3W98A

Crystal structure of human nucleosome core particle lacking h3.1 n-terminal region
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w98A00
3O62C 3C1CC 4AWLB 2NZDB 5GXQA 3MGQC 5CPKD 5AV9A 3W99B 3LZ0A 3MGRB 3KUYB 5AV5A 4YS3A 1U35A 1P3GC 4WNNB 2CV5C 2AROD 1S32C 1P3ID 4KUDA 4H9RB 4JJNA 3AZFA 5JA4B 1M19B 5CP6B 1KX3C 1ID3C 2NZDA 5B40B 3W99A 4XUJC 3REHB 3MGRA 3KUYA 4R8PB 3AV1B 1P3PA 2NQBC 2F8ND 4WNNA 2LY8A 5BT1C 5B1LD 4H9RA 5CPID 3X1TD 5JA4A 1EQZD 1M19A 4KGCB 3A6ND 1P3AD 3AZEB 5CP6A 1WWSA 1P3BC 4H9SC 5B40A 3AFAD 4J8XD 3B6GD 3REHA 3AV1A 1P3OD 5AV9C 3LZ0C 2RVQD 3LJAD 4YS3C 3WTPB 3AZFC 5BNVB 4Z66D 5JRGB 1P3KD 2HIOD 1P3MB 4AWLC 5AY8D 2NZDC 4WZSB 3W99C 5G49B 3X1UB 3MGSB 3MGRC 3WTPE 3KUYC 1HQ3D 4LD9D 3X1VB 5DNNB 3REIC 4NE3A 3WTPA 3AZLB 5BNVA 3AZGB 5JRGA 5GT0B 3C1BB 1M18D 1M1AB 4NFTA 1P3MA 1P3FD 2FJ7B 3RELD 5B40C 5GT3B 5G49A 3MNNB 3REHC 3X1UA 5B1MD 4R8PC 3MGSA 3AV1C 1TZYD 3AYWD 2PYOB 3X1VA 5DNNA 3AZLA 4KGCC 3AZGA 3REKD 5CHLB 5GSUD 5GT0A 3C1BA 3AZEC 3MVDD 1M1AA 2HUEB 2FJ7A 1P34B 5GT3A 5E5AB 3MNNA 5B33A 3REJB 5B32B 1KU5A 3AZID 3LZ1D 3AZKD 3VH6W 3WTPC 3AN2D 5JRGC 1P34A 3VH6A 1P3MC 3AZND 5B24D 5E5AA 3TU4C 3REJA 1ULYA 5B32A 1KX5D 3UTBD 3X1UC 3WKJD 3X1VC 5DNNC 3AZGC 3LELD 3KWQB 5AV6C 5BS7A 5B0ZB 5GT3C 3MNNC 2PYOC 4XZQD 5B2ID 3WAAC 1F66D 1BH8B 3WA9C 3B0CT 2HUEC 3KWQA 1P34C 1P3LD 5B0ZA 4DRBA 5B32C 3REJC 3B6FB 4YM6D 3V9RB 1TAFB 3R45B 1BH8A 4J8VC 3W98B 3O62D 5DNMB 3MGQD 4WU8B 1P3GD 2CV5D 1S32D 4JJNB 5BS7C 3B6FA 4ZBJB 2AROB 1TAFA 4CSRB 3R45A 3W98A 1KX3D 3NQJB 1ID3D 3AV2C 5DNMA 4H9NB 5F99C 4WU8A 4XUJD 1P3PB 4DRAA 2NQBD 3KWQC 4HGAB 5BT1D 3W97C 5B0ZC 2AROA 4CSRA 3X1TB 1EQZB 3A6NB 3KXBC 3NQJA 1P3BD 4H9NA 3AFAB 2BYMB 5AV9D 4M6BA 3LZ0D 4Z2MG 4J8WB 1P3OB 4YS3D 2F8NA 5CPIA 3X1TA 1EQZA 3B6FC 5AVBB 3X1SB 3A6NA 4ZUXB 3W98C 4Z66B 5GXQC 2HIOB 3AFAA 5DNMC 4WU8C 2BYMA 3W99D 5AV5C 1U35C 4J8WA 3KUYD 1P3OA 3REID 4KUDC 4JJNC 4LD9B 3X1SA 1H3OB 4ZBJC 5AVBA 2AROC 5AV8D 1ZLAD 2F8NH 4ZUXA 4Z66A 2HIOA 1B6WA 5B40D 5AVCB 1P3PC 3REHD 3AV1D 4R8PD 4HGAC 2L5AA 3AYWB 1HQ3A 1M19C 4KGCD 4LD9A 1H3OA 5CP6C 5C3IB 4G92B 3AZED 1N1JB 5B31B 1M18A 5AVCA 1KX4B 3B0DB 5B33B 3MGPB 4WU9B 3W96B 4J8WC 1P3OC 3AYWA 3AZIB 3AZHD 5B0YD 5B2JB 3WTPD 5AVBC 3X1SC 1N1JA 5JRGD 5B31A 1AOIB 4ZUXC 1KX4A 1P3MD 3MGPA 3TU4D 2IO5B 4WU9A 3AZMB 3W96A 3VH5W 3AZIA 5DNND 5B32G 3UT9B 5B2JA 3WKJB 4LD9C 3VH5A 3AZGD 3UTAD 1AOIA 3LELB 5AV6D 5AVCC 3AZMA 5GT3D 3MGSC 2PYOD 4EO5B 2BYKB 3B0CW 3WAAD 3AZLC 3UT9A 3WKJA 3WA9D 5GT0C 3C1BC 1JFIB 4X23B 4H9PB 5C3IC 4G92C 1M1AC 2FJ7C 3LELA 5B31C 1KX4C 3B0DC 5B33C 3MGPC 4Z5TD 5B32D 4WU9C 1P3LB 2BYKA 3W96C 4J8VD 2CWEA 4YM6B 1JFIA 4X23A 4H9PA 5B2JC 5CPJB 3O62B 4J8UB 3AZJB 4QLCB 1AOIC 5KDMB 5E5AC 2IO5C 3VH6T 1P3LA 3AZMC 3C1CD 4YM6A 1B67A 3UT9C 3WKJC 3AV2D 5CPJA 3O62A 5F99D 1ID3B 4J8UA 5BNXB 3AZJA 4QLCA 5CPKB 5KDMA 4UUZB 4CAYB 3KWQD 2NQBB 3W97D 1P3IB 5B0ZD 4NE6A 3KXBD 3KSYA 1Q9CA 1ID3A 4X23C 5BNXA 1WWIA 5CPKA 4UUZA 4CAYA 2F8NB 2NQBA 1P3IA 2F8NK 5B1LB 5CPIB 1P3AB 1P3LC 2F8NG 3W98D 4E45A 5GXQD 4J8XB 3B6GB 5CPJC 5DNMD 4WU8D 5AV5D 4J8UC 3AZJC 4QLCC 1U35D 3LJAB 5B1LA 4KUDD 4JJND 3AZFD 1P3AA 3REIB 2YFWA 1A7WA 1P3KB 5AV8B 2NZDD 4J8XA 1ZLAB 3B6GA 5AY8B 4G91B 3MGRD 1P3PD 5CPKC 3LJAA 1HQ3B 1M19D 1P3IC 3REIA 5CP6D 1P3KA 1M18B 5AV8A 1ZLAA 5AY8A 1P3FB 4WV4B 3RELB 5B1MB 1TZYB 4R8PA 4J8WD 5B1LC 5CPIC 3X1TC 1EQZC 3REKB 5GSUB 3A6NC 1P3AC 4H9QB 3AZHB 5AVBD 3X1SD 3MVDB 5B0YB 4KGCA 4KHAB 3AZEA 1P3FA 4ZUXD 1BFMA 3RELA 3AFAC 4J8XC 3B6GC 5B1MA 3TU4B 1TZYA 5B31G 2YFVB 3LZ1B 2RVQC 3LJAC 4Z2MH 3REKA 3AZKB 5GSUA 4H9QA 3AZHA 3MVDA 5B0YA 3AN2B 4KHAA 4Z66C 1P3KC 2HIOC 2JSSA 5AV8C 4E44A 3UTAB 1ZLAC 3AZNB 5B24B 5AY8C 4G91C 5AVCD 3X1UD 3MGSD 5AV6B 3TU4A 1KX5B 3X1VD 2YFVA 3UTBB 3LZ1A 1HQ3C 3AZLD 3AZKA 3WAAB 5GT0D 3C1BD 3AN2A 1M1AD 3WA9B 1M18C 2FJ7D 3UTAA 4NE5A 5B31D 3AZNA 5B24A 1P3FC 3MNND 1KX4D 3RELC 5B33D 5AV6A 3MGPD 1KX5A 4WU9D 3UTBA 5B1MC 4XZQB 5B2IB 3W96D 1TZYC 3AYWC 4Z5TB 2PYOA 1F66B 3WAAA 4J8VB 3REKC 5B2JD 5GSUC 3WA9A 3AZHC 3MVDC 5B0YC 1P34D 1AOID 5E5AD 3REJD 3AZMD 4XZQA 4H9OB 5B2IA 3AZIC 4Z5TA 1F66A 3LZ1C 4J8VA 3C1CB 3UT9D 3AZKC 3MGQB 3AN2C 3AV2B 5F99B 3VH5T 3UTAC 3AZNC 1P3GB 5B24C 2CV5B 1S32B 4H9OA 1KX5C 3W97B 5BO0B 3UTBC 1KX3B 3C1CA 1BH9B 3KXBB 3MGQA 5FUGB 4X23D 3AV2A 4XUJB 3LELC 5F99A 1P3GA 2CV5A 1S32A 4EO5C 3W97A 5BO0A 4XZQC 5B2IC 1KX3A 3NQUB 4Z5TC 1P3BB 1F66C 1BH9A 3KXBA 5FUGA 3B0BA 4XUJA 5CPJD 5GXQB 4J8UD 3AZJD 4QLCD 5AV9B 3LZ0B 5AV5B 4YS3B 1U35B 1HTAA 1R4VA 3B6FD 1F1EA 2YFWB 4KUDB 3AZFB 3NQUA 4YM6C 1P3BA 4H9SA 3V9RA
chains in the Genus database with same CATH superfamily
3O62C 3C1CC 4AWLB 2NZDB 5GXQA 3MGQC 5CPKD 5AV9A 3W99B 3LZ0A 3MGRB 3KUYB 5AV5A 4YS3A 1U35A 1P3GC 4WNNB 2ZY2A 2AROD 2CV5C 1S32C 1P3ID 4KUDA 2W8SA 4H9RB 4JJNA 3AZFA 5JA4B 1M19B 3IP4C 5CP6B 1KX3C 1ID3C 2NZDA 5B40B 3EG5B 3W99A 4XUJC 3REHB 3MGRA 3KUYA 4R8PB 3AV1B 1P3PA 2NQBC 2F8ND 4WNNA 2LY8A 5BT1C 5B1LD 4H9RA 5CPID 3X1TD 5JA4A 1EQZD 1M19A 4KGCB 3A6ND 1P3AD 3AZEB 5CP6A 1WWSA 1P3BC 4H9SC 5B40A 3AFAD 4J8XD 3B6GD 3REHA 3AV1A 1P3OD 5AV9C 3LZ0C 2RVQD 3LJAD 4YS3C 3WTPB 3AZFC 5BNVB 4Z66D 5JRGB 1P3KD 2HIOD 1P3MB 3H0RC 4AWLC 5AY8D 2NZDC 4WZSB 3W99C 5G49B 2JCHA 3X1UB 3MGSB 3WTPE 3MGRC 3KUYC 1HQ3D 4LD9D 3X1VB 5DNNB 3REIC 4NE3A 3WTPA 3AZLB 5BNVA 3AZGB 5JRGA 5GT0B 3C1BB 1M18D 1M1AB 4NFTA 1P3MA 1P3FD 2FJ7B 3RELD 5B40C 5GT3B 5G49A 3MNNB 3REHC 3X1UA 5B1MD 4R8PC 3MGSA 3AV1C 1TZYD 3AYWD 2PYOB 3X1VA 5DNNA 3AZLA 4KGCC 3AZGA 3REKD 2DQNC 5CHLB 5GSUD 5GT0A 3C1BA 3AZEC 3MVDD 1M1AA 2HUEB 2FJ7A 1P34B 5GT3A 5E5AB 3MNNA 3FDDA 5B33A 3REJB 5B32B 1KU5A 3AZID 3LZ1D 3AZKD 3VH6W 3WTPC 3AN2D 5JRGC 1P34A 3VH6A 1P3MC 3AZND 5B24D 5E5AA 3TU4C 3REJA 1ULYA 5B32A 1KX5D 3UTBD 3X1UC 3WKJD 3X1VC 5DNNC 3AZGC 3LELD 2Y2QA 3KWQB 5AV6C 5BS7A 5B0ZB 5GT3C 3MNNC 2PYOC 4XZQD 5B2ID 3WAAC 1F66D 1BH8B 3WA9C 3B0CT 2HUEC 3KWQA 1P34C 1P3LD 5B0ZA 4DRBA 5B32C 3REJC 3B6FB 4YM6D 3V9RB 1TAFB 3R45B 1BH8A 4J8VC 3P5JB 3W98B 1T3UA 3O62D 5DNMB 3MGQD 4WU8B 1P3GD 2CV5D 1S32D 4JJNB 3AL0C 5BS7C 3B6FA 4ZBJB 2AROB 1TAFA 4CSRB 3R45A 3W98A 1KX3D 3NQJB 1ID3D 3AV2C 5DNMA 2ZY4A 4H9NB 5F99C 4WU8A 4XUJD 1P3PB 4DRAA 2NQBD 3KWQC 4HGAB 5BT1D 3W97C 5B0ZC 2AROA 4CSRA 3X1TB 1EQZB 3A6NB 3KXBC 3NQJA 1P3BD 4H9NA 3AFAB 2BYMB 5AV9D 4M6BA 3LZ0D 4Z2MG 4J8WB 1P3OB 4YS3D 2F8NA 5CPIA 3X1TA 1EQZA 3B6FC 5AVBB 3X1SB 3A6NA 4ZUXB 3W98C 4Z66B 5GXQC 2HIOB 3AFAA 5DNMC 4WU8C 2BYMA 3W99D 5AV5C 1U35C 4J8WA 3KUYD 1P3OA 3REID 4KUDC 4JJNC 4LD9B 3X1SA 1H3OB 4ZBJC 5AVBA 2AROC 5AV8D 1ZLAD 2F8NH 4ZUXA 4Z66A 2HIOA 1B6WA 5B40D 5AVCB 1P3PC 3REHD 1W2EA 3AV1D 4R8PD 4HGAC 2L5AA 3AYWB 1HQ3A 1M19C 4KGCD 4LD9A 1H3OA 2DF4C 5CP6C 5C3IB 4G92B 3AZED 1N1JB 5B31B 2VQRA 1M18A 5AVCA 1KX4B 3B0DB 5B33B 2Y2LA 3MGPB 4WU9B 2Y2KA 3W96B 2Y2OA 2ZY3A 4J8WC 1P3OC 3AYWA 3AZIB 3AZHD 5B0YD 3EPJA 5B2JB 3WTPD 5AVBC 3X1SC 1N1JA 5JRGD 5B31A 1AOIB 4ZUXC 1KX4A 1P3MD 3MGPA 3TU4D 2IO5B 4WU9A 3AZMB 3W96A 3VH5W 3AZIA 5DNND 5B32G 3UT9B 5B2JA 3WKJB 4LD9C 3VH5A 3AZGD 3UTAD 1AOIA 3LELB 5AV6D 5AVCC 3AZMA 5GT3D 3MGSC 2PYOD 4EO5B 2BYKB 3B0CW 3WAAD 2Y2NA 3AZLC 3UT9A 3WKJA 3WA9D 5GT0C 3C1BC 1JFIB 4X23B 4H9PB 5C3IC 4G92C 2XD1A 1M1AC 2BG1A 2FJ7C 3LELA 5B31C 3EPLA 1KX4C 3B0DC 5B33C 3MGPC 4Z5TD 5B32D 4WU9C 1P3LB 2BYKA 3W96C 2ZY5A 4J8VD 2CWEA 4YM6B 1JFIA 4X23A 4H9PA 5B2JC 2ZM5A 5CPJB 3O62B 4J8UB 3AZJB 4QLCB 1AOIC 5KDMB 5E5AC 2Y2MA 2IO5C 3VH6T 1P3LA 3AZMC 3C1CD 4YM6A 3EPHA 1B67A 3UT9C 3WKJC 3AV2D 5CPJA 3O62A 5F99D 1ID3B 2UWXA 4J8UA 5BNXB 3AZJA 4QLCA 5CPKB 5KDMA 4UUZB 4CAYB 3KWQD 2NQBB 3W97D 1P3IB 5B0ZD 4NE6A 3KXBD 3KSYA 3KFUG 3A1KA 1Q9CA 1ID3A 4X23C 5BNXA 1WWIA 5CPKA 4UUZA 4CAYA 2F8NB 2NQBA 1P3IA 2F8NK 5B1LB 5CPIB 3EPKA 1P3AB 1P3LC 2G5HC 2F8NG 3W98D 4E45A 3F6TA 5GXQD 4J8XB 3B6GB 5CPJC 5DNMD 4WU8D 5AV5D 4J8UC 3AZJC 4QLCC 1U35D 3LJAB 5B1LA 4KUDD 4JJND 3AZFD 1P3AA 2FFFB 3REIB 2YFWA 1A7WA 1P3KB 5AV8B 2NZDD 4J8XA 1ZLAB 3B6GA 5AY8B 4G91B 3MGRD 1P3PD 5CPKC 3LJAA 1HQ3B 1M19D 1P3IC 3REIA 5CP6D 1P3KA 1M18B 5AV8A 1ZLAA 5AY8A 1P3FB 4WV4B 3RELB 2Y2GA 2Y2JA 5B1MB 2Y2PA 1TZYB 4R8PA 3H0LC 4J8WD 5B1LC 5CPIC 2F2AC 3X1TC 1EQZC 3REKB 5GSUB 3A6NC 1P3AC 4H9QB 3AZHB 5AVBD 3X1SD 3MVDB 5B0YB 4KGCA 4KHAB 3AZEA 1P3FA 4ZUXD 1BFMA 3RELA 3AFAC 4J8XC 3B6GC 5B1MA 3TU4B 1TZYA 5B31G 2YFVB 3A1IA 3LZ1B 2RVQC 3LJAC 4Z2MH 3REKA 3AZKB 5GSUA 4H9QA 3AZHA 3MVDA 5B0YA 3AN2B 4KHAA 4Z66C 4UPKA 1P3KC 2HIOC 2JSSA 5AV8C 4E44A 3UTAB 1ZLAC 3AZNB 5B24B 5AY8C 4G91C 5AVCD 3X1UD 3MGSD 5AV6B 3TU4A 1KX5B 1PZRA 3X1VD 2YFVA 3UTBB 3LZ1A 1HQ3C 3AZLD 3AZKA 3WAAB 5GT0D 2Y2HA 3C1BD 3AN2A 1M1AD 3WA9B 1M18C 2FJ7D 2Y2IA 4NE5A 3UTAA 5B31D 3AZNA 5B24A 1P3FC 3MNND 1KX4D 3RELC 5B33D 5AV6A 3MGPD 1KX5A 2XD5A 4WU9D 3UTBA 5B1MC 4XZQB 5B2IB 3W96D 1TZYC 3AYWC 4Z5TB 2PYOA 1F66B 3WAAA 4J8VB 3REKC 5B2JD 5GSUC 3WA9A 3AZHC 3MVDC 3H0MC 5B0YC 1P34D 1AOID 5E5AD 3REJD 3AZMD 4XZQA 4H9OB 5B2IA 3AZIC 4Z5TA 1F66A 3LZ1C 4J8VA 3C1CB 3UT9D 3AZKC 3MGQB 3AN2C 3AV2B 5F99B 3VH5T 3UTAC 3AZNC 1P3GB 5B24C 2CV5B 1S32B 4H9OA 1KX5C 3W97B 2G5IC 5BO0B 3UTBC 1KX3B 3C1CA 1BH9B 3KXBB 3MGQA 5FUGB 4X23D 3AV2A 4XUJB 3LELC 5F99A 1P3GA 2CV5A 1S32A 2JE5A 4EO5C 3W97A 4DQYB 5BO0A 4XZQC 5B2IC 1KX3A 3NQUB 4Z5TC 1P3BB 1F66C 4WJ3C 1BH9A 3KXBA 5FUGA 3B0BA 4XUJA 5CPJD 5GXQB 4J8UD 3AZJD 4QLCD 5AV9B 3LZ0B 5AV5B 4YS3B 2RIQA 1U35B 1HTAA 1R4VA 1Z2CB 3B6FD 1F1EA 2YFWB 4KUDB 3AZFB 3NQUA 4YM6C 1P3BA 4H9SA 3V9RA 2J8PA
chains in the Genus database with same CATH topology
3O62C 3C1CC 4AWLB 2NZDB 5GXQA 3MGQC 5CPKD 5AV9A 3W99B 3LZ0A 3MGRB 3KUYB 5AV5A 4YS3A 1U35A 1P3GC 4WNNB 2ZY2A 2AROD 2CV5C 1S32C 1P3ID 4KUDA 2W8SA 4H9RB 4JJNA 3AZFA 5JA4B 1M19B 3IP4C 5CP6B 1KX3C 1ID3C 2NZDA 5B40B 3EG5B 3W99A 4XUJC 3REHB 3MGRA 3KUYA 4R8PB 3AV1B 1P3PA 2NQBC 2F8ND 4WNNA 2LY8A 5BT1C 5B1LD 4H9RA 5CPID 3X1TD 5JA4A 1EQZD 1M19A 4KGCB 3A6ND 1P3AD 3AZEB 5CP6A 1WWSA 1P3BC 4H9SC 5B40A 3AFAD 4J8XD 3B6GD 3REHA 3AV1A 1P3OD 5AV9C 3LZ0C 2RVQD 3LJAD 4YS3C 3WTPB 3AZFC 5BNVB 4Z66D 5JRGB 1P3KD 2HIOD 1P3MB 3H0RC 4AWLC 5AY8D 2NZDC 4WZSB 3W99C 5G49B 2JCHA 3X1UB 3MGSB 3WTPE 3MGRC 3KUYC 1HQ3D 4LD9D 3X1VB 5DNNB 3REIC 4NE3A 3WTPA 3AZLB 5BNVA 3AZGB 5JRGA 5GT0B 3C1BB 1M18D 1M1AB 4NFTA 1P3MA 1P3FD 2FJ7B 3RELD 5B40C 5GT3B 5G49A 3MNNB 3REHC 3X1UA 5B1MD 4R8PC 3MGSA 3AV1C 1TZYD 3AYWD 2PYOB 3X1VA 5DNNA 3AZLA 4KGCC 3AZGA 3REKD 2DQNC 5CHLB 5GSUD 5GT0A 3C1BA 3AZEC 3MVDD 1M1AA 2HUEB 2FJ7A 1P34B 5GT3A 5E5AB 3MNNA 3FDDA 5B33A 3REJB 5B32B 1KU5A 3AZID 3LZ1D 3AZKD 3VH6W 3WTPC 3AN2D 5JRGC 1P34A 3VH6A 1P3MC 3AZND 5B24D 5E5AA 3TU4C 3REJA 1ULYA 5B32A 1KX5D 3UTBD 3X1UC 3WKJD 3X1VC 5DNNC 3AZGC 3LELD 2Y2QA 3KWQB 5AV6C 5BS7A 5B0ZB 5GT3C 3MNNC 2PYOC 4XZQD 5B2ID 3WAAC 1F66D 1BH8B 3WA9C 3B0CT 2HUEC 3KWQA 1P34C 1P3LD 5B0ZA 4DRBA 5B32C 3REJC 3B6FB 4YM6D 3V9RB 1TAFB 3R45B 1BH8A 4J8VC 3P5JB 3W98B 1T3UA 3O62D 5DNMB 3MGQD 4WU8B 1P3GD 2CV5D 1S32D 4JJNB 3AL0C 5BS7C 3B6FA 4ZBJB 2AROB 1TAFA 4CSRB 3R45A 3W98A 1KX3D 3NQJB 1ID3D 3AV2C 5DNMA 2ZY4A 4H9NB 5F99C 4WU8A 4XUJD 1P3PB 4DRAA 2NQBD 3KWQC 4HGAB 5BT1D 3W97C 5B0ZC 2AROA 4CSRA 3X1TB 1EQZB 3A6NB 3KXBC 3NQJA 1P3BD 4H9NA 3AFAB 2BYMB 5AV9D 4M6BA 3LZ0D 4Z2MG 4J8WB 1P3OB 4YS3D 2F8NA 5CPIA 3X1TA 1EQZA 3B6FC 5AVBB 3X1SB 3A6NA 4ZUXB 3W98C 4Z66B 5GXQC 2HIOB 3AFAA 5DNMC 4WU8C 2BYMA 3W99D 5AV5C 1U35C 4J8WA 3KUYD 1P3OA 3REID 4KUDC 4JJNC 4LD9B 3X1SA 1H3OB 4ZBJC 5AVBA 2AROC 5AV8D 1ZLAD 2F8NH 4ZUXA 4Z66A 2HIOA 1B6WA 5B40D 5AVCB 1P3PC 3REHD 1W2EA 3AV1D 4R8PD 4HGAC 2L5AA 3AYWB 1HQ3A 1M19C 4KGCD 4LD9A 1H3OA 2DF4C 5CP6C 5C3IB 4G92B 3AZED 1N1JB 5B31B 2VQRA 1M18A 5AVCA 1KX4B 3B0DB 5B33B 2Y2LA 3MGPB 4WU9B 2Y2KA 3W96B 2Y2OA 2ZY3A 4J8WC 1P3OC 3AYWA 3AZIB 3AZHD 5B0YD 3EPJA 5B2JB 3WTPD 5AVBC 3X1SC 1N1JA 5JRGD 5B31A 1AOIB 4ZUXC 1KX4A 1P3MD 3MGPA 3TU4D 2IO5B 4WU9A 3AZMB 3W96A 3VH5W 3AZIA 5DNND 5B32G 3UT9B 5B2JA 3WKJB 4LD9C 3VH5A 3AZGD 3UTAD 1AOIA 3LELB 5AV6D 5AVCC 3AZMA 5GT3D 3MGSC 2PYOD 4EO5B 2BYKB 3B0CW 3WAAD 2Y2NA 3AZLC 3UT9A 3WKJA 3WA9D 5GT0C 3C1BC 1JFIB 4X23B 4H9PB 5C3IC 4G92C 2XD1A 1M1AC 2BG1A 2FJ7C 3LELA 5B31C 3EPLA 1KX4C 3B0DC 5B33C 3MGPC 4Z5TD 5B32D 4WU9C 1P3LB 2BYKA 3W96C 2ZY5A 4J8VD 2CWEA 4YM6B 1JFIA 4X23A 4H9PA 5B2JC 2ZM5A 5CPJB 3O62B 4J8UB 3AZJB 4QLCB 1AOIC 5KDMB 5E5AC 2Y2MA 2IO5C 3VH6T 1P3LA 3AZMC 3C1CD 4YM6A 3EPHA 1B67A 3UT9C 3WKJC 3AV2D 5CPJA 3O62A 5F99D 1ID3B 2UWXA 4J8UA 5BNXB 3AZJA 4QLCA 5CPKB 5KDMA 4UUZB 4CAYB 3KWQD 2NQBB 3W97D 1P3IB 5B0ZD 4NE6A 3KXBD 3KSYA 3KFUG 3A1KA 1Q9CA 1ID3A 4X23C 5BNXA 1WWIA 5CPKA 4UUZA 4CAYA 2F8NB 2NQBA 1P3IA 2F8NK 5B1LB 5CPIB 3EPKA 1P3AB 1P3LC 2G5HC 2F8NG 3W98D 4E45A 3F6TA 5GXQD 4J8XB 3B6GB 5CPJC 5DNMD 4WU8D 5AV5D 4J8UC 3AZJC 4QLCC 1U35D 3LJAB 5B1LA 4KUDD 4JJND 3AZFD 1P3AA 2FFFB 3REIB 2YFWA 1A7WA 1P3KB 5AV8B 2NZDD 4J8XA 1ZLAB 3B6GA 5AY8B 4G91B 3MGRD 1P3PD 5CPKC 3LJAA 1HQ3B 1M19D 1P3IC 3REIA 5CP6D 1P3KA 1M18B 5AV8A 1ZLAA 5AY8A 1P3FB 4WV4B 3RELB 2Y2GA 2Y2JA 5B1MB 2Y2PA 1TZYB 4R8PA 3H0LC 4J8WD 5B1LC 5CPIC 2F2AC 3X1TC 1EQZC 3REKB 5GSUB 3A6NC 1P3AC 4H9QB 3AZHB 5AVBD 3X1SD 3MVDB 5B0YB 4KGCA 4KHAB 3AZEA 1P3FA 4ZUXD 1BFMA 3RELA 3AFAC 4J8XC 3B6GC 5B1MA 3TU4B 1TZYA 5B31G 2YFVB 3A1IA 3LZ1B 2RVQC 3LJAC 4Z2MH 3REKA 3AZKB 5GSUA 4H9QA 3AZHA 3MVDA 5B0YA 3AN2B 4KHAA 4Z66C 4UPKA 1P3KC 2HIOC 2JSSA 5AV8C 4E44A 3UTAB 1ZLAC 3AZNB 5B24B 5AY8C 4G91C 5AVCD 3X1UD 3MGSD 5AV6B 3TU4A 1KX5B 1PZRA 3X1VD 2YFVA 3UTBB 3LZ1A 1HQ3C 3AZLD 3AZKA 3WAAB 5GT0D 2Y2HA 3C1BD 3AN2A 1M1AD 3WA9B 1M18C 2FJ7D 2Y2IA 4NE5A 3UTAA 5B31D 3AZNA 5B24A 1P3FC 3MNND 1KX4D 3RELC 5B33D 5AV6A 3MGPD 1KX5A 2XD5A 4WU9D 3UTBA 5B1MC 4XZQB 5B2IB 3W96D 1TZYC 3AYWC 4Z5TB 2PYOA 1F66B 3WAAA 4J8VB 3REKC 5B2JD 5GSUC 3WA9A 3AZHC 3MVDC 3H0MC 5B0YC 1P34D 1AOID 5E5AD 3REJD 3AZMD 4XZQA 4H9OB 5B2IA 3AZIC 4Z5TA 1F66A 3LZ1C 4J8VA 3C1CB 3UT9D 3AZKC 3MGQB 3AN2C 3AV2B 5F99B 3VH5T 3UTAC 3AZNC 1P3GB 5B24C 2CV5B 1S32B 4H9OA 1KX5C 3W97B 2G5IC 5BO0B 3UTBC 1KX3B 3C1CA 1BH9B 3KXBB 3MGQA 5FUGB 4X23D 3AV2A 4XUJB 3LELC 5F99A 1P3GA 2CV5A 1S32A 2JE5A 4EO5C 3W97A 4DQYB 5BO0A 4XZQC 5B2IC 1KX3A 3NQUB 4Z5TC 1P3BB 1F66C 4WJ3C 1BH9A 3KXBA 5FUGA 3B0BA 4XUJA 5CPJD 5GXQB 4J8UD 3AZJD 4QLCD 5AV9B 3LZ0B 5AV5B 4YS3B 2RIQA 1U35B 1HTAA 1R4VA 1Z2CB 3B6FD 1F1EA 2YFWB 4KUDB 3AZFB 3NQUA 4YM6C 1P3BA 4H9SA 3V9RA 2J8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O62 C;  3C1C C;  4AWL B;  2NZD B;  5GXQ A;  3MGQ C;  5CPK D;  5AV9 A;  3W99 B;  3LZ0 A;  3MGR B;  3KUY B;  5AV5 A;  4YS3 A;  1U35 A;  1P3G C;  4WNN B;  2CV5 C;  2ARO D;  1S32 C;  1P3I D;  4KUD A;  4H9R B;  4JJN A;  3AZF A;  5JA4 B;  1M19 B;  5CP6 B;  1KX3 C;  1ID3 C;  2NZD A;  5B40 B;  3W99 A;  4XUJ C;  3REH B;  3MGR A;  3KUY A;  4R8P B;  3AV1 B;  1P3P A;  2NQB C;  2F8N D;  4WNN A;  2LY8 A;  5BT1 C;  5B1L D;  4H9R A;  5CPI D;  3X1T D;  5JA4 A;  1EQZ D;  1M19 A;  4KGC B;  3A6N D;  1P3A D;  3AZE B;  5CP6 A;  1WWS A;  1P3B C;  4H9S C;  5B40 A;  3AFA D;  4J8X D;  3B6G D;  3REH A;  3AV1 A;  1P3O D;  5AV9 C;  3LZ0 C;  2RVQ D;  3LJA D;  4YS3 C;  3WTP B;  3AZF C;  5BNV B;  4Z66 D;  5JRG B;  1P3K D;  2HIO D;  1P3M B;  4AWL C;  5AY8 D;  2NZD C;  4WZS B;  3W99 C;  5G49 B;  3X1U B;  3MGS B;  3MGR C;  3WTP E;  3KUY C;  1HQ3 D;  4LD9 D;  3X1V B;  5DNN B;  3REI C;  4NE3 A;  3WTP A;  3AZL B;  5BNV A;  3AZG B;  5JRG A;  5GT0 B;  3C1B B;  1M18 D;  1M1A B;  4NFT A;  1P3M A;  1P3F D;  2FJ7 B;  3REL D;  5B40 C;  5GT3 B;  5G49 A;  3MNN B;  3REH C;  3X1U A;  5B1M D;  4R8P C;  3MGS A;  3AV1 C;  1TZY D;  3AYW D;  2PYO B;  3X1V A;  5DNN A;  3AZL A;  4KGC C;  3AZG A;  3REK D;  5CHL B;  5GSU D;  5GT0 A;  3C1B A;  3AZE C;  3MVD D;  1M1A A;  2HUE B;  2FJ7 A;  1P34 B;  5GT3 A;  5E5A B;  3MNN A;  5B33 A;  3REJ B;  5B32 B;  1KU5 A;  3AZI D;  3LZ1 D;  3AZK D;  3VH6 W;  3WTP C;  3AN2 D;  5JRG C;  1P34 A;  3VH6 A;  1P3M C;  3AZN D;  5B24 D;  5E5A A;  3TU4 C;  3REJ A;  1ULY A;  5B32 A;  1KX5 D;  3UTB D;  3X1U C;  3WKJ D;  3X1V C;  5DNN C;  3AZG C;  3LEL D;  3KWQ B;  5AV6 C;  5BS7 A;  5B0Z B;  5GT3 C;  3MNN C;  2PYO C;  4XZQ D;  5B2I D;  3WAA C;  1F66 D;  1BH8 B;  3WA9 C;  3B0C T;  2HUE C;  3KWQ A;  1P34 C;  1P3L D;  5B0Z A;  4DRB A;  5B32 C;  3REJ C;  3B6F B;  4YM6 D;  3V9R B;  1TAF B;  3R45 B;  1BH8 A;  4J8V C;  3W98 B;  3O62 D;  5DNM B;  3MGQ D;  4WU8 B;  1P3G D;  2CV5 D;  1S32 D;  4JJN B;  5BS7 C;  3B6F A;  4ZBJ B;  2ARO B;  1TAF A;  4CSR B;  3R45 A;  3W98 A;  1KX3 D;  3NQJ B;  1ID3 D;  3AV2 C;  5DNM A;  4H9N B;  5F99 C;  4WU8 A;  4XUJ D;  1P3P B;  4DRA A;  2NQB D;  3KWQ C;  4HGA B;  5BT1 D;  3W97 C;  5B0Z C;  2ARO A;  4CSR A;  3X1T B;  1EQZ B;  3A6N B;  3KXB C;  3NQJ A;  1P3B D;  4H9N A;  3AFA B;  2BYM B;  5AV9 D;  4M6B A;  3LZ0 D;  4Z2M G;  4J8W B;  1P3O B;  4YS3 D;  2F8N A;  5CPI A;  3X1T A;  1EQZ A;  3B6F C;  5AVB B;  3X1S B;  3A6N A;  4ZUX B;  3W98 C;  4Z66 B;  5GXQ C;  2HIO B;  3AFA A;  5DNM C;  4WU8 C;  2BYM A;  3W99 D;  5AV5 C;  1U35 C;  4J8W A;  3KUY D;  1P3O A;  3REI D;  4KUD C;  4JJN C;  4LD9 B;  3X1S A;  1H3O B;  4ZBJ C;  5AVB A;  2ARO C;  5AV8 D;  1ZLA D;  2F8N H;  4ZUX A;  4Z66 A;  2HIO A;  1B6W A;  5B40 D;  5AVC B;  1P3P C;  3REH D;  3AV1 D;  4R8P D;  4HGA C;  2L5A A;  3AYW B;  1HQ3 A;  1M19 C;  4KGC D;  4LD9 A;  1H3O A;  5CP6 C;  5C3I B;  4G92 B;  3AZE D;  1N1J B;  5B31 B;  1M18 A;  5AVC A;  1KX4 B;  3B0D B;  5B33 B;  3MGP B;  4WU9 B;  3W96 B;  4J8W C;  1P3O C;  3AYW A;  3AZI B;  3AZH D;  5B0Y D;  5B2J B;  3WTP D;  5AVB C;  3X1S C;  1N1J A;  5JRG D;  5B31 A;  1AOI B;  4ZUX C;  1KX4 A;  1P3M D;  3MGP A;  3TU4 D;  2IO5 B;  4WU9 A;  3AZM B;  3W96 A;  3VH5 W;  3AZI A;  5DNN D;  5B32 G;  3UT9 B;  5B2J A;  3WKJ B;  4LD9 C;  3VH5 A;  3AZG D;  3UTA D;  1AOI A;  3LEL B;  5AV6 D;  5AVC C;  3AZM A;  5GT3 D;  3MGS C;  2PYO D;  4EO5 B;  2BYK B;  3B0C W;  3WAA D;  3AZL C;  3UT9 A;  3WKJ A;  3WA9 D;  5GT0 C;  3C1B C;  1JFI B;  4X23 B;  4H9P B;  5C3I C;  4G92 C;  1M1A C;  2FJ7 C;  3LEL A;  5B31 C;  1KX4 C;  3B0D C;  5B33 C;  3MGP C;  4Z5T D;  5B32 D;  4WU9 C;  1P3L B;  2BYK A;  3W96 C;  4J8V D;  2CWE A;  4YM6 B;  1JFI A;  4X23 A;  4H9P A;  5B2J C;  5CPJ B;  3O62 B;  4J8U B;  3AZJ B;  4QLC B;  1AOI C;  5KDM B;  5E5A C;  2IO5 C;  3VH6 T;  1P3L A;  3AZM C;  3C1C D;  4YM6 A;  1B67 A;  3UT9 C;  3WKJ C;  3AV2 D;  5CPJ A;  3O62 A;  5F99 D;  1ID3 B;  4J8U A;  5BNX B;  3AZJ A;  4QLC A;  5CPK B;  5KDM A;  4UUZ B;  4CAY B;  3KWQ D;  2NQB B;  3W97 D;  1P3I B;  5B0Z D;  4NE6 A;  3KXB D;  3KSY A;  1Q9C A;  1ID3 A;  4X23 C;  5BNX A;  1WWI A;  5CPK A;  4UUZ A;  4CAY A;  2F8N B;  2NQB A;  1P3I A;  2F8N K;  5B1L B;  5CPI B;  1P3A B;  1P3L C;  2F8N G;  3W98 D;  4E45 A;  5GXQ D;  4J8X B;  3B6G B;  5CPJ C;  5DNM D;  4WU8 D;  5AV5 D;  4J8U C;  3AZJ C;  4QLC C;  1U35 D;  3LJA B;  5B1L A;  4KUD D;  4JJN D;  3AZF D;  1P3A A;  3REI B;  2YFW A;  1A7W A;  1P3K B;  5AV8 B;  2NZD D;  4J8X A;  1ZLA B;  3B6G A;  5AY8 B;  4G91 B;  3MGR D;  1P3P D;  5CPK C;  3LJA A;  1HQ3 B;  1M19 D;  1P3I C;  3REI A;  5CP6 D;  1P3K A;  1M18 B;  5AV8 A;  1ZLA A;  5AY8 A;  1P3F B;  4WV4 B;  3REL B;  5B1M B;  1TZY B;  4R8P A;  4J8W D;  5B1L C;  5CPI C;  3X1T C;  1EQZ C;  3REK B;  5GSU B;  3A6N C;  1P3A C;  4H9Q B;  3AZH B;  5AVB D;  3X1S D;  3MVD B;  5B0Y B;  4KGC A;  4KHA B;  3AZE A;  1P3F A;  4ZUX D;  1BFM A;  3REL A;  3AFA C;  4J8X C;  3B6G C;  5B1M A;  3TU4 B;  1TZY A;  5B31 G;  2YFV B;  3LZ1 B;  2RVQ C;  3LJA C;  4Z2M H;  3REK A;  3AZK B;  5GSU A;  4H9Q A;  3AZH A;  3MVD A;  5B0Y A;  3AN2 B;  4KHA A;  4Z66 C;  1P3K C;  2HIO C;  2JSS A;  5AV8 C;  4E44 A;  3UTA B;  1ZLA C;  3AZN B;  5B24 B;  5AY8 C;  4G91 C;  5AVC D;  3X1U D;  3MGS D;  5AV6 B;  3TU4 A;  1KX5 B;  3X1V D;  2YFV A;  3UTB B;  3LZ1 A;  1HQ3 C;  3AZL D;  3AZK A;  3WAA B;  5GT0 D;  3C1B D;  3AN2 A;  1M1A D;  3WA9 B;  1M18 C;  2FJ7 D;  3UTA A;  4NE5 A;  5B31 D;  3AZN A;  5B24 A;  1P3F C;  3MNN D;  1KX4 D;  3REL C;  5B33 D;  5AV6 A;  3MGP D;  1KX5 A;  4WU9 D;  3UTB A;  5B1M C;  4XZQ B;  5B2I B;  3W96 D;  1TZY C;  3AYW C;  4Z5T B;  2PYO A;  1F66 B;  3WAA A;  4J8V B;  3REK C;  5B2J D;  5GSU C;  3WA9 A;  3AZH C;  3MVD C;  5B0Y C;  1P34 D;  1AOI D;  5E5A D;  3REJ D;  3AZM D;  4XZQ A;  4H9O B;  5B2I A;  3AZI C;  4Z5T A;  1F66 A;  3LZ1 C;  4J8V A;  3C1C B;  3UT9 D;  3AZK C;  3MGQ B;  3AN2 C;  3AV2 B;  5F99 B;  3VH5 T;  3UTA C;  3AZN C;  1P3G B;  5B24 C;  2CV5 B;  1S32 B;  4H9O A;  1KX5 C;  3W97 B;  5BO0 B;  3UTB C;  1KX3 B;  3C1C A;  1BH9 B;  3KXB B;  3MGQ A;  5FUG B;  4X23 D;  3AV2 A;  4XUJ B;  3LEL C;  5F99 A;  1P3G A;  2CV5 A;  1S32 A;  4EO5 C;  3W97 A;  5BO0 A;  4XZQ C;  5B2I C;  1KX3 A;  3NQU B;  4Z5T C;  1P3B B;  1F66 C;  1BH9 A;  3KXB A;  5FUG A;  3B0B A;  4XUJ A;  5CPJ D;  5GXQ B;  4J8U D;  3AZJ D;  4QLC D;  5AV9 B;  3LZ0 B;  5AV5 B;  4YS3 B;  1U35 B;  1HTA A;  1R4V A;  3B6F D;  1F1E A;  2YFW B;  4KUD B;  3AZF B;  3NQU A;  4YM6 C;  1P3B A;  4H9S A;  3V9R A; 
#chains in the Genus database with same CATH topology
 3O62 C;  3C1C C;  4AWL B;  2NZD B;  5GXQ A;  3MGQ C;  5CPK D;  5AV9 A;  3W99 B;  3LZ0 A;  3MGR B;  3KUY B;  5AV5 A;  4YS3 A;  1U35 A;  1P3G C;  4WNN B;  2ZY2 A;  2ARO D;  2CV5 C;  1S32 C;  1P3I D;  4KUD A;  2W8S A;  4H9R B;  4JJN A;  3AZF A;  5JA4 B;  1M19 B;  3IP4 C;  5CP6 B;  1KX3 C;  1ID3 C;  2NZD A;  5B40 B;  3EG5 B;  3W99 A;  4XUJ C;  3REH B;  3MGR A;  3KUY A;  4R8P B;  3AV1 B;  1P3P A;  2NQB C;  2F8N D;  4WNN A;  2LY8 A;  5BT1 C;  5B1L D;  4H9R A;  5CPI D;  3X1T D;  5JA4 A;  1EQZ D;  1M19 A;  4KGC B;  3A6N D;  1P3A D;  3AZE B;  5CP6 A;  1WWS A;  1P3B C;  4H9S C;  5B40 A;  3AFA D;  4J8X D;  3B6G D;  3REH A;  3AV1 A;  1P3O D;  5AV9 C;  3LZ0 C;  2RVQ D;  3LJA D;  4YS3 C;  3WTP B;  3AZF C;  5BNV B;  4Z66 D;  5JRG B;  1P3K D;  2HIO D;  1P3M B;  3H0R C;  4AWL C;  5AY8 D;  2NZD C;  4WZS B;  3W99 C;  5G49 B;  2JCH A;  3X1U B;  3MGS B;  3WTP E;  3MGR C;  3KUY C;  1HQ3 D;  4LD9 D;  3X1V B;  5DNN B;  3REI C;  4NE3 A;  3WTP A;  3AZL B;  5BNV A;  3AZG B;  5JRG A;  5GT0 B;  3C1B B;  1M18 D;  1M1A B;  4NFT A;  1P3M A;  1P3F D;  2FJ7 B;  3REL D;  5B40 C;  5GT3 B;  5G49 A;  3MNN B;  3REH C;  3X1U A;  5B1M D;  4R8P C;  3MGS A;  3AV1 C;  1TZY D;  3AYW D;  2PYO B;  3X1V A;  5DNN A;  3AZL A;  4KGC C;  3AZG A;  3REK D;  2DQN C;  5CHL B;  5GSU D;  5GT0 A;  3C1B A;  3AZE C;  3MVD D;  1M1A A;  2HUE B;  2FJ7 A;  1P34 B;  5GT3 A;  5E5A B;  3MNN A;  3FDD A;  5B33 A;  3REJ B;  5B32 B;  1KU5 A;  3AZI D;  3LZ1 D;  3AZK D;  3VH6 W;  3WTP C;  3AN2 D;  5JRG C;  1P34 A;  3VH6 A;  1P3M C;  3AZN D;  5B24 D;  5E5A A;  3TU4 C;  3REJ A;  1ULY A;  5B32 A;  1KX5 D;  3UTB D;  3X1U C;  3WKJ D;  3X1V C;  5DNN C;  3AZG C;  3LEL D;  2Y2Q A;  3KWQ B;  5AV6 C;  5BS7 A;  5B0Z B;  5GT3 C;  3MNN C;  2PYO C;  4XZQ D;  5B2I D;  3WAA C;  1F66 D;  1BH8 B;  3WA9 C;  3B0C T;  2HUE C;  3KWQ A;  1P34 C;  1P3L D;  5B0Z A;  4DRB A;  5B32 C;  3REJ C;  3B6F B;  4YM6 D;  3V9R B;  1TAF B;  3R45 B;  1BH8 A;  4J8V C;  3P5J B;  3W98 B;  1T3U A;  3O62 D;  5DNM B;  3MGQ D;  4WU8 B;  1P3G D;  2CV5 D;  1S32 D;  4JJN B;  3AL0 C;  5BS7 C;  3B6F A;  4ZBJ B;  2ARO B;  1TAF A;  4CSR B;  3R45 A;  3W98 A;  1KX3 D;  3NQJ B;  1ID3 D;  3AV2 C;  5DNM A;  2ZY4 A;  4H9N B;  5F99 C;  4WU8 A;  4XUJ D;  1P3P B;  4DRA A;  2NQB D;  3KWQ C;  4HGA B;  5BT1 D;  3W97 C;  5B0Z C;  2ARO A;  4CSR A;  3X1T B;  1EQZ B;  3A6N B;  3KXB C;  3NQJ A;  1P3B D;  4H9N A;  3AFA B;  2BYM B;  5AV9 D;  4M6B A;  3LZ0 D;  4Z2M G;  4J8W B;  1P3O B;  4YS3 D;  2F8N A;  5CPI A;  3X1T A;  1EQZ A;  3B6F C;  5AVB B;  3X1S B;  3A6N A;  4ZUX B;  3W98 C;  4Z66 B;  5GXQ C;  2HIO B;  3AFA A;  5DNM C;  4WU8 C;  2BYM A;  3W99 D;  5AV5 C;  1U35 C;  4J8W A;  3KUY D;  1P3O A;  3REI D;  4KUD C;  4JJN C;  4LD9 B;  3X1S A;  1H3O B;  4ZBJ C;  5AVB A;  2ARO C;  5AV8 D;  1ZLA D;  2F8N H;  4ZUX A;  4Z66 A;  2HIO A;  1B6W A;  5B40 D;  5AVC B;  1P3P C;  3REH D;  1W2E A;  3AV1 D;  4R8P D;  4HGA C;  2L5A A;  3AYW B;  1HQ3 A;  1M19 C;  4KGC D;  4LD9 A;  1H3O A;  2DF4 C;  5CP6 C;  5C3I B;  4G92 B;  3AZE D;  1N1J B;  5B31 B;  2VQR A;  1M18 A;  5AVC A;  1KX4 B;  3B0D B;  5B33 B;  2Y2L A;  3MGP B;  4WU9 B;  2Y2K A;  3W96 B;  2Y2O A;  2ZY3 A;  4J8W C;  1P3O C;  3AYW A;  3AZI B;  3AZH D;  5B0Y D;  3EPJ A;  5B2J B;  3WTP D;  5AVB C;  3X1S C;  1N1J A;  5JRG D;  5B31 A;  1AOI B;  4ZUX C;  1KX4 A;  1P3M D;  3MGP A;  3TU4 D;  2IO5 B;  4WU9 A;  3AZM B;  3W96 A;  3VH5 W;  3AZI A;  5DNN D;  5B32 G;  3UT9 B;  5B2J A;  3WKJ B;  4LD9 C;  3VH5 A;  3AZG D;  3UTA D;  1AOI A;  3LEL B;  5AV6 D;  5AVC C;  3AZM A;  5GT3 D;  3MGS C;  2PYO D;  4EO5 B;  2BYK B;  3B0C W;  3WAA D;  2Y2N A;  3AZL C;  3UT9 A;  3WKJ A;  3WA9 D;  5GT0 C;  3C1B C;  1JFI B;  4X23 B;  4H9P B;  5C3I C;  4G92 C;  2XD1 A;  1M1A C;  2BG1 A;  2FJ7 C;  3LEL A;  5B31 C;  3EPL A;  1KX4 C;  3B0D C;  5B33 C;  3MGP C;  4Z5T D;  5B32 D;  4WU9 C;  1P3L B;  2BYK A;  3W96 C;  2ZY5 A;  4J8V D;  2CWE A;  4YM6 B;  1JFI A;  4X23 A;  4H9P A;  5B2J C;  2ZM5 A;  5CPJ B;  3O62 B;  4J8U B;  3AZJ B;  4QLC B;  1AOI C;  5KDM B;  5E5A C;  2Y2M A;  2IO5 C;  3VH6 T;  1P3L A;  3AZM C;  3C1C D;  4YM6 A;  3EPH A;  1B67 A;  3UT9 C;  3WKJ C;  3AV2 D;  5CPJ A;  3O62 A;  5F99 D;  1ID3 B;  2UWX A;  4J8U A;  5BNX B;  3AZJ A;  4QLC A;  5CPK B;  5KDM A;  4UUZ B;  4CAY B;  3KWQ D;  2NQB B;  3W97 D;  1P3I B;  5B0Z D;  4NE6 A;  3KXB D;  3KSY A;  3KFU G;  3A1K A;  1Q9C A;  1ID3 A;  4X23 C;  5BNX A;  1WWI A;  5CPK A;  4UUZ A;  4CAY A;  2F8N B;  2NQB A;  1P3I A;  2F8N K;  5B1L B;  5CPI B;  3EPK A;  1P3A B;  1P3L C;  2G5H C;  2F8N G;  3W98 D;  4E45 A;  3F6T A;  5GXQ D;  4J8X B;  3B6G B;  5CPJ C;  5DNM D;  4WU8 D;  5AV5 D;  4J8U C;  3AZJ C;  4QLC C;  1U35 D;  3LJA B;  5B1L A;  4KUD D;  4JJN D;  3AZF D;  1P3A A;  2FFF B;  3REI B;  2YFW A;  1A7W A;  1P3K B;  5AV8 B;  2NZD D;  4J8X A;  1ZLA B;  3B6G A;  5AY8 B;  4G91 B;  3MGR D;  1P3P D;  5CPK C;  3LJA A;  1HQ3 B;  1M19 D;  1P3I C;  3REI A;  5CP6 D;  1P3K A;  1M18 B;  5AV8 A;  1ZLA A;  5AY8 A;  1P3F B;  4WV4 B;  3REL B;  2Y2G A;  2Y2J A;  5B1M B;  2Y2P A;  1TZY B;  4R8P A;  3H0L C;  4J8W D;  5B1L C;  5CPI C;  2F2A C;  3X1T C;  1EQZ C;  3REK B;  5GSU B;  3A6N C;  1P3A C;  4H9Q B;  3AZH B;  5AVB D;  3X1S D;  3MVD B;  5B0Y B;  4KGC A;  4KHA B;  3AZE A;  1P3F A;  4ZUX D;  1BFM A;  3REL A;  3AFA C;  4J8X C;  3B6G C;  5B1M A;  3TU4 B;  1TZY A;  5B31 G;  2YFV B;  3A1I A;  3LZ1 B;  2RVQ C;  3LJA C;  4Z2M H;  3REK A;  3AZK B;  5GSU A;  4H9Q A;  3AZH A;  3MVD A;  5B0Y A;  3AN2 B;  4KHA A;  4Z66 C;  4UPK A;  1P3K C;  2HIO C;  2JSS A;  5AV8 C;  4E44 A;  3UTA B;  1ZLA C;  3AZN B;  5B24 B;  5AY8 C;  4G91 C;  5AVC D;  3X1U D;  3MGS D;  5AV6 B;  3TU4 A;  1KX5 B;  1PZR A;  3X1V D;  2YFV A;  3UTB B;  3LZ1 A;  1HQ3 C;  3AZL D;  3AZK A;  3WAA B;  5GT0 D;  2Y2H A;  3C1B D;  3AN2 A;  1M1A D;  3WA9 B;  1M18 C;  2FJ7 D;  2Y2I A;  4NE5 A;  3UTA A;  5B31 D;  3AZN A;  5B24 A;  1P3F C;  3MNN D;  1KX4 D;  3REL C;  5B33 D;  5AV6 A;  3MGP D;  1KX5 A;  2XD5 A;  4WU9 D;  3UTB A;  5B1M C;  4XZQ B;  5B2I B;  3W96 D;  1TZY C;  3AYW C;  4Z5T B;  2PYO A;  1F66 B;  3WAA A;  4J8V B;  3REK C;  5B2J D;  5GSU C;  3WA9 A;  3AZH C;  3MVD C;  3H0M C;  5B0Y C;  1P34 D;  1AOI D;  5E5A D;  3REJ D;  3AZM D;  4XZQ A;  4H9O B;  5B2I A;  3AZI C;  4Z5T A;  1F66 A;  3LZ1 C;  4J8V A;  3C1C B;  3UT9 D;  3AZK C;  3MGQ B;  3AN2 C;  3AV2 B;  5F99 B;  3VH5 T;  3UTA C;  3AZN C;  1P3G B;  5B24 C;  2CV5 B;  1S32 B;  4H9O A;  1KX5 C;  3W97 B;  2G5I C;  5BO0 B;  3UTB C;  1KX3 B;  3C1C A;  1BH9 B;  3KXB B;  3MGQ A;  5FUG B;  4X23 D;  3AV2 A;  4XUJ B;  3LEL C;  5F99 A;  1P3G A;  2CV5 A;  1S32 A;  2JE5 A;  4EO5 C;  3W97 A;  4DQY B;  5BO0 A;  4XZQ C;  5B2I C;  1KX3 A;  3NQU B;  4Z5T C;  1P3B B;  1F66 C;  4WJ3 C;  1BH9 A;  3KXB A;  5FUG A;  3B0B A;  4XUJ A;  5CPJ D;  5GXQ B;  4J8U D;  3AZJ D;  4QLC D;  5AV9 B;  3LZ0 B;  5AV5 B;  4YS3 B;  2RIQ A;  1U35 B;  1HTA A;  1R4V A;  1Z2C B;  3B6F D;  1F1E A;  2YFW B;  4KUD B;  3AZF B;  3NQU A;  4YM6 C;  1P3B A;  4H9S A;  3V9R A;  2J8P A; 
#chains in the Genus database with same CATH homology
 3O62 C;  3C1C C;  4AWL B;  2NZD B;  5GXQ A;  3MGQ C;  5CPK D;  5AV9 A;  3W99 B;  3LZ0 A;  3MGR B;  3KUY B;  5AV5 A;  4YS3 A;  1U35 A;  1P3G C;  4WNN B;  2ZY2 A;  2ARO D;  2CV5 C;  1S32 C;  1P3I D;  4KUD A;  2W8S A;  4H9R B;  4JJN A;  3AZF A;  5JA4 B;  1M19 B;  3IP4 C;  5CP6 B;  1KX3 C;  1ID3 C;  2NZD A;  5B40 B;  3EG5 B;  3W99 A;  4XUJ C;  3REH B;  3MGR A;  3KUY A;  4R8P B;  3AV1 B;  1P3P A;  2NQB C;  2F8N D;  4WNN A;  2LY8 A;  5BT1 C;  5B1L D;  4H9R A;  5CPI D;  3X1T D;  5JA4 A;  1EQZ D;  1M19 A;  4KGC B;  3A6N D;  1P3A D;  3AZE B;  5CP6 A;  1WWS A;  1P3B C;  4H9S C;  5B40 A;  3AFA D;  4J8X D;  3B6G D;  3REH A;  3AV1 A;  1P3O D;  5AV9 C;  3LZ0 C;  2RVQ D;  3LJA D;  4YS3 C;  3WTP B;  3AZF C;  5BNV B;  4Z66 D;  5JRG B;  1P3K D;  2HIO D;  1P3M B;  3H0R C;  4AWL C;  5AY8 D;  2NZD C;  4WZS B;  3W99 C;  5G49 B;  2JCH A;  3X1U B;  3MGS B;  3WTP E;  3MGR C;  3KUY C;  1HQ3 D;  4LD9 D;  3X1V B;  5DNN B;  3REI C;  4NE3 A;  3WTP A;  3AZL B;  5BNV A;  3AZG B;  5JRG A;  5GT0 B;  3C1B B;  1M18 D;  1M1A B;  4NFT A;  1P3M A;  1P3F D;  2FJ7 B;  3REL D;  5B40 C;  5GT3 B;  5G49 A;  3MNN B;  3REH C;  3X1U A;  5B1M D;  4R8P C;  3MGS A;  3AV1 C;  1TZY D;  3AYW D;  2PYO B;  3X1V A;  5DNN A;  3AZL A;  4KGC C;  3AZG A;  3REK D;  2DQN C;  5CHL B;  5GSU D;  5GT0 A;  3C1B A;  3AZE C;  3MVD D;  1M1A A;  2HUE B;  2FJ7 A;  1P34 B;  5GT3 A;  5E5A B;  3MNN A;  3FDD A;  5B33 A;  3REJ B;  5B32 B;  1KU5 A;  3AZI D;  3LZ1 D;  3AZK D;  3VH6 W;  3WTP C;  3AN2 D;  5JRG C;  1P34 A;  3VH6 A;  1P3M C;  3AZN D;  5B24 D;  5E5A A;  3TU4 C;  3REJ A;  1ULY A;  5B32 A;  1KX5 D;  3UTB D;  3X1U C;  3WKJ D;  3X1V C;  5DNN C;  3AZG C;  3LEL D;  2Y2Q A;  3KWQ B;  5AV6 C;  5BS7 A;  5B0Z B;  5GT3 C;  3MNN C;  2PYO C;  4XZQ D;  5B2I D;  3WAA C;  1F66 D;  1BH8 B;  3WA9 C;  3B0C T;  2HUE C;  3KWQ A;  1P34 C;  1P3L D;  5B0Z A;  4DRB A;  5B32 C;  3REJ C;  3B6F B;  4YM6 D;  3V9R B;  1TAF B;  3R45 B;  1BH8 A;  4J8V C;  3P5J B;  3W98 B;  1T3U A;  3O62 D;  5DNM B;  3MGQ D;  4WU8 B;  1P3G D;  2CV5 D;  1S32 D;  4JJN B;  3AL0 C;  5BS7 C;  3B6F A;  4ZBJ B;  2ARO B;  1TAF A;  4CSR B;  3R45 A;  3W98 A;  1KX3 D;  3NQJ B;  1ID3 D;  3AV2 C;  5DNM A;  2ZY4 A;  4H9N B;  5F99 C;  4WU8 A;  4XUJ D;  1P3P B;  4DRA A;  2NQB D;  3KWQ C;  4HGA B;  5BT1 D;  3W97 C;  5B0Z C;  2ARO A;  4CSR A;  3X1T B;  1EQZ B;  3A6N B;  3KXB C;  3NQJ A;  1P3B D;  4H9N A;  3AFA B;  2BYM B;  5AV9 D;  4M6B A;  3LZ0 D;  4Z2M G;  4J8W B;  1P3O B;  4YS3 D;  2F8N A;  5CPI A;  3X1T A;  1EQZ A;  3B6F C;  5AVB B;  3X1S B;  3A6N A;  4ZUX B;  3W98 C;  4Z66 B;  5GXQ C;  2HIO B;  3AFA A;  5DNM C;  4WU8 C;  2BYM A;  3W99 D;  5AV5 C;  1U35 C;  4J8W A;  3KUY D;  1P3O A;  3REI D;  4KUD C;  4JJN C;  4LD9 B;  3X1S A;  1H3O B;  4ZBJ C;  5AVB A;  2ARO C;  5AV8 D;  1ZLA D;  2F8N H;  4ZUX A;  4Z66 A;  2HIO A;  1B6W A;  5B40 D;  5AVC B;  1P3P C;  3REH D;  1W2E A;  3AV1 D;  4R8P D;  4HGA C;  2L5A A;  3AYW B;  1HQ3 A;  1M19 C;  4KGC D;  4LD9 A;  1H3O A;  2DF4 C;  5CP6 C;  5C3I B;  4G92 B;  3AZE D;  1N1J B;  5B31 B;  2VQR A;  1M18 A;  5AVC A;  1KX4 B;  3B0D B;  5B33 B;  2Y2L A;  3MGP B;  4WU9 B;  2Y2K A;  3W96 B;  2Y2O A;  2ZY3 A;  4J8W C;  1P3O C;  3AYW A;  3AZI B;  3AZH D;  5B0Y D;  3EPJ A;  5B2J B;  3WTP D;  5AVB C;  3X1S C;  1N1J A;  5JRG D;  5B31 A;  1AOI B;  4ZUX C;  1KX4 A;  1P3M D;  3MGP A;  3TU4 D;  2IO5 B;  4WU9 A;  3AZM B;  3W96 A;  3VH5 W;  3AZI A;  5DNN D;  5B32 G;  3UT9 B;  5B2J A;  3WKJ B;  4LD9 C;  3VH5 A;  3AZG D;  3UTA D;  1AOI A;  3LEL B;  5AV6 D;  5AVC C;  3AZM A;  5GT3 D;  3MGS C;  2PYO D;  4EO5 B;  2BYK B;  3B0C W;  3WAA D;  2Y2N A;  3AZL C;  3UT9 A;  3WKJ A;  3WA9 D;  5GT0 C;  3C1B C;  1JFI B;  4X23 B;  4H9P B;  5C3I C;  4G92 C;  2XD1 A;  1M1A C;  2BG1 A;  2FJ7 C;  3LEL A;  5B31 C;  3EPL A;  1KX4 C;  3B0D C;  5B33 C;  3MGP C;  4Z5T D;  5B32 D;  4WU9 C;  1P3L B;  2BYK A;  3W96 C;  2ZY5 A;  4J8V D;  2CWE A;  4YM6 B;  1JFI A;  4X23 A;  4H9P A;  5B2J C;  2ZM5 A;  5CPJ B;  3O62 B;  4J8U B;  3AZJ B;  4QLC B;  1AOI C;  5KDM B;  5E5A C;  2Y2M A;  2IO5 C;  3VH6 T;  1P3L A;  3AZM C;  3C1C D;  4YM6 A;  3EPH A;  1B67 A;  3UT9 C;  3WKJ C;  3AV2 D;  5CPJ A;  3O62 A;  5F99 D;  1ID3 B;  2UWX A;  4J8U A;  5BNX B;  3AZJ A;  4QLC A;  5CPK B;  5KDM A;  4UUZ B;  4CAY B;  3KWQ D;  2NQB B;  3W97 D;  1P3I B;  5B0Z D;  4NE6 A;  3KXB D;  3KSY A;  3KFU G;  3A1K A;  1Q9C A;  1ID3 A;  4X23 C;  5BNX A;  1WWI A;  5CPK A;  4UUZ A;  4CAY A;  2F8N B;  2NQB A;  1P3I A;  2F8N K;  5B1L B;  5CPI B;  3EPK A;  1P3A B;  1P3L C;  2G5H C;  2F8N G;  3W98 D;  4E45 A;  3F6T A;  5GXQ D;  4J8X B;  3B6G B;  5CPJ C;  5DNM D;  4WU8 D;  5AV5 D;  4J8U C;  3AZJ C;  4QLC C;  1U35 D;  3LJA B;  5B1L A;  4KUD D;  4JJN D;  3AZF D;  1P3A A;  2FFF B;  3REI B;  2YFW A;  1A7W A;  1P3K B;  5AV8 B;  2NZD D;  4J8X A;  1ZLA B;  3B6G A;  5AY8 B;  4G91 B;  3MGR D;  1P3P D;  5CPK C;  3LJA A;  1HQ3 B;  1M19 D;  1P3I C;  3REI A;  5CP6 D;  1P3K A;  1M18 B;  5AV8 A;  1ZLA A;  5AY8 A;  1P3F B;  4WV4 B;  3REL B;  2Y2G A;  2Y2J A;  5B1M B;  2Y2P A;  1TZY B;  4R8P A;  3H0L C;  4J8W D;  5B1L C;  5CPI C;  2F2A C;  3X1T C;  1EQZ C;  3REK B;  5GSU B;  3A6N C;  1P3A C;  4H9Q B;  3AZH B;  5AVB D;  3X1S D;  3MVD B;  5B0Y B;  4KGC A;  4KHA B;  3AZE A;  1P3F A;  4ZUX D;  1BFM A;  3REL A;  3AFA C;  4J8X C;  3B6G C;  5B1M A;  3TU4 B;  1TZY A;  5B31 G;  2YFV B;  3A1I A;  3LZ1 B;  2RVQ C;  3LJA C;  4Z2M H;  3REK A;  3AZK B;  5GSU A;  4H9Q A;  3AZH A;  3MVD A;  5B0Y A;  3AN2 B;  4KHA A;  4Z66 C;  4UPK A;  1P3K C;  2HIO C;  2JSS A;  5AV8 C;  4E44 A;  3UTA B;  1ZLA C;  3AZN B;  5B24 B;  5AY8 C;  4G91 C;  5AVC D;  3X1U D;  3MGS D;  5AV6 B;  3TU4 A;  1KX5 B;  1PZR A;  3X1V D;  2YFV A;  3UTB B;  3LZ1 A;  1HQ3 C;  3AZL D;  3AZK A;  3WAA B;  5GT0 D;  2Y2H A;  3C1B D;  3AN2 A;  1M1A D;  3WA9 B;  1M18 C;  2FJ7 D;  2Y2I A;  4NE5 A;  3UTA A;  5B31 D;  3AZN A;  5B24 A;  1P3F C;  3MNN D;  1KX4 D;  3REL C;  5B33 D;  5AV6 A;  3MGP D;  1KX5 A;  2XD5 A;  4WU9 D;  3UTB A;  5B1M C;  4XZQ B;  5B2I B;  3W96 D;  1TZY C;  3AYW C;  4Z5T B;  2PYO A;  1F66 B;  3WAA A;  4J8V B;  3REK C;  5B2J D;  5GSU C;  3WA9 A;  3AZH C;  3MVD C;  3H0M C;  5B0Y C;  1P34 D;  1AOI D;  5E5A D;  3REJ D;  3AZM D;  4XZQ A;  4H9O B;  5B2I A;  3AZI C;  4Z5T A;  1F66 A;  3LZ1 C;  4J8V A;  3C1C B;  3UT9 D;  3AZK C;  3MGQ B;  3AN2 C;  3AV2 B;  5F99 B;  3VH5 T;  3UTA C;  3AZN C;  1P3G B;  5B24 C;  2CV5 B;  1S32 B;  4H9O A;  1KX5 C;  3W97 B;  2G5I C;  5BO0 B;  3UTB C;  1KX3 B;  3C1C A;  1BH9 B;  3KXB B;  3MGQ A;  5FUG B;  4X23 D;  3AV2 A;  4XUJ B;  3LEL C;  5F99 A;  1P3G A;  2CV5 A;  1S32 A;  2JE5 A;  4EO5 C;  3W97 A;  4DQY B;  5BO0 A;  4XZQ C;  5B2I C;  1KX3 A;  3NQU B;  4Z5T C;  1P3B B;  1F66 C;  4WJ3 C;  1BH9 A;  3KXB A;  5FUG A;  3B0B A;  4XUJ A;  5CPJ D;  5GXQ B;  4J8U D;  3AZJ D;  4QLC D;  5AV9 B;  3LZ0 B;  5AV5 B;  4YS3 B;  2RIQ A;  1U35 B;  1HTA A;  1R4V A;  1Z2C B;  3B6F D;  1F1E A;  2YFW B;  4KUD B;  3AZF B;  3NQU A;  4YM6 C;  1P3B A;  4H9S A;  3V9R A;  2J8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...