C;  3GOD A;  3EZI A;  2PX0 A;  3EQL F;  4AE4 A;  3JRT A;  2W4B A;  1IW7 F;  3KMI A;  3MX3 A;  3NYJ A;  3IEE A;  1J8M F;  2XSE A;  4JW1 A;  3AG4 C;  2NG1 A;  1SMY F;  3DD7 A;  2XRH A;  4E7Z A;  3ABL C;  2VH3 A;  1NG1 A;  4OD4 A;  3UR3 C;  4KC9 A;  1SZI A;  5KYU B;  1ZHY A;  5FCL A;  2J9U A;  3TD7 A;  2J7P D;  4YT8 A;  4IWB A;  2R7R A;  2IXM A;  3V7O A;  2R7U A;  4DOZ A;  4DVZ A;  1D0X A;  3FHD A;  1TR2 A;  1ST6 A;  1TWG A;  2YHS A;  3JSZ A;  3UNG C;  3ITF A;  2G62 A;  4F4B A;  4CS8 A;  4PJL A;  3PMR A;  4XLN F;  4A2N B;  2WZL A;  2PP4 A;  4G0H A;  1D0Z A;  3DXJ F;  2PF4 E;  3VAY A;  1W2W A;  5DVW A;  3LNR A;  3NYM A;  4AE4 B;  3HLZ A;  1Z23 A;  3O6X A;  3ABM C;  1D1B A;  2L81 A;  3OA1 A;  5IY5 C;  1TKN A;  1PD1 A;  4PK4 A;  2CDQ A;  1OCO C;  4LAC B;  2EIM C;  2W9Y A;  4U5E E;  1NU9 C;  2R7W A;  3LLK A;  3HJC A;  3OWT A;  1ZU4 A;  4YN0 B;  4ULW A;  3W2W A;  3KH2 A;  2LSE A;  4C7O A;  2H7B A;  3T4R A;  4OIN F;  3POV A;  2H7V C;  3RIP A;  2IYL D;  4CSA A;  4XLP F;  4J32 B;  3ASO C;  4DBR A;  4YT4 A;  3I4U A;  3F46 A;  4QI0 A;  1FFT C;  1Z3I X;  1VYI A;  3FVY A;  2YZS A;  1MMG A;  4QDL A;  3LS0 A;  4OIR F;  2WVO A;  4C3B A;  1D0Y A;  4KNW A;  3K1I C;  1Z63 A;  5L3V A;  3EH2 A;  4I1M A;  2A6H F;  4BJ6 C;  3LEV A;  4BEJ A;  4HEA J;  1O87 A;  1ZYR F;  1LVK A;  4EBB A;  3LES A;  3B0U X;  3JT1 A;  2CNW D;  3LS1 A;  3K7D A;  2ZXP A;  4Q4Z F;  3EHN A;  1SF8 A;  3DAG A;  2J45 A;  3W8I A;  3QMK A;  1KU2 A;  2HV6 A;  3AQC A;  5BUO A;  4HFF B;  4C7O B;  2KW3 C;  4JUR I;  4CS9 C;  1MMD A;  1OKK D;  4AK9 A;  3EH1 A;  5E3A A;  2C04 A;  3SZR A;  2G3K A;  2Y39 A;  3NYL A;  2OG2 A;  4X0R A;  3NRH A;  5DQT A;  1VK5 A;  4O6M A;  3T6B A;  5E2Q A;  2X51 A;  3ZVR A;  2WVN A;  2WVQ A;  4PJJ A;  2WZG A;  2M4E A;  4FWV A;  2EIL C;  4E7S A;  2J7P A;  2R7O A;  3WOD F;  3ZC4 A;  4G7O F;  1TWH A;  4W8K A;  3E70 C;  2BE5 F;  1MND A;  3K1H A;  3MLG A;  1OCR C;  5KYY A;  4C3E A;  2FFH A;  3Q7L A;  4U5D E;  1ZHW A;  3Q6M A;  1OCC C;  2EIJ C;  3L34 A;  4O7G A;  5T1D B;  3W2V A;  2Y3G A;  3WG7 C;  5KYW A;  1ZU5 A;  2GFH A;  4Q7C A;  4HE8 D;  3UMI A;  1TWA A;  4CS8 C;  5D91 A;  2QY9 A;  3NKE A;  1FMV A;  1RJ9 B;  3EFO A;  1ZHT A;  4U5F E;  3SNH A;  3N24 A;  2WL8 A;  1ZHX A;  2R7T A;  1Z5Z A;  2FGY A;  4OIQ F;  4U5G A;  2W45 A;  2Q9B A;  5E3C A;  3UMH A;  2DYR C;  4AX2 A;  1Z6A A;  5KYN A;  2J0X A;  1M2V A;  1M57 C;  2ZXO A;  4H4K C;  2Q9A A;  1FFH A;  4ZLC A;  5B3S C;  1D1C A;  2E87 A;  3I5Q A;  1WGW A;  2I8B A;  2J9V A;  4ANJ A;  1BR2 A;  2CW0 F;  4U5B E;  3EG9 A;  4B6I A;  3ZG1 A;  4JJF A;  5KYY B;  4RBN A;  4O79 A;  3HTK C;  4CBE A;  2Y3B A;  4O6Y A;  3UMK A;  1ZHZ A;  1FTS A;  3ZIB A;  3B9Q A;  1NU7 D;  3RH3 A;  5DS5 A;  5KYW B;  3PHF 2;  4CSA C;  2ZPA A;  3X2Q C;  3S27 A;  4XWJ A;  3N0T A;  1G8X A;  2IXN A;  3KL4 A;  4K7B A;  2Y3H A;  4ZLD A;  4GEH A;  3EFO B;  4G7Z F;  2WB7 A;  3T6J A;  3RFY A;  2CNW A;  3OEO A;  2IXP A;  1JPN A;  3S28 A;  1BR1 A;  1BR4 A;  3CZ6 A;  4BJ6 A;  3K6B A;  4JCH A;  3SP1 A;  3DJU B;  4Q5S F;  3AG2 C;  2IXO A;  1M2O A;  2Y3D A;  3EZH A;  1M2V B;  2B0J A;  4IJJ A;  4I1O B;  3F47 A;  4MND A;  3DZA A;  2R7X A;  3H65 A;  2R7S A;  4HFK B;  1V55 C;  4FES A;  1MNE A;  3ASN C;  2A6E F;  5DS4 A;  5D92 A;  5B1B C;  4BJ5 A;  2KNH A;  5CI8 A;  4CIH A;  1OKK A;  3EG9 B;  2EIN C;  5EGY A;  3ZSU A;  1RJ9 A;  2J46 A;  3N2Z B;  4IRU A;  5DLJ A;  2A1D D;  4PJM A;  4U5C E;  4KI2 A;  2J0W A;  4K0D A;  1J8Y F;  1O5H A;  4GYT A;  2DGJ A;  3AG1 C;  1VYK A;  3AQB A;  2H7O A;  2NUT A;  4BJT A;  3K33 A;  2XL4 A;  1N1C A;  3SYN A;  2QTV A;  4I3M A;  4EWC A;  2O9X A;  2HV7 A;  3NKD A;  3RKO F;  3Q6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...