3W96D

Crystal structure of human nucleosome core particle lacking h2a n-terminal region
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 34
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w96D00
4NE5A 3X1SA 5BO0A 3AZKA 1P3GA 5CPJD 2HIOD 3KWQD 5JA4A 3AZMC 4J8UC 3AZHD 4CAYB 5GT0B 3X1UB 1AOIC 4H9NB 5B0YB 1M19A 3UTAA 2PYOC 2BYMB 3AZIA 4ZUXB 1S32B 1KX3D 1M1AA 4DRBA 2IO5B 1A7WA 3AN2A 3O62C 3WKJD 3AZJB 3W98B 2NZDC 1P3KB 4XUJD 3REHD 5B0ZA 3UTBD 1HQ3A 4YM6B 5G49B 4J8WA 2RVQC 2FJ7A 3MGRA 5CPJB 3MGPC 3AFAC 1ZLAA 2HIOB 3X1VB 1WWIA 1B6WA 3X1TB 4H9SA 4LD9D 4QLCC 4YS3A 5F99B 4XZQD 2AROB 3VH5W 2YFVA 3LELD 4J8XB 4R8PC 5B1LA 5AVBC 3AZEC 1M18B 3AZGD 2CV5A 1EQZB 3MGQC 3KUYC 1TAFA 5AVCB 5AV8B 4H9QB 3A6NB 3AV1A 3AZFB 3KWQC 5GT0A 5GSUB 3X1UA 2BYMA 3UT9D 3AZNC 3AZHC 3C1CD 2F8ND 4XUJB 1B67A 1N1JB 5B40D 1P3PB 4M6BA 1P3AA 1P34B 5B2IC 3AV2C 4Z2MG 2YFWB 5DNND 5FUGA 5B31A 4X23A 4Z5TB 1P3GD 5CPIA 4ZBJB 5B24B 4JJND 4WU8C 1KX3C 1P3BA 4XZQB 5AV5D 3WKJC 3C1BA 1TZYC 1JFIB 4H9OA 5DNMD 3REHC 3R45B 3X1VA 3AZID 2NQBD 3WTPA 1ID3B 2AROA 4J8VB 1M1AD 3RELB 4LD9C 3W96C 1M18A 3MGSD 3TU4A 3LELC 5B2JA 5AV8A 4H9QA 5B0ZD 3AZLB 3AZFA 5B1MB 3X1SB 3AZGC 3AZKB 2FJ7D 1P3GB 5GSUA 5CPKA 1ZLAD 1Q9CA 5AV6D 5JA4B 4HGAC 5GT3A 3REJC 1BH8A 4YS3D 4KUDB 1P3PA 5CHLB 3UT9C 1P3ID 1WWSA 3C1CC 1M19B 3UTAB 5B1LD 3REKB 4Z5TA 5B40C 4WZSB 3B6GB 5E5AB 5DNNC 3B0DB 5KDMA 4G92B 1P3LA 4Z66A 3AZLA 3AN2B 5GT0D 5BS7C 3X1UD 5BT1D 4JJNC 5B0YD 5AV5C 4ZUXD 5B32A 5DNMC 1HQ3B 3W97A 4EO5C 4J8WB 3MGRB 1ZLAB 3AZIC 3AZJD 1KX4B 3VH6T 2NQBC 5JRGA 3W98D 1P3KD 1M1AC 3VH6A 1F66B 2YFVB 1P3FB 5B1MA 4YM6D 5B1LB 3MNNA 3MGSC 4WU9C 2CV5B 3X1VD 5B0ZC 1TAFB 3X1TD 3LZ0C 3AV1B 4KUDA 2FJ7C 5F99D 4G91B 2AROD 4NE6A 5AV6C 1P3OB 4YS3C 4J8XD 2F8NG 3REKA 4DRAA 5AY8A 5GXQC 1M18D 3B6FB 1EQZD 1P3IC 5C3IB 3B6GA 5AVCD 5E5AA 1P3AB 5AV8D 3A6ND 3KXBA 4X23B 5B31B 5FUGB 3AZFD 5GSUD 4KGCA 5CPIB 3B0CT 2LY8A 1P3BB 4E44A 5GT0C 3X1UC 1KX5C 5BT1C 4NFTA 3C1BB 5B0YC 1P3MA 1P3PD 3WA9B 1P34D 4H9OB 5AV9B 4Z5TD 5B33A 4ZUXC 1KX4A 1S32C 5B24D 1KU5A 2IO5C 3WTPB 1F66A 3AZJC 3MVDA 1P3FA 3W98C 1P3KC 3TU4B 3W99B 5CP6B 5B2JB 4YM6C 5CPJC 1ID3D 4J8VD 2HIOC 3X1VC 3AYWB 3RELD 5CPKB 3AZMA 3X1TC 1P3OA 4J8UA 3REIB 5F99C 5GT3B 2AROC 1BH8B 4AWLB 3B6FA 2PYOA 3AZNB 4J8XC 4H9PB 3AZLD 1M18C 5B1MD 3X1SD 1EQZC 3AZKD 5AVCC 3A6NC 3AZFC 3O62A 5KDMB 4KUDD 1P3LB 5GSUC 2NZDA 4Z66B 3V9RB 3WA9A 3LZ1B 5AV9A 1M19D 3UTAD 4XUJC 3REKD 1P3PC 3UTBC 1P34C 4E45A 5B32B 3B6GD 5E5AD 3AFAA 3W97B 5B31G 4Z5TC 4ZBJC 3AN2D 5B24C 3LJAB 1BH9A 5JRGB 4XZQC 3W99A 5CP6A 3W96B 3WAAB 4R8PA 1HQ3D 3MGQA 3KUYA 3MNNB 4J8WD 3AYWA 3MGRD 1KX4D 3REIA 3KWQA 1ID3C 4J8VC 3RELC 1F66D 3AZNA 3VH6W 1P3FD 3AZHA 4H9PA 2L5AA 3REJB 5AY8B 5B2IA 3AV2A 2CV5D 3AZLC 3WTPE 5B1MC 3AV1D 3X1SC 3KXBB 3AZKC 1BFMA 1P3GC 4WU8A 1KX3A 3V9RA 3LZ1A 4KGCB 3WKJA 1P3OD 4J8UD 4KUDC 1TZYA 3B6FD 1P3MB 1P3AD 3UTAC 2BYKA 3REHA 1M19C 3REKC 2HUEB 4X23D 5B31D 4H9RA 4KHAB 5B33B 3LJAA 5CPID 3B6GC 5E5AC 3NQJA 3B0DC 4G92C 1R4VA 1P3BD 4LD9A 3AN2C 3W96A 3KSYA 3WAAA 3MVDB 3C1BD 3WA9D 5AV9D 3LELA 1U35B 5B32G 1HQ3C 3AZGA 4J8WC 3WTPD 5BNVA 3MGRC 1ZLAC 4WNNA 1KX4C 3AZMB 3REJA 4H9SC 4J8UB 1AOIB 3TU4D 1P3FC 2PYOB 3W99D 5CP6D 4R8PD 5B2JD 5B1LC 5GXQB 3KUYD 2CV5C 4CSRA 3AYWD 5DNNA 5CPKD 2JSSA 3AV1C 3REID 5GT3D 4G91C 3O62B 5BS7A 4JJNA 2NZDB 5AV5A 4UUZB 3AZND 1P3OC 1KX5B 3B6FC 5DNMA 4KHAA 5C3IC 5B2ID 1P3AC 3AV2D 4X23C 5B31C 3AFAB 3MGPB 2F8NH 1P3LD 2NQBA 5CPIC 4Z66D 4WU8D 4QLCB 3LZ1D 1BH9B 1P3BC 2CWEA 1U35A 3C1BC 1TZYD 3WA9C 4R8PB 3MGSA 5AVBB 5AV9C 5B32D 3AZEB 4WU9A 3W97D 3MGQB 3KUYB 3LZ0A 3LJAD 2F8NK 5JRGD 3WTPC 3KWQB 1AOIA 3NQUB 5AV6A 3W96D 3WAAD 3AZHB 5GXQA 1P3IA 3MNND 3TU4C 3W99C 5CP6C 5B2IB 3AV2B 5B2JC 5AV8C 3AYWC 5CPKC 4NE3A 4UUZA 4WU8B 1KX3B 3REIC 3REJD 4CAYA 5GT3C 3WKJB 1KX5A 4AWLC 4H9NA 5B0YA 5AY8D 1TZYB 3MGPA 2BYKB 3REHB 3B0BA 4ZUXA 3KXBD 3UTBB 1S32A 4H9RB 4QLCA 4KGCD 3NQJB 3AZJA 4Z2MH 3VH5T 1P3LC 3W98A 4Z66C 4LD9B 1P3KA 3LZ1C 5AVBA 3AZEA 1P3MD 3VH5A 5BNXB 1H3OB 3LELB 4YM6A 5G49A 5B33D 5B32C 5CPJA 3AZGB 3W97C 2HIOA 3NQUA 3X1TA 5BNVB 4WNNB 3MVDD 4HGAB 5F99A 3LJAC 5JRGC 3UT9B 3WAAC 4J8XA 1U35D 1ULYA 3C1CB 2F8NB 1EQZA 4WU9D 3MNNC 5B40B 5AVCA 3A6NA 4CSRB 5DNNB 3LZ0D 3AZMD 5BO0B 1AOID 4JJNB 5AV5B 2PYOD 4XUJA 1N1JA 5GXQD 5AY8C 3UTBA 1P34A 5DNMB 2YFWA 4EO5B 4WV4B 3KXBC 3O62D 3AZIB 5B24A 2NQBB 2NZDD 4KGCC 4XZQA 3B0CW 5BNXA 1H3OA 1M1AB 1F1EA 1KX5D 1JFIA 1P3MC 3MGSB 2RVQD 3R45A 4WU9B 1HTAA 2HUEC 3AFAD 3MGPD 5B0ZB 5B33C 3LZ0B 1S32D 4J8VA 1ID3A 4QLCD 3RELA 2FJ7B 1F66C 5AV6B 3UT9A 3MVDC 3C1CA 2F8NA 4YS3B 5AVBD 3AZED 5B40A 1P3IB 3MGQD 1U35C
chains in the Genus database with same CATH superfamily
4NE5A 3X1SA 5BO0A 3EPJA 3AZKA 1P3GA 5CPJD 2HIOD 3KWQD 5JA4A 3AZMC 4J8UC 3AZHD 3IP4C 4CAYB 5GT0B 3X1UB 1AOIC 4H9NB 5B0YB 1M19A 3UTAA 2PYOC 2BYMB 3AZIA 4ZUXB 2Y2LA 2Y2MA 1S32B 1KX3D 1M1AA 4DRBA 2IO5B 1A7WA 3AN2A 3O62C 3WKJD 3AZJB 3W98B 2NZDC 1P3KB 4XUJD 2JCHA 3REHD 5B0ZA 3UTBD 1HQ3A 4YM6B 5G49B 4J8WA 2RVQC 2FJ7A 3MGRA 5CPJB 3MGPC 3AFAC 1ZLAA 2HIOB 3X1VB 1WWIA 2ZY5A 1B6WA 3X1TB 4H9SA 4LD9D 4QLCC 4YS3A 5F99B 4XZQD 2AROB 3VH5W 2YFVA 2VQRA 3LELD 4J8XB 4R8PC 5B1LA 5AVBC 3AZEC 1M18B 3AZGD 2CV5A 1EQZB 3MGQC 3KUYC 1TAFA 2Y2QA 5AVCB 2Y2KA 4H9QB 5AV8B 4UPKA 3A6NB 3AV1A 3AZFB 3KWQC 2F2AC 2UWXA 5GT0A 5GSUB 3X1UA 2BYMA 3UT9D 3AZNC 3AZHC 2G5HC 3C1CD 2F8ND 4XUJB 1B67A 1N1JB 5B40D 1Z2CB 1P3PB 4M6BA 1P3AA 1P34B 5B2IC 3AV2C 4Z2MG 2YFWB 5DNND 5FUGA 5B31A 4X23A 4Z5TB 1P3GD 5CPIA 4ZBJB 5B24B 4JJND 4WU8C 1KX3C 1P3BA 4XZQB 5AV5D 3WKJC 3C1BA 1TZYC 1JFIB 4H9OA 5DNMD 3REHC 3R45B 3X1VA 3AZID 2Y2OA 2NQBD 3WTPA 1ID3B 2AROA 4J8VB 1M1AD 3RELB 4LD9C 3W96C 1M18A 3MGSD 3TU4A 3LELC 5B2JA 5AV8A 4H9QA 5B0ZD 3AZLB 3AZFA 5B1MB 3X1SB 3AZGC 3AZKB 2FJ7D 1P3GB 5GSUA 5CPKA 1ZLAD 1Q9CA 5AV6D 5JA4B 4HGAC 5GT3A 3REJC 1BH8A 4YS3D 4KUDB 1P3PA 5CHLB 3UT9C 1P3ID 1WWSA 3C1CC 1M19B 3UTAB 5B1LD 3REKB 4Z5TA 2Y2IA 5B40C 4WZSB 3B6GB 5E5AB 5DNNC 3B0DB 5KDMA 4G92B 1P3LA 4Z66A 3AZLA 3AN2B 5GT0D 5BS7C 3X1UD 5BT1D 4JJNC 5B0YD 3H0LC 5AV5C 2DQNC 4ZUXD 5B32A 5DNMC 1HQ3B 3W97A 4EO5C 4J8WB 3MGRB 1ZLAB 3AZIC 3AZJD 1KX4B 3VH6T 2NQBC 5JRGA 3W98D 1P3KD 1M1AC 3VH6A 1F66B 2YFVB 1P3FB 5B1MA 4YM6D 5B1LB 3MNNA 3MGSC 4WU9C 2CV5B 3X1VD 5B0ZC 1TAFB 3X1TD 3LZ0C 3AV1B 3FDDA 3A1IA 2FJ7C 5F99D 4KUDA 4WJ3C 4G91B 2AROD 4NE6A 5AV6C 1P3OB 4YS3C 4J8XD 2F8NG 3REKA 4DRAA 5AY8A 2Y2JA 5GXQC 1M18D 3B6FB 1EQZD 1P3IC 5C3IB 3B6GA 2BG1A 5E5AA 5AVCD 1P3AB 5AV8D 3A6ND 3KXBA 4X23B 5B31B 5FUGB 3AZFD 5GSUD 4KGCA 5CPIB 3B0CT 2LY8A 1P3BB 4E44A 5GT0C 3X1UC 1KX5C 5BT1C 4NFTA 3C1BB 3H0RC 5B0YC 1P3MA 1P3PD 3WA9B 1P34D 4H9OB 5AV9B 4Z5TD 5B33A 4ZUXC 1KX4A 1S32C 2RIQA 5B24D 1KU5A 2IO5C 3WTPB 1F66A 3AZJC 3MVDA 1P3FA 3W98C 3EPLA 1P3KC 3TU4B 3W99B 5CP6B 5B2JB 4YM6C 5CPJC 1ID3D 4J8VD 2HIOC 3X1VC 3AYWB 3RELD 5CPKB 3AZMA 3X1TC 1P3OA 4J8UA 3REIB 5F99C 5GT3B 2AROC 1BH8B 4AWLB 3B6FA 2PYOA 2ZY3A 3AZNB 4J8XC 4H9PB 3AZLD 1M18C 5B1MD 3X1SD 1EQZC 3AZKD 5AVCC 3A6NC 3AZFC 3O62A 5KDMB 4KUDD 1P3LB 5GSUC 2NZDA 4Z66B 2ZM5A 3V9RB 3WA9A 3LZ1B 5AV9A 1M19D 3UTAD 4XUJC 3REKD 1P3PC 3UTBC 1P34C 4E45A 5B32B 3B6GD 5E5AD 3AFAA 3W97B 5B31G 4Z5TC 4ZBJC 3AN2D 5B24C 3LJAB 1BH9A 5JRGB 4XZQC 2Y2PA 3W99A 5CP6A 3W96B 3WAAB 4R8PA 1HQ3D 3MGQA 3KUYA 3MNNB 4J8WD 3AYWA 3MGRD 1KX4D 3REIA 3KWQA 1ID3C 4J8VC 3EPKA 3RELC 1W2EA 1F66D 3AZNA 3VH6W 1P3FD 3AZHA 4H9PA 2L5AA 3REJB 2Y2HA 5AY8B 5B2IA 3AV2A 2CV5D 3KFUG 3AZLC 3WTPE 5B1MC 3AV1D 3X1SC 3KXBB 3AZKC 1BFMA 1P3GC 4WU8A 3A1KA 1KX3A 3V9RA 3LZ1A 4KGCB 3EG5B 3WKJA 1P3OD 4J8UD 4KUDC 2ZY2A 1TZYA 3B6FD 2XD5A 1P3MB 1P3AD 3UTAC 2BYKA 3REHA 1M19C 3REKC 2HUEB 4X23D 5B31D 4H9RA 4KHAB 5B33B 3LJAA 5CPID 3B6GC 5E5AC 3NQJA 3B0DC 4G92C 1R4VA 1P3BD 4LD9A 2ZY4A 3AN2C 3W96A 3KSYA 3WAAA 3MVDB 3C1BD 3WA9D 5AV9D 3LELA 1U35B 5B32G 1HQ3C 3AZGA 4J8WC 3WTPD 5BNVA 3MGRC 1ZLAC 4WNNA 1KX4C 3AZMB 3REJA 4H9SC 2W8SA 4J8UB 1AOIB 3TU4D 1P3FC 2PYOB 2XD1A 3W99D 5CP6D 4R8PD 3AL0C 5B2JD 5B1LC 5GXQB 2Y2GA 3KUYD 2CV5C 4CSRA 3AYWD 5DNNA 5CPKD 2JSSA 3AV1C 3REID 5GT3D 4G91C 3O62B 5BS7A 4JJNA 2G5IC 2NZDB 5AV5A 4UUZB 3AZND 1P3OC 1T3UA 1KX5B 3B6FC 5DNMA 1PZRA 4KHAA 5C3IC 5B2ID 1P3AC 3AV2D 4X23C 5B31C 3AFAB 3MGPB 2F8NH 1P3LD 2NQBA 5CPIC 4Z66D 4WU8D 4QLCB 3LZ1D 1BH9B 1P3BC 2CWEA 1U35A 3C1BC 1TZYD 3WA9C 4R8PB 3MGSA 5AVBB 5AV9C 5B32D 3AZEB 2FFFB 4WU9A 3W97D 3MGQB 3KUYB 3LZ0A 3LJAD 2F8NK 5JRGD 3WTPC 3KWQB 1AOIA 3NQUB 5AV6A 3W96D 3WAAD 3AZHB 5GXQA 1P3IA 3MNND 3TU4C 3W99C 2Y2NA 5CP6C 5B2IB 3AV2B 5B2JC 5AV8C 3EPHA 3AYWC 3H0MC 5CPKC 4NE3A 4UUZA 4WU8B 1KX3B 3REIC 3REJD 4CAYA 5GT3C 3WKJB 1KX5A 4AWLC 4H9NA 5B0YA 5AY8D 1TZYB 3MGPA 2BYKB 3REHB 3B0BA 4ZUXA 3KXBD 3UTBB 1S32A 4H9RB 4QLCA 4KGCD 3NQJB 2J8PA 3AZJA 4Z2MH 3VH5T 1P3LC 3W98A 4Z66C 4LD9B 1P3KA 3LZ1C 5AVBA 3AZEA 1P3MD 3VH5A 5BNXB 1H3OB 3LELB 4YM6A 5G49A 5B33D 5B32C 5CPJA 3AZGB 3W97C 2HIOA 3NQUA 3X1TA 5BNVB 4DQYB 4WNNB 3MVDD 2JE5A 4HGAB 5F99A 3LJAC 5JRGC 3UT9B 3WAAC 4J8XA 1U35D 1ULYA 3C1CB 2F8NB 1EQZA 4WU9D 3MNNC 5B40B 5AVCA 3A6NA 4CSRB 5DNNB 3LZ0D 3AZMD 5BO0B 1AOID 4JJNB 5AV5B 2PYOD 4XUJA 1N1JA 5GXQD 5AY8C 3UTBA 1P34A 3F6TA 3P5JB 5DNMB 2YFWA 4EO5B 4WV4B 3KXBC 3O62D 3AZIB 5B24A 2NQBB 2NZDD 4KGCC 4XZQA 3B0CW 5BNXA 1H3OA 1M1AB 1F1EA 1KX5D 1JFIA 1P3MC 3MGSB 2RVQD 3R45A 4WU9B 1HTAA 2HUEC 3AFAD 3MGPD 5B0ZB 5B33C 3LZ0B 1S32D 4J8VA 1ID3A 4QLCD 3RELA 2DF4C 2FJ7B 1F66C 5AV6B 3UT9A 3MVDC 3C1CA 2F8NA 4YS3B 5AVBD 3AZED 5B40A 1P3IB 3MGQD 1U35C
chains in the Genus database with same CATH topology
4NE5A 3X1SA 5BO0A 3EPJA 3AZKA 1P3GA 5CPJD 2HIOD 3KWQD 5JA4A 3AZMC 4J8UC 3AZHD 3IP4C 4CAYB 5GT0B 3X1UB 1AOIC 4H9NB 5B0YB 1M19A 3UTAA 2PYOC 2BYMB 3AZIA 4ZUXB 2Y2LA 2Y2MA 1S32B 1KX3D 1M1AA 4DRBA 2IO5B 1A7WA 3AN2A 3O62C 3WKJD 3AZJB 3W98B 2NZDC 1P3KB 4XUJD 2JCHA 3REHD 5B0ZA 3UTBD 1HQ3A 4YM6B 5G49B 4J8WA 2RVQC 2FJ7A 3MGRA 5CPJB 3MGPC 3AFAC 1ZLAA 2HIOB 3X1VB 1WWIA 2ZY5A 1B6WA 3X1TB 4H9SA 4LD9D 4QLCC 4YS3A 5F99B 4XZQD 2AROB 3VH5W 2YFVA 2VQRA 3LELD 4J8XB 4R8PC 5B1LA 5AVBC 3AZEC 1M18B 3AZGD 2CV5A 1EQZB 3MGQC 3KUYC 1TAFA 2Y2QA 5AVCB 2Y2KA 4H9QB 5AV8B 4UPKA 3A6NB 3AV1A 3AZFB 3KWQC 2F2AC 2UWXA 5GT0A 5GSUB 3X1UA 2BYMA 3UT9D 3AZNC 3AZHC 2G5HC 3C1CD 2F8ND 4XUJB 1B67A 1N1JB 5B40D 1Z2CB 1P3PB 4M6BA 1P3AA 1P34B 5B2IC 3AV2C 4Z2MG 2YFWB 5DNND 5FUGA 5B31A 4X23A 4Z5TB 1P3GD 5CPIA 4ZBJB 5B24B 4JJND 4WU8C 1KX3C 1P3BA 4XZQB 5AV5D 3WKJC 3C1BA 1TZYC 1JFIB 4H9OA 5DNMD 3REHC 3R45B 3X1VA 3AZID 2Y2OA 2NQBD 3WTPA 1ID3B 2AROA 4J8VB 1M1AD 3RELB 4LD9C 3W96C 1M18A 3MGSD 3TU4A 3LELC 5B2JA 5AV8A 4H9QA 5B0ZD 3AZLB 3AZFA 5B1MB 3X1SB 3AZGC 3AZKB 2FJ7D 1P3GB 5GSUA 5CPKA 1ZLAD 1Q9CA 5AV6D 5JA4B 4HGAC 5GT3A 3REJC 1BH8A 4YS3D 4KUDB 1P3PA 5CHLB 3UT9C 1P3ID 1WWSA 3C1CC 1M19B 3UTAB 5B1LD 3REKB 4Z5TA 2Y2IA 5B40C 4WZSB 3B6GB 5E5AB 5DNNC 3B0DB 5KDMA 4G92B 1P3LA 4Z66A 3AZLA 3AN2B 5GT0D 5BS7C 3X1UD 5BT1D 4JJNC 5B0YD 3H0LC 5AV5C 2DQNC 4ZUXD 5B32A 5DNMC 1HQ3B 3W97A 4EO5C 4J8WB 3MGRB 1ZLAB 3AZIC 3AZJD 1KX4B 3VH6T 2NQBC 5JRGA 3W98D 1P3KD 1M1AC 3VH6A 1F66B 2YFVB 1P3FB 5B1MA 4YM6D 5B1LB 3MNNA 3MGSC 4WU9C 2CV5B 3X1VD 5B0ZC 1TAFB 3X1TD 3LZ0C 3AV1B 3FDDA 3A1IA 2FJ7C 5F99D 4KUDA 4WJ3C 4G91B 2AROD 4NE6A 5AV6C 1P3OB 4YS3C 4J8XD 2F8NG 3REKA 4DRAA 5AY8A 2Y2JA 5GXQC 1M18D 3B6FB 1EQZD 1P3IC 5C3IB 3B6GA 2BG1A 5E5AA 5AVCD 1P3AB 5AV8D 3A6ND 3KXBA 4X23B 5B31B 5FUGB 3AZFD 5GSUD 4KGCA 5CPIB 3B0CT 2LY8A 1P3BB 4E44A 5GT0C 3X1UC 1KX5C 5BT1C 4NFTA 3C1BB 3H0RC 5B0YC 1P3MA 1P3PD 3WA9B 1P34D 4H9OB 5AV9B 4Z5TD 5B33A 4ZUXC 1KX4A 1S32C 2RIQA 5B24D 1KU5A 2IO5C 3WTPB 1F66A 3AZJC 3MVDA 1P3FA 3W98C 3EPLA 1P3KC 3TU4B 3W99B 5CP6B 5B2JB 4YM6C 5CPJC 1ID3D 4J8VD 2HIOC 3X1VC 3AYWB 3RELD 5CPKB 3AZMA 3X1TC 1P3OA 4J8UA 3REIB 5F99C 5GT3B 2AROC 1BH8B 4AWLB 3B6FA 2PYOA 2ZY3A 3AZNB 4J8XC 4H9PB 3AZLD 1M18C 5B1MD 3X1SD 1EQZC 3AZKD 5AVCC 3A6NC 3AZFC 3O62A 5KDMB 4KUDD 1P3LB 5GSUC 2NZDA 4Z66B 2ZM5A 3V9RB 3WA9A 3LZ1B 5AV9A 1M19D 3UTAD 4XUJC 3REKD 1P3PC 3UTBC 1P34C 4E45A 5B32B 3B6GD 5E5AD 3AFAA 3W97B 5B31G 4Z5TC 4ZBJC 3AN2D 5B24C 3LJAB 1BH9A 5JRGB 4XZQC 2Y2PA 3W99A 5CP6A 3W96B 3WAAB 4R8PA 1HQ3D 3MGQA 3KUYA 3MNNB 4J8WD 3AYWA 3MGRD 1KX4D 3REIA 3KWQA 1ID3C 4J8VC 3EPKA 3RELC 1W2EA 1F66D 3AZNA 3VH6W 1P3FD 3AZHA 4H9PA 2L5AA 3REJB 2Y2HA 5AY8B 5B2IA 3AV2A 2CV5D 3KFUG 3AZLC 3WTPE 5B1MC 3AV1D 3X1SC 3KXBB 3AZKC 1BFMA 1P3GC 4WU8A 3A1KA 1KX3A 3V9RA 3LZ1A 4KGCB 3EG5B 3WKJA 1P3OD 4J8UD 4KUDC 2ZY2A 1TZYA 3B6FD 2XD5A 1P3MB 1P3AD 3UTAC 2BYKA 3REHA 1M19C 3REKC 2HUEB 4X23D 5B31D 4H9RA 4KHAB 5B33B 3LJAA 5CPID 3B6GC 5E5AC 3NQJA 3B0DC 4G92C 1R4VA 1P3BD 4LD9A 2ZY4A 3AN2C 3W96A 3KSYA 3WAAA 3MVDB 3C1BD 3WA9D 5AV9D 3LELA 1U35B 5B32G 1HQ3C 3AZGA 4J8WC 3WTPD 5BNVA 3MGRC 1ZLAC 4WNNA 1KX4C 3AZMB 3REJA 4H9SC 2W8SA 4J8UB 1AOIB 3TU4D 1P3FC 2PYOB 2XD1A 3W99D 5CP6D 4R8PD 3AL0C 5B2JD 5B1LC 5GXQB 2Y2GA 3KUYD 2CV5C 4CSRA 3AYWD 5DNNA 5CPKD 2JSSA 3AV1C 3REID 5GT3D 4G91C 3O62B 5BS7A 4JJNA 2G5IC 2NZDB 5AV5A 4UUZB 3AZND 1P3OC 1T3UA 1KX5B 3B6FC 5DNMA 1PZRA 4KHAA 5C3IC 5B2ID 1P3AC 3AV2D 4X23C 5B31C 3AFAB 3MGPB 2F8NH 1P3LD 2NQBA 5CPIC 4Z66D 4WU8D 4QLCB 3LZ1D 1BH9B 1P3BC 2CWEA 1U35A 3C1BC 1TZYD 3WA9C 4R8PB 3MGSA 5AVBB 5AV9C 5B32D 3AZEB 2FFFB 4WU9A 3W97D 3MGQB 3KUYB 3LZ0A 3LJAD 2F8NK 5JRGD 3WTPC 3KWQB 1AOIA 3NQUB 5AV6A 3W96D 3WAAD 3AZHB 5GXQA 1P3IA 3MNND 3TU4C 3W99C 2Y2NA 5CP6C 5B2IB 3AV2B 5B2JC 5AV8C 3EPHA 3AYWC 3H0MC 5CPKC 4NE3A 4UUZA 4WU8B 1KX3B 3REIC 3REJD 4CAYA 5GT3C 3WKJB 1KX5A 4AWLC 4H9NA 5B0YA 5AY8D 1TZYB 3MGPA 2BYKB 3REHB 3B0BA 4ZUXA 3KXBD 3UTBB 1S32A 4H9RB 4QLCA 4KGCD 3NQJB 2J8PA 3AZJA 4Z2MH 3VH5T 1P3LC 3W98A 4Z66C 4LD9B 1P3KA 3LZ1C 5AVBA 3AZEA 1P3MD 3VH5A 5BNXB 1H3OB 3LELB 4YM6A 5G49A 5B33D 5B32C 5CPJA 3AZGB 3W97C 2HIOA 3NQUA 3X1TA 5BNVB 4DQYB 4WNNB 3MVDD 2JE5A 4HGAB 5F99A 3LJAC 5JRGC 3UT9B 3WAAC 4J8XA 1U35D 1ULYA 3C1CB 2F8NB 1EQZA 4WU9D 3MNNC 5B40B 5AVCA 3A6NA 4CSRB 5DNNB 3LZ0D 3AZMD 5BO0B 1AOID 4JJNB 5AV5B 2PYOD 4XUJA 1N1JA 5GXQD 5AY8C 3UTBA 1P34A 3F6TA 3P5JB 5DNMB 2YFWA 4EO5B 4WV4B 3KXBC 3O62D 3AZIB 5B24A 2NQBB 2NZDD 4KGCC 4XZQA 3B0CW 5BNXA 1H3OA 1M1AB 1F1EA 1KX5D 1JFIA 1P3MC 3MGSB 2RVQD 3R45A 4WU9B 1HTAA 2HUEC 3AFAD 3MGPD 5B0ZB 5B33C 3LZ0B 1S32D 4J8VA 1ID3A 4QLCD 3RELA 2DF4C 2FJ7B 1F66C 5AV6B 3UT9A 3MVDC 3C1CA 2F8NA 4YS3B 5AVBD 3AZED 5B40A 1P3IB 3MGQD 1U35C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NE5 A;  3X1S A;  5BO0 A;  3AZK A;  1P3G A;  5CPJ D;  2HIO D;  3KWQ D;  5JA4 A;  3AZM C;  4J8U C;  3AZH D;  4CAY B;  5GT0 B;  3X1U B;  1AOI C;  4H9N B;  5B0Y B;  1M19 A;  3UTA A;  2PYO C;  2BYM B;  3AZI A;  4ZUX B;  1S32 B;  1KX3 D;  1M1A A;  4DRB A;  2IO5 B;  1A7W A;  3AN2 A;  3O62 C;  3WKJ D;  3AZJ B;  3W98 B;  2NZD C;  1P3K B;  4XUJ D;  3REH D;  5B0Z A;  3UTB D;  1HQ3 A;  4YM6 B;  5G49 B;  4J8W A;  2RVQ C;  2FJ7 A;  3MGR A;  5CPJ B;  3MGP C;  3AFA C;  1ZLA A;  2HIO B;  3X1V B;  1WWI A;  1B6W A;  3X1T B;  4H9S A;  4LD9 D;  4QLC C;  4YS3 A;  5F99 B;  4XZQ D;  2ARO B;  3VH5 W;  2YFV A;  3LEL D;  4J8X B;  4R8P C;  5B1L A;  5AVB C;  3AZE C;  1M18 B;  3AZG D;  2CV5 A;  1EQZ B;  3MGQ C;  3KUY C;  1TAF A;  5AVC B;  5AV8 B;  4H9Q B;  3A6N B;  3AV1 A;  3AZF B;  3KWQ C;  5GT0 A;  5GSU B;  3X1U A;  2BYM A;  3UT9 D;  3AZN C;  3AZH C;  3C1C D;  2F8N D;  4XUJ B;  1B67 A;  1N1J B;  5B40 D;  1P3P B;  4M6B A;  1P3A A;  1P34 B;  5B2I C;  3AV2 C;  4Z2M G;  2YFW B;  5DNN D;  5FUG A;  5B31 A;  4X23 A;  4Z5T B;  1P3G D;  5CPI A;  4ZBJ B;  5B24 B;  4JJN D;  4WU8 C;  1KX3 C;  1P3B A;  4XZQ B;  5AV5 D;  3WKJ C;  3C1B A;  1TZY C;  1JFI B;  4H9O A;  5DNM D;  3REH C;  3R45 B;  3X1V A;  3AZI D;  2NQB D;  3WTP A;  1ID3 B;  2ARO A;  4J8V B;  1M1A D;  3REL B;  4LD9 C;  3W96 C;  1M18 A;  3MGS D;  3TU4 A;  3LEL C;  5B2J A;  5AV8 A;  4H9Q A;  5B0Z D;  3AZL B;  3AZF A;  5B1M B;  3X1S B;  3AZG C;  3AZK B;  2FJ7 D;  1P3G B;  5GSU A;  5CPK A;  1ZLA D;  1Q9C A;  5AV6 D;  5JA4 B;  4HGA C;  5GT3 A;  3REJ C;  1BH8 A;  4YS3 D;  4KUD B;  1P3P A;  5CHL B;  3UT9 C;  1P3I D;  1WWS A;  3C1C C;  1M19 B;  3UTA B;  5B1L D;  3REK B;  4Z5T A;  5B40 C;  4WZS B;  3B6G B;  5E5A B;  5DNN C;  3B0D B;  5KDM A;  4G92 B;  1P3L A;  4Z66 A;  3AZL A;  3AN2 B;  5GT0 D;  5BS7 C;  3X1U D;  5BT1 D;  4JJN C;  5B0Y D;  5AV5 C;  4ZUX D;  5B32 A;  5DNM C;  1HQ3 B;  3W97 A;  4EO5 C;  4J8W B;  3MGR B;  1ZLA B;  3AZI C;  3AZJ D;  1KX4 B;  3VH6 T;  2NQB C;  5JRG A;  3W98 D;  1P3K D;  1M1A C;  3VH6 A;  1F66 B;  2YFV B;  1P3F B;  5B1M A;  4YM6 D;  5B1L B;  3MNN A;  3MGS C;  4WU9 C;  2CV5 B;  3X1V D;  5B0Z C;  1TAF B;  3X1T D;  3LZ0 C;  3AV1 B;  4KUD A;  2FJ7 C;  5F99 D;  4G91 B;  2ARO D;  4NE6 A;  5AV6 C;  1P3O B;  4YS3 C;  4J8X D;  2F8N G;  3REK A;  4DRA A;  5AY8 A;  5GXQ C;  1M18 D;  3B6F B;  1EQZ D;  1P3I C;  5C3I B;  3B6G A;  5AVC D;  5E5A A;  1P3A B;  5AV8 D;  3A6N D;  3KXB A;  4X23 B;  5B31 B;  5FUG B;  3AZF D;  5GSU D;  4KGC A;  5CPI B;  3B0C T;  2LY8 A;  1P3B B;  4E44 A;  5GT0 C;  3X1U C;  1KX5 C;  5BT1 C;  4NFT A;  3C1B B;  5B0Y C;  1P3M A;  1P3P D;  3WA9 B;  1P34 D;  4H9O B;  5AV9 B;  4Z5T D;  5B33 A;  4ZUX C;  1KX4 A;  1S32 C;  5B24 D;  1KU5 A;  2IO5 C;  3WTP B;  1F66 A;  3AZJ C;  3MVD A;  1P3F A;  3W98 C;  1P3K C;  3TU4 B;  3W99 B;  5CP6 B;  5B2J B;  4YM6 C;  5CPJ C;  1ID3 D;  4J8V D;  2HIO C;  3X1V C;  3AYW B;  3REL D;  5CPK B;  3AZM A;  3X1T C;  1P3O A;  4J8U A;  3REI B;  5F99 C;  5GT3 B;  2ARO C;  1BH8 B;  4AWL B;  3B6F A;  2PYO A;  3AZN B;  4J8X C;  4H9P B;  3AZL D;  1M18 C;  5B1M D;  3X1S D;  1EQZ C;  3AZK D;  5AVC C;  3A6N C;  3AZF C;  3O62 A;  5KDM B;  4KUD D;  1P3L B;  5GSU C;  2NZD A;  4Z66 B;  3V9R B;  3WA9 A;  3LZ1 B;  5AV9 A;  1M19 D;  3UTA D;  4XUJ C;  3REK D;  1P3P C;  3UTB C;  1P34 C;  4E45 A;  5B32 B;  3B6G D;  5E5A D;  3AFA A;  3W97 B;  5B31 G;  4Z5T C;  4ZBJ C;  3AN2 D;  5B24 C;  3LJA B;  1BH9 A;  5JRG B;  4XZQ C;  3W99 A;  5CP6 A;  3W96 B;  3WAA B;  4R8P A;  1HQ3 D;  3MGQ A;  3KUY A;  3MNN B;  4J8W D;  3AYW A;  3MGR D;  1KX4 D;  3REI A;  3KWQ A;  1ID3 C;  4J8V C;  3REL C;  1F66 D;  3AZN A;  3VH6 W;  1P3F D;  3AZH A;  4H9P A;  2L5A A;  3REJ B;  5AY8 B;  5B2I A;  3AV2 A;  2CV5 D;  3AZL C;  3WTP E;  5B1M C;  3AV1 D;  3X1S C;  3KXB B;  3AZK C;  1BFM A;  1P3G C;  4WU8 A;  1KX3 A;  3V9R A;  3LZ1 A;  4KGC B;  3WKJ A;  1P3O D;  4J8U D;  4KUD C;  1TZY A;  3B6F D;  1P3M B;  1P3A D;  3UTA C;  2BYK A;  3REH A;  1M19 C;  3REK C;  2HUE B;  4X23 D;  5B31 D;  4H9R A;  4KHA B;  5B33 B;  3LJA A;  5CPI D;  3B6G C;  5E5A C;  3NQJ A;  3B0D C;  4G92 C;  1R4V A;  1P3B D;  4LD9 A;  3AN2 C;  3W96 A;  3KSY A;  3WAA A;  3MVD B;  3C1B D;  3WA9 D;  5AV9 D;  3LEL A;  1U35 B;  5B32 G;  1HQ3 C;  3AZG A;  4J8W C;  3WTP D;  5BNV A;  3MGR C;  1ZLA C;  4WNN A;  1KX4 C;  3AZM B;  3REJ A;  4H9S C;  4J8U B;  1AOI B;  3TU4 D;  1P3F C;  2PYO B;  3W99 D;  5CP6 D;  4R8P D;  5B2J D;  5B1L C;  5GXQ B;  3KUY D;  2CV5 C;  4CSR A;  3AYW D;  5DNN A;  5CPK D;  2JSS A;  3AV1 C;  3REI D;  5GT3 D;  4G91 C;  3O62 B;  5BS7 A;  4JJN A;  2NZD B;  5AV5 A;  4UUZ B;  3AZN D;  1P3O C;  1KX5 B;  3B6F C;  5DNM A;  4KHA A;  5C3I C;  5B2I D;  1P3A C;  3AV2 D;  4X23 C;  5B31 C;  3AFA B;  3MGP B;  2F8N H;  1P3L D;  2NQB A;  5CPI C;  4Z66 D;  4WU8 D;  4QLC B;  3LZ1 D;  1BH9 B;  1P3B C;  2CWE A;  1U35 A;  3C1B C;  1TZY D;  3WA9 C;  4R8P B;  3MGS A;  5AVB B;  5AV9 C;  5B32 D;  3AZE B;  4WU9 A;  3W97 D;  3MGQ B;  3KUY B;  3LZ0 A;  3LJA D;  2F8N K;  5JRG D;  3WTP C;  3KWQ B;  1AOI A;  3NQU B;  5AV6 A;  3W96 D;  3WAA D;  3AZH B;  5GXQ A;  1P3I A;  3MNN D;  3TU4 C;  3W99 C;  5CP6 C;  5B2I B;  3AV2 B;  5B2J C;  5AV8 C;  3AYW C;  5CPK C;  4NE3 A;  4UUZ A;  4WU8 B;  1KX3 B;  3REI C;  3REJ D;  4CAY A;  5GT3 C;  3WKJ B;  1KX5 A;  4AWL C;  4H9N A;  5B0Y A;  5AY8 D;  1TZY B;  3MGP A;  2BYK B;  3REH B;  3B0B A;  4ZUX A;  3KXB D;  3UTB B;  1S32 A;  4H9R B;  4QLC A;  4KGC D;  3NQJ B;  3AZJ A;  4Z2M H;  3VH5 T;  1P3L C;  3W98 A;  4Z66 C;  4LD9 B;  1P3K A;  3LZ1 C;  5AVB A;  3AZE A;  1P3M D;  3VH5 A;  5BNX B;  1H3O B;  3LEL B;  4YM6 A;  5G49 A;  5B33 D;  5B32 C;  5CPJ A;  3AZG B;  3W97 C;  2HIO A;  3NQU A;  3X1T A;  5BNV B;  4WNN B;  3MVD D;  4HGA B;  5F99 A;  3LJA C;  5JRG C;  3UT9 B;  3WAA C;  4J8X A;  1U35 D;  1ULY A;  3C1C B;  2F8N B;  1EQZ A;  4WU9 D;  3MNN C;  5B40 B;  5AVC A;  3A6N A;  4CSR B;  5DNN B;  3LZ0 D;  3AZM D;  5BO0 B;  1AOI D;  4JJN B;  5AV5 B;  2PYO D;  4XUJ A;  1N1J A;  5GXQ D;  5AY8 C;  3UTB A;  1P34 A;  5DNM B;  2YFW A;  4EO5 B;  4WV4 B;  3KXB C;  3O62 D;  3AZI B;  5B24 A;  2NQB B;  2NZD D;  4KGC C;  4XZQ A;  3B0C W;  5BNX A;  1H3O A;  1M1A B;  1F1E A;  1KX5 D;  1JFI A;  1P3M C;  3MGS B;  2RVQ D;  3R45 A;  4WU9 B;  1HTA A;  2HUE C;  3AFA D;  3MGP D;  5B0Z B;  5B33 C;  3LZ0 B;  1S32 D;  4J8V A;  1ID3 A;  4QLC D;  3REL A;  2FJ7 B;  1F66 C;  5AV6 B;  3UT9 A;  3MVD C;  3C1C A;  2F8N A;  4YS3 B;  5AVB D;  3AZE D;  5B40 A;  1P3I B;  3MGQ D;  1U35 C; 
#chains in the Genus database with same CATH topology
 4NE5 A;  3X1S A;  5BO0 A;  3EPJ A;  3AZK A;  1P3G A;  5CPJ D;  2HIO D;  3KWQ D;  5JA4 A;  3AZM C;  4J8U C;  3AZH D;  3IP4 C;  4CAY B;  5GT0 B;  3X1U B;  1AOI C;  4H9N B;  5B0Y B;  1M19 A;  3UTA A;  2PYO C;  2BYM B;  3AZI A;  4ZUX B;  2Y2L A;  2Y2M A;  1S32 B;  1KX3 D;  1M1A A;  4DRB A;  2IO5 B;  1A7W A;  3AN2 A;  3O62 C;  3WKJ D;  3AZJ B;  3W98 B;  2NZD C;  1P3K B;  4XUJ D;  2JCH A;  3REH D;  5B0Z A;  3UTB D;  1HQ3 A;  4YM6 B;  5G49 B;  4J8W A;  2RVQ C;  2FJ7 A;  3MGR A;  5CPJ B;  3MGP C;  3AFA C;  1ZLA A;  2HIO B;  3X1V B;  1WWI A;  2ZY5 A;  1B6W A;  3X1T B;  4H9S A;  4LD9 D;  4QLC C;  4YS3 A;  5F99 B;  4XZQ D;  2ARO B;  3VH5 W;  2YFV A;  2VQR A;  3LEL D;  4J8X B;  4R8P C;  5B1L A;  5AVB C;  3AZE C;  1M18 B;  3AZG D;  2CV5 A;  1EQZ B;  3MGQ C;  3KUY C;  1TAF A;  2Y2Q A;  5AVC B;  2Y2K A;  4H9Q B;  5AV8 B;  4UPK A;  3A6N B;  3AV1 A;  3AZF B;  3KWQ C;  2F2A C;  2UWX A;  5GT0 A;  5GSU B;  3X1U A;  2BYM A;  3UT9 D;  3AZN C;  3AZH C;  2G5H C;  3C1C D;  2F8N D;  4XUJ B;  1B67 A;  1N1J B;  5B40 D;  1Z2C B;  1P3P B;  4M6B A;  1P3A A;  1P34 B;  5B2I C;  3AV2 C;  4Z2M G;  2YFW B;  5DNN D;  5FUG A;  5B31 A;  4X23 A;  4Z5T B;  1P3G D;  5CPI A;  4ZBJ B;  5B24 B;  4JJN D;  4WU8 C;  1KX3 C;  1P3B A;  4XZQ B;  5AV5 D;  3WKJ C;  3C1B A;  1TZY C;  1JFI B;  4H9O A;  5DNM D;  3REH C;  3R45 B;  3X1V A;  3AZI D;  2Y2O A;  2NQB D;  3WTP A;  1ID3 B;  2ARO A;  4J8V B;  1M1A D;  3REL B;  4LD9 C;  3W96 C;  1M18 A;  3MGS D;  3TU4 A;  3LEL C;  5B2J A;  5AV8 A;  4H9Q A;  5B0Z D;  3AZL B;  3AZF A;  5B1M B;  3X1S B;  3AZG C;  3AZK B;  2FJ7 D;  1P3G B;  5GSU A;  5CPK A;  1ZLA D;  1Q9C A;  5AV6 D;  5JA4 B;  4HGA C;  5GT3 A;  3REJ C;  1BH8 A;  4YS3 D;  4KUD B;  1P3P A;  5CHL B;  3UT9 C;  1P3I D;  1WWS A;  3C1C C;  1M19 B;  3UTA B;  5B1L D;  3REK B;  4Z5T A;  2Y2I A;  5B40 C;  4WZS B;  3B6G B;  5E5A B;  5DNN C;  3B0D B;  5KDM A;  4G92 B;  1P3L A;  4Z66 A;  3AZL A;  3AN2 B;  5GT0 D;  5BS7 C;  3X1U D;  5BT1 D;  4JJN C;  5B0Y D;  3H0L C;  5AV5 C;  2DQN C;  4ZUX D;  5B32 A;  5DNM C;  1HQ3 B;  3W97 A;  4EO5 C;  4J8W B;  3MGR B;  1ZLA B;  3AZI C;  3AZJ D;  1KX4 B;  3VH6 T;  2NQB C;  5JRG A;  3W98 D;  1P3K D;  1M1A C;  3VH6 A;  1F66 B;  2YFV B;  1P3F B;  5B1M A;  4YM6 D;  5B1L B;  3MNN A;  3MGS C;  4WU9 C;  2CV5 B;  3X1V D;  5B0Z C;  1TAF B;  3X1T D;  3LZ0 C;  3AV1 B;  3FDD A;  3A1I A;  2FJ7 C;  5F99 D;  4KUD A;  4WJ3 C;  4G91 B;  2ARO D;  4NE6 A;  5AV6 C;  1P3O B;  4YS3 C;  4J8X D;  2F8N G;  3REK A;  4DRA A;  5AY8 A;  2Y2J A;  5GXQ C;  1M18 D;  3B6F B;  1EQZ D;  1P3I C;  5C3I B;  3B6G A;  2BG1 A;  5E5A A;  5AVC D;  1P3A B;  5AV8 D;  3A6N D;  3KXB A;  4X23 B;  5B31 B;  5FUG B;  3AZF D;  5GSU D;  4KGC A;  5CPI B;  3B0C T;  2LY8 A;  1P3B B;  4E44 A;  5GT0 C;  3X1U C;  1KX5 C;  5BT1 C;  4NFT A;  3C1B B;  3H0R C;  5B0Y C;  1P3M A;  1P3P D;  3WA9 B;  1P34 D;  4H9O B;  5AV9 B;  4Z5T D;  5B33 A;  4ZUX C;  1KX4 A;  1S32 C;  2RIQ A;  5B24 D;  1KU5 A;  2IO5 C;  3WTP B;  1F66 A;  3AZJ C;  3MVD A;  1P3F A;  3W98 C;  3EPL A;  1P3K C;  3TU4 B;  3W99 B;  5CP6 B;  5B2J B;  4YM6 C;  5CPJ C;  1ID3 D;  4J8V D;  2HIO C;  3X1V C;  3AYW B;  3REL D;  5CPK B;  3AZM A;  3X1T C;  1P3O A;  4J8U A;  3REI B;  5F99 C;  5GT3 B;  2ARO C;  1BH8 B;  4AWL B;  3B6F A;  2PYO A;  2ZY3 A;  3AZN B;  4J8X C;  4H9P B;  3AZL D;  1M18 C;  5B1M D;  3X1S D;  1EQZ C;  3AZK D;  5AVC C;  3A6N C;  3AZF C;  3O62 A;  5KDM B;  4KUD D;  1P3L B;  5GSU C;  2NZD A;  4Z66 B;  2ZM5 A;  3V9R B;  3WA9 A;  3LZ1 B;  5AV9 A;  1M19 D;  3UTA D;  4XUJ C;  3REK D;  1P3P C;  3UTB C;  1P34 C;  4E45 A;  5B32 B;  3B6G D;  5E5A D;  3AFA A;  3W97 B;  5B31 G;  4Z5T C;  4ZBJ C;  3AN2 D;  5B24 C;  3LJA B;  1BH9 A;  5JRG B;  4XZQ C;  2Y2P A;  3W99 A;  5CP6 A;  3W96 B;  3WAA B;  4R8P A;  1HQ3 D;  3MGQ A;  3KUY A;  3MNN B;  4J8W D;  3AYW A;  3MGR D;  1KX4 D;  3REI A;  3KWQ A;  1ID3 C;  4J8V C;  3EPK A;  3REL C;  1W2E A;  1F66 D;  3AZN A;  3VH6 W;  1P3F D;  3AZH A;  4H9P A;  2L5A A;  3REJ B;  2Y2H A;  5AY8 B;  5B2I A;  3AV2 A;  2CV5 D;  3KFU G;  3AZL C;  3WTP E;  5B1M C;  3AV1 D;  3X1S C;  3KXB B;  3AZK C;  1BFM A;  1P3G C;  4WU8 A;  3A1K A;  1KX3 A;  3V9R A;  3LZ1 A;  4KGC B;  3EG5 B;  3WKJ A;  1P3O D;  4J8U D;  4KUD C;  2ZY2 A;  1TZY A;  3B6F D;  2XD5 A;  1P3M B;  1P3A D;  3UTA C;  2BYK A;  3REH A;  1M19 C;  3REK C;  2HUE B;  4X23 D;  5B31 D;  4H9R A;  4KHA B;  5B33 B;  3LJA A;  5CPI D;  3B6G C;  5E5A C;  3NQJ A;  3B0D C;  4G92 C;  1R4V A;  1P3B D;  4LD9 A;  2ZY4 A;  3AN2 C;  3W96 A;  3KSY A;  3WAA A;  3MVD B;  3C1B D;  3WA9 D;  5AV9 D;  3LEL A;  1U35 B;  5B32 G;  1HQ3 C;  3AZG A;  4J8W C;  3WTP D;  5BNV A;  3MGR C;  1ZLA C;  4WNN A;  1KX4 C;  3AZM B;  3REJ A;  4H9S C;  2W8S A;  4J8U B;  1AOI B;  3TU4 D;  1P3F C;  2PYO B;  2XD1 A;  3W99 D;  5CP6 D;  4R8P D;  3AL0 C;  5B2J D;  5B1L C;  5GXQ B;  2Y2G A;  3KUY D;  2CV5 C;  4CSR A;  3AYW D;  5DNN A;  5CPK D;  2JSS A;  3AV1 C;  3REI D;  5GT3 D;  4G91 C;  3O62 B;  5BS7 A;  4JJN A;  2G5I C;  2NZD B;  5AV5 A;  4UUZ B;  3AZN D;  1P3O C;  1T3U A;  1KX5 B;  3B6F C;  5DNM A;  1PZR A;  4KHA A;  5C3I C;  5B2I D;  1P3A C;  3AV2 D;  4X23 C;  5B31 C;  3AFA B;  3MGP B;  2F8N H;  1P3L D;  2NQB A;  5CPI C;  4Z66 D;  4WU8 D;  4QLC B;  3LZ1 D;  1BH9 B;  1P3B C;  2CWE A;  1U35 A;  3C1B C;  1TZY D;  3WA9 C;  4R8P B;  3MGS A;  5AVB B;  5AV9 C;  5B32 D;  3AZE B;  2FFF B;  4WU9 A;  3W97 D;  3MGQ B;  3KUY B;  3LZ0 A;  3LJA D;  2F8N K;  5JRG D;  3WTP C;  3KWQ B;  1AOI A;  3NQU B;  5AV6 A;  3W96 D;  3WAA D;  3AZH B;  5GXQ A;  1P3I A;  3MNN D;  3TU4 C;  3W99 C;  2Y2N A;  5CP6 C;  5B2I B;  3AV2 B;  5B2J C;  5AV8 C;  3EPH A;  3AYW C;  3H0M C;  5CPK C;  4NE3 A;  4UUZ A;  4WU8 B;  1KX3 B;  3REI C;  3REJ D;  4CAY A;  5GT3 C;  3WKJ B;  1KX5 A;  4AWL C;  4H9N A;  5B0Y A;  5AY8 D;  1TZY B;  3MGP A;  2BYK B;  3REH B;  3B0B A;  4ZUX A;  3KXB D;  3UTB B;  1S32 A;  4H9R B;  4QLC A;  4KGC D;  3NQJ B;  2J8P A;  3AZJ A;  4Z2M H;  3VH5 T;  1P3L C;  3W98 A;  4Z66 C;  4LD9 B;  1P3K A;  3LZ1 C;  5AVB A;  3AZE A;  1P3M D;  3VH5 A;  5BNX B;  1H3O B;  3LEL B;  4YM6 A;  5G49 A;  5B33 D;  5B32 C;  5CPJ A;  3AZG B;  3W97 C;  2HIO A;  3NQU A;  3X1T A;  5BNV B;  4DQY B;  4WNN B;  3MVD D;  2JE5 A;  4HGA B;  5F99 A;  3LJA C;  5JRG C;  3UT9 B;  3WAA C;  4J8X A;  1U35 D;  1ULY A;  3C1C B;  2F8N B;  1EQZ A;  4WU9 D;  3MNN C;  5B40 B;  5AVC A;  3A6N A;  4CSR B;  5DNN B;  3LZ0 D;  3AZM D;  5BO0 B;  1AOI D;  4JJN B;  5AV5 B;  2PYO D;  4XUJ A;  1N1J A;  5GXQ D;  5AY8 C;  3UTB A;  1P34 A;  3F6T A;  3P5J B;  5DNM B;  2YFW A;  4EO5 B;  4WV4 B;  3KXB C;  3O62 D;  3AZI B;  5B24 A;  2NQB B;  2NZD D;  4KGC C;  4XZQ A;  3B0C W;  5BNX A;  1H3O A;  1M1A B;  1F1E A;  1KX5 D;  1JFI A;  1P3M C;  3MGS B;  2RVQ D;  3R45 A;  4WU9 B;  1HTA A;  2HUE C;  3AFA D;  3MGP D;  5B0Z B;  5B33 C;  3LZ0 B;  1S32 D;  4J8V A;  1ID3 A;  4QLC D;  3REL A;  2DF4 C;  2FJ7 B;  1F66 C;  5AV6 B;  3UT9 A;  3MVD C;  3C1C A;  2F8N A;  4YS3 B;  5AVB D;  3AZE D;  5B40 A;  1P3I B;  3MGQ D;  1U35 C; 
#chains in the Genus database with same CATH homology
 4NE5 A;  3X1S A;  5BO0 A;  3EPJ A;  3AZK A;  1P3G A;  5CPJ D;  2HIO D;  3KWQ D;  5JA4 A;  3AZM C;  4J8U C;  3AZH D;  3IP4 C;  4CAY B;  5GT0 B;  3X1U B;  1AOI C;  4H9N B;  5B0Y B;  1M19 A;  3UTA A;  2PYO C;  2BYM B;  3AZI A;  4ZUX B;  2Y2L A;  2Y2M A;  1S32 B;  1KX3 D;  1M1A A;  4DRB A;  2IO5 B;  1A7W A;  3AN2 A;  3O62 C;  3WKJ D;  3AZJ B;  3W98 B;  2NZD C;  1P3K B;  4XUJ D;  2JCH A;  3REH D;  5B0Z A;  3UTB D;  1HQ3 A;  4YM6 B;  5G49 B;  4J8W A;  2RVQ C;  2FJ7 A;  3MGR A;  5CPJ B;  3MGP C;  3AFA C;  1ZLA A;  2HIO B;  3X1V B;  1WWI A;  2ZY5 A;  1B6W A;  3X1T B;  4H9S A;  4LD9 D;  4QLC C;  4YS3 A;  5F99 B;  4XZQ D;  2ARO B;  3VH5 W;  2YFV A;  2VQR A;  3LEL D;  4J8X B;  4R8P C;  5B1L A;  5AVB C;  3AZE C;  1M18 B;  3AZG D;  2CV5 A;  1EQZ B;  3MGQ C;  3KUY C;  1TAF A;  2Y2Q A;  5AVC B;  2Y2K A;  4H9Q B;  5AV8 B;  4UPK A;  3A6N B;  3AV1 A;  3AZF B;  3KWQ C;  2F2A C;  2UWX A;  5GT0 A;  5GSU B;  3X1U A;  2BYM A;  3UT9 D;  3AZN C;  3AZH C;  2G5H C;  3C1C D;  2F8N D;  4XUJ B;  1B67 A;  1N1J B;  5B40 D;  1Z2C B;  1P3P B;  4M6B A;  1P3A A;  1P34 B;  5B2I C;  3AV2 C;  4Z2M G;  2YFW B;  5DNN D;  5FUG A;  5B31 A;  4X23 A;  4Z5T B;  1P3G D;  5CPI A;  4ZBJ B;  5B24 B;  4JJN D;  4WU8 C;  1KX3 C;  1P3B A;  4XZQ B;  5AV5 D;  3WKJ C;  3C1B A;  1TZY C;  1JFI B;  4H9O A;  5DNM D;  3REH C;  3R45 B;  3X1V A;  3AZI D;  2Y2O A;  2NQB D;  3WTP A;  1ID3 B;  2ARO A;  4J8V B;  1M1A D;  3REL B;  4LD9 C;  3W96 C;  1M18 A;  3MGS D;  3TU4 A;  3LEL C;  5B2J A;  5AV8 A;  4H9Q A;  5B0Z D;  3AZL B;  3AZF A;  5B1M B;  3X1S B;  3AZG C;  3AZK B;  2FJ7 D;  1P3G B;  5GSU A;  5CPK A;  1ZLA D;  1Q9C A;  5AV6 D;  5JA4 B;  4HGA C;  5GT3 A;  3REJ C;  1BH8 A;  4YS3 D;  4KUD B;  1P3P A;  5CHL B;  3UT9 C;  1P3I D;  1WWS A;  3C1C C;  1M19 B;  3UTA B;  5B1L D;  3REK B;  4Z5T A;  2Y2I A;  5B40 C;  4WZS B;  3B6G B;  5E5A B;  5DNN C;  3B0D B;  5KDM A;  4G92 B;  1P3L A;  4Z66 A;  3AZL A;  3AN2 B;  5GT0 D;  5BS7 C;  3X1U D;  5BT1 D;  4JJN C;  5B0Y D;  3H0L C;  5AV5 C;  2DQN C;  4ZUX D;  5B32 A;  5DNM C;  1HQ3 B;  3W97 A;  4EO5 C;  4J8W B;  3MGR B;  1ZLA B;  3AZI C;  3AZJ D;  1KX4 B;  3VH6 T;  2NQB C;  5JRG A;  3W98 D;  1P3K D;  1M1A C;  3VH6 A;  1F66 B;  2YFV B;  1P3F B;  5B1M A;  4YM6 D;  5B1L B;  3MNN A;  3MGS C;  4WU9 C;  2CV5 B;  3X1V D;  5B0Z C;  1TAF B;  3X1T D;  3LZ0 C;  3AV1 B;  3FDD A;  3A1I A;  2FJ7 C;  5F99 D;  4KUD A;  4WJ3 C;  4G91 B;  2ARO D;  4NE6 A;  5AV6 C;  1P3O B;  4YS3 C;  4J8X D;  2F8N G;  3REK A;  4DRA A;  5AY8 A;  2Y2J A;  5GXQ C;  1M18 D;  3B6F B;  1EQZ D;  1P3I C;  5C3I B;  3B6G A;  2BG1 A;  5E5A A;  5AVC D;  1P3A B;  5AV8 D;  3A6N D;  3KXB A;  4X23 B;  5B31 B;  5FUG B;  3AZF D;  5GSU D;  4KGC A;  5CPI B;  3B0C T;  2LY8 A;  1P3B B;  4E44 A;  5GT0 C;  3X1U C;  1KX5 C;  5BT1 C;  4NFT A;  3C1B B;  3H0R C;  5B0Y C;  1P3M A;  1P3P D;  3WA9 B;  1P34 D;  4H9O B;  5AV9 B;  4Z5T D;  5B33 A;  4ZUX C;  1KX4 A;  1S32 C;  2RIQ A;  5B24 D;  1KU5 A;  2IO5 C;  3WTP B;  1F66 A;  3AZJ C;  3MVD A;  1P3F A;  3W98 C;  3EPL A;  1P3K C;  3TU4 B;  3W99 B;  5CP6 B;  5B2J B;  4YM6 C;  5CPJ C;  1ID3 D;  4J8V D;  2HIO C;  3X1V C;  3AYW B;  3REL D;  5CPK B;  3AZM A;  3X1T C;  1P3O A;  4J8U A;  3REI B;  5F99 C;  5GT3 B;  2ARO C;  1BH8 B;  4AWL B;  3B6F A;  2PYO A;  2ZY3 A;  3AZN B;  4J8X C;  4H9P B;  3AZL D;  1M18 C;  5B1M D;  3X1S D;  1EQZ C;  3AZK D;  5AVC C;  3A6N C;  3AZF C;  3O62 A;  5KDM B;  4KUD D;  1P3L B;  5GSU C;  2NZD A;  4Z66 B;  2ZM5 A;  3V9R B;  3WA9 A;  3LZ1 B;  5AV9 A;  1M19 D;  3UTA D;  4XUJ C;  3REK D;  1P3P C;  3UTB C;  1P34 C;  4E45 A;  5B32 B;  3B6G D;  5E5A D;  3AFA A;  3W97 B;  5B31 G;  4Z5T C;  4ZBJ C;  3AN2 D;  5B24 C;  3LJA B;  1BH9 A;  5JRG B;  4XZQ C;  2Y2P A;  3W99 A;  5CP6 A;  3W96 B;  3WAA B;  4R8P A;  1HQ3 D;  3MGQ A;  3KUY A;  3MNN B;  4J8W D;  3AYW A;  3MGR D;  1KX4 D;  3REI A;  3KWQ A;  1ID3 C;  4J8V C;  3EPK A;  3REL C;  1W2E A;  1F66 D;  3AZN A;  3VH6 W;  1P3F D;  3AZH A;  4H9P A;  2L5A A;  3REJ B;  2Y2H A;  5AY8 B;  5B2I A;  3AV2 A;  2CV5 D;  3KFU G;  3AZL C;  3WTP E;  5B1M C;  3AV1 D;  3X1S C;  3KXB B;  3AZK C;  1BFM A;  1P3G C;  4WU8 A;  3A1K A;  1KX3 A;  3V9R A;  3LZ1 A;  4KGC B;  3EG5 B;  3WKJ A;  1P3O D;  4J8U D;  4KUD C;  2ZY2 A;  1TZY A;  3B6F D;  2XD5 A;  1P3M B;  1P3A D;  3UTA C;  2BYK A;  3REH A;  1M19 C;  3REK C;  2HUE B;  4X23 D;  5B31 D;  4H9R A;  4KHA B;  5B33 B;  3LJA A;  5CPI D;  3B6G C;  5E5A C;  3NQJ A;  3B0D C;  4G92 C;  1R4V A;  1P3B D;  4LD9 A;  2ZY4 A;  3AN2 C;  3W96 A;  3KSY A;  3WAA A;  3MVD B;  3C1B D;  3WA9 D;  5AV9 D;  3LEL A;  1U35 B;  5B32 G;  1HQ3 C;  3AZG A;  4J8W C;  3WTP D;  5BNV A;  3MGR C;  1ZLA C;  4WNN A;  1KX4 C;  3AZM B;  3REJ A;  4H9S C;  2W8S A;  4J8U B;  1AOI B;  3TU4 D;  1P3F C;  2PYO B;  2XD1 A;  3W99 D;  5CP6 D;  4R8P D;  3AL0 C;  5B2J D;  5B1L C;  5GXQ B;  2Y2G A;  3KUY D;  2CV5 C;  4CSR A;  3AYW D;  5DNN A;  5CPK D;  2JSS A;  3AV1 C;  3REI D;  5GT3 D;  4G91 C;  3O62 B;  5BS7 A;  4JJN A;  2G5I C;  2NZD B;  5AV5 A;  4UUZ B;  3AZN D;  1P3O C;  1T3U A;  1KX5 B;  3B6F C;  5DNM A;  1PZR A;  4KHA A;  5C3I C;  5B2I D;  1P3A C;  3AV2 D;  4X23 C;  5B31 C;  3AFA B;  3MGP B;  2F8N H;  1P3L D;  2NQB A;  5CPI C;  4Z66 D;  4WU8 D;  4QLC B;  3LZ1 D;  1BH9 B;  1P3B C;  2CWE A;  1U35 A;  3C1B C;  1TZY D;  3WA9 C;  4R8P B;  3MGS A;  5AVB B;  5AV9 C;  5B32 D;  3AZE B;  2FFF B;  4WU9 A;  3W97 D;  3MGQ B;  3KUY B;  3LZ0 A;  3LJA D;  2F8N K;  5JRG D;  3WTP C;  3KWQ B;  1AOI A;  3NQU B;  5AV6 A;  3W96 D;  3WAA D;  3AZH B;  5GXQ A;  1P3I A;  3MNN D;  3TU4 C;  3W99 C;  2Y2N A;  5CP6 C;  5B2I B;  3AV2 B;  5B2J C;  5AV8 C;  3EPH A;  3AYW C;  3H0M C;  5CPK C;  4NE3 A;  4UUZ A;  4WU8 B;  1KX3 B;  3REI C;  3REJ D;  4CAY A;  5GT3 C;  3WKJ B;  1KX5 A;  4AWL C;  4H9N A;  5B0Y A;  5AY8 D;  1TZY B;  3MGP A;  2BYK B;  3REH B;  3B0B A;  4ZUX A;  3KXB D;  3UTB B;  1S32 A;  4H9R B;  4QLC A;  4KGC D;  3NQJ B;  2J8P A;  3AZJ A;  4Z2M H;  3VH5 T;  1P3L C;  3W98 A;  4Z66 C;  4LD9 B;  1P3K A;  3LZ1 C;  5AVB A;  3AZE A;  1P3M D;  3VH5 A;  5BNX B;  1H3O B;  3LEL B;  4YM6 A;  5G49 A;  5B33 D;  5B32 C;  5CPJ A;  3AZG B;  3W97 C;  2HIO A;  3NQU A;  3X1T A;  5BNV B;  4DQY B;  4WNN B;  3MVD D;  2JE5 A;  4HGA B;  5F99 A;  3LJA C;  5JRG C;  3UT9 B;  3WAA C;  4J8X A;  1U35 D;  1ULY A;  3C1C B;  2F8N B;  1EQZ A;  4WU9 D;  3MNN C;  5B40 B;  5AVC A;  3A6N A;  4CSR B;  5DNN B;  3LZ0 D;  3AZM D;  5BO0 B;  1AOI D;  4JJN B;  5AV5 B;  2PYO D;  4XUJ A;  1N1J A;  5GXQ D;  5AY8 C;  3UTB A;  1P34 A;  3F6T A;  3P5J B;  5DNM B;  2YFW A;  4EO5 B;  4WV4 B;  3KXB C;  3O62 D;  3AZI B;  5B24 A;  2NQB B;  2NZD D;  4KGC C;  4XZQ A;  3B0C W;  5BNX A;  1H3O A;  1M1A B;  1F1E A;  1KX5 D;  1JFI A;  1P3M C;  3MGS B;  2RVQ D;  3R45 A;  4WU9 B;  1HTA A;  2HUE C;  3AFA D;  3MGP D;  5B0Z B;  5B33 C;  3LZ0 B;  1S32 D;  4J8V A;  1ID3 A;  4QLC D;  3REL A;  2DF4 C;  2FJ7 B;  1F66 C;  5AV6 B;  3UT9 A;  3MVD C;  3C1C A;  2F8N A;  4YS3 B;  5AVB D;  3AZE D;  5B40 A;  1P3I B;  3MGQ D;  1U35 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...