3W97B

Crystal structure of human nucleosome core particle lacking h2b n-terminal region
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 23
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w97B00
3REID 1N1JA 5B40D 1P3LD 3AFAB 4R8PA 3KWQC 3MGQB 4KGCB 1AOID 4J8VD 4G91C 4YS3D 4QLCC 1P3BC 1HQ3A 3LZ1D 1P3GC 1KU5A 2BYMA 2F8NB 1EQZB 3W98A 3AZJD 1S32D 3C1CD 1P3OA 4J8UB 2AROC 1M19A 4YM6D 5B33B 4X23C 5CPKA 2NQBC 5GT0B 3UTAA 3WA9A 4H9NA 2FJ7B 5FUGB 3VH6T 4J8XB 3KUYC 4Z66D 3REJD 3AZIB 4XZQB 4HGAB 3X1UB 1TZYB 1M18C 1AOIC 3MNNA 4J8VC 5DNMB 1P3AC 3X1SD 3MGSB 3AZHA 4H9PB 2YFWB 5AV5B 2YFVB 3LZ1C 4AWLC 3AN2A 2CV5A 3VH6W 3UT9A 5BS7A 3AZJC 1ZLAB 3MGPA 3A6ND 3C1CC 4JJNA 5B1LB 4WU8C 1U35B 4YM6C 5G49B 3KXBA 2NZDB 4J8WB 1M1AA 1HQ3D 3B6FB 2F8NG 1H3OB 4Z66C 2HIOD 3AFAC 3REJC 3VH5W 3B0DB 5B0ZA 5GXQA 3W98D 3V9RA 5BNVA 4H9RA 1ULYA 1P3OD 5GSUB 5B32B 1M19D 3B0CT 3X1VA 5CP6C 5CPKD 3X1SC 2JSSA 4LD9B 1Q9CA 3REHD 3UTAD 3WA9D 5B24A 3REKA 5AY8D 5CPJA 1KX5A 4WU9A 4NE3A 4NE6A 5GT3A 1KX3A 5B1MB 5JA4B 1P3KB 3A6NC 5B33C 3WAAA 3R45A 2BYKA 5AV6B 3AV2B 3MNND 1BH9A 4NFTA 3AZHD 1JFIA 3UTBD 3WKJD 1P3PB 5JRGA 3KWQB 3X1UC 3O62B 3AN2D 4KUDA 2CV5D 2HIOC 4QLCB 3AZKC 1P3BB 5AV8D 5DNMC 4JJND 3TU4B 5DNNB 3MVDA 1P3GB 4ZBJC 5CPKC 3REHC 3UTAC 1M1AD 1KX4A 1P3MD 5AY8C 2AROB 4ZUXA 1WWIA 4X23B 5B1LC 2NQBB 5GXQD 4UUZB 1F66A 5B32G 5BT1D 5B40B 3AYWA 5AVBD 3AZHC 3UTBC 3WKJC 5B24D 5CPJD 1M18B 1AOIB 4J8VB 4WU9D 5KDMB 1BH8A 5GSUC 5AV8C 5GT3D 1ID3D 3WAAD 3LZ1B 4AWLB 1P3FA 3MGRA 3C1BA 3RELA 3AZJB 1S32B 3C1CB 1M1AC 4CAYA 4WU8B 1P3MC 5JRGD 1P3KC 4YM6B 3LZ0A 3NQJB 4KGCA 3MVDD 3X1TD 4Z66B 3REJB 1P3PC 3O62C 5AVBC 3MGQA 4ZUXD 4E45A 5CP6B 3X1SB 3TU4C 5CPIA 5GT3C 5DNNC 1ID3C 3WAAC 5F99A 3B6GA 3WTPA 4KHAB 5B31A 1EQZA 3LJAD 4H9OB 3A6NB 3AYWD 3AZFA 5JRGC 3LELC 4H9QA 3AZNA 5FUGA 3REIC 5B40C 1P3FD 3AZIA 3X1TC 4XZQA 2HIOB 5B2JD 3AZKB 1P3LC 3C1BD 3W98B 3RELD 1TZYA 3NQUA 4XUJA 4YS3C 3W97A 1M19B 3LZ0D 5AV9A 4ZBJB 5CPKB 3MGSA 4H9PA 2YFWA 5AV5A 3REHB 3UTAB 3AZMD 3WA9B 5AY8B 1S32C 1P34A 3LJAC 5BNXB 4R8PD 4Z5TA 3MGQD 1U35A 4CSRB 2NZDA 4J8WA 3AZGA 5CPID 2IO5C 3AZHB 3UTBB 3WKJB 5F99D 3B6GD 3AN2B 3B6FA 3W99A 3WTPD 1H3OA 5BO0B 5B31D 1P3FC 5B2JC 3C1BC 5AV8B 3AZFD 5AVCA 3AZND 4LD9A 3AZMC 1M1AB 1P3MB 3AZLA 3AZEA 3AZID 4XZQD 5B1MA 4R8PC 3V9RB 5BNVB 4H9RB 5B2IA 4XUJD 3B0CW 3W97D 1HQ3C 5AV9D 1R4VA 5E5AA 5AVBB 5B24B 5C3IB 3UT9D 5CPJB 3W98C 3B6GC 3MGPD 4QLCA 1P3BA 1P3OC 2F8NH 1P34D 1M19C 5GT3B 1ID3B 3WAAB 4Z5TD 3R45B 2RVQD 3AZFC 4H9SA 2BYKB 3KXBD 4WV4B 1U35D 1P3GA 3WA9C 3W96A 1BH9B 1P3IA 3AZGD 1JFIB 2AROA 1WWSA 5JRGB 5B0ZD 3W99D 4X23A 3LELB 2NQBA 2PYOA 2CWEA 3MNNC 3X1VD 4XUJC 3REIB 3KUYA 3KSYA 3W97C 3MVDB 3X1TB 5AVCD 1P3LB 3REKD 4M6BA 4WNNB 1KX5D 5AV9C 3AN2C 4G92B 2CV5C 4YS3B 3UT9C 1M18A 5BS7C 4J8VA 4NE5A 4ZUXB 3MGPC 5KDMA 3AZLD 1P3AA 1KX3D 4JJNC 1B67A 3AZED 1P34C 5B1MD 4Z2MH 4Z5TC 5B2ID 3KXBC 3LJAB 4KUDD 3C1CA 5B0YA 4WU8A 5E5AD 5GXQC 5B0ZC 4YM6A 3W99C 2LY8A 2IO5B 3AV1A 3X1VC 5BT1C 1P3GD 1P3FB 3AFAA 3REJA 5AVCC 5B2JB 5C3IC 5B24C 3REKC 3C1BB 5CPJC 1KX4D 3RELB 1KX5C 3W96D 1P3ID 4WU9C 4CAYB 1KX3C 3AZLC 5CP6A 1F66D 2F8NK 2PYOD 1TAFB 3AZMB 2F8NA 3AV1B 1N1JB 3KUYD 4J8UA 4R8PB 5B33A 3A6NA 4KUDC 5CHLB 5E5AC 3WTPE 5GT0A 1BFMA 1M18D 2FJ7A 2L5AA 1P3AD 1HQ3B 4J8XA 5CPIB 3MVDC 2HUEC 3MGRD 2BYMB 3VH6A 3X1UA 5F99B 3B6GB 4G92C 4H9SC 3WTPB 2HIOA 5B31B 3AZKA 1P3OB 1KX4C 3W96C 5DNMA 4ZUXC 4WZSB 1P3IC 5B0YD 4WU8D 3AZFB 2YFVA 4H9NB 1F66C 4H9QB 3AZNB 3REHA 2PYOC 3AV1D 5AY8A 1ZLAA 3VH5A 5B1LA 3AYWC 5BNXA 3AFAD 4KGCD 4EO5C 5G49A 3MNNB 4E44A 3NQUB 4XUJB 1F1EA 3W97B 4CSRA 5CP6D 5AV9B 3UTBA 3WKJA 3MGRC 2CV5B 2F8ND 1EQZD 3UT9B 3RELC 5BO0A 3VH5T 3MGPB 5GSUA 5B32A 4JJNB 5AV8A 4J8UD 1B6WA 1P34B 5B33D 3LZ0C 5B0YC 4Z5TB 5GT0D 3KXBB 2FJ7D 4DRBA 4J8XD 3AZGB 1P3MA 3AV1C 5JA4A 1P3KA 3X1UD 5GXQB 5B0ZB 5B31G 3W99B 1TZYD 3AZKD 5AV6A 3MGQC 4KGCC 3AV2A 5DNMD 3X1VB 3MGSD 5CPIC 5AV5D 1P3PA 3KWQA 5AVCB 3O62A 3REKB 5F99C 1KX5B 5AVBA 3WTPC 5B31C 4WU9B 1EQZC 1ZLAD 1KX3B 3AZLB 5B1LD 3TU4A 3AZEB 4J8UC 5DNNA 1ID3A 5B2IB 3AZNC 5GT0C 2NZDD 4J8WD 2FJ7C 4J8XC 3B6FD 4KUDB 5E5AB 3AZIC 4XZQC 4HGAC 4UUZA 3LELA 4G91B 1TZYC 5GSUD 5B32D 4Z2MG 2HUEB 3REIA 5B40A 4LD9D 3MGSC 4DRAA 3X1TA 5AV5C 1P3LA 4WNNA 1KX4B 1AOIA 3W96B 1P3IB 4YS3A 1P3KD 1ZLAC 3LZ1A 1F66B 2RVQC 5AV6D 1U35C 2PYOB 3AV2D 3AZJA 1S32A 2NZDC 4J8WC 3AZGC 3KUYB 3LJAA 3AYWB 1P3PD 3KWQD 3O62D 4EO5B 1A7WA 3B6FC 4QLCD 3NQJA 1P3BD 3B0DC 1BH8B 1P3AB 5B32C 3TU4D 3B0BA 5DNND 4Z66A 3MGRB 4LD9C 5B2JA 2AROD 4X23D 3LZ0B 5B0YB 3X1SA 2NQBD 3AZEC 5B1MC 3LELD 5B2IC 5AV6C 1TAFA 4KHAA 3AZMA 3AV2C 1HTAA 4H9OA
chains in the Genus database with same CATH superfamily
3REID 1N1JA 5B40D 1P3LD 3AFAB 4R8PA 3KWQC 3MGQB 4KGCB 1AOID 4J8VD 4G91C 4YS3D 4QLCC 1P3BC 2J8PA 2ZY4A 1HQ3A 3LZ1D 1P3GC 1KU5A 2BYMA 2F8NB 1EQZB 3EPLA 3W98A 3AZJD 1S32D 3C1CD 1P3OA 4J8UB 2AROC 1M19A 4YM6D 5B33B 4X23C 3EPKA 5CPKA 2NQBC 5GT0B 3UTAA 3WA9A 4H9NA 2FJ7B 5FUGB 3VH6T 4J8XB 3KUYC 4Z66D 3REJD 3AZIB 4XZQB 4HGAB 3X1UB 1TZYB 1M18C 1AOIC 3MNNA 4J8VC 5DNMB 1P3AC 3X1SD 3H0MC 3MGSB 3AZHA 4H9PB 2YFWB 5AV5B 2YFVB 3LZ1C 4AWLC 3AN2A 2CV5A 3VH6W 3UT9A 3F6TA 5BS7A 3AZJC 1ZLAB 3MGPA 3A6ND 3C1CC 4JJNA 5B1LB 4WU8C 1U35B 4YM6C 5G49B 3KXBA 2NZDB 4J8WB 2DF4C 1M1AA 1HQ3D 3B6FB 2F8NG 1H3OB 4Z66C 2HIOD 3AFAC 3REJC 3VH5W 3B0DB 5B0ZA 5GXQA 3W98D 3V9RA 5BNVA 4H9RA 1ULYA 1P3OD 5GSUB 5B32B 1M19D 3B0CT 3X1VA 5CP6C 5CPKD 3X1SC 2JSSA 4LD9B 1Q9CA 3REHD 3UTAD 3WA9D 5B24A 3REKA 5AY8D 5CPJA 1KX5A 4WU9A 4NE3A 4NE6A 5GT3A 1KX3A 5B1MB 5JA4B 1P3KB 3A6NC 3EPJA 5B33C 3WAAA 3R45A 2XD5A 2BYKA 5AV6B 3AV2B 3MNND 3A1KA 1BH9A 4NFTA 3AZHD 1JFIA 3UTBD 3WKJD 1P3PB 5JRGA 3KWQB 3X1UC 3O62B 3AN2D 4KUDA 2CV5D 2HIOC 4QLCB 3AZKC 1P3BB 5AV8D 5DNMC 4JJND 3TU4B 5DNNB 3MVDA 1P3GB 2RIQA 4ZBJC 5CPKC 3REHC 3UTAC 4DQYB 2BG1A 1M1AD 1P3MD 1KX4A 5AY8C 2AROB 4ZUXA 1WWIA 4X23B 5B1LC 2NQBB 5GXQD 4UUZB 1F66A 5B32G 2Y2NA 2Y2HA 5BT1D 5B40B 3AYWA 5AVBD 3AZHC 3UTBC 3WKJC 5B24D 5CPJD 1M18B 1AOIB 4J8VB 4WU9D 5KDMB 1BH8A 5GSUC 5AV8C 5GT3D 1ID3D 3WAAD 3LZ1B 4AWLB 1P3FA 3MGRA 3C1BA 3RELA 3AZJB 2JE5A 1S32B 3C1CB 1M1AC 2Y2KA 4CAYA 4WU8B 1P3MC 5JRGD 1P3KC 4YM6B 3LZ0A 3NQJB 4KGCA 3MVDD 3X1TD 4Z66B 3REJB 1P3PC 3O62C 3IP4C 2VQRA 1T3UA 5AVBC 3MGQA 4ZUXD 4E45A 5CP6B 3X1SB 3TU4C 5CPIA 5GT3C 5DNNC 1W2EA 2Y2PA 1ID3C 3WAAC 5F99A 3B6GA 3WTPA 4KHAB 5B31A 1EQZA 3LJAD 4H9OB 3A6NB 3AYWD 3AZFA 1Z2CB 5JRGC 3LELC 4H9QA 3AZNA 5FUGA 2ZY3A 3REIC 5B40C 1P3FD 3AZIA 3X1TC 4XZQA 2HIOB 5B2JD 3AZKB 1P3LC 3C1BD 3W98B 3RELD 1TZYA 3NQUA 4XUJA 4YS3C 3W97A 1M19B 2XD1A 3LZ0D 5AV9A 4ZBJB 5CPKB 3MGSA 4H9PA 2YFWA 5AV5A 3REHB 3UTAB 3AZMD 3WA9B 5AY8B 2F2AC 1S32C 1P34A 3LJAC 5BNXB 4R8PD 4Z5TA 3MGQD 1U35A 2ZY5A 4CSRB 2NZDA 4J8WA 3AZGA 5CPID 2IO5C 3AZHB 3UTBB 3WKJB 5F99D 3B6GD 3AN2B 3B6FA 3W99A 1H3OA 5BO0B 5B31D 3WTPD 1P3FC 5B2JC 3AL0C 3C1BC 5AV8B 3AZFD 5AVCA 3AZND 4LD9A 3AZMC 1M1AB 1P3MB 3AZLA 2Y2IA 4UPKA 4XZQD 3AZEA 5B1MA 4R8PC 3AZID 3V9RB 5BNVB 4H9RB 5B2IA 4XUJD 3B0CW 3W97D 1HQ3C 5AV9D 1R4VA 5E5AA 5AVBB 5B24B 5C3IB 3UT9D 5CPJB 3W98C 3B6GC 3MGPD 4QLCA 1P3BA 1P3OC 2F8NH 1P34D 2W8SA 1M19C 5GT3B 1ID3B 3WAAB 4Z5TD 3R45B 2RVQD 3AZFC 4H9SA 2BYKB 3KXBD 4WV4B 1U35D 1P3GA 3WA9C 3W96A 1BH9B 1P3IA 3H0LC 3AZGD 2Y2GA 1JFIB 2AROA 1WWSA 5JRGB 5B0ZD 3W99D 4X23A 3LELB 2NQBA 2PYOA 2CWEA 3MNNC 3X1VD 4XUJC 3REIB 3KUYA 3KSYA 3W97C 3MVDB 3X1TB 5AVCD 1P3LB 3REKD 4M6BA 4WNNB 1KX5D 5AV9C 3AN2C 4G92B 2CV5C 4YS3B 3UT9C 1M18A 5BS7C 4J8VA 4NE5A 4ZUXB 3MGPC 5KDMA 3AZLD 1P3AA 1KX3D 4JJNC 1B67A 3AZED 1P34C 5B1MD 4Z2MH 4Z5TC 5B2ID 3FDDA 3KXBC 1PZRA 2UWXA 3LJAB 2ZM5A 4KUDD 3C1CA 5B0YA 4WU8A 5E5AD 5GXQC 5B0ZC 4YM6A 3W99C 2LY8A 2IO5B 3AV1A 3X1VC 5BT1C 1P3GD 1P3FB 3AFAA 3REJA 5AVCC 5B2JB 5C3IC 5B24C 3REKC 3C1BB 5CPJC 1KX4D 3RELB 1KX5C 3W96D 1P3ID 4WU9C 4CAYB 3P5JB 1KX3C 3AZLC 5CP6A 1F66D 2F8NK 2PYOD 1TAFB 3AZMB 3EG5B 2F8NA 3AV1B 1N1JB 3KUYD 4J8UA 4R8PB 5B33A 3A6NA 4KUDC 5CHLB 5E5AC 3WTPE 5GT0A 1BFMA 1M18D 2FJ7A 2L5AA 1P3AD 1HQ3B 4J8XA 5CPIB 3MVDC 2HUEC 3MGRD 2BYMB 3VH6A 3X1UA 5F99B 3B6GB 4G92C 4H9SC 3WTPB 2HIOA 5B31B 3AZKA 1P3OB 1KX4C 3W96C 5DNMA 4ZUXC 4WZSB 1P3IC 5B0YD 4WU8D 3AZFB 2YFVA 4H9NB 1F66C 4H9QB 3AZNB 3REHA 2PYOC 3AV1D 5AY8A 1ZLAA 3VH5A 5B1LA 3AYWC 5BNXA 3AFAD 4KGCD 4EO5C 2ZY2A 5G49A 2Y2OA 3MNNB 4E44A 3NQUB 4XUJB 1F1EA 3W97B 4CSRA 2Y2MA 2Y2JA 5CP6D 5AV9B 3UTBA 3WKJA 3MGRC 2CV5B 2F8ND 1EQZD 2DQNC 3UT9B 3RELC 5BO0A 3VH5T 2G5IC 3MGPB 5GSUA 5B32A 4JJNB 5AV8A 4J8UD 1B6WA 1P34B 5B33D 3LZ0C 5B0YC 2Y2LA 2Y2QA 4Z5TB 5GT0D 3KXBB 2FJ7D 4DRBA 4J8XD 3AZGB 1P3MA 3AV1C 5JA4A 1P3KA 3X1UD 5GXQB 5B0ZB 5B31G 3W99B 1TZYD 3AZKD 5AV6A 3MGQC 4KGCC 3AV2A 5DNMD 3X1VB 3MGSD 5CPIC 5AV5D 1P3PA 3KWQA 5AVCB 4WJ3C 3O62A 3REKB 5F99C 1KX5B 5AVBA 3WTPC 5B31C 4WU9B 1EQZC 1ZLAD 1KX3B 3AZLB 2JCHA 5B1LD 3TU4A 3AZEB 4J8UC 5DNNA 1ID3A 5B2IB 3AZNC 5GT0C 2NZDD 4J8WD 3EPHA 2FJ7C 2FFFB 4J8XC 3B6FD 4KUDB 5E5AB 3AZIC 4XZQC 4HGAC 4UUZA 3LELA 4G91B 1TZYC 5GSUD 5B32D 4Z2MG 2HUEB 3REIA 5B40A 4LD9D 3MGSC 4DRAA 3X1TA 5AV5C 1P3LA 4WNNA 1KX4B 1AOIA 3W96B 1P3IB 3KFUG 4YS3A 1P3KD 1ZLAC 3LZ1A 1F66B 2RVQC 2G5HC 5AV6D 1U35C 2PYOB 3AV2D 3AZJA 1S32A 2NZDC 4J8WC 3AZGC 3KUYB 3LJAA 3AYWB 1P3PD 3KWQD 3O62D 4EO5B 1A7WA 3B6FC 3A1IA 4QLCD 3H0RC 3NQJA 1P3BD 3B0DC 1BH8B 1P3AB 5B32C 3TU4D 3B0BA 5DNND 4Z66A 3MGRB 4LD9C 5B2JA 2AROD 4X23D 3LZ0B 5B0YB 3X1SA 2NQBD 3AZEC 5B1MC 3LELD 5B2IC 5AV6C 1TAFA 4KHAA 3AZMA 3AV2C 1HTAA 4H9OA
chains in the Genus database with same CATH topology
3REID 1N1JA 5B40D 1P3LD 3AFAB 4R8PA 3KWQC 3MGQB 4KGCB 1AOID 4J8VD 4G91C 4YS3D 4QLCC 1P3BC 2J8PA 2ZY4A 1HQ3A 3LZ1D 1P3GC 1KU5A 2BYMA 2F8NB 1EQZB 3EPLA 3W98A 3AZJD 1S32D 3C1CD 1P3OA 4J8UB 2AROC 1M19A 4YM6D 5B33B 4X23C 3EPKA 5CPKA 2NQBC 5GT0B 3UTAA 3WA9A 4H9NA 2FJ7B 5FUGB 3VH6T 4J8XB 3KUYC 4Z66D 3REJD 3AZIB 4XZQB 4HGAB 3X1UB 1TZYB 1M18C 1AOIC 3MNNA 4J8VC 5DNMB 1P3AC 3X1SD 3H0MC 3MGSB 3AZHA 4H9PB 2YFWB 5AV5B 2YFVB 3LZ1C 4AWLC 3AN2A 2CV5A 3VH6W 3UT9A 3F6TA 5BS7A 3AZJC 1ZLAB 3MGPA 3A6ND 3C1CC 4JJNA 5B1LB 4WU8C 1U35B 4YM6C 5G49B 3KXBA 2NZDB 4J8WB 2DF4C 1M1AA 1HQ3D 3B6FB 2F8NG 1H3OB 4Z66C 2HIOD 3AFAC 3REJC 3VH5W 3B0DB 5B0ZA 5GXQA 3W98D 3V9RA 5BNVA 4H9RA 1ULYA 1P3OD 5GSUB 5B32B 1M19D 3B0CT 3X1VA 5CP6C 5CPKD 3X1SC 2JSSA 4LD9B 1Q9CA 3REHD 3UTAD 3WA9D 5B24A 3REKA 5AY8D 5CPJA 1KX5A 4WU9A 4NE3A 4NE6A 5GT3A 1KX3A 5B1MB 5JA4B 1P3KB 3A6NC 3EPJA 5B33C 3WAAA 3R45A 2XD5A 2BYKA 5AV6B 3AV2B 3MNND 3A1KA 1BH9A 4NFTA 3AZHD 1JFIA 3UTBD 3WKJD 1P3PB 5JRGA 3KWQB 3X1UC 3O62B 3AN2D 4KUDA 2CV5D 2HIOC 4QLCB 3AZKC 1P3BB 5AV8D 5DNMC 4JJND 3TU4B 5DNNB 3MVDA 1P3GB 2RIQA 4ZBJC 5CPKC 3REHC 3UTAC 4DQYB 2BG1A 1M1AD 1P3MD 1KX4A 5AY8C 2AROB 4ZUXA 1WWIA 4X23B 5B1LC 2NQBB 5GXQD 4UUZB 1F66A 5B32G 2Y2NA 2Y2HA 5BT1D 5B40B 3AYWA 5AVBD 3AZHC 3UTBC 3WKJC 5B24D 5CPJD 1M18B 1AOIB 4J8VB 4WU9D 5KDMB 1BH8A 5GSUC 5AV8C 5GT3D 1ID3D 3WAAD 3LZ1B 4AWLB 1P3FA 3MGRA 3C1BA 3RELA 3AZJB 2JE5A 1S32B 3C1CB 1M1AC 2Y2KA 4CAYA 4WU8B 1P3MC 5JRGD 1P3KC 4YM6B 3LZ0A 3NQJB 4KGCA 3MVDD 3X1TD 4Z66B 3REJB 1P3PC 3O62C 3IP4C 2VQRA 1T3UA 5AVBC 3MGQA 4ZUXD 4E45A 5CP6B 3X1SB 3TU4C 5CPIA 5GT3C 5DNNC 1W2EA 2Y2PA 1ID3C 3WAAC 5F99A 3B6GA 3WTPA 4KHAB 5B31A 1EQZA 3LJAD 4H9OB 3A6NB 3AYWD 3AZFA 1Z2CB 5JRGC 3LELC 4H9QA 3AZNA 5FUGA 2ZY3A 3REIC 5B40C 1P3FD 3AZIA 3X1TC 4XZQA 2HIOB 5B2JD 3AZKB 1P3LC 3C1BD 3W98B 3RELD 1TZYA 3NQUA 4XUJA 4YS3C 3W97A 1M19B 2XD1A 3LZ0D 5AV9A 4ZBJB 5CPKB 3MGSA 4H9PA 2YFWA 5AV5A 3REHB 3UTAB 3AZMD 3WA9B 5AY8B 2F2AC 1S32C 1P34A 3LJAC 5BNXB 4R8PD 4Z5TA 3MGQD 1U35A 2ZY5A 4CSRB 2NZDA 4J8WA 3AZGA 5CPID 2IO5C 3AZHB 3UTBB 3WKJB 5F99D 3B6GD 3AN2B 3B6FA 3W99A 1H3OA 5BO0B 5B31D 3WTPD 1P3FC 5B2JC 3AL0C 3C1BC 5AV8B 3AZFD 5AVCA 3AZND 4LD9A 3AZMC 1M1AB 1P3MB 3AZLA 2Y2IA 4UPKA 4XZQD 3AZEA 5B1MA 4R8PC 3AZID 3V9RB 5BNVB 4H9RB 5B2IA 4XUJD 3B0CW 3W97D 1HQ3C 5AV9D 1R4VA 5E5AA 5AVBB 5B24B 5C3IB 3UT9D 5CPJB 3W98C 3B6GC 3MGPD 4QLCA 1P3BA 1P3OC 2F8NH 1P34D 2W8SA 1M19C 5GT3B 1ID3B 3WAAB 4Z5TD 3R45B 2RVQD 3AZFC 4H9SA 2BYKB 3KXBD 4WV4B 1U35D 1P3GA 3WA9C 3W96A 1BH9B 1P3IA 3H0LC 3AZGD 2Y2GA 1JFIB 2AROA 1WWSA 5JRGB 5B0ZD 3W99D 4X23A 3LELB 2NQBA 2PYOA 2CWEA 3MNNC 3X1VD 4XUJC 3REIB 3KUYA 3KSYA 3W97C 3MVDB 3X1TB 5AVCD 1P3LB 3REKD 4M6BA 4WNNB 1KX5D 5AV9C 3AN2C 4G92B 2CV5C 4YS3B 3UT9C 1M18A 5BS7C 4J8VA 4NE5A 4ZUXB 3MGPC 5KDMA 3AZLD 1P3AA 1KX3D 4JJNC 1B67A 3AZED 1P34C 5B1MD 4Z2MH 4Z5TC 5B2ID 3FDDA 3KXBC 1PZRA 2UWXA 3LJAB 2ZM5A 4KUDD 3C1CA 5B0YA 4WU8A 5E5AD 5GXQC 5B0ZC 4YM6A 3W99C 2LY8A 2IO5B 3AV1A 3X1VC 5BT1C 1P3GD 1P3FB 3AFAA 3REJA 5AVCC 5B2JB 5C3IC 5B24C 3REKC 3C1BB 5CPJC 1KX4D 3RELB 1KX5C 3W96D 1P3ID 4WU9C 4CAYB 3P5JB 1KX3C 3AZLC 5CP6A 1F66D 2F8NK 2PYOD 1TAFB 3AZMB 3EG5B 2F8NA 3AV1B 1N1JB 3KUYD 4J8UA 4R8PB 5B33A 3A6NA 4KUDC 5CHLB 5E5AC 3WTPE 5GT0A 1BFMA 1M18D 2FJ7A 2L5AA 1P3AD 1HQ3B 4J8XA 5CPIB 3MVDC 2HUEC 3MGRD 2BYMB 3VH6A 3X1UA 5F99B 3B6GB 4G92C 4H9SC 3WTPB 2HIOA 5B31B 3AZKA 1P3OB 1KX4C 3W96C 5DNMA 4ZUXC 4WZSB 1P3IC 5B0YD 4WU8D 3AZFB 2YFVA 4H9NB 1F66C 4H9QB 3AZNB 3REHA 2PYOC 3AV1D 5AY8A 1ZLAA 3VH5A 5B1LA 3AYWC 5BNXA 3AFAD 4KGCD 4EO5C 2ZY2A 5G49A 2Y2OA 3MNNB 4E44A 3NQUB 4XUJB 1F1EA 3W97B 4CSRA 2Y2MA 2Y2JA 5CP6D 5AV9B 3UTBA 3WKJA 3MGRC 2CV5B 2F8ND 1EQZD 2DQNC 3UT9B 3RELC 5BO0A 3VH5T 2G5IC 3MGPB 5GSUA 5B32A 4JJNB 5AV8A 4J8UD 1B6WA 1P34B 5B33D 3LZ0C 5B0YC 2Y2LA 2Y2QA 4Z5TB 5GT0D 3KXBB 2FJ7D 4DRBA 4J8XD 3AZGB 1P3MA 3AV1C 5JA4A 1P3KA 3X1UD 5GXQB 5B0ZB 5B31G 3W99B 1TZYD 3AZKD 5AV6A 3MGQC 4KGCC 3AV2A 5DNMD 3X1VB 3MGSD 5CPIC 5AV5D 1P3PA 3KWQA 5AVCB 4WJ3C 3O62A 3REKB 5F99C 1KX5B 5AVBA 3WTPC 5B31C 4WU9B 1EQZC 1ZLAD 1KX3B 3AZLB 2JCHA 5B1LD 3TU4A 3AZEB 4J8UC 5DNNA 1ID3A 5B2IB 3AZNC 5GT0C 2NZDD 4J8WD 3EPHA 2FJ7C 2FFFB 4J8XC 3B6FD 4KUDB 5E5AB 3AZIC 4XZQC 4HGAC 4UUZA 3LELA 4G91B 1TZYC 5GSUD 5B32D 4Z2MG 2HUEB 3REIA 5B40A 4LD9D 3MGSC 4DRAA 3X1TA 5AV5C 1P3LA 4WNNA 1KX4B 1AOIA 3W96B 1P3IB 3KFUG 4YS3A 1P3KD 1ZLAC 3LZ1A 1F66B 2RVQC 2G5HC 5AV6D 1U35C 2PYOB 3AV2D 3AZJA 1S32A 2NZDC 4J8WC 3AZGC 3KUYB 3LJAA 3AYWB 1P3PD 3KWQD 3O62D 4EO5B 1A7WA 3B6FC 3A1IA 4QLCD 3H0RC 3NQJA 1P3BD 3B0DC 1BH8B 1P3AB 5B32C 3TU4D 3B0BA 5DNND 4Z66A 3MGRB 4LD9C 5B2JA 2AROD 4X23D 3LZ0B 5B0YB 3X1SA 2NQBD 3AZEC 5B1MC 3LELD 5B2IC 5AV6C 1TAFA 4KHAA 3AZMA 3AV2C 1HTAA 4H9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REI D;  1N1J A;  5B40 D;  1P3L D;  3AFA B;  4R8P A;  3KWQ C;  3MGQ B;  4KGC B;  1AOI D;  4J8V D;  4G91 C;  4YS3 D;  4QLC C;  1P3B C;  1HQ3 A;  3LZ1 D;  1P3G C;  1KU5 A;  2BYM A;  2F8N B;  1EQZ B;  3W98 A;  3AZJ D;  1S32 D;  3C1C D;  1P3O A;  4J8U B;  2ARO C;  1M19 A;  4YM6 D;  5B33 B;  4X23 C;  5CPK A;  2NQB C;  5GT0 B;  3UTA A;  3WA9 A;  4H9N A;  2FJ7 B;  5FUG B;  3VH6 T;  4J8X B;  3KUY C;  4Z66 D;  3REJ D;  3AZI B;  4XZQ B;  4HGA B;  3X1U B;  1TZY B;  1M18 C;  1AOI C;  3MNN A;  4J8V C;  5DNM B;  1P3A C;  3X1S D;  3MGS B;  3AZH A;  4H9P B;  2YFW B;  5AV5 B;  2YFV B;  3LZ1 C;  4AWL C;  3AN2 A;  2CV5 A;  3VH6 W;  3UT9 A;  5BS7 A;  3AZJ C;  1ZLA B;  3MGP A;  3A6N D;  3C1C C;  4JJN A;  5B1L B;  4WU8 C;  1U35 B;  4YM6 C;  5G49 B;  3KXB A;  2NZD B;  4J8W B;  1M1A A;  1HQ3 D;  3B6F B;  2F8N G;  1H3O B;  4Z66 C;  2HIO D;  3AFA C;  3REJ C;  3VH5 W;  3B0D B;  5B0Z A;  5GXQ A;  3W98 D;  3V9R A;  5BNV A;  4H9R A;  1ULY A;  1P3O D;  5GSU B;  5B32 B;  1M19 D;  3B0C T;  3X1V A;  5CP6 C;  5CPK D;  3X1S C;  2JSS A;  4LD9 B;  1Q9C A;  3REH D;  3UTA D;  3WA9 D;  5B24 A;  3REK A;  5AY8 D;  5CPJ A;  1KX5 A;  4WU9 A;  4NE3 A;  4NE6 A;  5GT3 A;  1KX3 A;  5B1M B;  5JA4 B;  1P3K B;  3A6N C;  5B33 C;  3WAA A;  3R45 A;  2BYK A;  5AV6 B;  3AV2 B;  3MNN D;  1BH9 A;  4NFT A;  3AZH D;  1JFI A;  3UTB D;  3WKJ D;  1P3P B;  5JRG A;  3KWQ B;  3X1U C;  3O62 B;  3AN2 D;  4KUD A;  2CV5 D;  2HIO C;  4QLC B;  3AZK C;  1P3B B;  5AV8 D;  5DNM C;  4JJN D;  3TU4 B;  5DNN B;  3MVD A;  1P3G B;  4ZBJ C;  5CPK C;  3REH C;  3UTA C;  1M1A D;  1KX4 A;  1P3M D;  5AY8 C;  2ARO B;  4ZUX A;  1WWI A;  4X23 B;  5B1L C;  2NQB B;  5GXQ D;  4UUZ B;  1F66 A;  5B32 G;  5BT1 D;  5B40 B;  3AYW A;  5AVB D;  3AZH C;  3UTB C;  3WKJ C;  5B24 D;  5CPJ D;  1M18 B;  1AOI B;  4J8V B;  4WU9 D;  5KDM B;  1BH8 A;  5GSU C;  5AV8 C;  5GT3 D;  1ID3 D;  3WAA D;  3LZ1 B;  4AWL B;  1P3F A;  3MGR A;  3C1B A;  3REL A;  3AZJ B;  1S32 B;  3C1C B;  1M1A C;  4CAY A;  4WU8 B;  1P3M C;  5JRG D;  1P3K C;  4YM6 B;  3LZ0 A;  3NQJ B;  4KGC A;  3MVD D;  3X1T D;  4Z66 B;  3REJ B;  1P3P C;  3O62 C;  5AVB C;  3MGQ A;  4ZUX D;  4E45 A;  5CP6 B;  3X1S B;  3TU4 C;  5CPI A;  5GT3 C;  5DNN C;  1ID3 C;  3WAA C;  5F99 A;  3B6G A;  3WTP A;  4KHA B;  5B31 A;  1EQZ A;  3LJA D;  4H9O B;  3A6N B;  3AYW D;  3AZF A;  5JRG C;  3LEL C;  4H9Q A;  3AZN A;  5FUG A;  3REI C;  5B40 C;  1P3F D;  3AZI A;  3X1T C;  4XZQ A;  2HIO B;  5B2J D;  3AZK B;  1P3L C;  3C1B D;  3W98 B;  3REL D;  1TZY A;  3NQU A;  4XUJ A;  4YS3 C;  3W97 A;  1M19 B;  3LZ0 D;  5AV9 A;  4ZBJ B;  5CPK B;  3MGS A;  4H9P A;  2YFW A;  5AV5 A;  3REH B;  3UTA B;  3AZM D;  3WA9 B;  5AY8 B;  1S32 C;  1P34 A;  3LJA C;  5BNX B;  4R8P D;  4Z5T A;  3MGQ D;  1U35 A;  4CSR B;  2NZD A;  4J8W A;  3AZG A;  5CPI D;  2IO5 C;  3AZH B;  3UTB B;  3WKJ B;  5F99 D;  3B6G D;  3AN2 B;  3B6F A;  3W99 A;  3WTP D;  1H3O A;  5BO0 B;  5B31 D;  1P3F C;  5B2J C;  3C1B C;  5AV8 B;  3AZF D;  5AVC A;  3AZN D;  4LD9 A;  3AZM C;  1M1A B;  1P3M B;  3AZL A;  3AZE A;  3AZI D;  4XZQ D;  5B1M A;  4R8P C;  3V9R B;  5BNV B;  4H9R B;  5B2I A;  4XUJ D;  3B0C W;  3W97 D;  1HQ3 C;  5AV9 D;  1R4V A;  5E5A A;  5AVB B;  5B24 B;  5C3I B;  3UT9 D;  5CPJ B;  3W98 C;  3B6G C;  3MGP D;  4QLC A;  1P3B A;  1P3O C;  2F8N H;  1P34 D;  1M19 C;  5GT3 B;  1ID3 B;  3WAA B;  4Z5T D;  3R45 B;  2RVQ D;  3AZF C;  4H9S A;  2BYK B;  3KXB D;  4WV4 B;  1U35 D;  1P3G A;  3WA9 C;  3W96 A;  1BH9 B;  1P3I A;  3AZG D;  1JFI B;  2ARO A;  1WWS A;  5JRG B;  5B0Z D;  3W99 D;  4X23 A;  3LEL B;  2NQB A;  2PYO A;  2CWE A;  3MNN C;  3X1V D;  4XUJ C;  3REI B;  3KUY A;  3KSY A;  3W97 C;  3MVD B;  3X1T B;  5AVC D;  1P3L B;  3REK D;  4M6B A;  4WNN B;  1KX5 D;  5AV9 C;  3AN2 C;  4G92 B;  2CV5 C;  4YS3 B;  3UT9 C;  1M18 A;  5BS7 C;  4J8V A;  4NE5 A;  4ZUX B;  3MGP C;  5KDM A;  3AZL D;  1P3A A;  1KX3 D;  4JJN C;  1B67 A;  3AZE D;  1P34 C;  5B1M D;  4Z2M H;  4Z5T C;  5B2I D;  3KXB C;  3LJA B;  4KUD D;  3C1C A;  5B0Y A;  4WU8 A;  5E5A D;  5GXQ C;  5B0Z C;  4YM6 A;  3W99 C;  2LY8 A;  2IO5 B;  3AV1 A;  3X1V C;  5BT1 C;  1P3G D;  1P3F B;  3AFA A;  3REJ A;  5AVC C;  5B2J B;  5C3I C;  5B24 C;  3REK C;  3C1B B;  5CPJ C;  1KX4 D;  3REL B;  1KX5 C;  3W96 D;  1P3I D;  4WU9 C;  4CAY B;  1KX3 C;  3AZL C;  5CP6 A;  1F66 D;  2F8N K;  2PYO D;  1TAF B;  3AZM B;  2F8N A;  3AV1 B;  1N1J B;  3KUY D;  4J8U A;  4R8P B;  5B33 A;  3A6N A;  4KUD C;  5CHL B;  5E5A C;  3WTP E;  5GT0 A;  1BFM A;  1M18 D;  2FJ7 A;  2L5A A;  1P3A D;  1HQ3 B;  4J8X A;  5CPI B;  3MVD C;  2HUE C;  3MGR D;  2BYM B;  3VH6 A;  3X1U A;  5F99 B;  3B6G B;  4G92 C;  4H9S C;  3WTP B;  2HIO A;  5B31 B;  3AZK A;  1P3O B;  1KX4 C;  3W96 C;  5DNM A;  4ZUX C;  4WZS B;  1P3I C;  5B0Y D;  4WU8 D;  3AZF B;  2YFV A;  4H9N B;  1F66 C;  4H9Q B;  3AZN B;  3REH A;  2PYO C;  3AV1 D;  5AY8 A;  1ZLA A;  3VH5 A;  5B1L A;  3AYW C;  5BNX A;  3AFA D;  4KGC D;  4EO5 C;  5G49 A;  3MNN B;  4E44 A;  3NQU B;  4XUJ B;  1F1E A;  3W97 B;  4CSR A;  5CP6 D;  5AV9 B;  3UTB A;  3WKJ A;  3MGR C;  2CV5 B;  2F8N D;  1EQZ D;  3UT9 B;  3REL C;  5BO0 A;  3VH5 T;  3MGP B;  5GSU A;  5B32 A;  4JJN B;  5AV8 A;  4J8U D;  1B6W A;  1P34 B;  5B33 D;  3LZ0 C;  5B0Y C;  4Z5T B;  5GT0 D;  3KXB B;  2FJ7 D;  4DRB A;  4J8X D;  3AZG B;  1P3M A;  3AV1 C;  5JA4 A;  1P3K A;  3X1U D;  5GXQ B;  5B0Z B;  5B31 G;  3W99 B;  1TZY D;  3AZK D;  5AV6 A;  3MGQ C;  4KGC C;  3AV2 A;  5DNM D;  3X1V B;  3MGS D;  5CPI C;  5AV5 D;  1P3P A;  3KWQ A;  5AVC B;  3O62 A;  3REK B;  5F99 C;  1KX5 B;  5AVB A;  3WTP C;  5B31 C;  4WU9 B;  1EQZ C;  1ZLA D;  1KX3 B;  3AZL B;  5B1L D;  3TU4 A;  3AZE B;  4J8U C;  5DNN A;  1ID3 A;  5B2I B;  3AZN C;  5GT0 C;  2NZD D;  4J8W D;  2FJ7 C;  4J8X C;  3B6F D;  4KUD B;  5E5A B;  3AZI C;  4XZQ C;  4HGA C;  4UUZ A;  3LEL A;  4G91 B;  1TZY C;  5GSU D;  5B32 D;  4Z2M G;  2HUE B;  3REI A;  5B40 A;  4LD9 D;  3MGS C;  4DRA A;  3X1T A;  5AV5 C;  1P3L A;  4WNN A;  1KX4 B;  1AOI A;  3W96 B;  1P3I B;  4YS3 A;  1P3K D;  1ZLA C;  3LZ1 A;  1F66 B;  2RVQ C;  5AV6 D;  1U35 C;  2PYO B;  3AV2 D;  3AZJ A;  1S32 A;  2NZD C;  4J8W C;  3AZG C;  3KUY B;  3LJA A;  3AYW B;  1P3P D;  3KWQ D;  3O62 D;  4EO5 B;  1A7W A;  3B6F C;  4QLC D;  3NQJ A;  1P3B D;  3B0D C;  1BH8 B;  1P3A B;  5B32 C;  3TU4 D;  3B0B A;  5DNN D;  4Z66 A;  3MGR B;  4LD9 C;  5B2J A;  2ARO D;  4X23 D;  3LZ0 B;  5B0Y B;  3X1S A;  2NQB D;  3AZE C;  5B1M C;  3LEL D;  5B2I C;  5AV6 C;  1TAF A;  4KHA A;  3AZM A;  3AV2 C;  1HTA A;  4H9O A; 
#chains in the Genus database with same CATH topology
 3REI D;  1N1J A;  5B40 D;  1P3L D;  3AFA B;  4R8P A;  3KWQ C;  3MGQ B;  4KGC B;  1AOI D;  4J8V D;  4G91 C;  4YS3 D;  4QLC C;  1P3B C;  2J8P A;  2ZY4 A;  1HQ3 A;  3LZ1 D;  1P3G C;  1KU5 A;  2BYM A;  2F8N B;  1EQZ B;  3EPL A;  3W98 A;  3AZJ D;  1S32 D;  3C1C D;  1P3O A;  4J8U B;  2ARO C;  1M19 A;  4YM6 D;  5B33 B;  4X23 C;  3EPK A;  5CPK A;  2NQB C;  5GT0 B;  3UTA A;  3WA9 A;  4H9N A;  2FJ7 B;  5FUG B;  3VH6 T;  4J8X B;  3KUY C;  4Z66 D;  3REJ D;  3AZI B;  4XZQ B;  4HGA B;  3X1U B;  1TZY B;  1M18 C;  1AOI C;  3MNN A;  4J8V C;  5DNM B;  1P3A C;  3X1S D;  3H0M C;  3MGS B;  3AZH A;  4H9P B;  2YFW B;  5AV5 B;  2YFV B;  3LZ1 C;  4AWL C;  3AN2 A;  2CV5 A;  3VH6 W;  3UT9 A;  3F6T A;  5BS7 A;  3AZJ C;  1ZLA B;  3MGP A;  3A6N D;  3C1C C;  4JJN A;  5B1L B;  4WU8 C;  1U35 B;  4YM6 C;  5G49 B;  3KXB A;  2NZD B;  4J8W B;  2DF4 C;  1M1A A;  1HQ3 D;  3B6F B;  2F8N G;  1H3O B;  4Z66 C;  2HIO D;  3AFA C;  3REJ C;  3VH5 W;  3B0D B;  5B0Z A;  5GXQ A;  3W98 D;  3V9R A;  5BNV A;  4H9R A;  1ULY A;  1P3O D;  5GSU B;  5B32 B;  1M19 D;  3B0C T;  3X1V A;  5CP6 C;  5CPK D;  3X1S C;  2JSS A;  4LD9 B;  1Q9C A;  3REH D;  3UTA D;  3WA9 D;  5B24 A;  3REK A;  5AY8 D;  5CPJ A;  1KX5 A;  4WU9 A;  4NE3 A;  4NE6 A;  5GT3 A;  1KX3 A;  5B1M B;  5JA4 B;  1P3K B;  3A6N C;  3EPJ A;  5B33 C;  3WAA A;  3R45 A;  2XD5 A;  2BYK A;  5AV6 B;  3AV2 B;  3MNN D;  3A1K A;  1BH9 A;  4NFT A;  3AZH D;  1JFI A;  3UTB D;  3WKJ D;  1P3P B;  5JRG A;  3KWQ B;  3X1U C;  3O62 B;  3AN2 D;  4KUD A;  2CV5 D;  2HIO C;  4QLC B;  3AZK C;  1P3B B;  5AV8 D;  5DNM C;  4JJN D;  3TU4 B;  5DNN B;  3MVD A;  1P3G B;  2RIQ A;  4ZBJ C;  5CPK C;  3REH C;  3UTA C;  4DQY B;  2BG1 A;  1M1A D;  1P3M D;  1KX4 A;  5AY8 C;  2ARO B;  4ZUX A;  1WWI A;  4X23 B;  5B1L C;  2NQB B;  5GXQ D;  4UUZ B;  1F66 A;  5B32 G;  2Y2N A;  2Y2H A;  5BT1 D;  5B40 B;  3AYW A;  5AVB D;  3AZH C;  3UTB C;  3WKJ C;  5B24 D;  5CPJ D;  1M18 B;  1AOI B;  4J8V B;  4WU9 D;  5KDM B;  1BH8 A;  5GSU C;  5AV8 C;  5GT3 D;  1ID3 D;  3WAA D;  3LZ1 B;  4AWL B;  1P3F A;  3MGR A;  3C1B A;  3REL A;  3AZJ B;  2JE5 A;  1S32 B;  3C1C B;  1M1A C;  2Y2K A;  4CAY A;  4WU8 B;  1P3M C;  5JRG D;  1P3K C;  4YM6 B;  3LZ0 A;  3NQJ B;  4KGC A;  3MVD D;  3X1T D;  4Z66 B;  3REJ B;  1P3P C;  3O62 C;  3IP4 C;  2VQR A;  1T3U A;  5AVB C;  3MGQ A;  4ZUX D;  4E45 A;  5CP6 B;  3X1S B;  3TU4 C;  5CPI A;  5GT3 C;  5DNN C;  1W2E A;  2Y2P A;  1ID3 C;  3WAA C;  5F99 A;  3B6G A;  3WTP A;  4KHA B;  5B31 A;  1EQZ A;  3LJA D;  4H9O B;  3A6N B;  3AYW D;  3AZF A;  1Z2C B;  5JRG C;  3LEL C;  4H9Q A;  3AZN A;  5FUG A;  2ZY3 A;  3REI C;  5B40 C;  1P3F D;  3AZI A;  3X1T C;  4XZQ A;  2HIO B;  5B2J D;  3AZK B;  1P3L C;  3C1B D;  3W98 B;  3REL D;  1TZY A;  3NQU A;  4XUJ A;  4YS3 C;  3W97 A;  1M19 B;  2XD1 A;  3LZ0 D;  5AV9 A;  4ZBJ B;  5CPK B;  3MGS A;  4H9P A;  2YFW A;  5AV5 A;  3REH B;  3UTA B;  3AZM D;  3WA9 B;  5AY8 B;  2F2A C;  1S32 C;  1P34 A;  3LJA C;  5BNX B;  4R8P D;  4Z5T A;  3MGQ D;  1U35 A;  2ZY5 A;  4CSR B;  2NZD A;  4J8W A;  3AZG A;  5CPI D;  2IO5 C;  3AZH B;  3UTB B;  3WKJ B;  5F99 D;  3B6G D;  3AN2 B;  3B6F A;  3W99 A;  1H3O A;  5BO0 B;  5B31 D;  3WTP D;  1P3F C;  5B2J C;  3AL0 C;  3C1B C;  5AV8 B;  3AZF D;  5AVC A;  3AZN D;  4LD9 A;  3AZM C;  1M1A B;  1P3M B;  3AZL A;  2Y2I A;  4UPK A;  4XZQ D;  3AZE A;  5B1M A;  4R8P C;  3AZI D;  3V9R B;  5BNV B;  4H9R B;  5B2I A;  4XUJ D;  3B0C W;  3W97 D;  1HQ3 C;  5AV9 D;  1R4V A;  5E5A A;  5AVB B;  5B24 B;  5C3I B;  3UT9 D;  5CPJ B;  3W98 C;  3B6G C;  3MGP D;  4QLC A;  1P3B A;  1P3O C;  2F8N H;  1P34 D;  2W8S A;  1M19 C;  5GT3 B;  1ID3 B;  3WAA B;  4Z5T D;  3R45 B;  2RVQ D;  3AZF C;  4H9S A;  2BYK B;  3KXB D;  4WV4 B;  1U35 D;  1P3G A;  3WA9 C;  3W96 A;  1BH9 B;  1P3I A;  3H0L C;  3AZG D;  2Y2G A;  1JFI B;  2ARO A;  1WWS A;  5JRG B;  5B0Z D;  3W99 D;  4X23 A;  3LEL B;  2NQB A;  2PYO A;  2CWE A;  3MNN C;  3X1V D;  4XUJ C;  3REI B;  3KUY A;  3KSY A;  3W97 C;  3MVD B;  3X1T B;  5AVC D;  1P3L B;  3REK D;  4M6B A;  4WNN B;  1KX5 D;  5AV9 C;  3AN2 C;  4G92 B;  2CV5 C;  4YS3 B;  3UT9 C;  1M18 A;  5BS7 C;  4J8V A;  4NE5 A;  4ZUX B;  3MGP C;  5KDM A;  3AZL D;  1P3A A;  1KX3 D;  4JJN C;  1B67 A;  3AZE D;  1P34 C;  5B1M D;  4Z2M H;  4Z5T C;  5B2I D;  3FDD A;  3KXB C;  1PZR A;  2UWX A;  3LJA B;  2ZM5 A;  4KUD D;  3C1C A;  5B0Y A;  4WU8 A;  5E5A D;  5GXQ C;  5B0Z C;  4YM6 A;  3W99 C;  2LY8 A;  2IO5 B;  3AV1 A;  3X1V C;  5BT1 C;  1P3G D;  1P3F B;  3AFA A;  3REJ A;  5AVC C;  5B2J B;  5C3I C;  5B24 C;  3REK C;  3C1B B;  5CPJ C;  1KX4 D;  3REL B;  1KX5 C;  3W96 D;  1P3I D;  4WU9 C;  4CAY B;  3P5J B;  1KX3 C;  3AZL C;  5CP6 A;  1F66 D;  2F8N K;  2PYO D;  1TAF B;  3AZM B;  3EG5 B;  2F8N A;  3AV1 B;  1N1J B;  3KUY D;  4J8U A;  4R8P B;  5B33 A;  3A6N A;  4KUD C;  5CHL B;  5E5A C;  3WTP E;  5GT0 A;  1BFM A;  1M18 D;  2FJ7 A;  2L5A A;  1P3A D;  1HQ3 B;  4J8X A;  5CPI B;  3MVD C;  2HUE C;  3MGR D;  2BYM B;  3VH6 A;  3X1U A;  5F99 B;  3B6G B;  4G92 C;  4H9S C;  3WTP B;  2HIO A;  5B31 B;  3AZK A;  1P3O B;  1KX4 C;  3W96 C;  5DNM A;  4ZUX C;  4WZS B;  1P3I C;  5B0Y D;  4WU8 D;  3AZF B;  2YFV A;  4H9N B;  1F66 C;  4H9Q B;  3AZN B;  3REH A;  2PYO C;  3AV1 D;  5AY8 A;  1ZLA A;  3VH5 A;  5B1L A;  3AYW C;  5BNX A;  3AFA D;  4KGC D;  4EO5 C;  2ZY2 A;  5G49 A;  2Y2O A;  3MNN B;  4E44 A;  3NQU B;  4XUJ B;  1F1E A;  3W97 B;  4CSR A;  2Y2M A;  2Y2J A;  5CP6 D;  5AV9 B;  3UTB A;  3WKJ A;  3MGR C;  2CV5 B;  2F8N D;  1EQZ D;  2DQN C;  3UT9 B;  3REL C;  5BO0 A;  3VH5 T;  2G5I C;  3MGP B;  5GSU A;  5B32 A;  4JJN B;  5AV8 A;  4J8U D;  1B6W A;  1P34 B;  5B33 D;  3LZ0 C;  5B0Y C;  2Y2L A;  2Y2Q A;  4Z5T B;  5GT0 D;  3KXB B;  2FJ7 D;  4DRB A;  4J8X D;  3AZG B;  1P3M A;  3AV1 C;  5JA4 A;  1P3K A;  3X1U D;  5GXQ B;  5B0Z B;  5B31 G;  3W99 B;  1TZY D;  3AZK D;  5AV6 A;  3MGQ C;  4KGC C;  3AV2 A;  5DNM D;  3X1V B;  3MGS D;  5CPI C;  5AV5 D;  1P3P A;  3KWQ A;  5AVC B;  4WJ3 C;  3O62 A;  3REK B;  5F99 C;  1KX5 B;  5AVB A;  3WTP C;  5B31 C;  4WU9 B;  1EQZ C;  1ZLA D;  1KX3 B;  3AZL B;  2JCH A;  5B1L D;  3TU4 A;  3AZE B;  4J8U C;  5DNN A;  1ID3 A;  5B2I B;  3AZN C;  5GT0 C;  2NZD D;  4J8W D;  3EPH A;  2FJ7 C;  2FFF B;  4J8X C;  3B6F D;  4KUD B;  5E5A B;  3AZI C;  4XZQ C;  4HGA C;  4UUZ A;  3LEL A;  4G91 B;  1TZY C;  5GSU D;  5B32 D;  4Z2M G;  2HUE B;  3REI A;  5B40 A;  4LD9 D;  3MGS C;  4DRA A;  3X1T A;  5AV5 C;  1P3L A;  4WNN A;  1KX4 B;  1AOI A;  3W96 B;  1P3I B;  3KFU G;  4YS3 A;  1P3K D;  1ZLA C;  3LZ1 A;  1F66 B;  2RVQ C;  2G5H C;  5AV6 D;  1U35 C;  2PYO B;  3AV2 D;  3AZJ A;  1S32 A;  2NZD C;  4J8W C;  3AZG C;  3KUY B;  3LJA A;  3AYW B;  1P3P D;  3KWQ D;  3O62 D;  4EO5 B;  1A7W A;  3B6F C;  3A1I A;  4QLC D;  3H0R C;  3NQJ A;  1P3B D;  3B0D C;  1BH8 B;  1P3A B;  5B32 C;  3TU4 D;  3B0B A;  5DNN D;  4Z66 A;  3MGR B;  4LD9 C;  5B2J A;  2ARO D;  4X23 D;  3LZ0 B;  5B0Y B;  3X1S A;  2NQB D;  3AZE C;  5B1M C;  3LEL D;  5B2I C;  5AV6 C;  1TAF A;  4KHA A;  3AZM A;  3AV2 C;  1HTA A;  4H9O A; 
#chains in the Genus database with same CATH homology
 3REI D;  1N1J A;  5B40 D;  1P3L D;  3AFA B;  4R8P A;  3KWQ C;  3MGQ B;  4KGC B;  1AOI D;  4J8V D;  4G91 C;  4YS3 D;  4QLC C;  1P3B C;  2J8P A;  2ZY4 A;  1HQ3 A;  3LZ1 D;  1P3G C;  1KU5 A;  2BYM A;  2F8N B;  1EQZ B;  3EPL A;  3W98 A;  3AZJ D;  1S32 D;  3C1C D;  1P3O A;  4J8U B;  2ARO C;  1M19 A;  4YM6 D;  5B33 B;  4X23 C;  3EPK A;  5CPK A;  2NQB C;  5GT0 B;  3UTA A;  3WA9 A;  4H9N A;  2FJ7 B;  5FUG B;  3VH6 T;  4J8X B;  3KUY C;  4Z66 D;  3REJ D;  3AZI B;  4XZQ B;  4HGA B;  3X1U B;  1TZY B;  1M18 C;  1AOI C;  3MNN A;  4J8V C;  5DNM B;  1P3A C;  3X1S D;  3H0M C;  3MGS B;  3AZH A;  4H9P B;  2YFW B;  5AV5 B;  2YFV B;  3LZ1 C;  4AWL C;  3AN2 A;  2CV5 A;  3VH6 W;  3UT9 A;  3F6T A;  5BS7 A;  3AZJ C;  1ZLA B;  3MGP A;  3A6N D;  3C1C C;  4JJN A;  5B1L B;  4WU8 C;  1U35 B;  4YM6 C;  5G49 B;  3KXB A;  2NZD B;  4J8W B;  2DF4 C;  1M1A A;  1HQ3 D;  3B6F B;  2F8N G;  1H3O B;  4Z66 C;  2HIO D;  3AFA C;  3REJ C;  3VH5 W;  3B0D B;  5B0Z A;  5GXQ A;  3W98 D;  3V9R A;  5BNV A;  4H9R A;  1ULY A;  1P3O D;  5GSU B;  5B32 B;  1M19 D;  3B0C T;  3X1V A;  5CP6 C;  5CPK D;  3X1S C;  2JSS A;  4LD9 B;  1Q9C A;  3REH D;  3UTA D;  3WA9 D;  5B24 A;  3REK A;  5AY8 D;  5CPJ A;  1KX5 A;  4WU9 A;  4NE3 A;  4NE6 A;  5GT3 A;  1KX3 A;  5B1M B;  5JA4 B;  1P3K B;  3A6N C;  3EPJ A;  5B33 C;  3WAA A;  3R45 A;  2XD5 A;  2BYK A;  5AV6 B;  3AV2 B;  3MNN D;  3A1K A;  1BH9 A;  4NFT A;  3AZH D;  1JFI A;  3UTB D;  3WKJ D;  1P3P B;  5JRG A;  3KWQ B;  3X1U C;  3O62 B;  3AN2 D;  4KUD A;  2CV5 D;  2HIO C;  4QLC B;  3AZK C;  1P3B B;  5AV8 D;  5DNM C;  4JJN D;  3TU4 B;  5DNN B;  3MVD A;  1P3G B;  2RIQ A;  4ZBJ C;  5CPK C;  3REH C;  3UTA C;  4DQY B;  2BG1 A;  1M1A D;  1P3M D;  1KX4 A;  5AY8 C;  2ARO B;  4ZUX A;  1WWI A;  4X23 B;  5B1L C;  2NQB B;  5GXQ D;  4UUZ B;  1F66 A;  5B32 G;  2Y2N A;  2Y2H A;  5BT1 D;  5B40 B;  3AYW A;  5AVB D;  3AZH C;  3UTB C;  3WKJ C;  5B24 D;  5CPJ D;  1M18 B;  1AOI B;  4J8V B;  4WU9 D;  5KDM B;  1BH8 A;  5GSU C;  5AV8 C;  5GT3 D;  1ID3 D;  3WAA D;  3LZ1 B;  4AWL B;  1P3F A;  3MGR A;  3C1B A;  3REL A;  3AZJ B;  2JE5 A;  1S32 B;  3C1C B;  1M1A C;  2Y2K A;  4CAY A;  4WU8 B;  1P3M C;  5JRG D;  1P3K C;  4YM6 B;  3LZ0 A;  3NQJ B;  4KGC A;  3MVD D;  3X1T D;  4Z66 B;  3REJ B;  1P3P C;  3O62 C;  3IP4 C;  2VQR A;  1T3U A;  5AVB C;  3MGQ A;  4ZUX D;  4E45 A;  5CP6 B;  3X1S B;  3TU4 C;  5CPI A;  5GT3 C;  5DNN C;  1W2E A;  2Y2P A;  1ID3 C;  3WAA C;  5F99 A;  3B6G A;  3WTP A;  4KHA B;  5B31 A;  1EQZ A;  3LJA D;  4H9O B;  3A6N B;  3AYW D;  3AZF A;  1Z2C B;  5JRG C;  3LEL C;  4H9Q A;  3AZN A;  5FUG A;  2ZY3 A;  3REI C;  5B40 C;  1P3F D;  3AZI A;  3X1T C;  4XZQ A;  2HIO B;  5B2J D;  3AZK B;  1P3L C;  3C1B D;  3W98 B;  3REL D;  1TZY A;  3NQU A;  4XUJ A;  4YS3 C;  3W97 A;  1M19 B;  2XD1 A;  3LZ0 D;  5AV9 A;  4ZBJ B;  5CPK B;  3MGS A;  4H9P A;  2YFW A;  5AV5 A;  3REH B;  3UTA B;  3AZM D;  3WA9 B;  5AY8 B;  2F2A C;  1S32 C;  1P34 A;  3LJA C;  5BNX B;  4R8P D;  4Z5T A;  3MGQ D;  1U35 A;  2ZY5 A;  4CSR B;  2NZD A;  4J8W A;  3AZG A;  5CPI D;  2IO5 C;  3AZH B;  3UTB B;  3WKJ B;  5F99 D;  3B6G D;  3AN2 B;  3B6F A;  3W99 A;  1H3O A;  5BO0 B;  5B31 D;  3WTP D;  1P3F C;  5B2J C;  3AL0 C;  3C1B C;  5AV8 B;  3AZF D;  5AVC A;  3AZN D;  4LD9 A;  3AZM C;  1M1A B;  1P3M B;  3AZL A;  2Y2I A;  4UPK A;  4XZQ D;  3AZE A;  5B1M A;  4R8P C;  3AZI D;  3V9R B;  5BNV B;  4H9R B;  5B2I A;  4XUJ D;  3B0C W;  3W97 D;  1HQ3 C;  5AV9 D;  1R4V A;  5E5A A;  5AVB B;  5B24 B;  5C3I B;  3UT9 D;  5CPJ B;  3W98 C;  3B6G C;  3MGP D;  4QLC A;  1P3B A;  1P3O C;  2F8N H;  1P34 D;  2W8S A;  1M19 C;  5GT3 B;  1ID3 B;  3WAA B;  4Z5T D;  3R45 B;  2RVQ D;  3AZF C;  4H9S A;  2BYK B;  3KXB D;  4WV4 B;  1U35 D;  1P3G A;  3WA9 C;  3W96 A;  1BH9 B;  1P3I A;  3H0L C;  3AZG D;  2Y2G A;  1JFI B;  2ARO A;  1WWS A;  5JRG B;  5B0Z D;  3W99 D;  4X23 A;  3LEL B;  2NQB A;  2PYO A;  2CWE A;  3MNN C;  3X1V D;  4XUJ C;  3REI B;  3KUY A;  3KSY A;  3W97 C;  3MVD B;  3X1T B;  5AVC D;  1P3L B;  3REK D;  4M6B A;  4WNN B;  1KX5 D;  5AV9 C;  3AN2 C;  4G92 B;  2CV5 C;  4YS3 B;  3UT9 C;  1M18 A;  5BS7 C;  4J8V A;  4NE5 A;  4ZUX B;  3MGP C;  5KDM A;  3AZL D;  1P3A A;  1KX3 D;  4JJN C;  1B67 A;  3AZE D;  1P34 C;  5B1M D;  4Z2M H;  4Z5T C;  5B2I D;  3FDD A;  3KXB C;  1PZR A;  2UWX A;  3LJA B;  2ZM5 A;  4KUD D;  3C1C A;  5B0Y A;  4WU8 A;  5E5A D;  5GXQ C;  5B0Z C;  4YM6 A;  3W99 C;  2LY8 A;  2IO5 B;  3AV1 A;  3X1V C;  5BT1 C;  1P3G D;  1P3F B;  3AFA A;  3REJ A;  5AVC C;  5B2J B;  5C3I C;  5B24 C;  3REK C;  3C1B B;  5CPJ C;  1KX4 D;  3REL B;  1KX5 C;  3W96 D;  1P3I D;  4WU9 C;  4CAY B;  3P5J B;  1KX3 C;  3AZL C;  5CP6 A;  1F66 D;  2F8N K;  2PYO D;  1TAF B;  3AZM B;  3EG5 B;  2F8N A;  3AV1 B;  1N1J B;  3KUY D;  4J8U A;  4R8P B;  5B33 A;  3A6N A;  4KUD C;  5CHL B;  5E5A C;  3WTP E;  5GT0 A;  1BFM A;  1M18 D;  2FJ7 A;  2L5A A;  1P3A D;  1HQ3 B;  4J8X A;  5CPI B;  3MVD C;  2HUE C;  3MGR D;  2BYM B;  3VH6 A;  3X1U A;  5F99 B;  3B6G B;  4G92 C;  4H9S C;  3WTP B;  2HIO A;  5B31 B;  3AZK A;  1P3O B;  1KX4 C;  3W96 C;  5DNM A;  4ZUX C;  4WZS B;  1P3I C;  5B0Y D;  4WU8 D;  3AZF B;  2YFV A;  4H9N B;  1F66 C;  4H9Q B;  3AZN B;  3REH A;  2PYO C;  3AV1 D;  5AY8 A;  1ZLA A;  3VH5 A;  5B1L A;  3AYW C;  5BNX A;  3AFA D;  4KGC D;  4EO5 C;  2ZY2 A;  5G49 A;  2Y2O A;  3MNN B;  4E44 A;  3NQU B;  4XUJ B;  1F1E A;  3W97 B;  4CSR A;  2Y2M A;  2Y2J A;  5CP6 D;  5AV9 B;  3UTB A;  3WKJ A;  3MGR C;  2CV5 B;  2F8N D;  1EQZ D;  2DQN C;  3UT9 B;  3REL C;  5BO0 A;  3VH5 T;  2G5I C;  3MGP B;  5GSU A;  5B32 A;  4JJN B;  5AV8 A;  4J8U D;  1B6W A;  1P34 B;  5B33 D;  3LZ0 C;  5B0Y C;  2Y2L A;  2Y2Q A;  4Z5T B;  5GT0 D;  3KXB B;  2FJ7 D;  4DRB A;  4J8X D;  3AZG B;  1P3M A;  3AV1 C;  5JA4 A;  1P3K A;  3X1U D;  5GXQ B;  5B0Z B;  5B31 G;  3W99 B;  1TZY D;  3AZK D;  5AV6 A;  3MGQ C;  4KGC C;  3AV2 A;  5DNM D;  3X1V B;  3MGS D;  5CPI C;  5AV5 D;  1P3P A;  3KWQ A;  5AVC B;  4WJ3 C;  3O62 A;  3REK B;  5F99 C;  1KX5 B;  5AVB A;  3WTP C;  5B31 C;  4WU9 B;  1EQZ C;  1ZLA D;  1KX3 B;  3AZL B;  2JCH A;  5B1L D;  3TU4 A;  3AZE B;  4J8U C;  5DNN A;  1ID3 A;  5B2I B;  3AZN C;  5GT0 C;  2NZD D;  4J8W D;  3EPH A;  2FJ7 C;  2FFF B;  4J8X C;  3B6F D;  4KUD B;  5E5A B;  3AZI C;  4XZQ C;  4HGA C;  4UUZ A;  3LEL A;  4G91 B;  1TZY C;  5GSU D;  5B32 D;  4Z2M G;  2HUE B;  3REI A;  5B40 A;  4LD9 D;  3MGS C;  4DRA A;  3X1T A;  5AV5 C;  1P3L A;  4WNN A;  1KX4 B;  1AOI A;  3W96 B;  1P3I B;  3KFU G;  4YS3 A;  1P3K D;  1ZLA C;  3LZ1 A;  1F66 B;  2RVQ C;  2G5H C;  5AV6 D;  1U35 C;  2PYO B;  3AV2 D;  3AZJ A;  1S32 A;  2NZD C;  4J8W C;  3AZG C;  3KUY B;  3LJA A;  3AYW B;  1P3P D;  3KWQ D;  3O62 D;  4EO5 B;  1A7W A;  3B6F C;  3A1I A;  4QLC D;  3H0R C;  3NQJ A;  1P3B D;  3B0D C;  1BH8 B;  1P3A B;  5B32 C;  3TU4 D;  3B0B A;  5DNN D;  4Z66 A;  3MGR B;  4LD9 C;  5B2J A;  2ARO D;  4X23 D;  3LZ0 B;  5B0Y B;  3X1S A;  2NQB D;  3AZE C;  5B1M C;  3LEL D;  5B2I C;  5AV6 C;  1TAF A;  4KHA A;  3AZM A;  3AV2 C;  1HTA A;  4H9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...