3W91A

Crystal structure of semet-labeled yeast n-acetyltransferase mpr1 l87m mutant
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
226
structure length
226
Chain Sequence
ESIEWKLTANLRNGPTFFQPLADSIEPLQFKLIGSDTVATAFPVFDTKYIPDSLINYLFKLFNLEIESGKTYPQLHSLTKQGFMNYWFHSFAVVVLQTDEKFIQDNQDWNSVLLGTFYIKPNYAPRCSHNCNAGFLVNGAHRGQKVGYRLAQVYLNWAPLLGYKYSIFNLVFVTNQASWKIWDKLNFQRIGLVPHAGILNGFSEPVDAIIYGKDLTKIEPEFLSME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of the yeast N-acetyltransferase Mpr1 involved in oxidative stress tolerance via proline metabolism
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords MPR1 protein
total genus 61
structure length 226
sequence length 226
chains with identical sequence B, C
ec nomenclature ec 2.3.1.271: L-glutamate-5-semialdehyde N-acetyltransferase.
pdb deposition date 2013-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3w91A00
2NMTA 2JDDA 3S6KA 4AG9A 1OZPA 4KVXA 4KLVA 2ZXVA 1QSRA 3TCVA 2REEA 2REFA 3SXOA 1IYLA 4K30A 3TOAA 1YR0A 2Z11A 4AVBA 1LRZA 4KOSA 2ZPAA 1Y9WA 3C26A 3KKWA 4CAWA 1YK3A 5F47A 1Q2CA 4R9MA 4CAVA 2Q7BA 1QSTA 1RO5A 5CNPA 5EBVA 1KUYA 3I3GA 2HQYA 3FRMA 4HNXB 2RC4A 3H4QA 4QUSA 2R8VA 4KUBA 1YLEA 2P6GA 5HH1A 3ZZIA 4HNYB 2BSWA 4PV6A 1M4GA 2WPWA 3R95A 1N71A 3FYNA 2JDCA 4KOTA 1KZFA 1S7LA 2FS5A 3W6SA 4M3SA 2CY2A 2CNTA 4PK3A 2BL1A 5E96A 4KVME 3FIXA 3DSBA 3F8KA 1IIDA 3LD2A 2P6EA 2D4OA 2JLMA 1I1DA 3D3SA 1IICA 2ARHA 4MBUA 3P2FA 4BMHA 1S7FA 4JLYA 2B4BA 3F0AA 2QECA 3W91A 5GCNA 3EC4A 2EVNA 3DDDA 4H89A 2IL4A 3CXQA 3SHPA 3FNCA 4AG7A 1Y7RA 3G3SA 2PRBA 2ZW5A 2G3TA 3D8PA 4PSWA 1Q2DA 2OZHA 3TFYA 2C27A 3G8WA 4YFJA 1Q2YA 1B87A 4AVAA 5EC4A 1BO4A 2VBQA 4QB9A 3EO4A 4RS2A 2PR1A 4R87A 2R7HA 2H5MA 2AE6A 2B5GB 1MK4A 1L0CA 1M4IA 2DXQA 1PUAA 4XPDC 2VQYA 3TO9A 4EVYA 4LX9A 2R1IA 1I12A 2BUEA 3GYAA 1FY7A 5C88A 2Y0MA 3TOBA 5C82A 2B58A 4CRYB 1V0CA 4KOXA 1S7NA 2OZGA 4IUSA 4DNCA 1Z4RA 3V8IA 4XPDB 4ZBGA 2OZUA 3S6FA 4E8OA 5F48A 4OLLA 2CNSA 1QSMA 4PK2A 2FT0A 1XF8A 4KOUA 4R3LA 5JQ4A 4KLWA 3WR7A 4NXYA 4XPLA 4MJ8A 1WK4A 2AJ6A 4F0YA 3BLNA 3QB8A 1CJWA 2OU2A 1M4DA 3D2MA 4QBJA 1KUVA 3LODA 2J8RA 2P6FA 1P4NA 5ISVA 2FIWA 5FVJA 2ATRA 3N7ZA 1XE4A 1GHEA 2K5TA 2VZYA 4X5KA 2Z10A 3IGRA 2HUZA 1U6MA 2ZW6A 4FD4A 4KZTA 4GS4A 3FXTA 2I00A 4KUAA 2B4DB 3EXNA 4CAXA 1MJAA 4II9A 2B4DA 1YREA 4H6UA 2VXKA 4UA3A 5J8CA 2B5GA 5DWMA 3E0KA 3VWEA 4AVCA 5DWNA 4ORFA 1YVKA 2B3VA 1YGHA 5IV0A 3TO6A 4UWIA 3VWDA 4KOVA 4YGOA 2J8MA 3S6HA 1S7KA 2ZW4A 3P2HA 2O28A 2VI7A 3CXSA 3CXPA 4NEXA 4JD6A 4Y49C 1PU9A 4FD5A 4MY0A 4MY3A 2HV2A 4KOYA 4PSXA 3PGPA 4ONUA 4MHDA 2I79A 3TTHA 1MJBA 3TO7A 1NMTA 1XEBA 2PSWA 4JXRA 3R9EA 3R96A 3PZJA 3I9SA 3DNSA 3JUWA 2FIAA 4HKFA 4QVTA 3R9FA 2A4NA 4I49A 4R57A 4XNHB 2FL4A 2EUIA 1VKCA 5IB0A 1B6BA 4MI4A 2D4PA 2OB0A 1QSNA 3FB3A 5KTDA 2BEIA 3FBUA 4XNHC 1CM0A 1P0HA 1TIQA 3GY9A 4LUAA 1IB1E 1MJ9A 3ZJ0A 1Z9UA 3W6XA 4OAEA 4R3KA 2FE7A 5HMNA 2Q04A 4JWPA 1Z4EA 4B5PB 3PP9A 1YVOA 4M85A 2J8NA 3NE7A 3B8GA 2R98A 2FSRA 2PR8A 1R57A 3TE4A 4L89A 2Q0YA 1NSLA 3GKRA 2G3AA 3SXNA 4NCZA 4CRZB 3T90A 2KCWA 4QC6A 2GIVA 3D2PA 4KOWA 4FD6A 4L8AA 3MGDA 2VZZA 3DR8A 1K4JA 4NSQA 2FXFA 2G0BA 4IF5A 2Q4YA 4E2AA 3TT2A 5F49A 3R9GA 1J4JA 3BJ8A 2OH1A 2FCKA 3OWCA 2GANA 3F5BA 2B3UA 2Z0ZA 2PQ8A 5I0CA 3EY5A 1IYKA 1ON0A 1NE9A 4F6AA 1M44A 3K9UA 3UY5A 1BOBA 2QMLA 5H84A 1Y9KA 4KORA 2F5IA 1KUXA 2X7BA 3BJ7A 1VHSA 2JEVA 5KTCA 4H6ZA 2WPXA 1XIXA 1QSOA 4Y49B 5JPHA 4B5OA 4JXQA 4RI1A 1M1DA 3EFAA 4HNWB 1WWZA 3DR6A 4OADA 2GE3A 2ZW7A 1XMTA 2CNMA 1S3ZA 2Q4VA 3QAHA 4U9ZA 5KTAA 4YRHA 5IX3A 4NF1A 4JJXA 2Q44A 4AB7A 5F46A 1YX0A 4U5YA 1S5KA 4UWJA 2QIRA 1SQHA 2VEZA 4KVOE 3JVNA 3S6GA 4B5PA 1RXTA 4J3GA 3RYOA 4E0AA 2PDOA 1S60A 2P0WA 4XPKA 1UFHA 4CS0B 4FD7A 4U9YA 1I21A 2PC1A 3R1KA 4UBRA 3IWGA 5H86A 5J8FA 3T9YA
chains in the Genus database with same CATH superfamily
2NMTA 2ZEMA 4NGNA 3VATA 4C7IA 6CPAA 5D29A 2JDDA 3S6KA 4AG9A 4P6YA 2FVGA 1OZPA 4KVXA 2AFSA 5LRJA 4B11A 4KLVA 2ZXVA 1QSRA 3D7FA 4PXCA 3TCVA 5A27A 2REEA 4B12A 2REFA 4M6GA 1IY7A 3SXOA 1IYLA 4PXEA 4K30A 3H8FA 2PJ9A 2HB6A 2ANPA 2PJ7A 3SJFA 1H8LA 4MHYA 3TOAA 1YR0A 4B14A 2Z11A 4AVBA 1LRZA 4KOSA 2ZPAA 4FBEA 5HMNA 4CAFA 4C2XA 1Z8WA 1Y9WA 1VHOA 2YNCA 3C26A 3KKWA 4H2KA 4CAWA 4O23A 3WC7A 5HXDA 5AG4A 5LYFA 1QQ9A 4ONWA 4MFZA 5D8NA 4MRIA 4Q36A 1YK3A 1ZLIA 5F47A 1Q2CA 4CGNA 2JBJA 3K9TA 1ARLA 4R9MA 4CAVA 2Q7BA 1QSTA 2WYRA 1RO5A 5CNPA 5EBVA 1KUYA 2XEIA 4HPSA 3I3GA 2V8VA 3IC1A 2HQYA 4M6HA 4UF4A 1CPXA 3FRMA 4HNXB 4DJLA 2RC4A 3H4QA 4QUSA 3HLPA 2R8VA 4KUBA 1YLEA 3PB6X 4ZY0A 2P6GA 5HH1A 3ZZIA 3NH4A 2ZEPA 1CX8A 2Z3MA 4HNYB 3BXMA 2AFMA 2BSWA 4PV6A 1M4GA 1YSJA 2WPWA 4MFJA 5ELYA 3R95A 2OOTA 2AFWA 5JH9A 1N71A 1ZO0A 2EWBA 3FYNA 3L2NA 2JDCA 4KOTA 1KZFA 3NA6A 1S7LA 4NJQA 5K8OA 2FS5A 5G21A 3IJ3A 3W6SA 4M3SA 2Z3LA 2CY2A 2CNTA 2BL1A 4PK3A 5E96A 1F2OA 2DEAA 1LAMA 1AMPA 3BHXA 4TWEA 4KVME 2YNDA 1Y0RA 3ISXA 3K2KA 3FIXA 3DSBA 2WZNA 1XFOA 3F8KA 2ZEFA 1TKHA 1IIDA 3LD2A 1HDUA 2P6EA 2F7VA 2D4OA 2JLMA 1I1DA 3D3SA 4BD9A 1KWMA 2PCUA 1F2PA 3IFEA 1IICA 1PCAA 2ZELA 1TF8A 2ZOGA 2ARHA 3D4UA 4MBUA 2RFHA 4YU9A 4UFVA 3P2FA 2GLJA 1S7FA 4BMHA 2OR4A 4JLYA 2B4BA 3F0AA 3B2YA 2QECA 1YW6A 2Z3OA 2Q43A 1Z5RA 1Z8XA 4P4BA 3W91A 4OMEA 4WJBA 2Q51A 5GCNA 3S9MA 3EC4A 2EVNA 3DGVA 3GB0A 3KHZA 3QNVA 3DDDA 2PIZA 4NGQA 4OC4A 2PIYA 2V77A 4H89A 4EMEA 3KGQA 1XJOA 3MRUA 4R6TA 2IL4A 3CXQA 3SHPA 3FNCA 4AG7A 1Y7RA 3G3SA 5LYIA 2PRBA 2ZW5A 5LYLA 3V38A 2G3TA 3D8PA 3GIUA 3FEDA 4KSIA 4MFPA 3FMCA 5G1ZA 4PSWA 2PJ3A 3ISZA 1Q2DA 1ARMA 3WC6A 3TC8A 4WWVA 3B7IA 2PJ4A 3GUXA 4FAIA 5HVHA 4OC3A 4CGMA 4G1PA 2Z3KA 5A28A 2OZHA 3TFYA 1YMEA 3B3WA 2C27A 4A38A 4B10A 3G8WA 4A39A 1NSAA 4YFJA 1Q2YA 2ZEOA 1B87A 1Y7EA 3VH9A 3IWEA 4AVAA 5EC4A 1BO4A 3B3SA 3NE8A 2VBQA 4KS9A 3EO4A 4QB9A 4RS2A 4A94A 4LQ6A 3RZAA 2PR1A 4R87A 4P10A 2R7HA 2H5MA 4OC5A 3FVLA 3H8GA 1VIXA 2EO8A 2AE6A 2B5GB 4FUUA 4X3RA 1MK4A 1L0CA 3D7DA 5LYDA 2PJBA 4K3NA 1M4IA 3D7GA 4BBHA 2DXQA 5K8MA 4F9VA 1PUAA 2PJ1A 1LAPA 4MHNA 4XPDC 1PYTB 2VQYA 3T8WA 3TO9A 2WUUA 4NGTA 4PQAA 4EVYA 4UEEA 4LX9A 4CYQA 5F09A 2R1IA 1I12A 3IIBA 2BUEA 3GYAA 4CGLA 3LACA 1FY7A 5C88A 2Y0MA 4GM5A 2YNCC 3TOBA 1XMBA 5DS0A 3SJGA 1QMUA 4EFDA 1ZG8A 5C82A 2B58A 2O53A 4CGPA 4MXUA 4CRYB 1ELLP 2BO9A 4P4IA 1V0CA 4KOXA 4TNUA 1S7NA 2JEWA 2C6GA 2OZGA 4IUSA 2PJ0A 1Z4RA 3V8IA 3MN8A 4DNCA 4XPDB 4MCQA 2ZEDA 3CDXA 4ZBGA 2OZUA 3S6FA 3A9LA 4MFKA 3SI2A 4A31A 4KSAA 2C6CA 4E8OA 5F48A 4OLLA 4PXBA 2CNSA 4JYWA 5K8PA 1QSMA 3CZXA 3IU1A 4PK2A 1Z8TA 2FT0A 1XF8A 4KOUA 4R3LA 1DE4C 5JQ4A 1Y0YA 4KLWA 4DYOA 4NJRA 3WR7A 2PVWA 2Q4ZA 4NXYA 1TXRA 4KSFA 4NFRA 4XPLA 4CPAA 1AYEA 4MJ8A 1ZLHA 1WK4A 4B13A 2AJ6A 2YGWA 3H8EA 4F0YA 1LFWA 3BLNA 4P4FA 3QB8A 3WT4A 7CPAA 2Q7SA 4DUKA 4LQGA 1CJWA 1VHEA 4A30A 3PFEA 2J9AA 2OU2A 5I4MA 1M4DA 3D2MA 4QBJA 1KUVA 3LODA 3D67A 4UFWA 4MMOA 4PXDA 2J8RA 3TX8A 1R43A 2P6FA 1LANA 3KASA 1P4NA 5ISVA 2FIWA 4PPZA 5FVJA 2ATRA 3N7ZA 1XE4A 3WABA 1AUGA 1BLLE 4GXHA 1GHEA 2K5TA 3SJXA 2VZYA 2PJ8A 4X5KA 2Z10A 2PJ2A 3KL9A 3IGRA 2HUZA 3CPAA 3S9NA 1U6MA 3FX6A 2G9DA 2ZW6A 4FD4A 4KZTA 4GS4A 3D68A 3FXTA 2I00A 3RO0A 3RBUA 4KUAA 4P4DA 2GU2A 4NGSA 2PJ5A 4UFXA 2B4DB 4OC0A 3EXNA 4CAXA 3S9LA 1MJAA 4II9A 4UEZA 2B4DA 3PB4X 1YW4A 1YREA 2V8GA 4H6UA 2VXKA 4UA3A 2QYVA 5J8CA 2RB7A 3CPXA 2B5GA 3HUVA 4MFLA 5DWMA 3E0KA 4UCPA 3VWEA 4AVCA 1Z2LA 2IQ6A 2Z3NA 4MCPA 4R76A 2XEFA 4ORFA 5DWNA 1YVKA 2B3VA 1M4LA 3IEHA 1YGHA 5IV0A 3TO6A 1FNOA 2PE3A 4R7MA 1EE3P 3KR4A 4MCSA 4A95A 3RNZA 4UWIA 4MHPA 1XRYA 2ZENA 4KOVA 3VWDA 1JQGA 2ZEEA 3PB8X 4YGOA 3IU2A 2J8MA 3V7ZA 3S6HA 3FJUA 1S7KA 2ZW4A 4ZY1A 4CYPA 3N5FA 2ABZA 4C2ZA 4C7HA 3P2HA 4MFQA 2O28A 4UCNA 4AXVA 2HC9A 1YLOA 2F8HA 1DTDA 2VI7A 3CXSA 3CXPA 1BPNA 4NEXA 3D7HA 5IB9A 4JD6A 4Q7AA 4Y49C 4R8FA 1HDQA 1PU9A 2GREA 2QVPA 3FECA 4FD5A 4MY0A 5AG7A 2CF4A 4MY3A 2EK8A 4OP4A 3B3TA 3NFZA 2HV2A 4KOYA 3PGPA 4PSXA 2PJ6A 4ONUA 4OC2A 4MHDA 3FF3A 2I79A 3TTHA 1MJBA 3TO7A 3PEIA 1NMTA 1XEBA 2PSWA 4CAEA 4JXRA 5THWA 3R9EA 2BOAA 3H5ZA 3PZJA 3R96A 3IO1A 5HVGA 4P44A 1IOFA 4OC1A 1UWYA 3I9SA 3B35A 5J1QA 2GFQA 3DNSA 3JUWA 2C6PA 2FIAA 3GLJA 4ZY2A 8CPAA 4HKFA 4QVTA 3R9FA 2A4NA 3SI1A 3WC5A 4CGOA 4I49A 4R57A 4XNHB 2FL4A 3BI1A 5G20A 2EUIA 3SI0A 4BINA 1ZG7A 3KZWA 1VKCA 4NGRA 2I3CA 1FT7A 5IB0A 2CXAA 1R3NA 1B6BA 4CYNA 4MI4A 2D4PA 1CP7A 2OB0A 1QSNA 2V8DA 3FB3A 5KTDA 2BEIA 2PJCA 4IK2A 4A2ZA 2YNEA 4P4EA 3FBUA 3D66A 3PFOA 4XNHC 5K8NA 1CM0A 1P0HA 1TIQA 5G22A 2EK9A 1XOVA 3GY9A 1X10A 4LUAA 1F57A 1CPSA 1IB1E 1MJ9A 1HEEA 1IU8A 1Z9UA 3PBEA 3ZJ0A 3W6XA 4OIWA 4OAEA 1CBXA 2FE7A 2ZOFA 4R3KA 2VL1A 3VARA 2AFXA 2Q04A 2WSAA 4JWPA 4P4JA 4MHZA 5AGEA 3SJEA 2CIJA 1Z4EA 2JBKA 2IJZA 4B5PB 3PP9A 5JM6A 1YVOA 4UCMA 3LMSA 4M85A 1Z8LA 2J8NA 3NE7A 3B8GA 1A2ZA 2R98A 2V8HA 4IAVA 2FSRA 2NYQA 2PRQA 4F0XA 5CBMA 3PBBA 2PR8A 1R57A 3TE4A 1BAVA 3CT9A 4L89A 2Z3PA 2DPTA 2Q0YA 1NSLA 1RTQA 3GKRA 2G3AA 3SXNA 4NCZA 4CRZB 3NH8A 4ZGYB 3T90A 2AFZA 1TKFA 2KCWA 1IOIA 3IWWA 4P45A 4QC6A 2GIVA 3D2PA 4KOWA 2GLFA 4FD6A 3MGDA 2VZZA 3DR8A 1K4JA 2O4HA 4L8AA 4NSQA 4YWYA 2FXFA 2G0BA 5AG6A 1JWQA 4IF5A 3KI9A 2Q4YA 4B6ZA 4RUHA 4E2AA 3TT2A 4NGPA 3RAMA 5BWAB 5LRGA 4NGMA 5F49A 3R9GA 4JZ0A 4UIBA 1J4JA 2ZEGA 3LWUA 1LOKA 1XBUA 3B3CA 3B3VA 3BJ8A 1GYTA 2OH1A 2FCKA 2ODFA 3OWCA 2GANA 3F5BA 3PRTA 2B3UA 3PB7X 4UIAA 4MCRA 5CPAA 2Z0ZA 3KQZA 2PQ8A 1OBRA 3PB9X 4A32A 5I0CA 4IHMA 3EY5A 2ZEHA 3NH5A 1IYKA 1ON0A 1NE9A 4F6AA 1M44A 3K9UA 4ZYQA 2PJAA 4X2TA 3FH4A 2PVVA 3UY5A 1BOBA 3FEEA 3KR5A 2QMLA 3KQXA 5H84A 1LCPA 4W9YA 4Q38A 1Y9KA 4F8ZA 2F5IA 3BJ7A 1KUXA 1TF9A 2X7BA 4KORA 3BI0A 1VHSA 1IGBA 2C1CA 4RN7A 4F9UA 4A37A 2JEVA 4ZI6A 4OIDA 4C2YA 5KTCA 4EWTA 2CTBA 2WPXA 4H6ZA 2EBJA 4A33A 1X12A 1XIXA 1QSOA 4Y49B 5JPHA 4B5OA 4OKOA 4JXQA 4RI1A 2AFUA 4FWUA 2XEGA 1M1DA 1Q7LA 2POKA 3KHXA 3EFAA 1TKJA 3I1UA 4HNWB 1WWZA 1CP6A 3DR6A 4OADA 2GE3A 1XMTA 2ZW7A 2CNMA 3DLJA 1S3ZA 2Q4VA 3JTKA 3JRUA 3QAHA 4U9ZA 5KTAA 4YRHA 4M6IA 5IX3A 4NF1A 4JJXA 2Q44A 4AB7A 5F46A 2CTCA 1YX0A 4U5YA 4Z65A 4ZX8A 4CYOA 4C68A 1S5KA 3QAYA 4ZX9A 2NSMA 2QIRA 4UWJA 1SQHA 2DPSA 2VEZA 2IMOA 3JVNA 4KVOE 3S6GA 4B5PA 1RXTA 1CG2A 4J3GA 3RYOA 1VGYA 2BCOA 1ZG9A 1YQEA 5LRKA 2XEJA 5EMIA 4E0AA 2PDOA 2QJ8A 4UEFA 1S60A 2P0WA 5AG5A 1ELMP 4XPKA 2DF5A 1UFHA 4CS0B 4FD7A 4U9YA 1I21A 2PC1A 1BPMA 3R1KA 5HVFA 5JGFA 4UBRA 2AFOA 3IWGA 5H86A 5J8FA 3T9YA 4X8IA
chains in the Genus database with same CATH topology
2NMTA 4C7IA 2JDDA 3S6KA 4AG9A 1OZPA 4KVXA 4B11A 4KLVA 2ZXVA 1QSRA 3TCVA 5A27A 2REEA 4B12A 2REFA 3SXOA 1IYLA 4K30A 3TOAA 1YR0A 4B14A 2Z11A 4AVBA 1LRZA 4KOSA 2ZPAA 4CAFA 4C2XA 1Y9WA 2YNCA 3C26A 3KKWA 4CAWA 5AG4A 4MFZA 4Q36A 1YK3A 5F47A 1Q2CA 4CGNA 4R9MA 4CAVA 2Q7BA 1QSTA 1RO5A 5CNPA 5EBVA 1KUYA 3I3GA 2HQYA 3FRMA 4HNXB 2RC4A 3H4QA 4QUSA 2R8VA 4KUBA 1YLEA 2P6GA 5HH1A 3ZZIA 2Z3MA 4HNYB 2BSWA 4PV6A 1M4GA 2WPWA 4MFJA 3R95A 1N71A 1ZO0A 3FYNA 2JDCA 4KOTA 1KZFA 1S7LA 2FS5A 5G21A 3W6SA 4M3SA 2Z3LA 2CY2A 2CNTA 2BL1A 4PK3A 5E96A 4KVME 2YNDA 3FIXA 3DSBA 3F8KA 1IIDA 3LD2A 2P6EA 2D4OA 2JLMA 1I1DA 3D3SA 1IICA 2ARHA 4MBUA 4UFVA 3P2FA 4BMHA 1S7FA 4JLYA 2B4BA 3F0AA 2QECA 2Z3OA 3W91A 5GCNA 3EC4A 2EVNA 3DDDA 4H89A 2IL4A 3CXQA 3SHPA 3FNCA 4AG7A 1Y7RA 3G3SA 2PRBA 2ZW5A 2G3TA 3D8PA 4MFPA 5G1ZA 4PSWA 1Q2DA 4CGMA 2Z3KA 5A28A 2OZHA 3TFYA 2C27A 4B10A 3G8WA 4YFJA 1Q2YA 1B87A 3IWEA 4AVAA 5EC4A 1BO4A 2VBQA 4KS9A 3EO4A 4QB9A 4RS2A 2PR1A 4R87A 2R7HA 2H5MA 2AE6A 2B5GB 1MK4A 1L0CA 1M4IA 4BBHA 2DXQA 1PUAA 4XPDC 2VQYA 3TO9A 2WUUA 4EVYA 4LX9A 4CYQA 2R1IA 1I12A 2BUEA 3GYAA 4CGLA 1FY7A 5C88A 2Y0MA 2YNCC 3TOBA 5C82A 2B58A 4CGPA 4CRYB 1V0CA 4KOXA 1S7NA 2OZGA 4IUSA 4DNCA 1Z4RA 3V8IA 4XPDB 4ZBGA 2OZUA 3S6FA 3A9LA 4MFKA 4A31A 4E8OA 4KSAA 5F48A 4OLLA 2CNSA 1QSMA 3IU1A 4PK2A 2FT0A 1XF8A 4KOUA 4R3LA 5JQ4A 4KLWA 3WR7A 4NXYA 4XPLA 4KSFA 4MJ8A 1WK4A 4B13A 2AJ6A 2YGWA 4F0YA 3BLNA 3QB8A 1CJWA 4A30A 2OU2A 1M4DA 3D2MA 4QBJA 1KUVA 3LODA 4UFWA 2J8RA 2P6FA 1P4NA 5ISVA 2FIWA 5FVJA 2ATRA 3N7ZA 1XE4A 1GHEA 2K5TA 2VZYA 4X5KA 2Z10A 3IGRA 2HUZA 1U6MA 2ZW6A 4FD4A 4KZTA 4GS4A 3FXTA 2I00A 4KUAA 4UFXA 2B4DB 3EXNA 4CAXA 1MJAA 4II9A 2B4DA 1YREA 4H6UA 2VXKA 4UA3A 5J8CA 2B5GA 4MFLA 5DWMA 3E0KA 4UCPA 3VWEA 4AVCA 2Z3NA 5DWNA 4ORFA 1YVKA 2B3VA 1YGHA 5IV0A 3TO6A 4A95A 4UWIA 3VWDA 4KOVA 4YGOA 3IU2A 2J8MA 3S6HA 1S7KA 2ZW4A 4CYPA 4C2ZA 4C7HA 3P2HA 4MFQA 2O28A 4UCNA 2VI7A 3CXSA 3CXPA 4NEXA 4JD6A 4Y49C 1PU9A 4FD5A 4MY0A 5AG7A 4MY3A 2HV2A 4KOYA 3PGPA 4PSXA 4ONUA 4MHDA 2I79A 3TTHA 1MJBA 3TO7A 1NMTA 1XEBA 2PSWA 4CAEA 4JXRA 3R9EA 3R96A 3H5ZA 3PZJA 3I9SA 3DNSA 3JUWA 2FIAA 4HKFA 4QVTA 3R9FA 2A4NA 4CGOA 4I49A 4R57A 4XNHB 2FL4A 5G20A 2EUIA 1VKCA 5IB0A 2CXAA 4CYNA 1B6BA 4MI4A 2D4PA 2OB0A 1QSNA 3FB3A 5KTDA 2BEIA 4A2ZA 2YNEA 3FBUA 4XNHC 1CM0A 1P0HA 1TIQA 5G22A 3GY9A 4LUAA 1IB1E 1MJ9A 3ZJ0A 1Z9UA 3W6XA 4OAEA 4R3KA 2FE7A 5HMNA 2Q04A 2WSAA 4JWPA 5AGEA 1Z4EA 4B5PB 3PP9A 1YVOA 4UCMA 4M85A 2J8NA 3NE7A 3B8GA 2R98A 2FSRA 4F0XA 2PR8A 1R57A 3TE4A 4L89A 2Z3PA 2DPTA 2Q0YA 1NSLA 3GKRA 2G3AA 3SXNA 4NCZA 4CRZB 4ZGYB 3T90A 2KCWA 4QC6A 2GIVA 3D2PA 4KOWA 4FD6A 4L8AA 3MGDA 2VZZA 3DR8A 1K4JA 4NSQA 2FXFA 2G0BA 5AG6A 4IF5A 2Q4YA 4E2AA 3TT2A 5BWAB 5F49A 3R9GA 1J4JA 3BJ8A 2OH1A 2FCKA 3OWCA 2GANA 3F5BA 2B3UA 2Z0ZA 2PQ8A 4A32A 5I0CA 3EY5A 1IYKA 1ON0A 1NE9A 4F6AA 1M44A 3K9UA 3UY5A 1BOBA 2QMLA 5H84A 4Q38A 1Y9KA 4KORA 2F5IA 1KUXA 2X7BA 3BJ7A 1VHSA 2JEVA 4C2YA 5KTCA 4H6ZA 2WPXA 4A33A 1XIXA 1QSOA 4Y49B 5JPHA 4B5OA 4JXQA 4RI1A 1M1DA 3EFAA 4HNWB 1WWZA 3DR6A 4OADA 2GE3A 2ZW7A 1XMTA 2CNMA 1S3ZA 2Q4VA 3JTKA 3QAHA 4U9ZA 5KTAA 4YRHA 5IX3A 4NF1A 4JJXA 2Q44A 4AB7A 5F46A 1YX0A 4U5YA 4CYOA 4C68A 1S5KA 4UWJA 2QIRA 1SQHA 2DPSA 4KVOE 2VEZA 3JVNA 3S6GA 4B5PA 1RXTA 4J3GA 3RYOA 4E0AA 2PDOA 1S60A 2P0WA 5AG5A 4XPKA 1UFHA 4CS0B 4FD7A 4U9YA 1I21A 2PC1A 3R1KA 4UBRA 3IWGA 5H86A 5J8FA 3T9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NMT A;  2JDD A;  3S6K A;  4AG9 A;  1OZP A;  4KVX A;  4KLV A;  2ZXV A;  1QSR A;  3TCV A;  2REE A;  2REF A;  3SXO A;  1IYL A;  4K30 A;  3TOA A;  1YR0 A;  2Z11 A;  4AVB A;  1LRZ A;  4KOS A;  2ZPA A;  1Y9W A;  3C26 A;  3KKW A;  4CAW A;  1YK3 A;  5F47 A;  1Q2C A;  4R9M A;  4CAV A;  2Q7B A;  1QST A;  1RO5 A;  5CNP A;  5EBV A;  1KUY A;  3I3G A;  2HQY A;  3FRM A;  4HNX B;  2RC4 A;  3H4Q A;  4QUS A;  2R8V A;  4KUB A;  1YLE A;  2P6G A;  5HH1 A;  3ZZI A;  4HNY B;  2BSW A;  4PV6 A;  1M4G A;  2WPW A;  3R95 A;  1N71 A;  3FYN A;  2JDC A;  4KOT A;  1KZF A;  1S7L A;  2FS5 A;  3W6S A;  4M3S A;  2CY2 A;  2CNT A;  4PK3 A;  2BL1 A;  5E96 A;  4KVM E;  3FIX A;  3DSB A;  3F8K A;  1IID A;  3LD2 A;  2P6E A;  2D4O A;  2JLM A;  1I1D A;  3D3S A;  1IIC A;  2ARH A;  4MBU A;  3P2F A;  4BMH A;  1S7F A;  4JLY A;  2B4B A;  3F0A A;  2QEC A;  3W91 A;  5GCN A;  3EC4 A;  2EVN A;  3DDD A;  4H89 A;  2IL4 A;  3CXQ A;  3SHP A;  3FNC A;  4AG7 A;  1Y7R A;  3G3S A;  2PRB A;  2ZW5 A;  2G3T A;  3D8P A;  4PSW A;  1Q2D A;  2OZH A;  3TFY A;  2C27 A;  3G8W A;  4YFJ A;  1Q2Y A;  1B87 A;  4AVA A;  5EC4 A;  1BO4 A;  2VBQ A;  4QB9 A;  3EO4 A;  4RS2 A;  2PR1 A;  4R87 A;  2R7H A;  2H5M A;  2AE6 A;  2B5G B;  1MK4 A;  1L0C A;  1M4I A;  2DXQ A;  1PUA A;  4XPD C;  2VQY A;  3TO9 A;  4EVY A;  4LX9 A;  2R1I A;  1I12 A;  2BUE A;  3GYA A;  1FY7 A;  5C88 A;  2Y0M A;  3TOB A;  5C82 A;  2B58 A;  4CRY B;  1V0C A;  4KOX A;  1S7N A;  2OZG A;  4IUS A;  4DNC A;  1Z4R A;  3V8I A;  4XPD B;  4ZBG A;  2OZU A;  3S6F A;  4E8O A;  5F48 A;  4OLL A;  2CNS A;  1QSM A;  4PK2 A;  2FT0 A;  1XF8 A;  4KOU A;  4R3L A;  5JQ4 A;  4KLW A;  3WR7 A;  4NXY A;  4XPL A;  4MJ8 A;  1WK4 A;  2AJ6 A;  4F0Y A;  3BLN A;  3QB8 A;  1CJW A;  2OU2 A;  1M4D A;  3D2M A;  4QBJ A;  1KUV A;  3LOD A;  2J8R A;  2P6F A;  1P4N A;  5ISV A;  2FIW A;  5FVJ A;  2ATR A;  3N7Z A;  1XE4 A;  1GHE A;  2K5T A;  2VZY A;  4X5K A;  2Z10 A;  3IGR A;  2HUZ A;  1U6M A;  2ZW6 A;  4FD4 A;  4KZT A;  4GS4 A;  3FXT A;  2I00 A;  4KUA A;  2B4D B;  3EXN A;  4CAX A;  1MJA A;  4II9 A;  2B4D A;  1YRE A;  4H6U A;  2VXK A;  4UA3 A;  5J8C A;  2B5G A;  5DWM A;  3E0K A;  3VWE A;  4AVC A;  5DWN A;  4ORF A;  1YVK A;  2B3V A;  1YGH A;  5IV0 A;  3TO6 A;  4UWI A;  3VWD A;  4KOV A;  4YGO A;  2J8M A;  3S6H A;  1S7K A;  2ZW4 A;  3P2H A;  2O28 A;  2VI7 A;  3CXS A;  3CXP A;  4NEX A;  4JD6 A;  4Y49 C;  1PU9 A;  4FD5 A;  4MY0 A;  4MY3 A;  2HV2 A;  4KOY A;  4PSX A;  3PGP A;  4ONU A;  4MHD A;  2I79 A;  3TTH A;  1MJB A;  3TO7 A;  1NMT A;  1XEB A;  2PSW A;  4JXR A;  3R9E A;  3R96 A;  3PZJ A;  3I9S A;  3DNS A;  3JUW A;  2FIA A;  4HKF A;  4QVT A;  3R9F A;  2A4N A;  4I49 A;  4R57 A;  4XNH B;  2FL4 A;  2EUI A;  1VKC A;  5IB0 A;  1B6B A;  4MI4 A;  2D4P A;  2OB0 A;  1QSN A;  3FB3 A;  5KTD A;  2BEI A;  3FBU A;  4XNH C;  1CM0 A;  1P0H A;  1TIQ A;  3GY9 A;  4LUA A;  1IB1 E;  1MJ9 A;  3ZJ0 A;  1Z9U A;  3W6X A;  4OAE A;  4R3K A;  2FE7 A;  5HMN A;  2Q04 A;  4JWP A;  1Z4E A;  4B5P B;  3PP9 A;  1YVO A;  4M85 A;  2J8N A;  3NE7 A;  3B8G A;  2R98 A;  2FSR A;  2PR8 A;  1R57 A;  3TE4 A;  4L89 A;  2Q0Y A;  1NSL A;  3GKR A;  2G3A A;  3SXN A;  4NCZ A;  4CRZ B;  3T90 A;  2KCW A;  4QC6 A;  2GIV A;  3D2P A;  4KOW A;  4FD6 A;  4L8A A;  3MGD A;  2VZZ A;  3DR8 A;  1K4J A;  4NSQ A;  2FXF A;  2G0B A;  4IF5 A;  2Q4Y A;  4E2A A;  3TT2 A;  5F49 A;  3R9G A;  1J4J A;  3BJ8 A;  2OH1 A;  2FCK A;  3OWC A;  2GAN A;  3F5B A;  2B3U A;  2Z0Z A;  2PQ8 A;  5I0C A;  3EY5 A;  1IYK A;  1ON0 A;  1NE9 A;  4F6A A;  1M44 A;  3K9U A;  3UY5 A;  1BOB A;  2QML A;  5H84 A;  1Y9K A;  4KOR A;  2F5I A;  1KUX A;  2X7B A;  3BJ7 A;  1VHS A;  2JEV A;  5KTC A;  4H6Z A;  2WPX A;  1XIX A;  1QSO A;  4Y49 B;  5JPH A;  4B5O A;  4JXQ A;  4RI1 A;  1M1D A;  3EFA A;  4HNW B;  1WWZ A;  3DR6 A;  4OAD A;  2GE3 A;  2ZW7 A;  1XMT A;  2CNM A;  1S3Z A;  2Q4V A;  3QAH A;  4U9Z A;  5KTA A;  4YRH A;  5IX3 A;  4NF1 A;  4JJX A;  2Q44 A;  4AB7 A;  5F46 A;  1YX0 A;  4U5Y A;  1S5K A;  4UWJ A;  2QIR A;  1SQH A;  2VEZ A;  4KVO E;  3JVN A;  3S6G A;  4B5P A;  1RXT A;  4J3G A;  3RYO A;  4E0A A;  2PDO A;  1S60 A;  2P0W A;  4XPK A;  1UFH A;  4CS0 B;  4FD7 A;  4U9Y A;  1I21 A;  2PC1 A;  3R1K A;  4UBR A;  3IWG A;  5H86 A;  5J8F A;  3T9Y A; 
#chains in the Genus database with same CATH topology
 2NMT A;  2ZEM A;  4NGN A;  3VAT A;  4C7I A;  6CPA A;  5D29 A;  2JDD A;  3S6K A;  4AG9 A;  4P6Y A;  2FVG A;  1OZP A;  4KVX A;  2AFS A;  5LRJ A;  4B11 A;  4KLV A;  2ZXV A;  1QSR A;  3D7F A;  4PXC A;  3TCV A;  5A27 A;  2REE A;  4B12 A;  2REF A;  4M6G A;  1IY7 A;  3SXO A;  1IYL A;  4PXE A;  4K30 A;  3H8F A;  2PJ9 A;  2HB6 A;  2ANP A;  2PJ7 A;  3SJF A;  1H8L A;  4MHY A;  3TOA A;  1YR0 A;  4B14 A;  2Z11 A;  4AVB A;  1LRZ A;  4KOS A;  2ZPA A;  4FBE A;  5HMN A;  4CAF A;  4C2X A;  1Z8W A;  1Y9W A;  1VHO A;  2YNC A;  3C26 A;  3KKW A;  4H2K A;  4CAW A;  4O23 A;  3WC7 A;  5HXD A;  5AG4 A;  5LYF A;  1QQ9 A;  4ONW A;  4MFZ A;  5D8N A;  4MRI A;  4Q36 A;  1YK3 A;  1ZLI A;  5F47 A;  1Q2C A;  4CGN A;  2JBJ A;  3K9T A;  1ARL A;  4R9M A;  4CAV A;  2Q7B A;  1QST A;  2WYR A;  1RO5 A;  5CNP A;  5EBV A;  1KUY A;  2XEI A;  4HPS A;  3I3G A;  2V8V A;  3IC1 A;  2HQY A;  4M6H A;  4UF4 A;  1CPX A;  3FRM A;  4HNX B;  4DJL A;  2RC4 A;  3H4Q A;  4QUS A;  3HLP A;  2R8V A;  4KUB A;  1YLE A;  3PB6 X;  4ZY0 A;  2P6G A;  5HH1 A;  3ZZI A;  3NH4 A;  2ZEP A;  1CX8 A;  2Z3M A;  4HNY B;  3BXM A;  2AFM A;  2BSW A;  4PV6 A;  1M4G A;  1YSJ A;  2WPW A;  4MFJ A;  5ELY A;  3R95 A;  2OOT A;  2AFW A;  5JH9 A;  1N71 A;  1ZO0 A;  2EWB A;  3FYN A;  3L2N A;  2JDC A;  4KOT A;  1KZF A;  3NA6 A;  1S7L A;  4NJQ A;  5K8O A;  2FS5 A;  5G21 A;  3IJ3 A;  3W6S A;  4M3S A;  2Z3L A;  2CY2 A;  2CNT A;  2BL1 A;  4PK3 A;  5E96 A;  1F2O A;  2DEA A;  1LAM A;  1AMP A;  3BHX A;  4TWE A;  4KVM E;  2YND A;  1Y0R A;  3ISX A;  3K2K A;  3FIX A;  3DSB A;  2WZN A;  1XFO A;  3F8K A;  2ZEF A;  1TKH A;  1IID A;  3LD2 A;  1HDU A;  2P6E A;  2F7V A;  2D4O A;  2JLM A;  1I1D A;  3D3S A;  4BD9 A;  1KWM A;  2PCU A;  1F2P A;  3IFE A;  1IIC A;  1PCA A;  2ZEL A;  1TF8 A;  2ZOG A;  2ARH A;  3D4U A;  4MBU A;  2RFH A;  4YU9 A;  4UFV A;  3P2F A;  2GLJ A;  1S7F A;  4BMH A;  2OR4 A;  4JLY A;  2B4B A;  3F0A A;  3B2Y A;  2QEC A;  1YW6 A;  2Z3O A;  2Q43 A;  1Z5R A;  1Z8X A;  4P4B A;  3W91 A;  4OME A;  4WJB A;  2Q51 A;  5GCN A;  3S9M A;  3EC4 A;  2EVN A;  3DGV A;  3GB0 A;  3KHZ A;  3QNV A;  3DDD A;  2PIZ A;  4NGQ A;  4OC4 A;  2PIY A;  2V77 A;  4H89 A;  4EME A;  3KGQ A;  1XJO A;  3MRU A;  4R6T A;  2IL4 A;  3CXQ A;  3SHP A;  3FNC A;  4AG7 A;  1Y7R A;  3G3S A;  5LYI A;  2PRB A;  2ZW5 A;  5LYL A;  3V38 A;  2G3T A;  3D8P A;  3GIU A;  3FED A;  4KSI A;  4MFP A;  3FMC A;  5G1Z A;  4PSW A;  2PJ3 A;  3ISZ A;  1Q2D A;  1ARM A;  3WC6 A;  3TC8 A;  4WWV A;  3B7I A;  2PJ4 A;  3GUX A;  4FAI A;  5HVH A;  4OC3 A;  4CGM A;  4G1P A;  2Z3K A;  5A28 A;  2OZH A;  3TFY A;  1YME A;  3B3W A;  2C27 A;  4A38 A;  4B10 A;  3G8W A;  4A39 A;  1NSA A;  4YFJ A;  1Q2Y A;  2ZEO A;  1B87 A;  1Y7E A;  3VH9 A;  3IWE A;  4AVA A;  5EC4 A;  1BO4 A;  3B3S A;  3NE8 A;  2VBQ A;  4KS9 A;  3EO4 A;  4QB9 A;  4RS2 A;  4A94 A;  4LQ6 A;  3RZA A;  2PR1 A;  4R87 A;  4P10 A;  2R7H A;  2H5M A;  4OC5 A;  3FVL A;  3H8G A;  1VIX A;  2EO8 A;  2AE6 A;  2B5G B;  4FUU A;  4X3R A;  1MK4 A;  1L0C A;  3D7D A;  5LYD A;  2PJB A;  4K3N A;  1M4I A;  3D7G A;  4BBH A;  2DXQ A;  5K8M A;  4F9V A;  1PUA A;  2PJ1 A;  1LAP A;  4MHN A;  4XPD C;  1PYT B;  2VQY A;  3T8W A;  3TO9 A;  2WUU A;  4NGT A;  4PQA A;  4EVY A;  4UEE A;  4LX9 A;  4CYQ A;  5F09 A;  2R1I A;  1I12 A;  3IIB A;  2BUE A;  3GYA A;  4CGL A;  3LAC A;  1FY7 A;  5C88 A;  2Y0M A;  4GM5 A;  2YNC C;  3TOB A;  1XMB A;  5DS0 A;  3SJG A;  1QMU A;  4EFD A;  1ZG8 A;  5C82 A;  2B58 A;  2O53 A;  4CGP A;  4MXU A;  4CRY B;  1ELL P;  2BO9 A;  4P4I A;  1V0C A;  4KOX A;  4TNU A;  1S7N A;  2JEW A;  2C6G A;  2OZG A;  4IUS A;  2PJ0 A;  1Z4R A;  3V8I A;  3MN8 A;  4DNC A;  4XPD B;  4MCQ A;  2ZED A;  3CDX A;  4ZBG A;  2OZU A;  3S6F A;  3A9L A;  4MFK A;  3SI2 A;  4A31 A;  4KSA A;  2C6C A;  4E8O A;  5F48 A;  4OLL A;  4PXB A;  2CNS A;  4JYW A;  5K8P A;  1QSM A;  3CZX A;  3IU1 A;  4PK2 A;  1Z8T A;  2FT0 A;  1XF8 A;  4KOU A;  4R3L A;  1DE4 C;  5JQ4 A;  1Y0Y A;  4KLW A;  4DYO A;  4NJR A;  3WR7 A;  2PVW A;  2Q4Z A;  4NXY A;  1TXR A;  4KSF A;  4NFR A;  4XPL A;  4CPA A;  1AYE A;  4MJ8 A;  1ZLH A;  1WK4 A;  4B13 A;  2AJ6 A;  2YGW A;  3H8E A;  4F0Y A;  1LFW A;  3BLN A;  4P4F A;  3QB8 A;  3WT4 A;  7CPA A;  2Q7S A;  4DUK A;  4LQG A;  1CJW A;  1VHE A;  4A30 A;  3PFE A;  2J9A A;  2OU2 A;  5I4M A;  1M4D A;  3D2M A;  4QBJ A;  1KUV A;  3LOD A;  3D67 A;  4UFW A;  4MMO A;  4PXD A;  2J8R A;  3TX8 A;  1R43 A;  2P6F A;  1LAN A;  3KAS A;  1P4N A;  5ISV A;  2FIW A;  4PPZ A;  5FVJ A;  2ATR A;  3N7Z A;  1XE4 A;  3WAB A;  1AUG A;  1BLL E;  4GXH A;  1GHE A;  2K5T A;  3SJX A;  2VZY A;  2PJ8 A;  4X5K A;  2Z10 A;  2PJ2 A;  3KL9 A;  3IGR A;  2HUZ A;  3CPA A;  3S9N A;  1U6M A;  3FX6 A;  2G9D A;  2ZW6 A;  4FD4 A;  4KZT A;  4GS4 A;  3D68 A;  3FXT A;  2I00 A;  3RO0 A;  3RBU A;  4KUA A;  4P4D A;  2GU2 A;  4NGS A;  2PJ5 A;  4UFX A;  2B4D B;  4OC0 A;  3EXN A;  4CAX A;  3S9L A;  1MJA A;  4II9 A;  4UEZ A;  2B4D A;  3PB4 X;  1YW4 A;  1YRE A;  2V8G A;  4H6U A;  2VXK A;  4UA3 A;  2QYV A;  5J8C A;  2RB7 A;  3CPX A;  2B5G A;  3HUV A;  4MFL A;  5DWM A;  3E0K A;  4UCP A;  3VWE A;  4AVC A;  1Z2L A;  2IQ6 A;  2Z3N A;  4MCP A;  4R76 A;  2XEF A;  4ORF A;  5DWN A;  1YVK A;  2B3V A;  1M4L A;  3IEH A;  1YGH A;  5IV0 A;  3TO6 A;  1FNO A;  2PE3 A;  4R7M A;  1EE3 P;  3KR4 A;  4MCS A;  4A95 A;  3RNZ A;  4UWI A;  4MHP A;  1XRY A;  2ZEN A;  4KOV A;  3VWD A;  1JQG A;  2ZEE A;  3PB8 X;  4YGO A;  3IU2 A;  2J8M A;  3V7Z A;  3S6H A;  3FJU A;  1S7K A;  2ZW4 A;  4ZY1 A;  4CYP A;  3N5F A;  2ABZ A;  4C2Z A;  4C7H A;  3P2H A;  4MFQ A;  2O28 A;  4UCN A;  4AXV A;  2HC9 A;  1YLO A;  2F8H A;  1DTD A;  2VI7 A;  3CXS A;  3CXP A;  1BPN A;  4NEX A;  3D7H A;  5IB9 A;  4JD6 A;  4Q7A A;  4Y49 C;  4R8F A;  1HDQ A;  1PU9 A;  2GRE A;  2QVP A;  3FEC A;  4FD5 A;  4MY0 A;  5AG7 A;  2CF4 A;  4MY3 A;  2EK8 A;  4OP4 A;  3B3T A;  3NFZ A;  2HV2 A;  4KOY A;  3PGP A;  4PSX A;  2PJ6 A;  4ONU A;  4OC2 A;  4MHD A;  3FF3 A;  2I79 A;  3TTH A;  1MJB A;  3TO7 A;  3PEI A;  1NMT A;  1XEB A;  2PSW A;  4CAE A;  4JXR A;  5THW A;  3R9E A;  2BOA A;  3H5Z A;  3PZJ A;  3R96 A;  3IO1 A;  5HVG A;  4P44 A;  1IOF A;  4OC1 A;  1UWY A;  3I9S A;  3B35 A;  5J1Q A;  2GFQ A;  3DNS A;  3JUW A;  2C6P A;  2FIA A;  3GLJ A;  4ZY2 A;  8CPA A;  4HKF A;  4QVT A;  3R9F A;  2A4N A;  3SI1 A;  3WC5 A;  4CGO A;  4I49 A;  4R57 A;  4XNH B;  2FL4 A;  3BI1 A;  5G20 A;  2EUI A;  3SI0 A;  4BIN A;  1ZG7 A;  3KZW A;  1VKC A;  4NGR A;  2I3C A;  1FT7 A;  5IB0 A;  2CXA A;  1R3N A;  1B6B A;  4CYN A;  4MI4 A;  2D4P A;  1CP7 A;  2OB0 A;  1QSN A;  2V8D A;  3FB3 A;  5KTD A;  2BEI A;  2PJC A;  4IK2 A;  4A2Z A;  2YNE A;  4P4E A;  3FBU A;  3D66 A;  3PFO A;  4XNH C;  5K8N A;  1CM0 A;  1P0H A;  1TIQ A;  5G22 A;  2EK9 A;  1XOV A;  3GY9 A;  1X10 A;  4LUA A;  1F57 A;  1CPS A;  1IB1 E;  1MJ9 A;  1HEE A;  1IU8 A;  1Z9U A;  3PBE A;  3ZJ0 A;  3W6X A;  4OIW A;  4OAE A;  1CBX A;  2FE7 A;  2ZOF A;  4R3K A;  2VL1 A;  3VAR A;  2AFX A;  2Q04 A;  2WSA A;  4JWP A;  4P4J A;  4MHZ A;  5AGE A;  3SJE A;  2CIJ A;  1Z4E A;  2JBK A;  2IJZ A;  4B5P B;  3PP9 A;  5JM6 A;  1YVO A;  4UCM A;  3LMS A;  4M85 A;  1Z8L A;  2J8N A;  3NE7 A;  3B8G A;  1A2Z A;  2R98 A;  2V8H A;  4IAV A;  2FSR A;  2NYQ A;  2PRQ A;  4F0X A;  5CBM A;  3PBB A;  2PR8 A;  1R57 A;  3TE4 A;  1BAV A;  3CT9 A;  4L89 A;  2Z3P A;  2DPT A;  2Q0Y A;  1NSL A;  1RTQ A;  3GKR A;  2G3A A;  3SXN A;  4NCZ A;  4CRZ B;  3NH8 A;  4ZGY B;  3T90 A;  2AFZ A;  1TKF A;  2KCW A;  1IOI A;  3IWW A;  4P45 A;  4QC6 A;  2GIV A;  3D2P A;  4KOW A;  2GLF A;  4FD6 A;  3MGD A;  2VZZ A;  3DR8 A;  1K4J A;  2O4H A;  4L8A A;  4NSQ A;  4YWY A;  2FXF A;  2G0B A;  5AG6 A;  1JWQ A;  4IF5 A;  3KI9 A;  2Q4Y A;  4B6Z A;  4RUH A;  4E2A A;  3TT2 A;  4NGP A;  3RAM A;  5BWA B;  5LRG A;  4NGM A;  5F49 A;  3R9G A;  4JZ0 A;  4UIB A;  1J4J A;  2ZEG A;  3LWU A;  1LOK A;  1XBU A;  3B3C A;  3B3V A;  3BJ8 A;  1GYT A;  2OH1 A;  2FCK A;  2ODF A;  3OWC A;  2GAN A;  3F5B A;  3PRT A;  2B3U A;  3PB7 X;  4UIA A;  4MCR A;  5CPA A;  2Z0Z A;  3KQZ A;  2PQ8 A;  1OBR A;  3PB9 X;  4A32 A;  5I0C A;  4IHM A;  3EY5 A;  2ZEH A;  3NH5 A;  1IYK A;  1ON0 A;  1NE9 A;  4F6A A;  1M44 A;  3K9U A;  4ZYQ A;  2PJA A;  4X2T A;  3FH4 A;  2PVV A;  3UY5 A;  1BOB A;  3FEE A;  3KR5 A;  2QML A;  3KQX A;  5H84 A;  1LCP A;  4W9Y A;  4Q38 A;  1Y9K A;  4F8Z A;  2F5I A;  3BJ7 A;  1KUX A;  1TF9 A;  2X7B A;  4KOR A;  3BI0 A;  1VHS A;  1IGB A;  2C1C A;  4RN7 A;  4F9U A;  4A37 A;  2JEV A;  4ZI6 A;  4OID A;  4C2Y A;  5KTC A;  4EWT A;  2CTB A;  2WPX A;  4H6Z A;  2EBJ A;  4A33 A;  1X12 A;  1XIX A;  1QSO A;  4Y49 B;  5JPH A;  4B5O A;  4OKO A;  4JXQ A;  4RI1 A;  2AFU A;  4FWU A;  2XEG A;  1M1D A;  1Q7L A;  2POK A;  3KHX A;  3EFA A;  1TKJ A;  3I1U A;  4HNW B;  1WWZ A;  1CP6 A;  3DR6 A;  4OAD A;  2GE3 A;  1XMT A;  2ZW7 A;  2CNM A;  3DLJ A;  1S3Z A;  2Q4V A;  3JTK A;  3JRU A;  3QAH A;  4U9Z A;  5KTA A;  4YRH A;  4M6I A;  5IX3 A;  4NF1 A;  4JJX A;  2Q44 A;  4AB7 A;  5F46 A;  2CTC A;  1YX0 A;  4U5Y A;  4Z65 A;  4ZX8 A;  4CYO A;  4C68 A;  1S5K A;  3QAY A;  4ZX9 A;  2NSM A;  2QIR A;  4UWJ A;  1SQH A;  2DPS A;  2VEZ A;  2IMO A;  3JVN A;  4KVO E;  3S6G A;  4B5P A;  1RXT A;  1CG2 A;  4J3G A;  3RYO A;  1VGY A;  2BCO A;  1ZG9 A;  1YQE A;  5LRK A;  2XEJ A;  5EMI A;  4E0A A;  2PDO A;  2QJ8 A;  4UEF A;  1S60 A;  2P0W A;  5AG5 A;  1ELM P;  4XPK A;  2DF5 A;  1UFH A;  4CS0 B;  4FD7 A;  4U9Y A;  1I21 A;  2PC1 A;  1BPM A;  3R1K A;  5HVF A;  5JGF A;  4UBR A;  2AFO A;  3IWG A;  5H86 A;  5J8F A;  3T9Y A;  4X8I A; 
#chains in the Genus database with same CATH homology
 2NMT A;  4C7I A;  2JDD A;  3S6K A;  4AG9 A;  1OZP A;  4KVX A;  4B11 A;  4KLV A;  2ZXV A;  1QSR A;  3TCV A;  5A27 A;  2REE A;  4B12 A;  2REF A;  3SXO A;  1IYL A;  4K30 A;  3TOA A;  1YR0 A;  4B14 A;  2Z11 A;  4AVB A;  1LRZ A;  4KOS A;  2ZPA A;  4CAF A;  4C2X A;  1Y9W A;  2YNC A;  3C26 A;  3KKW A;  4CAW A;  5AG4 A;  4MFZ A;  4Q36 A;  1YK3 A;  5F47 A;  1Q2C A;  4CGN A;  4R9M A;  4CAV A;  2Q7B A;  1QST A;  1RO5 A;  5CNP A;  5EBV A;  1KUY A;  3I3G A;  2HQY A;  3FRM A;  4HNX B;  2RC4 A;  3H4Q A;  4QUS A;  2R8V A;  4KUB A;  1YLE A;  2P6G A;  5HH1 A;  3ZZI A;  2Z3M A;  4HNY B;  2BSW A;  4PV6 A;  1M4G A;  2WPW A;  4MFJ A;  3R95 A;  1N71 A;  1ZO0 A;  3FYN A;  2JDC A;  4KOT A;  1KZF A;  1S7L A;  2FS5 A;  5G21 A;  3W6S A;  4M3S A;  2Z3L A;  2CY2 A;  2CNT A;  2BL1 A;  4PK3 A;  5E96 A;  4KVM E;  2YND A;  3FIX A;  3DSB A;  3F8K A;  1IID A;  3LD2 A;  2P6E A;  2D4O A;  2JLM A;  1I1D A;  3D3S A;  1IIC A;  2ARH A;  4MBU A;  4UFV A;  3P2F A;  4BMH A;  1S7F A;  4JLY A;  2B4B A;  3F0A A;  2QEC A;  2Z3O A;  3W91 A;  5GCN A;  3EC4 A;  2EVN A;  3DDD A;  4H89 A;  2IL4 A;  3CXQ A;  3SHP A;  3FNC A;  4AG7 A;  1Y7R A;  3G3S A;  2PRB A;  2ZW5 A;  2G3T A;  3D8P A;  4MFP A;  5G1Z A;  4PSW A;  1Q2D A;  4CGM A;  2Z3K A;  5A28 A;  2OZH A;  3TFY A;  2C27 A;  4B10 A;  3G8W A;  4YFJ A;  1Q2Y A;  1B87 A;  3IWE A;  4AVA A;  5EC4 A;  1BO4 A;  2VBQ A;  4KS9 A;  3EO4 A;  4QB9 A;  4RS2 A;  2PR1 A;  4R87 A;  2R7H A;  2H5M A;  2AE6 A;  2B5G B;  1MK4 A;  1L0C A;  1M4I A;  4BBH A;  2DXQ A;  1PUA A;  4XPD C;  2VQY A;  3TO9 A;  2WUU A;  4EVY A;  4LX9 A;  4CYQ A;  2R1I A;  1I12 A;  2BUE A;  3GYA A;  4CGL A;  1FY7 A;  5C88 A;  2Y0M A;  2YNC C;  3TOB A;  5C82 A;  2B58 A;  4CGP A;  4CRY B;  1V0C A;  4KOX A;  1S7N A;  2OZG A;  4IUS A;  4DNC A;  1Z4R A;  3V8I A;  4XPD B;  4ZBG A;  2OZU A;  3S6F A;  3A9L A;  4MFK A;  4A31 A;  4E8O A;  4KSA A;  5F48 A;  4OLL A;  2CNS A;  1QSM A;  3IU1 A;  4PK2 A;  2FT0 A;  1XF8 A;  4KOU A;  4R3L A;  5JQ4 A;  4KLW A;  3WR7 A;  4NXY A;  4XPL A;  4KSF A;  4MJ8 A;  1WK4 A;  4B13 A;  2AJ6 A;  2YGW A;  4F0Y A;  3BLN A;  3QB8 A;  1CJW A;  4A30 A;  2OU2 A;  1M4D A;  3D2M A;  4QBJ A;  1KUV A;  3LOD A;  4UFW A;  2J8R A;  2P6F A;  1P4N A;  5ISV A;  2FIW A;  5FVJ A;  2ATR A;  3N7Z A;  1XE4 A;  1GHE A;  2K5T A;  2VZY A;  4X5K A;  2Z10 A;  3IGR A;  2HUZ A;  1U6M A;  2ZW6 A;  4FD4 A;  4KZT A;  4GS4 A;  3FXT A;  2I00 A;  4KUA A;  4UFX A;  2B4D B;  3EXN A;  4CAX A;  1MJA A;  4II9 A;  2B4D A;  1YRE A;  4H6U A;  2VXK A;  4UA3 A;  5J8C A;  2B5G A;  4MFL A;  5DWM A;  3E0K A;  4UCP A;  3VWE A;  4AVC A;  2Z3N A;  5DWN A;  4ORF A;  1YVK A;  2B3V A;  1YGH A;  5IV0 A;  3TO6 A;  4A95 A;  4UWI A;  3VWD A;  4KOV A;  4YGO A;  3IU2 A;  2J8M A;  3S6H A;  1S7K A;  2ZW4 A;  4CYP A;  4C2Z A;  4C7H A;  3P2H A;  4MFQ A;  2O28 A;  4UCN A;  2VI7 A;  3CXS A;  3CXP A;  4NEX A;  4JD6 A;  4Y49 C;  1PU9 A;  4FD5 A;  4MY0 A;  5AG7 A;  4MY3 A;  2HV2 A;  4KOY A;  3PGP A;  4PSX A;  4ONU A;  4MHD A;  2I79 A;  3TTH A;  1MJB A;  3TO7 A;  1NMT A;  1XEB A;  2PSW A;  4CAE A;  4JXR A;  3R9E A;  3R96 A;  3H5Z A;  3PZJ A;  3I9S A;  3DNS A;  3JUW A;  2FIA A;  4HKF A;  4QVT A;  3R9F A;  2A4N A;  4CGO A;  4I49 A;  4R57 A;  4XNH B;  2FL4 A;  5G20 A;  2EUI A;  1VKC A;  5IB0 A;  2CXA A;  4CYN A;  1B6B A;  4MI4 A;  2D4P A;  2OB0 A;  1QSN A;  3FB3 A;  5KTD A;  2BEI A;  4A2Z A;  2YNE A;  3FBU A;  4XNH C;  1CM0 A;  1P0H A;  1TIQ A;  5G22 A;  3GY9 A;  4LUA A;  1IB1 E;  1MJ9 A;  3ZJ0 A;  1Z9U A;  3W6X A;  4OAE A;  4R3K A;  2FE7 A;  5HMN A;  2Q04 A;  2WSA A;  4JWP A;  5AGE A;  1Z4E A;  4B5P B;  3PP9 A;  1YVO A;  4UCM A;  4M85 A;  2J8N A;  3NE7 A;  3B8G A;  2R98 A;  2FSR A;  4F0X A;  2PR8 A;  1R57 A;  3TE4 A;  4L89 A;  2Z3P A;  2DPT A;  2Q0Y A;  1NSL A;  3GKR A;  2G3A A;  3SXN A;  4NCZ A;  4CRZ B;  4ZGY B;  3T90 A;  2KCW A;  4QC6 A;  2GIV A;  3D2P A;  4KOW A;  4FD6 A;  4L8A A;  3MGD A;  2VZZ A;  3DR8 A;  1K4J A;  4NSQ A;  2FXF A;  2G0B A;  5AG6 A;  4IF5 A;  2Q4Y A;  4E2A A;  3TT2 A;  5BWA B;  5F49 A;  3R9G A;  1J4J A;  3BJ8 A;  2OH1 A;  2FCK A;  3OWC A;  2GAN A;  3F5B A;  2B3U A;  2Z0Z A;  2PQ8 A;  4A32 A;  5I0C A;  3EY5 A;  1IYK A;  1ON0 A;  1NE9 A;  4F6A A;  1M44 A;  3K9U A;  3UY5 A;  1BOB A;  2QML A;  5H84 A;  4Q38 A;  1Y9K A;  4KOR A;  2F5I A;  1KUX A;  2X7B A;  3BJ7 A;  1VHS A;  2JEV A;  4C2Y A;  5KTC A;  4H6Z A;  2WPX A;  4A33 A;  1XIX A;  1QSO A;  4Y49 B;  5JPH A;  4B5O A;  4JXQ A;  4RI1 A;  1M1D A;  3EFA A;  4HNW B;  1WWZ A;  3DR6 A;  4OAD A;  2GE3 A;  2ZW7 A;  1XMT A;  2CNM A;  1S3Z A;  2Q4V A;  3JTK A;  3QAH A;  4U9Z A;  5KTA A;  4YRH A;  5IX3 A;  4NF1 A;  4JJX A;  2Q44 A;  4AB7 A;  5F46 A;  1YX0 A;  4U5Y A;  4CYO A;  4C68 A;  1S5K A;  4UWJ A;  2QIR A;  1SQH A;  2DPS A;  4KVO E;  2VEZ A;  3JVN A;  3S6G A;  4B5P A;  1RXT A;  4J3G A;  3RYO A;  4E0A A;  2PDO A;  1S60 A;  2P0W A;  5AG5 A;  4XPK A;  1UFH A;  4CS0 B;  4FD7 A;  4U9Y A;  1I21 A;  2PC1 A;  3R1K A;  4UBR A;  3IWG A;  5H86 A;  5J8F A;  3T9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...