3W8IA

Crystal structure of ccm3 in complex with the c-terminal regulatory domain of mst4
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
193
structure length
184
Chain Sequence
b'MVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKLEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 10
publication title Structural Basis for the Unique Heterodimeric Assembly between Cerebral Cavernous Malformation 3 and Germinal Center Kinase III.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
total genus 75
structure length 184
sequence length 193
ec nomenclature
pdb deposition date 2013-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1950 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3w8iA00
3W8IA 3W8HA 4GEHA
chains in the Genus database with same CATH superfamily
2HMQA 1PCXA 2R7WA 3TOMA 1Z7Qc 3V5YA 3JSZA 1NFOA 3B9QA 5HV9A 1ZU5A 1D0XA 2Q00A 2Q7RA 1CGME 1OQCA 1YVIA 4JURI 4JVSA 2W4MA 3W2VA 4I44A 1QKRA 3T6JA 1MMDA 1T6IA 3IQTA 1K40A 2R7SA 3KMIA 5DVWA 1N1CA 2EPOA 3U2MA 1HE9A 1NFNA 2FAPB 3ZC4A 4EBBA 2DB4A 1KU2A 3ASOC 4ULWA 3UMHA 2LSEA 1EQ1A 1ST6A 3M4CA 3LNMB 1M2VA 4PJJA 3EZIA 4BJTA 2YLDA 4YT4A 5A6AA 4CIPA 3POVA 3I4UA 1U89A 4MVQA 3U5SA 3C62A 3C8GA 3JT1A 4MW3A 5JT4A 3ABKC 2W4BA 5KYWB 5DS5A 2Q9AA 2R25A 4MS2A 3AG1C 3SP1A 3AQBA 1JOGA 3LEOA 4KNWA 2F22A 4U5HA 3E70C 1TWHA 1HW1A 1GS9A 3DM5A 2LIGA 3U3BA 3U8PA 2TMVP 4QDLA 1K04A 4N6CA 2GAQA 2OU6A 4H4KC 1F1MA 2Y3BA 1ZW2A 1CPQA 2J45A 2J9WA 3NMKA 1CGOA 3S28A 1JAFA 1KTMA 1OR3A 1FNTc 1RJ9A 2XLMA 3RVYA 4YWQA 1D0YA 2C04A 4IJJA 4NCQA 3WHNA 2J8WA 3SNHA 2GFHA 4CS8A 2LD6A 3V7OA 5JS5A 1OKKD 3K6BA 1Q0GA 2V3CC 4O6MA 5BQIA 1EI7A 3IQ5A 1TWAA 4JC7A 1LS1A 4MVMA 2KC3A 4NC3A 4P9FA 1Q0FA 2XRHA 4IB4A 1AVOB 3HKKA 4MNDA 1AUEA 2CNWA 1RJ9B 2OJED 3AGUA 1Z63A 1NZEA 4N6HA 3Q7GA 3LLIA 2RD9A 5T3TA 4E18A 3ZWIA 1T6UA 3GM2A 2Q9BA 3DE9A 1G4US 3MFNA 1YA9A 2YL0A 4ZLCA 1JMWA 3DMDA 3V5XA 3HNIA 2ZD9A 4YN0B 2IM8A 3HLZA 3T6GB 1HW2A 2HUJA 5AC5A 1E2XA 4K0DA 4HFFB 3EGXB 3BEHA 4YL3A 4G7ZF 1OXKA 1FAPB 1V54C 4XEVA 2ZPAA 1T01A 2YLGA 3EJNA 4XEKA 3ZQYA 1FTSA 1H9GA 4OD5A 1VOMA 1ZHXA 1ZW3A 5BQHA 4DJ9A 1R5ID 2LFFA 1W2WA 4RBNA 3PHF2 2PFDA 4JKVA 2R7XA 3FAPB 2EPNA 3FXHA 4NTAA 4Z9JA 3VF0A 4JTDB 1QVXA 5EGYA 2YRFA 2AWCA 3W8HA 2MWQA 4U5FE 3W4YA 3ZVRA 5L0HA 4W8PA 3DJUB 4J7TA 3QVYA 2QNLA 1DOVA 1TFKB 4IWBA 5B3IA 2IXOA 3HNKA 5KYYA 4E7SA 5KYUB 4NTBA 2R7TA 1Q0KA 2A0UA 2MHRA 2IXPA 1RXQA 2GA0A 2L7AA 3AQCA 4P6IC 2WZLA 3B0PA 4U5GA 2W9YA 2VB6A 3GANA 3NKDA 5E2QA 4GQHA 2J7PA 2H8AA 4N06A 1ZHTA 1BDJB 1WATA 1VTMP 1BR2A 2WVNA 3I5PA 1RMVA 3LUTB 4JTCB 4PJNA 3NMJA 2EPLX 1LVKA 5EHHA 1Y4CA 4MVSA 4CDVA 2HKVA 2FFHA 3GM1A 3UR3C 4H54A 3UGOA 4NTFA 1T9KA 1CPRA 3S29A 4C7OB 5L3QA 3LESA 2R7QA 1JPJA 2YWAA 4A4AA 1LE4A 2V26A 4YK5A 2O9XA 256BA 3SXKA 2HMZA 3TK0A 3NDBB 2EILC 3L34A 4ZLDA 2L81A 1V55C 1TWGA 1FMWA 2XM0A 3RQGA 4XLPF 5D91A 4G7OF 1JR8A 3TD7A 1MNDA 4JZAA 3HNLA 4WGYA 1XZQA 5FZTA 3RQFA 4E0HA 1TQGA 3MLGA 2ETSA 5JSLA 4CDYA 1GM5A 3NYMA 2WVQA 5B1AC 1BR4A 3DAFA 1E84A 1NU9C 1MNEA 5B3SC 1Q0MA 1EA8A 4LLCA 1K05A 5JLIA 1S7ZA 1QPUA 2OCCC 5L0IA 1PD1A 2NUPB 2AU5A 3X2QC 5COGA 3NKEA 3R7CA 2ZXWC 4FAPB 1OKKA 2WZFA 3CQZA 3EG9A 4FESA 2ASRA 2BL2A 4YT2A 4BJ5C 1Z5ZA 2OEXA 3ZG1A 3TQOA 1KNYA 2KQ9A 1D1CA 4MW8A 2YKZA 1VK5A 3EH1A 4I1OB 2EPMX 1ZVZA 4KNVA 2UUHA 3DKAA 3IEEA 1EKYA 2PBEA 3ABLC 3EG9B 3IQ6A 2EINC 3AOUA 4MVZA 2W45A 2XL4A 2DGJA 5FCLA 2R03A 2ZXPA 2XLEA 4MVRA 4EBJA 1QZXA 5KYXA 4Q4ZF 4CIHA 3LEVA 1T5OA 2J0WA 4PACA 1WWPA 4CS7A 2LP4A 1M2VB 1C17M 4GYTA 4LDRA 4BJ6A 4G7HF 1HE1A 2M4EA 3RKOF 4CS9C 2WVOA 3WODF 2XXAA 2Y3HA 3N24A 1J8YF 1L7CA 2P61A 2VASA 2YL3A 3B71A 3C8GB 3SYNA 3SZRA 2KW3C 5JRAA 3QTHA 3DM9B 3FMSA 3RFYA 4EIYA 2PF4E 3RIPA 2L6HA 1OCRC 3ZQVA 4ONSA 1VLSA 1I4YA 4MTOA 3DD7A 1RKEA 2Q9CA 2EIMC 4WABA 5COMA 2M64A 2G3KA 4DRIB 1YDIA 3C8ZA 1JRAA 1HMOA 3QVZA 4DXWA 4CSAC 1ZYRF 3K1IA 1FR0A 4BG0A 4L6RA 3M79A 3S0XA 3U9JA 4XPYA 4PFPA 5F5HA 4CBEA 4DBRA 1D1BA 2LQGA 1MMAA 2PX3A 2J0XA 2R7OA 2Z15A 3KL4A 3QW1A 4U5EE 2JX0A 1S05A 3RVZA 2L9JA 4ER9A 5E33A 1A7EA 3LS0A 5BQGA 4JTAB 2VCBA 3RYLA 1LS4A 2QLAA 5TJ5E 3RQEA 2L6FA 3HNJA 5CI9A 2H7BA 4C3BA 4DVYP 1ZZPA 3UMIA 2B0JA 4EWCA 5CIVA 1YA7O 3VM6A 4JJGA 1GQAA 4IRUA 4Q5SF 3FAJA 1IW7F 3Q7LA 3VRCA 4CJOA 1OR2A 4U9EA 3T9OA 3UNGC 3CZ6A 1ZHZA 4X0RA 4J30B 2A6HF 1VB5A 2JD3A 2OJQA 1QSPA 1ORJA 2CDQA 2D5RB 2R02A 2LFDA 3GM3A 3KKBA 3MBGA 3QZCA 5KYNA 1D1AA 2VCCA 1SZIA 1WTYA 4F4BA 2CYDA 3RW0A 5K0IA 3B0VC 5T3WA 4KC9A 4D4XA 4LACB 1RCPA 3T4RA 2H7VC 3AGTA 3Q6NA 3C63A 1JPNA 3I5QA 3U2LA 5KYYB 3LLKA 1WGWA 3S9OA 3G50A 3X1OA 2QY9A 3JRMO 3PDMP 3AG4C 1Y6DA 1YZCA 2XLVA 3ITFA 1B68A 1LIHA 2EIKC 3NG1A 4PFOA 3DXJF 3O55A 3TULA 1E85A 3WG7C 1C02A 3M1CB 5A6JA 5L0CA 1H9TA 4K7BA 3US6A 3ZDLA 1Z6AA 2MYSA 3TJ6A 1C03A 2XLOA 4A2NB 2PX0A 4WGZA 3OWTA 2A1DD 2A6EF 3L8IA 4PR9A 4IAOA 2P1AA 1BR1A 4Z9HA 2OQMA 3IQCA 3O39A 4O79A 1YJGA 4AE4A 1V74B 4EUKB 2IXMA 2XSEA 4NY3A 4BJ6C 3CSKA 1AEPA 4KI2A 1LI7A 4MTGA 4WJ0A 2P0NA 1SYQA 3DI5A 3H2UA 2IYLD 1NLXA 1SR2A 3QW0A 1OCOC 3EFOA 3GODA 3EH2A 4JW1A 5E3AA 2G62A 2OEVA 4CS8C 5L0GA 1J8MF 2A0BA 4OIPF 3N2ZB 1WOLA 4IAQA 1ORYA 2GDCA 1NU7D 1WASA 3W2WA 1QLEC 1Z3IX 2YVKA 1LKXA 1ZU4A 3W8IA 3ZSUA 1TR2A 2GWWA 3NYJA 3K66A 4W8KA 3VYWA 4I1MA 1O3UA 4LLEA 3IPMO 3ZTZA 2OOCA 3T6BA 4G78A 4HEAJ 1I5NA 1M6TA 2P6VA 4J7YA 1OCZC 1M56C 3QMKA 4AK9A 1UFBA 4LERA 4YL1A 2HSBA 2Q4FA 4P9TA 2XL6A 3SXMA 4FWVA 1RKCA 4U5CE 1G4WR 4YL0A 1YYJA 1QQ3A 3B29A 1VYKA 5F28E 1VLTA 3IHUA 2NPUA 2WL8A 3A11A 2D4UA 3N0TA 1LM3B 1D0ZA 1NBBA 2OG2A 1L3PA 4OINF 2YQYA 1ZHYA 1TFOB 4MQ9F 3RH3A 2CW0F 3RF3A 3SXZA 1O87A 4O6NA 1G8XA 2ICWG 3PMRA 2XS1A 2G3VA 2J46A 2UUIA 4XPWA 1SF8A 2KGOA 2KK1A 4JE9A 3H2VA 2A69F 2AWYA 4DVZA 2C03A 2ZXOA 3S27A 1MMNA 2BE5F 1HMDA 2YHSA 2YLIA 1LPEA 2HV7A 2NSFA 2X0CA 4JJFA 4EBKA 2R7RA 3ECSA 2CCYA 3ATPA 2HJMA 3JRTA 5KYXB 5JP7A 4E17A 3FOPA 5DS6A 3K7DA 3SEOA 2LCHA 3FHDA 2I8BA 4AL1A 4ULVA 3NYLA 3GEHA 4O6YA 4LDKA 4CX9A 2QTVA 1M2OA 3DJNB 2QE9A 3KYIA 2NG1A 4J32B 4XLNF 5AC4A 2IOQA 2XXAB 5F5FA 4HFKB 2HS5A 3MYFA 1O5HA 4G0HA 5IY5C 1DOWA 2BC5A 1OW6A 2HSQA 2QUPA 4JCHA 2NUTA 5DQTA 1T6QA 1XZPA 2FGYA 2ZXRA 5A6BD 2IXNA 4IGGA 4FX5A 5D92A 1YARO 3JZ0A 5GPGB 3EGDA 3F46A 5L0DA 2CGEA 3CAXA 1RKEB 2DYRC 4JEAA 4MVOA 4Q7CA 5L0FA 1E86A 4MTFA 1GGQA 4PJMA 3NRHA 3GORA 3JSEO 2NUTB 4K1OA 2EIJC 1E83A 4U9DA 3DE8A 4JIOA 4YT5A 4U5BE 3GEIA 5EK0A 2PP4A 3EGDB 2RSEB 4IARA 4Z9IA 4E0IA 3G4ZA 1U0BB 1OW7A 1APCA 1OW8A 1FFTC 4PJLA 2XLDA 3EPVA 4XPXA 3DWWA 2R9RB 2R05A 1LE2A 1HY5A 4XEFA 5AGFA 4B6IA 2XLHA 4CJGA 5BUOA 5DQZA 1BZ4A 1NSGB 1I4ZA 2XS8A 3E9VA 2E87A 3EGXA 2OKUA 3HJCA 3ASNC 3ABMC 3LS1A 4M63A 5L0JA 1Q0DA 2PNOA 3KPHA 2A68F 4QI2A 2J9VA 2Q3TA 2AP3A 4BJ5A 2XM4A 3C8GD 3OA1A 3SXYA 2HFIA 5DLJA 1H6GA 1OXBA 2VC9A 2YEVA 1FMVA 3R2PA 1A7DA 3O10A 3A9CA 3L8JA 1PV3A 4HE8D 1OCCC 3GWLA 3K1HA 3M4BA 4LDQA 4RDAA 4AL0A 5L3VA 3AG3C 3EQLF 3PCVA 4OD4A 1LI5A 3UGPA 4I3MA 4EKWA 3HTKC 1ORSC 4XTKA 3JYHA 2Y3GA 3ZTMA 4BEJA 4CDAA 4JRZA 3TOLA 3JCUQ 3U0CA 5KYUA 3BRJA 3MX3A 2XLWA 3TJ5A 1UG7A 2LK4A 2WZGA 4O7GA 3H65A 4OIRF 2DI3A 3C18A 4PK4A 1A0BA 4BJ1A 2Y39A 4DRJB 3LJBA 3L0IA 4QI0A 1IZMA 3OEOA 4CS9A 4RD9A 2J9BA 2HJ3A 1TKNA 2CNWD 4ANJA 2L6GA 4N4WA 1ZHWA 2Y69C 4XWJA 4EHPA 3GEEA 4OIOF 2KJGA 1V4AA 2YL1A 1M57C 3FDQA 1VYIA 5COFA 1PD0A 1BBHA 1WN0A 2I15A 2B0HA 2KNHA 4U5DE 1YLMA 4C3DA 3U3FA 3G4XA 4DOZA 3EHNA 2AVKA 2VH3A 3K33A 4BPMA 2J9UA 3S90A 4MVUA 2JPUA 4C7OA 2DYSC 4AE4B 2R7VA 2HV6A 2YZSA 2WB7A 3NMIA 3VAYA 4AX2A 4CSAA 1VMAA 4NQFA 1Z23A 4DBQA 1YYXA 1R4TA 3UMKA 4DRHB 3WAQA 5DS4A 1FFHA 5E3CA 3J06A 3KYJA 4UDVA 3EFOB 3M15A 4XQ1A 1MQVA 2H7OA 2P7VA 1A7VA 3B0UX 1YAUO 2HZ8A 3JYYA 5CI8A 5T1DB 3U9MA 4BEMJ 3GWNA 2KYHA 2NSGA 3K1IC 3AG2C 3LAYA 1CGNA 1NG1A 2KSFA 2VCAA 4D4NA 3V5ZA 2X51A 3LNRA 4JCZA 4YJWA 1U6HA 3U8VA 5A69A 3MYIA 4E7ZA 2EPKX 5JUAA 3L1MA 3Q6MA 4JEBA 4GEHA 1TWCA 4YT8A 1H7IA 1G5ZA 5JVEA 5KYWA 2R7UA 2NUPA 3CEXA 3JTLO 3FOOA 5A6BA 3DAGA 1SMYF 1XWJA 1YZAA 3KH2A 5B1BC 5A6KA 2XL8A 3EHMA 2IBFA 3EZHA 2Y3DA 3S84A 5HSWA 4R32A 2J7PD 4OIQF 4KBLA 3AJMA 3ZIBA 3FVYA 1A41A 3O6XA 1MMGA 3DZAA 4C3EA 3F47A 2YL7A 3C7JA
chains in the Genus database with same CATH topology
1PCXA 2R7WA 3JSZA 3B9QA 1ZU5A 1D0XA 4JURI 4JVSA 2W4MA 3W2VA 4I44A 3T6JA 1MMDA 2R7SA 3KMIA 5DVWA 1N1CA 3ZC4A 4EBBA 3ASOC 1KU2A 4ULWA 3UMHA 2LSEA 1ST6A 4PJJA 1M2VA 4BJTA 3EZIA 4YT4A 3POVA 3I4UA 5KYWB 3JT1A 5DS5A 3ABKC 2W4BA 2Q9AA 3AG1C 3SP1A 3AQBA 4U5HA 4KNWA 3E70C 1TWHA 3DM5A 4QDLA 4H4KC 2Y3BA 2J45A 2J9WA 3S28A 1RJ9A 4YWQA 1D0YA 2C04A 4IJJA 3SNHA 4CS8A 2GFHA 3V7OA 1OKKD 3K6BA 2V3CC 4O6MA 1TWAA 1LS1A 2XRHA 4MNDA 2CNWA 1RJ9B 1Z63A 1NZEA 3Q7GA 3LLIA 5T3TA 2Q9BA 4ZLCA 3DMDA 4YN0B 3HLZA 4K0DA 4HFFB 3EGXB 4G7ZF 1V54C 2ZPAA 3EJNA 1FTSA 4OD5A 1VOMA 1ZHXA 1W2WA 4RBNA 3PHF2 2PFDA 2R7XA 5EGYA 3W8HA 2MWQA 4U5FE 3ZVRA 3DJUB 4IWBA 2IXOA 5KYYA 4E7SA 5KYUB 2R7TA 2IXPA 3AQCA 4P6IC 2WZLA 3B0PA 4U5GA 2W9YA 2VB6A 3GANA 3NKDA 5E2QA 2J7PA 4N06A 1ZHTA 1BR2A 2WVNA 3I5PA 4PJNA 1LVKA 5EHHA 2FFHA 3UR3C 3UGOA 3S29A 4C7OB 5L3QA 3LESA 2R7QA 2V26A 2O9XA 3NDBB 2EILC 3L34A 4ZLDA 2L81A 1V55C 1TWGA 1FMWA 4XLPF 5D91A 4G7OF 3TD7A 1MNDA 4JZAA 3MLGA 3NYMA 2WVQA 5B1AC 1BR4A 3DAFA 1NU9C 1MNEA 5B3SC 4LLCA 1S7ZA 2OCCC 1PD1A 2NUPB 3X2QC 3NKEA 2ZXWC 1OKKA 2WZFA 3CQZA 3EG9A 4FESA 4YT2A 4BJ5C 1Z5ZA 3ZG1A 2KQ9A 1D1CA 1VK5A 3EH1A 4I1OB 4KNVA 3IEEA 3ABLC 3EG9B 2EINC 2W45A 2XL4A 2DGJA 2ZXPA 1QZXA 5KYXA 4Q4ZF 4CIHA 3LEVA 2J0WA 4CS7A 1M2VB 4G7HF 4GYTA 4BJ6A 2XXAA 2M4EA 3RKOF 4CS9C 2WVOA 3WODF 2Y3HA 3N24A 1J8YF 2VASA 3SZRA 3SYNA 2KW3C 3DM9B 3RFYA 2PF4E 3RIPA 1OCRC 3DD7A 2Q9CA 2EIMC 2G3KA 4CSAC 1ZYRF 4BG0A 3S0XA 5F5HA 4PFPA 4CBEA 4DBRA 1D1BA 2R7OA 1MMAA 2PX3A 2J0XA 2Z15A 3KL4A 4U5EE 2L9JA 5E33A 3LS0A 3RYLA 5CI9A 2H7BA 4C3BA 4DVYP 3UMIA 2B0JA 4EWCA 4JJGA 4IRUA 4Q5SF 3FAJA 1IW7F 3Q7LA 3UNGC 3CZ6A 1ZHZA 4X0RA 4J30B 2A6HF 2JD3A 2CDQA 2D5RB 3KKBA 3QZCA 5KYNA 1D1AA 1SZIA 4F4BA 3B0VC 5T3WA 4KC9A 4LACB 3T4RA 2H7VC 3Q6NA 1JPNA 3I5QA 5KYYB 3LLKA 1WGWA 3X1OA 2QY9A 3AG4C 3ITFA 2EIKC 3NG1A 4PFOA 3DXJF 3WG7C 3M1CB 4K7BA 1Z6AA 2MYSA 4A2NB 2PX0A 3OWTA 2A1DD 2A6EF 4IAOA 1BR1A 3O39A 4O79A 4AE4A 2IXMA 2XSEA 4NY3A 4BJ6C 3CSKA 4KI2A 4WJ0A 2IYLD 1OCOC 3EFOA 3GODA 3EH2A 4JW1A 5E3AA 2G62A 4CS8C 1J8MF 4OIPF 3N2ZB 1NU7D 3W2WA 1QLEC 1Z3IX 3W8IA 1LKXA 1ZU4A 3ZSUA 5FCLA 1TR2A 3NYJA 3K66A 4W8KA 3VYWA 4I1MA 4LLEA 3T6BA 4HEAJ 2P6VA 4AK9A 1OCZC 1M56C 3QMKA 4LERA 4FWVA 4U5CE 1VYKA 2WL8A 3N0TA 1D0ZA 2OG2A 4OINF 3RH3A 1ZHYA 4MQ9F 2CW0F 1O87A 4O6NA 1G8XA 3PMRA 2G3VA 2J46A 1SF8A 2KGOA 2A69F 4DVZA 2C03A 2ZXOA 3S27A 1MMNA 2BE5F 2YHSA 2HV7A 2R7RA 4JJFA 3ECSA 3JRTA 5KYXB 5DS6A 3K7DA 3SEOA 3FHDA 2I8BA 3NYLA 4O6YA 2QTVA 1M2OA 3DJNB 4J32B 4XLNF 2NG1A 2XXAB 5F5FA 2IOQA 4HFKB 1O5HA 4G0HA 5IY5C 4JCHA 2NUTA 5DQTA 2FGYA 2ZXRA 2IXNA 4FX5A 5D92A 3EGDA 3F46A 2CGEA 2DYRC 4Q7CA 4PJMA 3NRHA 2NUTB 2EIJC 4YT5A 4U5BE 2PP4A 3EGDB 1FFTC 4PJLA 3EPVA 4B6IA 5BUOA 5DQZA 3E9VA 3EGXA 2E87A 3HJCA 3LS1A 4M63A 3ASNC 3ABMC 2A68F 4QI2A 2J9VA 2Q3TA 4BJ5A 3OA1A 5DLJA 2YEVA 1FMVA 4HE8D 1OCCC 3K1HA 5L3VA 4RDAA 3AG3C 3EQLF 4OD4A 3UGPA 4I3MA 3HTKC 4XTKA 4BEJA 3JYHA 2Y3GA 3JCUQ 5KYUA 3MX3A 1MMGA 2WZGA 4O7GA 3H65A 4OIRF 4PK4A 4BJ1A 2Y39A 3LJBA 3L0IA 4QI0A 1IZMA 3OEOA 4CS9A 4RD9A 1TKNA 2CNWD 4ANJA 1ZHWA 2Y69C 4XWJA 4OIOF 2KJGA 1M57C 3FDQA 1VYIA 1PD0A 4DOZA 2KNHA 4U5DE 4C3DA 3EHNA 2VH3A 3K33A 2J9UA 4C7OA 2DYSC 4AE4B 2R7VA 2HV6A 2YZSA 2WB7A 4AX2A 3VAYA 4CSAA 1VMAA 4DBQA 1Z23A 3UMKA 5DS4A 1FFHA 5E3CA 3EFOB 2P7VA 2H7OA 3B0UX 5CI8A 5T1DB 3K1IC 3AG2C 3LAYA 1NG1A 2X51A 3LNRA 4YJWA 4E7ZA 3Q6MA 4GEHA 1TWCA 4YT8A 5KYWA 2R7UA 2NUPA 3DAGA 1SMYF 3KH2A 5B1BC 3EHMA 3EZHA 2Y3DA 5HSWA 4OIQF 2J7PD 4KBLA 3ZIBA 3FVYA 3O6XA 1JPJA 3DZAA 4C3EA 3F47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W8I A;  3W8H A;  4GEH A; 
#chains in the Genus database with same CATH topology
 2HMQ A;  1PCX A;  2R7W A;  3TOM A;  1Z7Q c;  3V5Y A;  3JSZ A;  1NFO A;  3B9Q A;  5HV9 A;  1ZU5 A;  1D0X A;  2Q00 A;  2Q7R A;  1CGM E;  1OQC A;  1YVI A;  4JUR I;  4JVS A;  2W4M A;  3W2V A;  4I44 A;  1QKR A;  3T6J A;  1MMD A;  1T6I A;  3IQT A;  1K40 A;  2R7S A;  3KMI A;  5DVW A;  1N1C A;  2EPO A;  3U2M A;  1HE9 A;  1NFN A;  2FAP B;  3ZC4 A;  4EBB A;  2DB4 A;  1KU2 A;  3ASO C;  4ULW A;  3UMH A;  2LSE A;  1EQ1 A;  1ST6 A;  3M4C A;  3LNM B;  1M2V A;  4PJJ A;  3EZI A;  4BJT A;  2YLD A;  4YT4 A;  5A6A A;  4CIP A;  3POV A;  3I4U A;  1U89 A;  4MVQ A;  3U5S A;  3C62 A;  3C8G A;  3JT1 A;  4MW3 A;  5JT4 A;  3ABK C;  2W4B A;  5KYW B;  5DS5 A;  2Q9A A;  2R25 A;  4MS2 A;  3AG1 C;  3SP1 A;  3AQB A;  1JOG A;  3LEO A;  4KNW A;  2F22 A;  4U5H A;  3E70 C;  1TWH A;  1HW1 A;  1GS9 A;  3DM5 A;  2LIG A;  3U3B A;  3U8P A;  2TMV P;  4QDL A;  1K04 A;  4N6C A;  2GAQ A;  2OU6 A;  4H4K C;  1F1M A;  2Y3B A;  1ZW2 A;  1CPQ A;  2J45 A;  2J9W A;  3NMK A;  1CGO A;  3S28 A;  1JAF A;  1KTM A;  1OR3 A;  1FNT c;  1RJ9 A;  2XLM A;  3RVY A;  4YWQ A;  1D0Y A;  2C04 A;  4IJJ A;  4NCQ A;  3WHN A;  2J8W A;  3SNH A;  2GFH A;  4CS8 A;  2LD6 A;  3V7O A;  5JS5 A;  1OKK D;  3K6B A;  1Q0G A;  2V3C C;  4O6M A;  5BQI A;  1EI7 A;  3IQ5 A;  1TWA A;  4JC7 A;  1LS1 A;  4MVM A;  2KC3 A;  4NC3 A;  4P9F A;  1Q0F A;  2XRH A;  4IB4 A;  1AVO B;  3HKK A;  4MND A;  1AUE A;  2CNW A;  1RJ9 B;  2OJE D;  3AGU A;  1Z63 A;  1NZE A;  4N6H A;  3Q7G A;  3LLI A;  2RD9 A;  5T3T A;  4E18 A;  3ZWI A;  1T6U A;  3GM2 A;  2Q9B A;  3DE9 A;  1G4U S;  3MFN A;  1YA9 A;  2YL0 A;  4ZLC A;  1JMW A;  3DMD A;  3V5X A;  3HNI A;  2ZD9 A;  4YN0 B;  2IM8 A;  3HLZ A;  3T6G B;  1HW2 A;  2HUJ A;  5AC5 A;  1E2X A;  4K0D A;  4HFF B;  3EGX B;  3BEH A;  4YL3 A;  4G7Z F;  1OXK A;  1FAP B;  1V54 C;  4XEV A;  2ZPA A;  1T01 A;  2YLG A;  3EJN A;  4XEK A;  3ZQY A;  1FTS A;  1H9G A;  4OD5 A;  1VOM A;  1ZHX A;  1ZW3 A;  5BQH A;  4DJ9 A;  1R5I D;  2LFF A;  1W2W A;  4RBN A;  3PHF 2;  2PFD A;  4JKV A;  2R7X A;  3FAP B;  2EPN A;  3FXH A;  4NTA A;  4Z9J A;  3VF0 A;  4JTD B;  1QVX A;  5EGY A;  2YRF A;  2AWC A;  3W8H A;  2MWQ A;  4U5F E;  3W4Y A;  3ZVR A;  5L0H A;  4W8P A;  3DJU B;  4J7T A;  3QVY A;  2QNL A;  1DOV A;  1TFK B;  4IWB A;  5B3I A;  2IXO A;  3HNK A;  5KYY A;  4E7S A;  5KYU B;  4NTB A;  2R7T A;  1Q0K A;  2A0U A;  2MHR A;  2IXP A;  1RXQ A;  2GA0 A;  2L7A A;  3AQC A;  4P6I C;  2WZL A;  3B0P A;  4U5G A;  2W9Y A;  2VB6 A;  3GAN A;  3NKD A;  5E2Q A;  4GQH A;  2J7P A;  2H8A A;  4N06 A;  1ZHT A;  1BDJ B;  1WAT A;  1VTM P;  1BR2 A;  2WVN A;  3I5P A;  1RMV A;  3LUT B;  4JTC B;  4PJN A;  3NMJ A;  2EPL X;  1LVK A;  5EHH A;  1Y4C A;  4MVS A;  4CDV A;  2HKV A;  2FFH A;  3GM1 A;  3UR3 C;  4H54 A;  3UGO A;  4NTF A;  1T9K A;  1CPR A;  3S29 A;  4C7O B;  5L3Q A;  3LES A;  2R7Q A;  1JPJ A;  2YWA A;  4A4A A;  1LE4 A;  2V26 A;  4YK5 A;  2O9X A;  256B A;  3SXK A;  2HMZ A;  3TK0 A;  3NDB B;  2EIL C;  3L34 A;  4ZLD A;  2L81 A;  1V55 C;  1TWG A;  1FMW A;  2XM0 A;  3RQG A;  4XLP F;  5D91 A;  4G7O F;  1JR8 A;  3TD7 A;  1MND A;  4JZA A;  3HNL A;  4WGY A;  1XZQ A;  5FZT A;  3RQF A;  4E0H A;  1TQG A;  3MLG A;  2ETS A;  5JSL A;  4CDY A;  1GM5 A;  3NYM A;  2WVQ A;  5B1A C;  1BR4 A;  3DAF A;  1E84 A;  1NU9 C;  1MNE A;  5B3S C;  1Q0M A;  1EA8 A;  4LLC A;  1K05 A;  5JLI A;  1S7Z A;  1QPU A;  2OCC C;  5L0I A;  1PD1 A;  2NUP B;  2AU5 A;  3X2Q C;  5COG A;  3NKE A;  3R7C A;  2ZXW C;  4FAP B;  1OKK A;  2WZF A;  3CQZ A;  3EG9 A;  4FES A;  2ASR A;  2BL2 A;  4YT2 A;  4BJ5 C;  1Z5Z A;  2OEX A;  3ZG1 A;  3TQO A;  1KNY A;  2KQ9 A;  1D1C A;  4MW8 A;  2YKZ A;  1VK5 A;  3EH1 A;  4I1O B;  2EPM X;  1ZVZ A;  4KNV A;  2UUH A;  3DKA A;  3IEE A;  1EKY A;  2PBE A;  3ABL C;  3EG9 B;  3IQ6 A;  2EIN C;  3AOU A;  4MVZ A;  2W45 A;  2XL4 A;  2DGJ A;  5FCL A;  2R03 A;  2ZXP A;  2XLE A;  4MVR A;  4EBJ A;  1QZX A;  5KYX A;  4Q4Z F;  4CIH A;  3LEV A;  1T5O A;  2J0W A;  4PAC A;  1WWP A;  4CS7 A;  2LP4 A;  1M2V B;  1C17 M;  4GYT A;  4LDR A;  4BJ6 A;  4G7H F;  1HE1 A;  2M4E A;  3RKO F;  4CS9 C;  2WVO A;  3WOD F;  2XXA A;  2Y3H A;  3N24 A;  1J8Y F;  1L7C A;  2P61 A;  2VAS A;  2YL3 A;  3B71 A;  3C8G B;  3SYN A;  3SZR A;  2KW3 C;  5JRA A;  3QTH A;  3DM9 B;  3FMS A;  3RFY A;  4EIY A;  2PF4 E;  3RIP A;  2L6H A;  1OCR C;  3ZQV A;  4ONS A;  1VLS A;  1I4Y A;  4MTO A;  3DD7 A;  1RKE A;  2Q9C A;  2EIM C;  4WAB A;  5COM A;  2M64 A;  2G3K A;  4DRI B;  1YDI A;  3C8Z A;  1JRA A;  1HMO A;  3QVZ A;  4DXW A;  4CSA C;  1ZYR F;  3K1I A;  1FR0 A;  4BG0 A;  4L6R A;  3M79 A;  3S0X A;  3U9J A;  4XPY A;  4PFP A;  5F5H A;  4CBE A;  4DBR A;  1D1B A;  2LQG A;  1MMA A;  2PX3 A;  2J0X A;  2R7O A;  2Z15 A;  3KL4 A;  3QW1 A;  4U5E E;  2JX0 A;  1S05 A;  3RVZ A;  2L9J A;  4ER9 A;  5E33 A;  1A7E A;  3LS0 A;  5BQG A;  4JTA B;  2VCB A;  3RYL A;  1LS4 A;  2QLA A;  5TJ5 E;  3RQE A;  2L6F A;  3HNJ A;  5CI9 A;  2H7B A;  4C3B A;  4DVY P;  1ZZP A;  3UMI A;  2B0J A;  4EWC A;  5CIV A;  1YA7 O;  3VM6 A;  4JJG A;  1GQA A;  4IRU A;  4Q5S F;  3FAJ A;  1IW7 F;  3Q7L A;  3VRC A;  4CJO A;  1OR2 A;  4U9E A;  3T9O A;  3UNG C;  3CZ6 A;  1ZHZ A;  4X0R A;  4J30 B;  2A6H F;  1VB5 A;  2JD3 A;  2OJQ A;  1QSP A;  1ORJ A;  2CDQ A;  2D5R B;  2R02 A;  2LFD A;  3GM3 A;  3KKB A;  3MBG A;  3QZC A;  5KYN A;  1D1A A;  2VCC A;  1SZI A;  1WTY A;  4F4B A;  2CYD A;  3RW0 A;  5K0I A;  3B0V C;  5T3W A;  4KC9 A;  4D4X A;  4LAC B;  1RCP A;  3T4R A;  2H7V C;  3AGT A;  3Q6N A;  3C63 A;  1JPN A;  3I5Q A;  3U2L A;  5KYY B;  3LLK A;  1WGW A;  3S9O A;  3G50 A;  3X1O A;  2QY9 A;  3JRM O;  3PDM P;  3AG4 C;  1Y6D A;  1YZC A;  2XLV A;  3ITF A;  1B68 A;  1LIH A;  2EIK C;  3NG1 A;  4PFO A;  3DXJ F;  3O55 A;  3TUL A;  1E85 A;  3WG7 C;  1C02 A;  3M1C B;  5A6J A;  5L0C A;  1H9T A;  4K7B A;  3US6 A;  3ZDL A;  1Z6A A;  2MYS A;  3TJ6 A;  1C03 A;  2XLO A;  4A2N B;  2PX0 A;  4WGZ A;  3OWT A;  2A1D D;  2A6E F;  3L8I A;  4PR9 A;  4IAO A;  2P1A A;  1BR1 A;  4Z9H A;  2OQM A;  3IQC A;  3O39 A;  4O79 A;  1YJG A;  4AE4 A;  1V74 B;  4EUK B;  2IXM A;  2XSE A;  4NY3 A;  4BJ6 C;  3CSK A;  1AEP A;  4KI2 A;  1LI7 A;  4MTG A;  4WJ0 A;  2P0N A;  1SYQ A;  3DI5 A;  3H2U A;  2IYL D;  1NLX A;  1SR2 A;  3QW0 A;  1OCO C;  3EFO A;  3GOD A;  3EH2 A;  4JW1 A;  5E3A A;  2G62 A;  2OEV A;  4CS8 C;  5L0G A;  1J8M F;  2A0B A;  4OIP F;  3N2Z B;  1WOL A;  4IAQ A;  1ORY A;  2GDC A;  1NU7 D;  1WAS A;  3W2W A;  1QLE C;  1Z3I X;  2YVK A;  1LKX A;  1ZU4 A;  3W8I A;  3ZSU A;  1TR2 A;  2GWW A;  3NYJ A;  3K66 A;  4W8K A;  3VYW A;  4I1M A;  1O3U A;  4LLE A;  3IPM O;  3ZTZ A;  2OOC A;  3T6B A;  4G78 A;  4HEA J;  1I5N A;  1M6T A;  2P6V A;  4J7Y A;  1OCZ C;  1M56 C;  3QMK A;  4AK9 A;  1UFB A;  4LER A;  4YL1 A;  2HSB A;  2Q4F A;  4P9T A;  2XL6 A;  3SXM A;  4FWV A;  1RKC A;  4U5C E;  1G4W R;  4YL0 A;  1YYJ A;  1QQ3 A;  3B29 A;  1VYK A;  5F28 E;  1VLT A;  3IHU A;  2NPU A;  2WL8 A;  3A11 A;  2D4U A;  3N0T A;  1LM3 B;  1D0Z A;  1NBB A;  2OG2 A;  1L3P A;  4OIN F;  2YQY A;  1ZHY A;  1TFO B;  4MQ9 F;  3RH3 A;  2CW0 F;  3RF3 A;  3SXZ A;  1O87 A;  4O6N A;  1G8X A;  2ICW G;  3PMR A;  2XS1 A;  2G3V A;  2J46 A;  2UUI A;  4XPW A;  1SF8 A;  2KGO A;  2KK1 A;  4JE9 A;  3H2V A;  2A69 F;  2AWY A;  4DVZ A;  2C03 A;  2ZXO A;  3S27 A;  1MMN A;  2BE5 F;  1HMD A;  2YHS A;  2YLI A;  1LPE A;  2HV7 A;  2NSF A;  2X0C A;  4JJF A;  4EBK A;  2R7R A;  3ECS A;  2CCY A;  3ATP A;  2HJM A;  3JRT A;  5KYX B;  5JP7 A;  4E17 A;  3FOP A;  5DS6 A;  3K7D A;  3SEO A;  2LCH A;  3FHD A;  2I8B A;  4AL1 A;  4ULV A;  3NYL A;  3GEH A;  4O6Y A;  4LDK A;  4CX9 A;  2QTV A;  1M2O A;  3DJN B;  2QE9 A;  3KYI A;  2NG1 A;  4J32 B;  4XLN F;  5AC4 A;  2IOQ A;  2XXA B;  5F5F A;  4HFK B;  2HS5 A;  3MYF A;  1O5H A;  4G0H A;  5IY5 C;  1DOW A;  2BC5 A;  1OW6 A;  2HSQ A;  2QUP A;  4JCH A;  2NUT A;  5DQT A;  1T6Q A;  1XZP A;  2FGY A;  2ZXR A;  5A6B D;  2IXN A;  4IGG A;  4FX5 A;  5D92 A;  1YAR O;  3JZ0 A;  5GPG B;  3EGD A;  3F46 A;  5L0D A;  2CGE A;  3CAX A;  1RKE B;  2DYR C;  4JEA A;  4MVO A;  4Q7C A;  5L0F A;  1E86 A;  4MTF A;  1GGQ A;  4PJM A;  3NRH A;  3GOR A;  3JSE O;  2NUT B;  4K1O A;  2EIJ C;  1E83 A;  4U9D A;  3DE8 A;  4JIO A;  4YT5 A;  4U5B E;  3GEI A;  5EK0 A;  2PP4 A;  3EGD B;  2RSE B;  4IAR A;  4Z9I A;  4E0I A;  3G4Z A;  1U0B B;  1OW7 A;  1APC A;  1OW8 A;  1FFT C;  4PJL A;  2XLD A;  3EPV A;  4XPX A;  3DWW A;  2R9R B;  2R05 A;  1LE2 A;  1HY5 A;  4XEF A;  5AGF A;  4B6I A;  2XLH A;  4CJG A;  5BUO A;  5DQZ A;  1BZ4 A;  1NSG B;  1I4Z A;  2XS8 A;  3E9V A;  2E87 A;  3EGX A;  2OKU A;  3HJC A;  3ASN C;  3ABM C;  3LS1 A;  4M63 A;  5L0J A;  1Q0D A;  2PNO A;  3KPH A;  2A68 F;  4QI2 A;  2J9V A;  2Q3T A;  2AP3 A;  4BJ5 A;  2XM4 A;  3C8G D;  3OA1 A;  3SXY A;  2HFI A;  5DLJ A;  1H6G A;  1OXB A;  2VC9 A;  2YEV A;  1FMV A;  3R2P A;  1A7D A;  3O10 A;  3A9C A;  3L8J A;  1PV3 A;  4HE8 D;  1OCC C;  3GWL A;  3K1H A;  3M4B A;  4LDQ A;  4RDA A;  4AL0 A;  5L3V A;  3AG3 C;  3EQL F;  3PCV A;  4OD4 A;  1LI5 A;  3UGP A;  4I3M A;  4EKW A;  3HTK C;  1ORS C;  4XTK A;  3JYH A;  2Y3G A;  3ZTM A;  4BEJ A;  4CDA A;  4JRZ A;  3TOL A;  3JCU Q;  3U0C A;  5KYU A;  3BRJ A;  3MX3 A;  2XLW A;  3TJ5 A;  1UG7 A;  2LK4 A;  2WZG A;  4O7G A;  3H65 A;  4OIR F;  2DI3 A;  3C18 A;  4PK4 A;  1A0B A;  4BJ1 A;  2Y39 A;  4DRJ B;  3LJB A;  3L0I A;  4QI0 A;  1IZM A;  3OEO A;  4CS9 A;  4RD9 A;  2J9B A;  2HJ3 A;  1TKN A;  2CNW D;  4ANJ A;  2L6G A;  4N4W A;  1ZHW A;  2Y69 C;  4XWJ A;  4EHP A;  3GEE A;  4OIO F;  2KJG A;  1V4A A;  2YL1 A;  1M57 C;  3FDQ A;  1VYI A;  5COF A;  1PD0 A;  1BBH A;  1WN0 A;  2I15 A;  2B0H A;  2KNH A;  4U5D E;  1YLM A;  4C3D A;  3U3F A;  3G4X A;  4DOZ A;  3EHN A;  2AVK A;  2VH3 A;  3K33 A;  4BPM A;  2J9U A;  3S90 A;  4MVU A;  2JPU A;  4C7O A;  2DYS C;  4AE4 B;  2R7V A;  2HV6 A;  2YZS A;  2WB7 A;  3NMI A;  3VAY A;  4AX2 A;  4CSA A;  1VMA A;  4NQF A;  1Z23 A;  4DBQ A;  1YYX A;  1R4T A;  3UMK A;  4DRH B;  3WAQ A;  5DS4 A;  1FFH A;  5E3C A;  3J06 A;  3KYJ A;  4UDV A;  3EFO B;  3M15 A;  4XQ1 A;  1MQV A;  2H7O A;  2P7V A;  1A7V A;  3B0U X;  1YAU O;  2HZ8 A;  3JYY A;  5CI8 A;  5T1D B;  3U9M A;  4BEM J;  3GWN A;  2KYH A;  2NSG A;  3K1I C;  3AG2 C;  3LAY A;  1CGN A;  1NG1 A;  2KSF A;  2VCA A;  4D4N A;  3V5Z A;  2X51 A;  3LNR A;  4JCZ A;  4YJW A;  1U6H A;  3U8V A;  5A69 A;  3MYI A;  4E7Z A;  2EPK X;  5JUA A;  3L1M A;  3Q6M A;  4JEB A;  4GEH A;  1TWC A;  4YT8 A;  1H7I A;  1G5Z A;  5JVE A;  5KYW A;  2R7U A;  2NUP A;  3CEX A;  3JTL O;  3FOO A;  5A6B A;  3DAG A;  1SMY F;  1XWJ A;  1YZA A;  3KH2 A;  5B1B C;  5A6K A;  2XL8 A;  3EHM A;  2IBF A;  3EZH A;  2Y3D A;  3S84 A;  5HSW A;  4R32 A;  2J7P D;  4OIQ F;  4KBL A;  3AJM A;  3ZIB A;  3FVY A;  1A41 A;  3O6X A;  1MMG A;  3DZA A;  4C3E A;  3F47 A;  2YL7 A;  3C7J A; 
#chains in the Genus database with same CATH homology
 1PCX A;  2R7W A;  3JSZ A;  3B9Q A;  1ZU5 A;  1D0X A;  4JUR I;  4JVS A;  2W4M A;  3W2V A;  4I44 A;  3T6J A;  1MMD A;  2R7S A;  3KMI A;  5DVW A;  1N1C A;  3ZC4 A;  4EBB A;  3ASO C;  1KU2 A;  4ULW A;  3UMH A;  2LSE A;  1ST6 A;  4PJJ A;  1M2V A;  4BJT A;  3EZI A;  4YT4 A;  3POV A;  3I4U A;  5KYW B;  3JT1 A;  5DS5 A;  3ABK C;  2W4B A;  2Q9A A;  3AG1 C;  3SP1 A;  3AQB A;  4U5H A;  4KNW A;  3E70 C;  1TWH A;  3DM5 A;  4QDL A;  4H4K C;  2Y3B A;  2J45 A;  2J9W A;  3S28 A;  1RJ9 A;  4YWQ A;  1D0Y A;  2C04 A;  4IJJ A;  3SNH A;  4CS8 A;  2GFH A;  3V7O A;  1OKK D;  3K6B A;  2V3C C;  4O6M A;  1TWA A;  1LS1 A;  2XRH A;  4MND A;  2CNW A;  1RJ9 B;  1Z63 A;  1NZE A;  3Q7G A;  3LLI A;  5T3T A;  2Q9B A;  4ZLC A;  3DMD A;  4YN0 B;  3HLZ A;  4K0D A;  4HFF B;  3EGX B;  4G7Z F;  1V54 C;  2ZPA A;  3EJN A;  1FTS A;  4OD5 A;  1VOM A;  1ZHX A;  1W2W A;  4RBN A;  3PHF 2;  2PFD A;  2R7X A;  5EGY A;  3W8H A;  2MWQ A;  4U5F E;  3ZVR A;  3DJU B;  4IWB A;  2IXO A;  5KYY A;  4E7S A;  5KYU B;  2R7T A;  2IXP A;  3AQC A;  4P6I C;  2WZL A;  3B0P A;  4U5G A;  2W9Y A;  2VB6 A;  3GAN A;  3NKD A;  5E2Q A;  2J7P A;  4N06 A;  1ZHT A;  1BR2 A;  2WVN A;  3I5P A;  4PJN A;  1LVK A;  5EHH A;  2FFH A;  3UR3 C;  3UGO A;  3S29 A;  4C7O B;  5L3Q A;  3LES A;  2R7Q A;  2V26 A;  2O9X A;  3NDB B;  2EIL C;  3L34 A;  4ZLD A;  2L81 A;  1V55 C;  1TWG A;  1FMW A;  4XLP F;  5D91 A;  4G7O F;  3TD7 A;  1MND A;  4JZA A;  3MLG A;  3NYM A;  2WVQ A;  5B1A C;  1BR4 A;  3DAF A;  1NU9 C;  1MNE A;  5B3S C;  4LLC A;  1S7Z A;  2OCC C;  1PD1 A;  2NUP B;  3X2Q C;  3NKE A;  2ZXW C;  1OKK A;  2WZF A;  3CQZ A;  3EG9 A;  4FES A;  4YT2 A;  4BJ5 C;  1Z5Z A;  3ZG1 A;  2KQ9 A;  1D1C A;  1VK5 A;  3EH1 A;  4I1O B;  4KNV A;  3IEE A;  3ABL C;  3EG9 B;  2EIN C;  2W45 A;  2XL4 A;  2DGJ A;  2ZXP A;  1QZX A;  5KYX A;  4Q4Z F;  4CIH A;  3LEV A;  2J0W A;  4CS7 A;  1M2V B;  4G7H F;  4GYT A;  4BJ6 A;  2XXA A;  2M4E A;  3RKO F;  4CS9 C;  2WVO A;  3WOD F;  2Y3H A;  3N24 A;  1J8Y F;  2VAS A;  3SZR A;  3SYN A;  2KW3 C;  3DM9 B;  3RFY A;  2PF4 E;  3RIP A;  1OCR C;  3DD7 A;  2Q9C A;  2EIM C;  2G3K A;  4CSA C;  1ZYR F;  4BG0 A;  3S0X A;  5F5H A;  4PFP A;  4CBE A;  4DBR A;  1D1B A;  2R7O A;  1MMA A;  2PX3 A;  2J0X A;  2Z15 A;  3KL4 A;  4U5E E;  2L9J A;  5E33 A;  3LS0 A;  3RYL A;  5CI9 A;  2H7B A;  4C3B A;  4DVY P;  3UMI A;  2B0J A;  4EWC A;  4JJG A;  4IRU A;  4Q5S F;  3FAJ A;  1IW7 F;  3Q7L A;  3UNG C;  3CZ6 A;  1ZHZ A;  4X0R A;  4J30 B;  2A6H F;  2JD3 A;  2CDQ A;  2D5R B;  3KKB A;  3QZC A;  5KYN A;  1D1A A;  1SZI A;  4F4B A;  3B0V C;  5T3W A;  4KC9 A;  4LAC B;  3T4R A;  2H7V C;  3Q6N A;  1JPN A;  3I5Q A;  5KYY B;  3LLK A;  1WGW A;  3X1O A;  2QY9 A;  3AG4 C;  3ITF A;  2EIK C;  3NG1 A;  4PFO A;  3DXJ F;  3WG7 C;  3M1C B;  4K7B A;  1Z6A A;  2MYS A;  4A2N B;  2PX0 A;  3OWT A;  2A1D D;  2A6E F;  4IAO A;  1BR1 A;  3O39 A;  4O79 A;  4AE4 A;  2IXM A;  2XSE A;  4NY3 A;  4BJ6 C;  3CSK A;  4KI2 A;  4WJ0 A;  2IYL D;  1OCO C;  3EFO A;  3GOD A;  3EH2 A;  4JW1 A;  5E3A A;  2G62 A;  4CS8 C;  1J8M F;  4OIP F;  3N2Z B;  1NU7 D;  3W2W A;  1QLE C;  1Z3I X;  3W8I A;  1LKX A;  1ZU4 A;  3ZSU A;  5FCL A;  1TR2 A;  3NYJ A;  3K66 A;  4W8K A;  3VYW A;  4I1M A;  4LLE A;  3T6B A;  4HEA J;  2P6V A;  4AK9 A;  1OCZ C;  1M56 C;  3QMK A;  4LER A;  4FWV A;  4U5C E;  1VYK A;  2WL8 A;  3N0T A;  1D0Z A;  2OG2 A;  4OIN F;  3RH3 A;  1ZHY A;  4MQ9 F;  2CW0 F;  1O87 A;  4O6N A;  1G8X A;  3PMR A;  2G3V A;  2J46 A;  1SF8 A;  2KGO A;  2A69 F;  4DVZ A;  2C03 A;  2ZXO A;  3S27 A;  1MMN A;  2BE5 F;  2YHS A;  2HV7 A;  2R7R A;  4JJF A;  3ECS A;  3JRT A;  5KYX B;  5DS6 A;  3K7D A;  3SEO A;  3FHD A;  2I8B A;  3NYL A;  4O6Y A;  2QTV A;  1M2O A;  3DJN B;  4J32 B;  4XLN F;  2NG1 A;  2XXA B;  5F5F A;  2IOQ A;  4HFK B;  1O5H A;  4G0H A;  5IY5 C;  4JCH A;  2NUT A;  5DQT A;  2FGY A;  2ZXR A;  2IXN A;  4FX5 A;  5D92 A;  3EGD A;  3F46 A;  2CGE A;  2DYR C;  4Q7C A;  4PJM A;  3NRH A;  2NUT B;  2EIJ C;  4YT5 A;  4U5B E;  2PP4 A;  3EGD B;  1FFT C;  4PJL A;  3EPV A;  4B6I A;  5BUO A;  5DQZ A;  3E9V A;  3EGX A;  2E87 A;  3HJC A;  3LS1 A;  4M63 A;  3ASN C;  3ABM C;  2A68 F;  4QI2 A;  2J9V A;  2Q3T A;  4BJ5 A;  3OA1 A;  5DLJ A;  2YEV A;  1FMV A;  4HE8 D;  1OCC C;  3K1H A;  5L3V A;  4RDA A;  3AG3 C;  3EQL F;  4OD4 A;  3UGP A;  4I3M A;  3HTK C;  4XTK A;  4BEJ A;  3JYH A;  2Y3G A;  3JCU Q;  5KYU A;  3MX3 A;  1MMG A;  2WZG A;  4O7G A;  3H65 A;  4OIR F;  4PK4 A;  4BJ1 A;  2Y39 A;  3LJB A;  3L0I A;  4QI0 A;  1IZM A;  3OEO A;  4CS9 A;  4RD9 A;  1TKN A;  2CNW D;  4ANJ A;  1ZHW A;  2Y69 C;  4XWJ A;  4OIO F;  2KJG A;  1M57 C;  3FDQ A;  1VYI A;  1PD0 A;  4DOZ A;  2KNH A;  4U5D E;  4C3D A;  3EHN A;  2VH3 A;  3K33 A;  2J9U A;  4C7O A;  2DYS C;  4AE4 B;  2R7V A;  2HV6 A;  2YZS A;  2WB7 A;  4AX2 A;  3VAY A;  4CSA A;  1VMA A;  4DBQ A;  1Z23 A;  3UMK A;  5DS4 A;  1FFH A;  5E3C A;  3EFO B;  2P7V A;  2H7O A;  3B0U X;  5CI8 A;  5T1D B;  3K1I C;  3AG2 C;  3LAY A;  1NG1 A;  2X51 A;  3LNR A;  4YJW A;  4E7Z A;  3Q6M A;  4GEH A;  1TWC A;  4YT8 A;  5KYW A;  2R7U A;  2NUP A;  3DAG A;  1SMY F;  3KH2 A;  5B1B C;  3EHM A;  3EZH A;  2Y3D A;  5HSW A;  4OIQ F;  2J7P D;  4KBL A;  3ZIB A;  3FVY A;  3O6X A;  1JPJ A;  3DZA A;  4C3E A;  3F47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...