3W96D

Crystal structure of human nucleosome core particle lacking h2a n-terminal region
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 34
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w96D00
5BNVA 2BYMB 4NFTA 2FJ7A 1M1AC 3KUYC 3W98A 2CV5B 2YFVB 5GXQD 1P3PD 3MGSC 4G92B 3W99A 3WA9C 4WU8B 1P3AA 5F99D 5B24D 3UTAB 5E5AA 3LELD 1A7WA 5JRGD 4J8WC 2FJ7B 3AZMC 5GT3A 2HIOB 4XZQA 3KXBC 3REJD 1AOIC 1ZLAD 5CP6D 4H9NA 3AZEC 3X1UB 3REHD 3C1CB 1M19D 4NE3A 4ZBJC 3MVDC 3C1BD 4Z5TB 3TU4A 3B6FB 2L5AA 5CPJC 3X1UA 4R8PA 4KGCD 4YS3A 5AVBB 4H9PB 3B0DC 3REKC 1F66A 4WU9D 1AOID 1ZLAC 4YM6D 3AZLD 4E44A 4WU8A 3B0CW 5GXQA 1P3PA 3MGPD 3NQUA 3NQJA 1P3BC 1M19B 3AYWC 1P3OA 3X1VA 5AVBA 5B33D 2RVQD 4J8UD 5BO0B 1TZYB 4WZSB 5B1LB 4Z2MH 3LZ1D 4H9RB 1HQ3C 3W98D 1TAFB 3AN2C 3AV1D 2HUEB 4YM6C 1B67A 3A6NA 3WAAA 4LD9A 5CPKA 2BYKB 3AZKB 5B0ZA 3AZIB 2IO5C 4JJNB 3X1SB 5BT1D 4KGCA 1P3KB 4X23D 3REIC 1ID3A 3UTBC 4UUZA 3LJAA 4KUDC 5AV9A 5AVCA 3WKJB 1S32B 2PYOA 3B0CT 3AZKA 3RELA 5CP6B 4QLCB 3MGQB 3AN2D 3AZMD 4KHAA 4H9QB 1N1JB 3C1BA 3AV1B 2AROD 3C1CD 5GSUA 3REJC 3KSYA 4Z66A 4H9OB 5B32G 3KWQA 3AFAB 4J8UA 1P3KC 5B24B 3LZ1A 5AV8A 4JJND 2NZDC 4J8XB 4G91B 5GT3B 5KDMB 1WWIA 5B2JC 4XUJD 3MGPC 3AZNA 4EO5B 1M18B 1M1AD 3WAAD 3UT9C 3AFAD 2NQBC 1P3MA 2CWEA 4J8VB 3KUYA 3UTBB 3REIB 2IO5B 4JJNC 5B0YA 3AV2C 5E5AC 1P3FD 2AROA 3R45A 4J8VA 2YFWB 1TZYD 1P3AD 4Z66D 3KWQD 4XZQC 1HQ3B 5B2JB 5FUGA 1BFMA 1P3OB 4H9NB 1P3IA 4J8XC 2FJ7D 4Z5TC 3AZNB 3MVDB 5DNMC 3O62C 3AZJC 3RELD 4H9PA 3W96A 5B40A 4QLCC 3MGQC 3X1UC 3AZGD 3AZEB 3UT9B 3UTBD 1BH9A 1S32C 3WKJC 2JSSA 4EO5C 4YS3C 4H9QA 3C1BB 1U35C 1ZLAA 4KUDB 5JA4B 4WU8C 2LY8A 4XUJA 4Z5TD 3MGSB 3W97D 3AFAC 3X1VC 5DNMD 3O62D 4YM6B 3AV1C 5AVBD 5CP6C 3MNNA 3AZHA 3KXBB 5B31C 5G49B 5B1LC 3V9RA 3AZIA 1P3ID 5B1MA 4YM6A 3MGRA 1KX3D 3WAAB 5AY8A 4WU8D 3AZFA 1P3BB 5CPJD 5CPIB 5BS7A 1TZYA 4HGAB 4KGCC 5B0YB 4X23B 5B2IC 1M1AB 1ZLAB 4KUDA 1WWSA 1P34C 5AV9C 1KX3B 5JRGB 5BNXB 2PYOC 3LZ0A 4AWLB 1EQZA 5C3IB 3RELC 5B31D 4ZUXA 5CPJB 3KXBD 1P3IB 4CAYB 2BYKA 2NZDD 3W98B 5B40D 4J8UC 5B2JD 5B32A 3W99D 1P3KA 3X1TA 1M19C 3LZ1C 5AV8C 3B0BA 4ZUXB 1R4VA 5DNNB 3MNND 3AZHD 2CV5A 3REKB 5CPID 5AVCD 3WTPE 3AZMB 1P3GA 3W97C 1KX5A 1S32D 4WU9B 4WU9C 4WNNA 4AWLC 4KUDD 5B40B 3W97B 1M18D 5AV9B 4JJNA 5B0YC 3REHA 4J8XD 5CPIC 3TU4B 4H9SC 4J8WB 2FJ7C 4J8UB 5AV5A 1HQ3D 3VH5W 3LELC 1P3FA 3W98C 5B32D 5CHLB 1P3IC 2F8NH 5B33A 1P3BD 3AYWD 1KX4D 2RVQC 4Z66B 3KWQB 3WTPA 4J8WA 4YS3D 1P3FB 3AZLA 4UUZB 4X23C 3KXBA 3REID 5B40C 1AOIA 4HGAC 3X1VB 1Q9CA 4KGCB 3AZEA 1S32A 4WV4B 4DRAA 3AZGA 1M18A 4R8PB 3MVDA 3TU4C 4YS3B 1TAFA 1ULYA 3W99B 4XUJB 2F8ND 3MGSA 1P3GD 1KX4B 4H9OA 3WA9A 5B1LD 3LZ1B 3REKA 3B6GC 4Z2MG 3MGRB 1JFIB 3AZMA 1N1JA 4KHAB 1F1EA 4CSRA 3C1CA 5GSUD 5F99C 1KX4A 3X1TB 3AYWA 1P3OC 5B1MC 5JRGC 1H3OB 1U35B 1P3MB 3AZFC 5AV9D 5B2IB 5DNNC 3AV2B 1EQZB 2PYOD 3X1SA 5CPJA 5B24A 1F66B 3WAAC 5CPKC 1P3MD 3AZID 2AROB 1BH9B 5B0ZC 3R45B 5B31B 5C3IC 1EQZD 2PYOB 3REIA 1ID3C 2HIOA 4XZQB 1P34B 5B32B 5AVCC 3UTAA 3AV2D 4G91C 2NZDB 5G49A 2F8NK 3KUYD 2CV5D 5AV6D 3MGSD 3A6NC 4LD9C 3B6GD 3WA9D 4WU9A 2NZDA 5JA4A 5B2JA 1P3LB 3AZJB 3UTBA 3O62B 5AV5B 5DNMB 3VH6A 4NE6A 3REHC 3WKJD 3REHB 3AZKC 3W96B 5DNND 4H9SA 3MNNB 3AZHB 5AV5C 1KX5D 3REJB 3C1BC 5AVCB 1P3AB 3VH5T 3X1SD 3NQJB 1P3LC 3V9RB 5E5AB 5B33C 1P3OD 2YFVA 3AV2A 3A6NB 2AROC 4LD9B 3B6FD 3LJAD 5AV6A 3AZLC 4X23A 1ID3D 3AZLB 3AZNC 4J8WD 3AYWB 4J8XA 4WNNB 4E45A 5GT0A 3UT9A 4Z5TA 5B33B 3UTAD 1M18C 3O62A 5DNMA 5BT1C 1P3MC 3MGPB 1ID3B 4QLCA 3MGQA 2NQBD 2F8NB 5F99B 4DRBA 3WKJA 1P34D 3B6FC 5CPKB 1KX3A 3B6GA 5B1MD 4J8VC 3MGRD 2BYMA 5B31G 1M1AA 4CAYA 3C1CC 4CSRB 5KDMA 5F99A 1KX4C 2NQBB 1P3KD 3AFAA 5JRGA 3W99C 1P3AC 5AV8D 4R8PD 5CP6A 5B1MB 3AZJA 5DNNA 5GT3C 3MNNC 3AZHC 3W96C 3LZ0D 3X1SC 3VH6W 5B31A 5B1LA 3AZIC 1P3LD 5B24C 5B0YD 4ZBJB 3MGRC 3X1TD 5B2ID 3TU4D 2HUEC 1H3OA 4QLCD 3MGQD 3AN2B 1U35A 4M6BA 3AZGB 3VH6T 5BNXA 4XUJC 5B0ZB 2HIOC 1P34A 5FUGB 4R8PC 1KU5A 5GT0D 3UT9D 3UTAC 3W96D 3LZ0C 3AV1A 1F66C 2YFWA 3WTPB 1HTAA 3A6ND 4LD9D 3X1VD 5GXQC 1P3PC 3KUYB 4NE5A 3AZFB 5B32C 1P3BA 5AVBC 5AY8C 1BH8B 2HIOD 3NQUB 5BS7C 1TZYC 3AZKD 3W97A 1HQ3A 5B2IA 1P3GC 5CPKD 3AN2A 5AV5D 1KX5C 3B6GB 5B0ZD 1U35D 1B6WA 1EQZC 3MVDD 4ZUXC 1JFIA 1AOIB 3AZJD 5GSUB 3B0DB 3WTPD 1P3LA 2F8NG 5AV6B 5AY8D 3LJAC 3AZED 3X1TC 1M19A 3AZND 3WA9B 4G92C 3AZFD 3RELB 5BO0A 2CV5C 5AV6C 3LJAB 5GT3D 5E5AD 3LELA 1P3FC 5GSUC 3REJA 4Z66C 3KWQC 1BH8A 5GT0C 4XZQD 5GXQB 1P3PB 4ZUXD 2F8NA 5AV8B 1F66D 3VH5A 3WTPC 3REKD 3LZ0B 1KX5B 5BNVB 3LELB 1P3GB 3MGPA 4J8VD 4H9RA 3B6FA 2NQBA 3X1UD 5AY8B 3AZGC 1KX3C 5GT0B 5CPIA
chains in the Genus database with same CATH superfamily
5BNVA 2BYMB 4NFTA 2FJ7A 1M1AC 3KUYC 3W98A 2CV5B 2YFVB 5GXQD 1P3PD 3MGSC 4G92B 3W99A 3WA9C 4WU8B 1P3AA 5F99D 5B24D 2VQRA 3UTAB 5E5AA 3LELD 1A7WA 5JRGD 4J8WC 2FJ7B 2XD1A 3AZMC 5GT3A 2HIOB 4XZQA 3KXBC 3REJD 1AOIC 1ZLAD 3IP4C 5CP6D 4H9NA 3AZEC 3X1UB 3REHD 3C1CB 1M19D 4NE3A 4ZBJC 3MVDC 3C1BD 2BG1A 4Z5TB 3TU4A 3B6FB 2L5AA 5CPJC 3X1UA 4R8PA 4KGCD 4YS3A 5AVBB 4H9PB 3B0DC 3REKC 1F66A 4WU9D 1AOID 1ZLAC 4YM6D 3AZLD 4E44A 4WU8A 3B0CW 5GXQA 1P3PA 3MGPD 3NQUA 3NQJA 1P3BC 1M19B 3AYWC 1P3OA 3X1VA 5AVBA 5B33D 2RVQD 4J8UD 5BO0B 1TZYB 4WZSB 5B1LB 4Z2MH 3LZ1D 4H9RB 3EPKA 1HQ3C 3W98D 1TAFB 3AN2C 3AV1D 2HUEB 4YM6C 1B67A 3A6NA 3WAAA 2G5HC 4LD9A 5CPKA 2BYKB 3FDDA 3AZKB 5B0ZA 3AZIB 2IO5C 4JJNB 3X1SB 5BT1D 4KGCA 1P3KB 2ZY3A 4X23D 3REIC 3UTBC 4UUZA 1ID3A 3LJAA 4KUDC 2DF4C 5AV9A 5AVCA 3WKJB 3KFUG 1S32B 2PYOA 3B0CT 3AZKA 3RELA 5CP6B 4QLCB 3MGQB 3AN2D 3AZMD 1N1JB 4H9QB 4KHAA 3C1BA 3AV1B 2AROD 3C1CD 2ZY2A 5GSUA 3REJC 3KSYA 4Z66A 4H9OB 5B32G 3KWQA 3AFAB 4J8UA 1P3KC 5B24B 3LZ1A 5AV8A 4JJND 2NZDC 4J8XB 4G91B 5GT3B 5KDMB 1WWIA 5B2JC 4XUJD 3MGPC 3AZNA 4EO5B 1M18B 1M1AD 3WAAD 3UT9C 3AFAD 2NQBC 2ZY4A 2XD5A 1P3MA 2CWEA 4J8VB 2Y2LA 3KUYA 3UTBB 3REIB 2IO5B 4JJNC 5B0YA 3AV2C 5E5AC 1P3FD 3R45A 2AROA 3EPLA 2YFWB 4J8VA 1TZYD 1P3AD 4Z66D 3KWQD 4XZQC 1HQ3B 5B2JB 5FUGA 1BFMA 1P3OB 4H9NB 1P3IA 4J8XC 2FJ7D 4Z5TC 3AZNB 3MVDB 5DNMC 3O62C 3AZJC 3RELD 4H9PA 3W96A 5B40A 4QLCC 3MGQC 3A1IA 3X1UC 3AZGD 3AZEB 3UT9B 2Y2NA 3UTBD 2FFFB 1BH9A 1S32C 3WKJC 2JSSA 4EO5C 4YS3C 4H9QA 3C1BB 1U35C 1ZLAA 4KUDB 5JA4B 4WU8C 2LY8A 4XUJA 4Z5TD 3MGSB 3W97D 3AFAC 3X1VC 5DNMD 3O62D 4YM6B 3AV1C 5AVBD 5CP6C 3EG5B 3MNNA 3AZHA 3KXBB 5B31C 5G49B 5B1LC 3V9RA 3AZIA 2ZY5A 1P3ID 5B1MA 4YM6A 3MGRA 1KX3D 3WAAB 5AY8A 4WU8D 3AZFA 1P3BB 5CPJD 5CPIB 5BS7A 1TZYA 4HGAB 4KGCC 5B0YB 4X23B 5B2IC 1M1AB 1ZLAB 4KUDA 1WWSA 1P34C 5AV9C 1KX3B 5JRGB 5BNXB 2PYOC 3LZ0A 4AWLB 1EQZA 2DQNC 5C3IB 3RELC 5B31D 4ZUXA 2JCHA 5CPJB 3KXBD 1P3IB 4CAYB 2BYKA 2NZDD 3W98B 5B40D 4J8UC 5B2JD 5B32A 3W99D 1P3KA 3X1TA 1M19C 2Y2OA 3LZ1C 5AV8C 3B0BA 4ZUXB 1R4VA 5DNNB 3MNND 3AZHD 2CV5A 3REKB 5CPID 5AVCD 3WTPE 3AZMB 1P3GA 3W97C 1KX5A 1S32D 4WU9B 4WU9C 4WNNA 1Z2CB 1PZRA 4AWLC 4KUDD 5B40B 3W97B 1M18D 5AV9B 4JJNA 5B0YC 3REHA 4J8XD 5CPIC 3TU4B 4H9SC 4J8WB 2FJ7C 4J8UB 5AV5A 1HQ3D 2Y2IA 2Y2QA 3VH5W 3LELC 1P3FA 3W98C 5B32D 5CHLB 1P3IC 2F8NH 5B33A 1P3BD 3AYWD 1KX4D 2RVQC 4Z66B 3KWQB 3WTPA 4J8WA 4YS3D 1P3FB 3AZLA 4UUZB 4X23C 3KXBA 3REID 5B40C 1AOIA 4HGAC 3X1VB 1Q9CA 4KGCB 3AZEA 1S32A 4WV4B 4DRAA 3AZGA 4WJ3C 1M18A 4R8PB 3MVDA 2G5IC 3TU4C 4YS3B 1TAFA 1ULYA 3W99B 4XUJB 2F8ND 3MGSA 1P3GD 1KX4B 4H9OA 3WA9A 5B1LD 3LZ1B 3REKA 3B6GC 4Z2MG 3MGRB 1JFIB 3AZMA 1N1JA 4KHAB 1F1EA 4CSRA 3C1CA 5GSUD 5F99C 1KX4A 3X1TB 3AYWA 1P3OC 5B1MC 5JRGC 1H3OB 1U35B 1P3MB 3AZFC 5AV9D 5B2IB 5DNNC 3AV2B 1EQZB 2PYOD 3X1SA 5CPJA 5B24A 1F66B 3A1KA 3WAAC 3H0MC 5CPKC 1P3MD 2Y2HA 2AROB 1BH9B 5B0ZC 3R45B 5B31B 3AZID 5C3IC 1EQZD 4UPKA 3REIA 1ID3C 2PYOB 2HIOA 4XZQB 1P34B 5B32B 5AVCC 3UTAA 3AV2D 4G91C 2NZDB 5G49A 1W2EA 2F8NK 2W8SA 3KUYD 2J8PA 2CV5D 5AV6D 3MGSD 3A6NC 4LD9C 3B6GD 3WA9D 4WU9A 2NZDA 5JA4A 5B2JA 1P3LB 3AZJB 3UTBA 3O62B 5AV5B 5DNMB 3VH6A 4NE6A 3REHC 3WKJD 3REHB 3AZKC 3W96B 5DNND 4H9SA 3MNNB 3AZHB 5AV5C 1KX5D 3REJB 3C1BC 5AVCB 1P3AB 3VH5T 3X1SD 3NQJB 1P3LC 3V9RB 5E5AB 5B33C 1P3OD 2Y2MA 2YFVA 3AV2A 3A6NB 2AROC 4LD9B 1T3UA 3B6FD 3LJAD 5AV6A 3AZLC 4X23A 1ID3D 3AZLB 3AZNC 4J8WD 3AYWB 4J8XA 4WNNB 4E45A 5GT0A 3H0LC 3UT9A 4DQYB 4Z5TA 5B33B 2ZM5A 3UTAD 1M18C 5DNMA 3O62A 5BT1C 1P3MC 2Y2GA 3MGPB 2F2AC 1ID3B 4QLCA 3MGQA 2NQBD 2F8NB 5F99B 3F6TA 4DRBA 3WKJA 1P34D 3B6FC 5CPKB 1KX3A 3B6GA 5B1MD 4J8VC 3MGRD 2BYMA 5B31G 1M1AA 4CAYA 3C1CC 2JE5A 4CSRB 5KDMA 5F99A 1KX4C 2NQBB 1P3KD 3AFAA 5JRGA 3W99C 1P3AC 5AV8D 4R8PD 2Y2PA 5CP6A 5B1MB 3AZJA 5DNNA 5GT3C 3MNNC 3AZHC 3W96C 3LZ0D 3X1SC 3VH6W 5B31A 5B1LA 3AZIC 1P3LD 5B24C 5B0YD 4ZBJB 3MGRC 3X1TD 5B2ID 3TU4D 2HUEC 1H3OA 4QLCD 3MGQD 3EPJA 3AN2B 1U35A 4M6BA 3AZGB 3VH6T 5BNXA 4XUJC 5B0ZB 2HIOC 1P34A 5FUGB 4R8PC 3EPHA 1KU5A 5GT0D 3UT9D 3UTAC 3W96D 3LZ0C 3AV1A 1F66C 2YFWA 3WTPB 1HTAA 3A6ND 4LD9D 3X1VD 5GXQC 1P3PC 3KUYB 4NE5A 3AZFB 5B32C 1P3BA 5AVBC 2Y2KA 2Y2JA 5AY8C 1BH8B 2HIOD 3NQUB 5BS7C 1TZYC 3P5JB 3AZKD 3W97A 1HQ3A 5B2IA 1P3GC 5CPKD 3AN2A 5AV5D 1KX5C 3B6GB 5B0ZD 1U35D 1B6WA 1EQZC 3MVDD 4ZUXC 1JFIA 1AOIB 3AZJD 5GSUB 3B0DB 3WTPD 3AL0C 1P3LA 2F8NG 5AV6B 5AY8D 3LJAC 3AZED 3X1TC 1M19A 3AZND 3WA9B 4G92C 3AZFD 3RELB 5BO0A 2CV5C 5AV6C 3LJAB 3H0RC 5GT3D 5E5AD 3LELA 1P3FC 5GSUC 3REJA 4Z66C 3KWQC 1BH8A 5GT0C 4XZQD 5GXQB 1P3PB 4ZUXD 2F8NA 2RIQA 5AV8B 1F66D 3VH5A 3WTPC 2UWXA 3REKD 3LZ0B 1KX5B 5BNVB 3LELB 1P3GB 3MGPA 4J8VD 4H9RA 3B6FA 2NQBA 3X1UD 5AY8B 3AZGC 1KX3C 5GT0B 5CPIA
chains in the Genus database with same CATH topology
5BNVA 2BYMB 4NFTA 2FJ7A 1M1AC 3KUYC 3W98A 2CV5B 2YFVB 5GXQD 1P3PD 3MGSC 4G92B 3W99A 3WA9C 4WU8B 1P3AA 5F99D 5B24D 2VQRA 3UTAB 5E5AA 3LELD 1A7WA 5JRGD 4J8WC 2FJ7B 2XD1A 3AZMC 5GT3A 2HIOB 4XZQA 3KXBC 3REJD 1AOIC 1ZLAD 3IP4C 5CP6D 4H9NA 3AZEC 3X1UB 3REHD 3C1CB 1M19D 4NE3A 4ZBJC 3MVDC 3C1BD 2BG1A 4Z5TB 3TU4A 3B6FB 2L5AA 5CPJC 3X1UA 4R8PA 4KGCD 4YS3A 5AVBB 4H9PB 3B0DC 3REKC 1F66A 4WU9D 1AOID 1ZLAC 4YM6D 3AZLD 4E44A 4WU8A 3B0CW 5GXQA 1P3PA 3MGPD 3NQUA 3NQJA 1P3BC 1M19B 3AYWC 1P3OA 3X1VA 5AVBA 5B33D 2RVQD 4J8UD 5BO0B 1TZYB 4WZSB 5B1LB 4Z2MH 3LZ1D 4H9RB 3EPKA 1HQ3C 3W98D 1TAFB 3AN2C 3AV1D 2HUEB 4YM6C 1B67A 3A6NA 3WAAA 2G5HC 4LD9A 5CPKA 2BYKB 3FDDA 3AZKB 5B0ZA 3AZIB 2IO5C 4JJNB 3X1SB 5BT1D 4KGCA 1P3KB 2ZY3A 4X23D 3REIC 3UTBC 4UUZA 1ID3A 3LJAA 4KUDC 2DF4C 5AV9A 5AVCA 3WKJB 3KFUG 1S32B 2PYOA 3B0CT 3AZKA 3RELA 5CP6B 4QLCB 3MGQB 3AN2D 3AZMD 1N1JB 4H9QB 4KHAA 3C1BA 3AV1B 2AROD 3C1CD 2ZY2A 5GSUA 3REJC 3KSYA 4Z66A 4H9OB 5B32G 3KWQA 3AFAB 4J8UA 1P3KC 5B24B 3LZ1A 5AV8A 4JJND 2NZDC 4J8XB 4G91B 5GT3B 5KDMB 1WWIA 5B2JC 4XUJD 3MGPC 3AZNA 4EO5B 1M18B 1M1AD 3WAAD 3UT9C 3AFAD 2NQBC 2ZY4A 2XD5A 1P3MA 2CWEA 4J8VB 2Y2LA 3KUYA 3UTBB 3REIB 2IO5B 4JJNC 5B0YA 3AV2C 5E5AC 1P3FD 3R45A 2AROA 3EPLA 2YFWB 4J8VA 1TZYD 1P3AD 4Z66D 3KWQD 4XZQC 1HQ3B 5B2JB 5FUGA 1BFMA 1P3OB 4H9NB 1P3IA 4J8XC 2FJ7D 4Z5TC 3AZNB 3MVDB 5DNMC 3O62C 3AZJC 3RELD 4H9PA 3W96A 5B40A 4QLCC 3MGQC 3A1IA 3X1UC 3AZGD 3AZEB 3UT9B 2Y2NA 3UTBD 2FFFB 1BH9A 1S32C 3WKJC 2JSSA 4EO5C 4YS3C 4H9QA 3C1BB 1U35C 1ZLAA 4KUDB 5JA4B 4WU8C 2LY8A 4XUJA 4Z5TD 3MGSB 3W97D 3AFAC 3X1VC 5DNMD 3O62D 4YM6B 3AV1C 5AVBD 5CP6C 3EG5B 3MNNA 3AZHA 3KXBB 5B31C 5G49B 5B1LC 3V9RA 3AZIA 2ZY5A 1P3ID 5B1MA 4YM6A 3MGRA 1KX3D 3WAAB 5AY8A 4WU8D 3AZFA 1P3BB 5CPJD 5CPIB 5BS7A 1TZYA 4HGAB 4KGCC 5B0YB 4X23B 5B2IC 1M1AB 1ZLAB 4KUDA 1WWSA 1P34C 5AV9C 1KX3B 5JRGB 5BNXB 2PYOC 3LZ0A 4AWLB 1EQZA 2DQNC 5C3IB 3RELC 5B31D 4ZUXA 2JCHA 5CPJB 3KXBD 1P3IB 4CAYB 2BYKA 2NZDD 3W98B 5B40D 4J8UC 5B2JD 5B32A 3W99D 1P3KA 3X1TA 1M19C 2Y2OA 3LZ1C 5AV8C 3B0BA 4ZUXB 1R4VA 5DNNB 3MNND 3AZHD 2CV5A 3REKB 5CPID 5AVCD 3WTPE 3AZMB 1P3GA 3W97C 1KX5A 1S32D 4WU9B 4WU9C 4WNNA 1Z2CB 1PZRA 4AWLC 4KUDD 5B40B 3W97B 1M18D 5AV9B 4JJNA 5B0YC 3REHA 4J8XD 5CPIC 3TU4B 4H9SC 4J8WB 2FJ7C 4J8UB 5AV5A 1HQ3D 2Y2IA 2Y2QA 3VH5W 3LELC 1P3FA 3W98C 5B32D 5CHLB 1P3IC 2F8NH 5B33A 1P3BD 3AYWD 1KX4D 2RVQC 4Z66B 3KWQB 3WTPA 4J8WA 4YS3D 1P3FB 3AZLA 4UUZB 4X23C 3KXBA 3REID 5B40C 1AOIA 4HGAC 3X1VB 1Q9CA 4KGCB 3AZEA 1S32A 4WV4B 4DRAA 3AZGA 4WJ3C 1M18A 4R8PB 3MVDA 2G5IC 3TU4C 4YS3B 1TAFA 1ULYA 3W99B 4XUJB 2F8ND 3MGSA 1P3GD 1KX4B 4H9OA 3WA9A 5B1LD 3LZ1B 3REKA 3B6GC 4Z2MG 3MGRB 1JFIB 3AZMA 1N1JA 4KHAB 1F1EA 4CSRA 3C1CA 5GSUD 5F99C 1KX4A 3X1TB 3AYWA 1P3OC 5B1MC 5JRGC 1H3OB 1U35B 1P3MB 3AZFC 5AV9D 5B2IB 5DNNC 3AV2B 1EQZB 2PYOD 3X1SA 5CPJA 5B24A 1F66B 3A1KA 3WAAC 3H0MC 5CPKC 1P3MD 2Y2HA 2AROB 1BH9B 5B0ZC 3R45B 5B31B 3AZID 5C3IC 1EQZD 4UPKA 3REIA 1ID3C 2PYOB 2HIOA 4XZQB 1P34B 5B32B 5AVCC 3UTAA 3AV2D 4G91C 2NZDB 5G49A 1W2EA 2F8NK 2W8SA 3KUYD 2J8PA 2CV5D 5AV6D 3MGSD 3A6NC 4LD9C 3B6GD 3WA9D 4WU9A 2NZDA 5JA4A 5B2JA 1P3LB 3AZJB 3UTBA 3O62B 5AV5B 5DNMB 3VH6A 4NE6A 3REHC 3WKJD 3REHB 3AZKC 3W96B 5DNND 4H9SA 3MNNB 3AZHB 5AV5C 1KX5D 3REJB 3C1BC 5AVCB 1P3AB 3VH5T 3X1SD 3NQJB 1P3LC 3V9RB 5E5AB 5B33C 1P3OD 2Y2MA 2YFVA 3AV2A 3A6NB 2AROC 4LD9B 1T3UA 3B6FD 3LJAD 5AV6A 3AZLC 4X23A 1ID3D 3AZLB 3AZNC 4J8WD 3AYWB 4J8XA 4WNNB 4E45A 5GT0A 3H0LC 3UT9A 4DQYB 4Z5TA 5B33B 2ZM5A 3UTAD 1M18C 5DNMA 3O62A 5BT1C 1P3MC 2Y2GA 3MGPB 2F2AC 1ID3B 4QLCA 3MGQA 2NQBD 2F8NB 5F99B 3F6TA 4DRBA 3WKJA 1P34D 3B6FC 5CPKB 1KX3A 3B6GA 5B1MD 4J8VC 3MGRD 2BYMA 5B31G 1M1AA 4CAYA 3C1CC 2JE5A 4CSRB 5KDMA 5F99A 1KX4C 2NQBB 1P3KD 3AFAA 5JRGA 3W99C 1P3AC 5AV8D 4R8PD 2Y2PA 5CP6A 5B1MB 3AZJA 5DNNA 5GT3C 3MNNC 3AZHC 3W96C 3LZ0D 3X1SC 3VH6W 5B31A 5B1LA 3AZIC 1P3LD 5B24C 5B0YD 4ZBJB 3MGRC 3X1TD 5B2ID 3TU4D 2HUEC 1H3OA 4QLCD 3MGQD 3EPJA 3AN2B 1U35A 4M6BA 3AZGB 3VH6T 5BNXA 4XUJC 5B0ZB 2HIOC 1P34A 5FUGB 4R8PC 3EPHA 1KU5A 5GT0D 3UT9D 3UTAC 3W96D 3LZ0C 3AV1A 1F66C 2YFWA 3WTPB 1HTAA 3A6ND 4LD9D 3X1VD 5GXQC 1P3PC 3KUYB 4NE5A 3AZFB 5B32C 1P3BA 5AVBC 2Y2KA 2Y2JA 5AY8C 1BH8B 2HIOD 3NQUB 5BS7C 1TZYC 3P5JB 3AZKD 3W97A 1HQ3A 5B2IA 1P3GC 5CPKD 3AN2A 5AV5D 1KX5C 3B6GB 5B0ZD 1U35D 1B6WA 1EQZC 3MVDD 4ZUXC 1JFIA 1AOIB 3AZJD 5GSUB 3B0DB 3WTPD 3AL0C 1P3LA 2F8NG 5AV6B 5AY8D 3LJAC 3AZED 3X1TC 1M19A 3AZND 3WA9B 4G92C 3AZFD 3RELB 5BO0A 2CV5C 5AV6C 3LJAB 3H0RC 5GT3D 5E5AD 3LELA 1P3FC 5GSUC 3REJA 4Z66C 3KWQC 1BH8A 5GT0C 4XZQD 5GXQB 1P3PB 4ZUXD 2F8NA 2RIQA 5AV8B 1F66D 3VH5A 3WTPC 2UWXA 3REKD 3LZ0B 1KX5B 5BNVB 3LELB 1P3GB 3MGPA 4J8VD 4H9RA 3B6FA 2NQBA 3X1UD 5AY8B 3AZGC 1KX3C 5GT0B 5CPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BNV A;  2BYM B;  4NFT A;  2FJ7 A;  1M1A C;  3KUY C;  3W98 A;  2CV5 B;  2YFV B;  5GXQ D;  1P3P D;  3MGS C;  4G92 B;  3W99 A;  3WA9 C;  4WU8 B;  1P3A A;  5F99 D;  5B24 D;  3UTA B;  5E5A A;  3LEL D;  1A7W A;  5JRG D;  4J8W C;  2FJ7 B;  3AZM C;  5GT3 A;  2HIO B;  4XZQ A;  3KXB C;  3REJ D;  1AOI C;  1ZLA D;  5CP6 D;  4H9N A;  3AZE C;  3X1U B;  3REH D;  3C1C B;  1M19 D;  4NE3 A;  4ZBJ C;  3MVD C;  3C1B D;  4Z5T B;  3TU4 A;  3B6F B;  2L5A A;  5CPJ C;  3X1U A;  4R8P A;  4KGC D;  4YS3 A;  5AVB B;  4H9P B;  3B0D C;  3REK C;  1F66 A;  4WU9 D;  1AOI D;  1ZLA C;  4YM6 D;  3AZL D;  4E44 A;  4WU8 A;  3B0C W;  5GXQ A;  1P3P A;  3MGP D;  3NQU A;  3NQJ A;  1P3B C;  1M19 B;  3AYW C;  1P3O A;  3X1V A;  5AVB A;  5B33 D;  2RVQ D;  4J8U D;  5BO0 B;  1TZY B;  4WZS B;  5B1L B;  4Z2M H;  3LZ1 D;  4H9R B;  1HQ3 C;  3W98 D;  1TAF B;  3AN2 C;  3AV1 D;  2HUE B;  4YM6 C;  1B67 A;  3A6N A;  3WAA A;  4LD9 A;  5CPK A;  2BYK B;  3AZK B;  5B0Z A;  3AZI B;  2IO5 C;  4JJN B;  3X1S B;  5BT1 D;  4KGC A;  1P3K B;  4X23 D;  3REI C;  1ID3 A;  3UTB C;  4UUZ A;  3LJA A;  4KUD C;  5AV9 A;  5AVC A;  3WKJ B;  1S32 B;  2PYO A;  3B0C T;  3AZK A;  3REL A;  5CP6 B;  4QLC B;  3MGQ B;  3AN2 D;  3AZM D;  4KHA A;  4H9Q B;  1N1J B;  3C1B A;  3AV1 B;  2ARO D;  3C1C D;  5GSU A;  3REJ C;  3KSY A;  4Z66 A;  4H9O B;  5B32 G;  3KWQ A;  3AFA B;  4J8U A;  1P3K C;  5B24 B;  3LZ1 A;  5AV8 A;  4JJN D;  2NZD C;  4J8X B;  4G91 B;  5GT3 B;  5KDM B;  1WWI A;  5B2J C;  4XUJ D;  3MGP C;  3AZN A;  4EO5 B;  1M18 B;  1M1A D;  3WAA D;  3UT9 C;  3AFA D;  2NQB C;  1P3M A;  2CWE A;  4J8V B;  3KUY A;  3UTB B;  3REI B;  2IO5 B;  4JJN C;  5B0Y A;  3AV2 C;  5E5A C;  1P3F D;  2ARO A;  3R45 A;  4J8V A;  2YFW B;  1TZY D;  1P3A D;  4Z66 D;  3KWQ D;  4XZQ C;  1HQ3 B;  5B2J B;  5FUG A;  1BFM A;  1P3O B;  4H9N B;  1P3I A;  4J8X C;  2FJ7 D;  4Z5T C;  3AZN B;  3MVD B;  5DNM C;  3O62 C;  3AZJ C;  3REL D;  4H9P A;  3W96 A;  5B40 A;  4QLC C;  3MGQ C;  3X1U C;  3AZG D;  3AZE B;  3UT9 B;  3UTB D;  1BH9 A;  1S32 C;  3WKJ C;  2JSS A;  4EO5 C;  4YS3 C;  4H9Q A;  3C1B B;  1U35 C;  1ZLA A;  4KUD B;  5JA4 B;  4WU8 C;  2LY8 A;  4XUJ A;  4Z5T D;  3MGS B;  3W97 D;  3AFA C;  3X1V C;  5DNM D;  3O62 D;  4YM6 B;  3AV1 C;  5AVB D;  5CP6 C;  3MNN A;  3AZH A;  3KXB B;  5B31 C;  5G49 B;  5B1L C;  3V9R A;  3AZI A;  1P3I D;  5B1M A;  4YM6 A;  3MGR A;  1KX3 D;  3WAA B;  5AY8 A;  4WU8 D;  3AZF A;  1P3B B;  5CPJ D;  5CPI B;  5BS7 A;  1TZY A;  4HGA B;  4KGC C;  5B0Y B;  4X23 B;  5B2I C;  1M1A B;  1ZLA B;  4KUD A;  1WWS A;  1P34 C;  5AV9 C;  1KX3 B;  5JRG B;  5BNX B;  2PYO C;  3LZ0 A;  4AWL B;  1EQZ A;  5C3I B;  3REL C;  5B31 D;  4ZUX A;  5CPJ B;  3KXB D;  1P3I B;  4CAY B;  2BYK A;  2NZD D;  3W98 B;  5B40 D;  4J8U C;  5B2J D;  5B32 A;  3W99 D;  1P3K A;  3X1T A;  1M19 C;  3LZ1 C;  5AV8 C;  3B0B A;  4ZUX B;  1R4V A;  5DNN B;  3MNN D;  3AZH D;  2CV5 A;  3REK B;  5CPI D;  5AVC D;  3WTP E;  3AZM B;  1P3G A;  3W97 C;  1KX5 A;  1S32 D;  4WU9 B;  4WU9 C;  4WNN A;  4AWL C;  4KUD D;  5B40 B;  3W97 B;  1M18 D;  5AV9 B;  4JJN A;  5B0Y C;  3REH A;  4J8X D;  5CPI C;  3TU4 B;  4H9S C;  4J8W B;  2FJ7 C;  4J8U B;  5AV5 A;  1HQ3 D;  3VH5 W;  3LEL C;  1P3F A;  3W98 C;  5B32 D;  5CHL B;  1P3I C;  2F8N H;  5B33 A;  1P3B D;  3AYW D;  1KX4 D;  2RVQ C;  4Z66 B;  3KWQ B;  3WTP A;  4J8W A;  4YS3 D;  1P3F B;  3AZL A;  4UUZ B;  4X23 C;  3KXB A;  3REI D;  5B40 C;  1AOI A;  4HGA C;  3X1V B;  1Q9C A;  4KGC B;  3AZE A;  1S32 A;  4WV4 B;  4DRA A;  3AZG A;  1M18 A;  4R8P B;  3MVD A;  3TU4 C;  4YS3 B;  1TAF A;  1ULY A;  3W99 B;  4XUJ B;  2F8N D;  3MGS A;  1P3G D;  1KX4 B;  4H9O A;  3WA9 A;  5B1L D;  3LZ1 B;  3REK A;  3B6G C;  4Z2M G;  3MGR B;  1JFI B;  3AZM A;  1N1J A;  4KHA B;  1F1E A;  4CSR A;  3C1C A;  5GSU D;  5F99 C;  1KX4 A;  3X1T B;  3AYW A;  1P3O C;  5B1M C;  5JRG C;  1H3O B;  1U35 B;  1P3M B;  3AZF C;  5AV9 D;  5B2I B;  5DNN C;  3AV2 B;  1EQZ B;  2PYO D;  3X1S A;  5CPJ A;  5B24 A;  1F66 B;  3WAA C;  5CPK C;  1P3M D;  3AZI D;  2ARO B;  1BH9 B;  5B0Z C;  3R45 B;  5B31 B;  5C3I C;  1EQZ D;  2PYO B;  3REI A;  1ID3 C;  2HIO A;  4XZQ B;  1P34 B;  5B32 B;  5AVC C;  3UTA A;  3AV2 D;  4G91 C;  2NZD B;  5G49 A;  2F8N K;  3KUY D;  2CV5 D;  5AV6 D;  3MGS D;  3A6N C;  4LD9 C;  3B6G D;  3WA9 D;  4WU9 A;  2NZD A;  5JA4 A;  5B2J A;  1P3L B;  3AZJ B;  3UTB A;  3O62 B;  5AV5 B;  5DNM B;  3VH6 A;  4NE6 A;  3REH C;  3WKJ D;  3REH B;  3AZK C;  3W96 B;  5DNN D;  4H9S A;  3MNN B;  3AZH B;  5AV5 C;  1KX5 D;  3REJ B;  3C1B C;  5AVC B;  1P3A B;  3VH5 T;  3X1S D;  3NQJ B;  1P3L C;  3V9R B;  5E5A B;  5B33 C;  1P3O D;  2YFV A;  3AV2 A;  3A6N B;  2ARO C;  4LD9 B;  3B6F D;  3LJA D;  5AV6 A;  3AZL C;  4X23 A;  1ID3 D;  3AZL B;  3AZN C;  4J8W D;  3AYW B;  4J8X A;  4WNN B;  4E45 A;  5GT0 A;  3UT9 A;  4Z5T A;  5B33 B;  3UTA D;  1M18 C;  3O62 A;  5DNM A;  5BT1 C;  1P3M C;  3MGP B;  1ID3 B;  4QLC A;  3MGQ A;  2NQB D;  2F8N B;  5F99 B;  4DRB A;  3WKJ A;  1P34 D;  3B6F C;  5CPK B;  1KX3 A;  3B6G A;  5B1M D;  4J8V C;  3MGR D;  2BYM A;  5B31 G;  1M1A A;  4CAY A;  3C1C C;  4CSR B;  5KDM A;  5F99 A;  1KX4 C;  2NQB B;  1P3K D;  3AFA A;  5JRG A;  3W99 C;  1P3A C;  5AV8 D;  4R8P D;  5CP6 A;  5B1M B;  3AZJ A;  5DNN A;  5GT3 C;  3MNN C;  3AZH C;  3W96 C;  3LZ0 D;  3X1S C;  3VH6 W;  5B31 A;  5B1L A;  3AZI C;  1P3L D;  5B24 C;  5B0Y D;  4ZBJ B;  3MGR C;  3X1T D;  5B2I D;  3TU4 D;  2HUE C;  1H3O A;  4QLC D;  3MGQ D;  3AN2 B;  1U35 A;  4M6B A;  3AZG B;  3VH6 T;  5BNX A;  4XUJ C;  5B0Z B;  2HIO C;  1P34 A;  5FUG B;  4R8P C;  1KU5 A;  5GT0 D;  3UT9 D;  3UTA C;  3W96 D;  3LZ0 C;  3AV1 A;  1F66 C;  2YFW A;  3WTP B;  1HTA A;  3A6N D;  4LD9 D;  3X1V D;  5GXQ C;  1P3P C;  3KUY B;  4NE5 A;  3AZF B;  5B32 C;  1P3B A;  5AVB C;  5AY8 C;  1BH8 B;  2HIO D;  3NQU B;  5BS7 C;  1TZY C;  3AZK D;  3W97 A;  1HQ3 A;  5B2I A;  1P3G C;  5CPK D;  3AN2 A;  5AV5 D;  1KX5 C;  3B6G B;  5B0Z D;  1U35 D;  1B6W A;  1EQZ C;  3MVD D;  4ZUX C;  1JFI A;  1AOI B;  3AZJ D;  5GSU B;  3B0D B;  3WTP D;  1P3L A;  2F8N G;  5AV6 B;  5AY8 D;  3LJA C;  3AZE D;  3X1T C;  1M19 A;  3AZN D;  3WA9 B;  4G92 C;  3AZF D;  3REL B;  5BO0 A;  2CV5 C;  5AV6 C;  3LJA B;  5GT3 D;  5E5A D;  3LEL A;  1P3F C;  5GSU C;  3REJ A;  4Z66 C;  3KWQ C;  1BH8 A;  5GT0 C;  4XZQ D;  5GXQ B;  1P3P B;  4ZUX D;  2F8N A;  5AV8 B;  1F66 D;  3VH5 A;  3WTP C;  3REK D;  3LZ0 B;  1KX5 B;  5BNV B;  3LEL B;  1P3G B;  3MGP A;  4J8V D;  4H9R A;  3B6F A;  2NQB A;  3X1U D;  5AY8 B;  3AZG C;  1KX3 C;  5GT0 B;  5CPI A; 
#chains in the Genus database with same CATH topology
 5BNV A;  2BYM B;  4NFT A;  2FJ7 A;  1M1A C;  3KUY C;  3W98 A;  2CV5 B;  2YFV B;  5GXQ D;  1P3P D;  3MGS C;  4G92 B;  3W99 A;  3WA9 C;  4WU8 B;  1P3A A;  5F99 D;  5B24 D;  2VQR A;  3UTA B;  5E5A A;  3LEL D;  1A7W A;  5JRG D;  4J8W C;  2FJ7 B;  2XD1 A;  3AZM C;  5GT3 A;  2HIO B;  4XZQ A;  3KXB C;  3REJ D;  1AOI C;  1ZLA D;  3IP4 C;  5CP6 D;  4H9N A;  3AZE C;  3X1U B;  3REH D;  3C1C B;  1M19 D;  4NE3 A;  4ZBJ C;  3MVD C;  3C1B D;  2BG1 A;  4Z5T B;  3TU4 A;  3B6F B;  2L5A A;  5CPJ C;  3X1U A;  4R8P A;  4KGC D;  4YS3 A;  5AVB B;  4H9P B;  3B0D C;  3REK C;  1F66 A;  4WU9 D;  1AOI D;  1ZLA C;  4YM6 D;  3AZL D;  4E44 A;  4WU8 A;  3B0C W;  5GXQ A;  1P3P A;  3MGP D;  3NQU A;  3NQJ A;  1P3B C;  1M19 B;  3AYW C;  1P3O A;  3X1V A;  5AVB A;  5B33 D;  2RVQ D;  4J8U D;  5BO0 B;  1TZY B;  4WZS B;  5B1L B;  4Z2M H;  3LZ1 D;  4H9R B;  3EPK A;  1HQ3 C;  3W98 D;  1TAF B;  3AN2 C;  3AV1 D;  2HUE B;  4YM6 C;  1B67 A;  3A6N A;  3WAA A;  2G5H C;  4LD9 A;  5CPK A;  2BYK B;  3FDD A;  3AZK B;  5B0Z A;  3AZI B;  2IO5 C;  4JJN B;  3X1S B;  5BT1 D;  4KGC A;  1P3K B;  2ZY3 A;  4X23 D;  3REI C;  3UTB C;  4UUZ A;  1ID3 A;  3LJA A;  4KUD C;  2DF4 C;  5AV9 A;  5AVC A;  3WKJ B;  3KFU G;  1S32 B;  2PYO A;  3B0C T;  3AZK A;  3REL A;  5CP6 B;  4QLC B;  3MGQ B;  3AN2 D;  3AZM D;  1N1J B;  4H9Q B;  4KHA A;  3C1B A;  3AV1 B;  2ARO D;  3C1C D;  2ZY2 A;  5GSU A;  3REJ C;  3KSY A;  4Z66 A;  4H9O B;  5B32 G;  3KWQ A;  3AFA B;  4J8U A;  1P3K C;  5B24 B;  3LZ1 A;  5AV8 A;  4JJN D;  2NZD C;  4J8X B;  4G91 B;  5GT3 B;  5KDM B;  1WWI A;  5B2J C;  4XUJ D;  3MGP C;  3AZN A;  4EO5 B;  1M18 B;  1M1A D;  3WAA D;  3UT9 C;  3AFA D;  2NQB C;  2ZY4 A;  2XD5 A;  1P3M A;  2CWE A;  4J8V B;  2Y2L A;  3KUY A;  3UTB B;  3REI B;  2IO5 B;  4JJN C;  5B0Y A;  3AV2 C;  5E5A C;  1P3F D;  3R45 A;  2ARO A;  3EPL A;  2YFW B;  4J8V A;  1TZY D;  1P3A D;  4Z66 D;  3KWQ D;  4XZQ C;  1HQ3 B;  5B2J B;  5FUG A;  1BFM A;  1P3O B;  4H9N B;  1P3I A;  4J8X C;  2FJ7 D;  4Z5T C;  3AZN B;  3MVD B;  5DNM C;  3O62 C;  3AZJ C;  3REL D;  4H9P A;  3W96 A;  5B40 A;  4QLC C;  3MGQ C;  3A1I A;  3X1U C;  3AZG D;  3AZE B;  3UT9 B;  2Y2N A;  3UTB D;  2FFF B;  1BH9 A;  1S32 C;  3WKJ C;  2JSS A;  4EO5 C;  4YS3 C;  4H9Q A;  3C1B B;  1U35 C;  1ZLA A;  4KUD B;  5JA4 B;  4WU8 C;  2LY8 A;  4XUJ A;  4Z5T D;  3MGS B;  3W97 D;  3AFA C;  3X1V C;  5DNM D;  3O62 D;  4YM6 B;  3AV1 C;  5AVB D;  5CP6 C;  3EG5 B;  3MNN A;  3AZH A;  3KXB B;  5B31 C;  5G49 B;  5B1L C;  3V9R A;  3AZI A;  2ZY5 A;  1P3I D;  5B1M A;  4YM6 A;  3MGR A;  1KX3 D;  3WAA B;  5AY8 A;  4WU8 D;  3AZF A;  1P3B B;  5CPJ D;  5CPI B;  5BS7 A;  1TZY A;  4HGA B;  4KGC C;  5B0Y B;  4X23 B;  5B2I C;  1M1A B;  1ZLA B;  4KUD A;  1WWS A;  1P34 C;  5AV9 C;  1KX3 B;  5JRG B;  5BNX B;  2PYO C;  3LZ0 A;  4AWL B;  1EQZ A;  2DQN C;  5C3I B;  3REL C;  5B31 D;  4ZUX A;  2JCH A;  5CPJ B;  3KXB D;  1P3I B;  4CAY B;  2BYK A;  2NZD D;  3W98 B;  5B40 D;  4J8U C;  5B2J D;  5B32 A;  3W99 D;  1P3K A;  3X1T A;  1M19 C;  2Y2O A;  3LZ1 C;  5AV8 C;  3B0B A;  4ZUX B;  1R4V A;  5DNN B;  3MNN D;  3AZH D;  2CV5 A;  3REK B;  5CPI D;  5AVC D;  3WTP E;  3AZM B;  1P3G A;  3W97 C;  1KX5 A;  1S32 D;  4WU9 B;  4WU9 C;  4WNN A;  1Z2C B;  1PZR A;  4AWL C;  4KUD D;  5B40 B;  3W97 B;  1M18 D;  5AV9 B;  4JJN A;  5B0Y C;  3REH A;  4J8X D;  5CPI C;  3TU4 B;  4H9S C;  4J8W B;  2FJ7 C;  4J8U B;  5AV5 A;  1HQ3 D;  2Y2I A;  2Y2Q A;  3VH5 W;  3LEL C;  1P3F A;  3W98 C;  5B32 D;  5CHL B;  1P3I C;  2F8N H;  5B33 A;  1P3B D;  3AYW D;  1KX4 D;  2RVQ C;  4Z66 B;  3KWQ B;  3WTP A;  4J8W A;  4YS3 D;  1P3F B;  3AZL A;  4UUZ B;  4X23 C;  3KXB A;  3REI D;  5B40 C;  1AOI A;  4HGA C;  3X1V B;  1Q9C A;  4KGC B;  3AZE A;  1S32 A;  4WV4 B;  4DRA A;  3AZG A;  4WJ3 C;  1M18 A;  4R8P B;  3MVD A;  2G5I C;  3TU4 C;  4YS3 B;  1TAF A;  1ULY A;  3W99 B;  4XUJ B;  2F8N D;  3MGS A;  1P3G D;  1KX4 B;  4H9O A;  3WA9 A;  5B1L D;  3LZ1 B;  3REK A;  3B6G C;  4Z2M G;  3MGR B;  1JFI B;  3AZM A;  1N1J A;  4KHA B;  1F1E A;  4CSR A;  3C1C A;  5GSU D;  5F99 C;  1KX4 A;  3X1T B;  3AYW A;  1P3O C;  5B1M C;  5JRG C;  1H3O B;  1U35 B;  1P3M B;  3AZF C;  5AV9 D;  5B2I B;  5DNN C;  3AV2 B;  1EQZ B;  2PYO D;  3X1S A;  5CPJ A;  5B24 A;  1F66 B;  3A1K A;  3WAA C;  3H0M C;  5CPK C;  1P3M D;  2Y2H A;  2ARO B;  1BH9 B;  5B0Z C;  3R45 B;  5B31 B;  3AZI D;  5C3I C;  1EQZ D;  4UPK A;  3REI A;  1ID3 C;  2PYO B;  2HIO A;  4XZQ B;  1P34 B;  5B32 B;  5AVC C;  3UTA A;  3AV2 D;  4G91 C;  2NZD B;  5G49 A;  1W2E A;  2F8N K;  2W8S A;  3KUY D;  2J8P A;  2CV5 D;  5AV6 D;  3MGS D;  3A6N C;  4LD9 C;  3B6G D;  3WA9 D;  4WU9 A;  2NZD A;  5JA4 A;  5B2J A;  1P3L B;  3AZJ B;  3UTB A;  3O62 B;  5AV5 B;  5DNM B;  3VH6 A;  4NE6 A;  3REH C;  3WKJ D;  3REH B;  3AZK C;  3W96 B;  5DNN D;  4H9S A;  3MNN B;  3AZH B;  5AV5 C;  1KX5 D;  3REJ B;  3C1B C;  5AVC B;  1P3A B;  3VH5 T;  3X1S D;  3NQJ B;  1P3L C;  3V9R B;  5E5A B;  5B33 C;  1P3O D;  2Y2M A;  2YFV A;  3AV2 A;  3A6N B;  2ARO C;  4LD9 B;  1T3U A;  3B6F D;  3LJA D;  5AV6 A;  3AZL C;  4X23 A;  1ID3 D;  3AZL B;  3AZN C;  4J8W D;  3AYW B;  4J8X A;  4WNN B;  4E45 A;  5GT0 A;  3H0L C;  3UT9 A;  4DQY B;  4Z5T A;  5B33 B;  2ZM5 A;  3UTA D;  1M18 C;  5DNM A;  3O62 A;  5BT1 C;  1P3M C;  2Y2G A;  3MGP B;  2F2A C;  1ID3 B;  4QLC A;  3MGQ A;  2NQB D;  2F8N B;  5F99 B;  3F6T A;  4DRB A;  3WKJ A;  1P34 D;  3B6F C;  5CPK B;  1KX3 A;  3B6G A;  5B1M D;  4J8V C;  3MGR D;  2BYM A;  5B31 G;  1M1A A;  4CAY A;  3C1C C;  2JE5 A;  4CSR B;  5KDM A;  5F99 A;  1KX4 C;  2NQB B;  1P3K D;  3AFA A;  5JRG A;  3W99 C;  1P3A C;  5AV8 D;  4R8P D;  2Y2P A;  5CP6 A;  5B1M B;  3AZJ A;  5DNN A;  5GT3 C;  3MNN C;  3AZH C;  3W96 C;  3LZ0 D;  3X1S C;  3VH6 W;  5B31 A;  5B1L A;  3AZI C;  1P3L D;  5B24 C;  5B0Y D;  4ZBJ B;  3MGR C;  3X1T D;  5B2I D;  3TU4 D;  2HUE C;  1H3O A;  4QLC D;  3MGQ D;  3EPJ A;  3AN2 B;  1U35 A;  4M6B A;  3AZG B;  3VH6 T;  5BNX A;  4XUJ C;  5B0Z B;  2HIO C;  1P34 A;  5FUG B;  4R8P C;  3EPH A;  1KU5 A;  5GT0 D;  3UT9 D;  3UTA C;  3W96 D;  3LZ0 C;  3AV1 A;  1F66 C;  2YFW A;  3WTP B;  1HTA A;  3A6N D;  4LD9 D;  3X1V D;  5GXQ C;  1P3P C;  3KUY B;  4NE5 A;  3AZF B;  5B32 C;  1P3B A;  5AVB C;  2Y2K A;  2Y2J A;  5AY8 C;  1BH8 B;  2HIO D;  3NQU B;  5BS7 C;  1TZY C;  3P5J B;  3AZK D;  3W97 A;  1HQ3 A;  5B2I A;  1P3G C;  5CPK D;  3AN2 A;  5AV5 D;  1KX5 C;  3B6G B;  5B0Z D;  1U35 D;  1B6W A;  1EQZ C;  3MVD D;  4ZUX C;  1JFI A;  1AOI B;  3AZJ D;  5GSU B;  3B0D B;  3WTP D;  3AL0 C;  1P3L A;  2F8N G;  5AV6 B;  5AY8 D;  3LJA C;  3AZE D;  3X1T C;  1M19 A;  3AZN D;  3WA9 B;  4G92 C;  3AZF D;  3REL B;  5BO0 A;  2CV5 C;  5AV6 C;  3LJA B;  3H0R C;  5GT3 D;  5E5A D;  3LEL A;  1P3F C;  5GSU C;  3REJ A;  4Z66 C;  3KWQ C;  1BH8 A;  5GT0 C;  4XZQ D;  5GXQ B;  1P3P B;  4ZUX D;  2F8N A;  2RIQ A;  5AV8 B;  1F66 D;  3VH5 A;  3WTP C;  2UWX A;  3REK D;  3LZ0 B;  1KX5 B;  5BNV B;  3LEL B;  1P3G B;  3MGP A;  4J8V D;  4H9R A;  3B6F A;  2NQB A;  3X1U D;  5AY8 B;  3AZG C;  1KX3 C;  5GT0 B;  5CPI A; 
#chains in the Genus database with same CATH homology
 5BNV A;  2BYM B;  4NFT A;  2FJ7 A;  1M1A C;  3KUY C;  3W98 A;  2CV5 B;  2YFV B;  5GXQ D;  1P3P D;  3MGS C;  4G92 B;  3W99 A;  3WA9 C;  4WU8 B;  1P3A A;  5F99 D;  5B24 D;  2VQR A;  3UTA B;  5E5A A;  3LEL D;  1A7W A;  5JRG D;  4J8W C;  2FJ7 B;  2XD1 A;  3AZM C;  5GT3 A;  2HIO B;  4XZQ A;  3KXB C;  3REJ D;  1AOI C;  1ZLA D;  3IP4 C;  5CP6 D;  4H9N A;  3AZE C;  3X1U B;  3REH D;  3C1C B;  1M19 D;  4NE3 A;  4ZBJ C;  3MVD C;  3C1B D;  2BG1 A;  4Z5T B;  3TU4 A;  3B6F B;  2L5A A;  5CPJ C;  3X1U A;  4R8P A;  4KGC D;  4YS3 A;  5AVB B;  4H9P B;  3B0D C;  3REK C;  1F66 A;  4WU9 D;  1AOI D;  1ZLA C;  4YM6 D;  3AZL D;  4E44 A;  4WU8 A;  3B0C W;  5GXQ A;  1P3P A;  3MGP D;  3NQU A;  3NQJ A;  1P3B C;  1M19 B;  3AYW C;  1P3O A;  3X1V A;  5AVB A;  5B33 D;  2RVQ D;  4J8U D;  5BO0 B;  1TZY B;  4WZS B;  5B1L B;  4Z2M H;  3LZ1 D;  4H9R B;  3EPK A;  1HQ3 C;  3W98 D;  1TAF B;  3AN2 C;  3AV1 D;  2HUE B;  4YM6 C;  1B67 A;  3A6N A;  3WAA A;  2G5H C;  4LD9 A;  5CPK A;  2BYK B;  3FDD A;  3AZK B;  5B0Z A;  3AZI B;  2IO5 C;  4JJN B;  3X1S B;  5BT1 D;  4KGC A;  1P3K B;  2ZY3 A;  4X23 D;  3REI C;  3UTB C;  4UUZ A;  1ID3 A;  3LJA A;  4KUD C;  2DF4 C;  5AV9 A;  5AVC A;  3WKJ B;  3KFU G;  1S32 B;  2PYO A;  3B0C T;  3AZK A;  3REL A;  5CP6 B;  4QLC B;  3MGQ B;  3AN2 D;  3AZM D;  1N1J B;  4H9Q B;  4KHA A;  3C1B A;  3AV1 B;  2ARO D;  3C1C D;  2ZY2 A;  5GSU A;  3REJ C;  3KSY A;  4Z66 A;  4H9O B;  5B32 G;  3KWQ A;  3AFA B;  4J8U A;  1P3K C;  5B24 B;  3LZ1 A;  5AV8 A;  4JJN D;  2NZD C;  4J8X B;  4G91 B;  5GT3 B;  5KDM B;  1WWI A;  5B2J C;  4XUJ D;  3MGP C;  3AZN A;  4EO5 B;  1M18 B;  1M1A D;  3WAA D;  3UT9 C;  3AFA D;  2NQB C;  2ZY4 A;  2XD5 A;  1P3M A;  2CWE A;  4J8V B;  2Y2L A;  3KUY A;  3UTB B;  3REI B;  2IO5 B;  4JJN C;  5B0Y A;  3AV2 C;  5E5A C;  1P3F D;  3R45 A;  2ARO A;  3EPL A;  2YFW B;  4J8V A;  1TZY D;  1P3A D;  4Z66 D;  3KWQ D;  4XZQ C;  1HQ3 B;  5B2J B;  5FUG A;  1BFM A;  1P3O B;  4H9N B;  1P3I A;  4J8X C;  2FJ7 D;  4Z5T C;  3AZN B;  3MVD B;  5DNM C;  3O62 C;  3AZJ C;  3REL D;  4H9P A;  3W96 A;  5B40 A;  4QLC C;  3MGQ C;  3A1I A;  3X1U C;  3AZG D;  3AZE B;  3UT9 B;  2Y2N A;  3UTB D;  2FFF B;  1BH9 A;  1S32 C;  3WKJ C;  2JSS A;  4EO5 C;  4YS3 C;  4H9Q A;  3C1B B;  1U35 C;  1ZLA A;  4KUD B;  5JA4 B;  4WU8 C;  2LY8 A;  4XUJ A;  4Z5T D;  3MGS B;  3W97 D;  3AFA C;  3X1V C;  5DNM D;  3O62 D;  4YM6 B;  3AV1 C;  5AVB D;  5CP6 C;  3EG5 B;  3MNN A;  3AZH A;  3KXB B;  5B31 C;  5G49 B;  5B1L C;  3V9R A;  3AZI A;  2ZY5 A;  1P3I D;  5B1M A;  4YM6 A;  3MGR A;  1KX3 D;  3WAA B;  5AY8 A;  4WU8 D;  3AZF A;  1P3B B;  5CPJ D;  5CPI B;  5BS7 A;  1TZY A;  4HGA B;  4KGC C;  5B0Y B;  4X23 B;  5B2I C;  1M1A B;  1ZLA B;  4KUD A;  1WWS A;  1P34 C;  5AV9 C;  1KX3 B;  5JRG B;  5BNX B;  2PYO C;  3LZ0 A;  4AWL B;  1EQZ A;  2DQN C;  5C3I B;  3REL C;  5B31 D;  4ZUX A;  2JCH A;  5CPJ B;  3KXB D;  1P3I B;  4CAY B;  2BYK A;  2NZD D;  3W98 B;  5B40 D;  4J8U C;  5B2J D;  5B32 A;  3W99 D;  1P3K A;  3X1T A;  1M19 C;  2Y2O A;  3LZ1 C;  5AV8 C;  3B0B A;  4ZUX B;  1R4V A;  5DNN B;  3MNN D;  3AZH D;  2CV5 A;  3REK B;  5CPI D;  5AVC D;  3WTP E;  3AZM B;  1P3G A;  3W97 C;  1KX5 A;  1S32 D;  4WU9 B;  4WU9 C;  4WNN A;  1Z2C B;  1PZR A;  4AWL C;  4KUD D;  5B40 B;  3W97 B;  1M18 D;  5AV9 B;  4JJN A;  5B0Y C;  3REH A;  4J8X D;  5CPI C;  3TU4 B;  4H9S C;  4J8W B;  2FJ7 C;  4J8U B;  5AV5 A;  1HQ3 D;  2Y2I A;  2Y2Q A;  3VH5 W;  3LEL C;  1P3F A;  3W98 C;  5B32 D;  5CHL B;  1P3I C;  2F8N H;  5B33 A;  1P3B D;  3AYW D;  1KX4 D;  2RVQ C;  4Z66 B;  3KWQ B;  3WTP A;  4J8W A;  4YS3 D;  1P3F B;  3AZL A;  4UUZ B;  4X23 C;  3KXB A;  3REI D;  5B40 C;  1AOI A;  4HGA C;  3X1V B;  1Q9C A;  4KGC B;  3AZE A;  1S32 A;  4WV4 B;  4DRA A;  3AZG A;  4WJ3 C;  1M18 A;  4R8P B;  3MVD A;  2G5I C;  3TU4 C;  4YS3 B;  1TAF A;  1ULY A;  3W99 B;  4XUJ B;  2F8N D;  3MGS A;  1P3G D;  1KX4 B;  4H9O A;  3WA9 A;  5B1L D;  3LZ1 B;  3REK A;  3B6G C;  4Z2M G;  3MGR B;  1JFI B;  3AZM A;  1N1J A;  4KHA B;  1F1E A;  4CSR A;  3C1C A;  5GSU D;  5F99 C;  1KX4 A;  3X1T B;  3AYW A;  1P3O C;  5B1M C;  5JRG C;  1H3O B;  1U35 B;  1P3M B;  3AZF C;  5AV9 D;  5B2I B;  5DNN C;  3AV2 B;  1EQZ B;  2PYO D;  3X1S A;  5CPJ A;  5B24 A;  1F66 B;  3A1K A;  3WAA C;  3H0M C;  5CPK C;  1P3M D;  2Y2H A;  2ARO B;  1BH9 B;  5B0Z C;  3R45 B;  5B31 B;  3AZI D;  5C3I C;  1EQZ D;  4UPK A;  3REI A;  1ID3 C;  2PYO B;  2HIO A;  4XZQ B;  1P34 B;  5B32 B;  5AVC C;  3UTA A;  3AV2 D;  4G91 C;  2NZD B;  5G49 A;  1W2E A;  2F8N K;  2W8S A;  3KUY D;  2J8P A;  2CV5 D;  5AV6 D;  3MGS D;  3A6N C;  4LD9 C;  3B6G D;  3WA9 D;  4WU9 A;  2NZD A;  5JA4 A;  5B2J A;  1P3L B;  3AZJ B;  3UTB A;  3O62 B;  5AV5 B;  5DNM B;  3VH6 A;  4NE6 A;  3REH C;  3WKJ D;  3REH B;  3AZK C;  3W96 B;  5DNN D;  4H9S A;  3MNN B;  3AZH B;  5AV5 C;  1KX5 D;  3REJ B;  3C1B C;  5AVC B;  1P3A B;  3VH5 T;  3X1S D;  3NQJ B;  1P3L C;  3V9R B;  5E5A B;  5B33 C;  1P3O D;  2Y2M A;  2YFV A;  3AV2 A;  3A6N B;  2ARO C;  4LD9 B;  1T3U A;  3B6F D;  3LJA D;  5AV6 A;  3AZL C;  4X23 A;  1ID3 D;  3AZL B;  3AZN C;  4J8W D;  3AYW B;  4J8X A;  4WNN B;  4E45 A;  5GT0 A;  3H0L C;  3UT9 A;  4DQY B;  4Z5T A;  5B33 B;  2ZM5 A;  3UTA D;  1M18 C;  5DNM A;  3O62 A;  5BT1 C;  1P3M C;  2Y2G A;  3MGP B;  2F2A C;  1ID3 B;  4QLC A;  3MGQ A;  2NQB D;  2F8N B;  5F99 B;  3F6T A;  4DRB A;  3WKJ A;  1P34 D;  3B6F C;  5CPK B;  1KX3 A;  3B6G A;  5B1M D;  4J8V C;  3MGR D;  2BYM A;  5B31 G;  1M1A A;  4CAY A;  3C1C C;  2JE5 A;  4CSR B;  5KDM A;  5F99 A;  1KX4 C;  2NQB B;  1P3K D;  3AFA A;  5JRG A;  3W99 C;  1P3A C;  5AV8 D;  4R8P D;  2Y2P A;  5CP6 A;  5B1M B;  3AZJ A;  5DNN A;  5GT3 C;  3MNN C;  3AZH C;  3W96 C;  3LZ0 D;  3X1S C;  3VH6 W;  5B31 A;  5B1L A;  3AZI C;  1P3L D;  5B24 C;  5B0Y D;  4ZBJ B;  3MGR C;  3X1T D;  5B2I D;  3TU4 D;  2HUE C;  1H3O A;  4QLC D;  3MGQ D;  3EPJ A;  3AN2 B;  1U35 A;  4M6B A;  3AZG B;  3VH6 T;  5BNX A;  4XUJ C;  5B0Z B;  2HIO C;  1P34 A;  5FUG B;  4R8P C;  3EPH A;  1KU5 A;  5GT0 D;  3UT9 D;  3UTA C;  3W96 D;  3LZ0 C;  3AV1 A;  1F66 C;  2YFW A;  3WTP B;  1HTA A;  3A6N D;  4LD9 D;  3X1V D;  5GXQ C;  1P3P C;  3KUY B;  4NE5 A;  3AZF B;  5B32 C;  1P3B A;  5AVB C;  2Y2K A;  2Y2J A;  5AY8 C;  1BH8 B;  2HIO D;  3NQU B;  5BS7 C;  1TZY C;  3P5J B;  3AZK D;  3W97 A;  1HQ3 A;  5B2I A;  1P3G C;  5CPK D;  3AN2 A;  5AV5 D;  1KX5 C;  3B6G B;  5B0Z D;  1U35 D;  1B6W A;  1EQZ C;  3MVD D;  4ZUX C;  1JFI A;  1AOI B;  3AZJ D;  5GSU B;  3B0D B;  3WTP D;  3AL0 C;  1P3L A;  2F8N G;  5AV6 B;  5AY8 D;  3LJA C;  3AZE D;  3X1T C;  1M19 A;  3AZN D;  3WA9 B;  4G92 C;  3AZF D;  3REL B;  5BO0 A;  2CV5 C;  5AV6 C;  3LJA B;  3H0R C;  5GT3 D;  5E5A D;  3LEL A;  1P3F C;  5GSU C;  3REJ A;  4Z66 C;  3KWQ C;  1BH8 A;  5GT0 C;  4XZQ D;  5GXQ B;  1P3P B;  4ZUX D;  2F8N A;  2RIQ A;  5AV8 B;  1F66 D;  3VH5 A;  3WTP C;  2UWX A;  3REK D;  3LZ0 B;  1KX5 B;  5BNV B;  3LEL B;  1P3G B;  3MGP A;  4J8V D;  4H9R A;  3B6F A;  2NQB A;  3X1U D;  5AY8 B;  3AZG C;  1KX3 C;  5GT0 B;  5CPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...