3W98A

Crystal structure of human nucleosome core particle lacking h3.1 n-terminal region
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w98A00
3WKJA 3KWQB 4XUJD 3AV2A 2BYKA 4QLCD 1KX3C 1P3BC 5B40B 3WTPC 1P3AA 3X1VA 3AYWD 3X1SB 3WA9A 3RELA 5BT1D 4H9SC 4XZQA 5B31B 3AZGB 2PYOD 5B0ZC 3KUYD 3LZ0A 4KHAB 5B2JC 3B0CT 4ZUXB 3B6FD 3MGQA 5BS7A 3W97A 3W96D 5GT3B 3WKJC 3AZLD 1U35D 1P3IA 3AV2C 1M1AB 1F1EA 1F66A 1P3MB 4WZSB 2NZDA 1BH8A 3KWQD 3LJAA 1P3AC 4R8PD 5AV8A 3X1VC 5B40D 5C3IC 3REID 3RELC 3KWQA 3WA9C 3B0DB 2FJ7A 4JJNA 4AWLB 3X1SD 4J8WA 3LZ0C 4WNNB 4Z5TA 5B31D 5BS7C 3MGQC 4J8XA 3W97C 4ZBJC 4ZUXD 1P3IC 3AZGA 1F66C 1H3OB 5GT3D 2NZDC 5AY8C 3LJAC 5AV8C 1JFIB 4YS3A 3AV1B 5AVCB 5B32A 5GSUB 1R4VA 3AZNB 2FJ7C 1M1AA 3AFAB 3W99A 4JJNC 5CPJB 3REKC 1P3MA 4J8WC 5F99B 5AV9A 1KX4A 1EQZA 2F8NH 4J8XC 4Z5TC 5GXQD 3UTBA 1P3OD 4NE6A 2CWEA 3UTAB 5B31G 1S32A 3X1UB 3MGPA 5B0YD 3NQUB 4YS3C 5AVBB 4J8VC 5B32C 2YFVB 3AZHB 1ULYA 3MGRC 1KX5A 3W99C 3AV1D 5FUGB 5AVCD 1ZLAB 1H3OA 5AV9C 1KX4C 3AZND 1EQZC 4KUDA 3AFAD 5CPJD 3KXBA 3REJB 3VH6T 3UTBC 5CP6B 5F99D 5GSUA 3AZNA 5B2IA 5DNMB 4HGAC 1S32C 1AOIA 4WV4B 5JA4A 3MGPC 3UTAD 4X23A 1HQ3B 3AZKA 3W98C 3X1UD 4G92B 4NFTA 1KX5C 5AVBD 3A6NB 1P3GA 4H9RB 3AZHD 4KUDC 3NQUA 1KU5A 3WTPE 5BNVB 4UUZB 5DNNB 5G49B 4EO5B 3KXBC 1ZLAD 3LELA 2CV5C 3VH5T 5KDMB 5B2IC 3TU4B 1Q9CA 3REJD 2HUEC 5GT0A 5CP6D 1P3LB 3MVDA 1AOIC 4X23C 3UT9B 3B0BA 3C1BA 3AZKC 4H9NB 4H9QA 5E5AA 5B1MB 1HQ3D 3AZIB 5DNMA 1P3GC 4WU8C 3B6FB 1HQ3A 1P3PB 3A6ND 3LELC 3C1CB 2HIOA 3AZJB 5B1LB 5B24A 1M18D 4H9OB 5DNND 3NQJB 1KX3D 5GT0C 3WAAB 3MVDC 4R8PB 3C1BC 3TU4D 5G49A 5BO0B 1P3LD 4H9PA 3REIB 4XUJA 5E5AC 3UT9D 3AZFB 4QLCA 4CSRA 1BH9A 4Z2MG 1BFMA 3V9RA 3B0CW 5B1MD 3O62B 3AZID 3AYWA 2HIOC 1M19B 5B24C 3B6GB 2AROB 1P3PD 2PYOA 3C1CD 3KUYA 3AZJD 5B1LD 4M6BA 4G91C 1TZYB 5AV5B 2RVQC 3B6FA 3KSYA 3WAAD 1P3PA 4LD9B 3W96A 3AZLA 1U35A 4XUJC 5AV6B 4QLCC 1B67A 4R8PA 3AZFD 4XZQC 5GXQB 5B40A 4WU9B 1P34B 3AYWC 4YM6B 3REIA 1P3OB 5BT1C 3O62D 4KGCB 2PYOC 5B33B 3X1SA 3KUYC 1M19D 5AY8D 3B6GD 5B0YB 2AROD 3MNNB 5B31A 3MGSB 2F8NB 3W96C 3AN2B 3AZLC 4KHAA 5AV5D 1TZYD 1U35C 4ZUXA 4LD9D 3AZEB 5GT3A 2IO5B 3KWQC 5AV6D 5B40C 1TAFB 4J8UB 4WU9D 1P34D 3X1SC 4YM6D 5CPKB 4KGCD 5B31C 3AZGC 5CPIB 5GXQA 5B33D 4J8VD 1P3OA 4ZUXC 3LZ1B 4KGCA 3MNND 4WNNA 3MGRD 2F8NK 3MGSD 2F8ND 5GT3C 3AN2D 5B0YA 1M1AC 1P3MC 3VH6W 3AZED 1JFIA 4Z66B 3AV1A 1P3KB 5AVCA 4J8UD 1P3FB 3REHB 3B0DC 3X1TB 3AFAA 1ID3B 5CPJA 1HTAA 4AWLC 5CPKD 5F99A 4E45A 3AZMB 5CPID 3LZ1D 5B32G 3UTAA 2NQBB 5BNXB 3X1UA 5JRGB 1M18B 2F8NG 2JSSA 3VH5W 3AV1C 5AVCC 5AVBA 1P3BB 1KX3B 3WTPB 5GSUC 2YFVA 3AZNC 3AZHA 4Z66D 3R45B 3AFAC 5FUGA 5CPJC 1P3KD 1ZLAA 5F99C 1P3FD 3REHD 1N1JB 3X1TD 1ID3D 2YFWB 3REJA 5CP6A 5B0ZB 3UTAC 5B2JB 3AZMD 4WU8D 1ID3A 4CAYB 4DRAA 3X1UC 3WKJB 3AV2B 5AVBC 2NQBD 5JRGD 3AZHC 1P3AB 3A6NA 1P3BD 1ZLAC 3X1VB 3WTPD 1M18A 5C3IB 4H9RA 3WA9B 3RELB 4UUZA 5BNVA 5DNNA 3REJC 1KX3A 5CP6C 4NE5A 3LZ0B 5KDMA 3TU4A 3MGQB 4NE3A 1P3LA 5DNMC 3W97B 5B0ZD 4ZBJB 1WWSA 5B2JD 3UT9A 1P3IB 1HQ3C 4H9NA 1F66B 4G92C 2NZDB 5AY8B 1BH8B 3WKJD 3LJAB 5B1MA 5B2JA 5AV8B 3AV2D 3A6NC 3AZIA 1P3AD 2FJ7B 1WWIA 5DNNC 4EO5C 4JJNB 3C1CA 3X1VD 3REKB 3AZJA 5B1LA 4J8WB 1B6WA 4H9OA 3RELD 3WA9D 3TU4C 4J8XB 3NQJA 4Z5TB 4XZQD 1P3LC 3WAAA 3LZ0D 3UT9C 3MGQD 5BO0A 3W97D 3AZFA 5B1MC 1P3ID 4YS3B 3AZIC 1F66D 4J8VB 5B32B 2NZDD 3LJAD 3O62A 3B6FC 5AV8D 3MGRB 1P3PC 3W99B 3C1CC 4E44A 3AZJC 1A7WA 5B1LC 1M19A 5AY8A 3B6GA 5AV9B 2AROA 1KX4B 1EQZB 2FJ7D 3WAAC 4JJND 3REKD 3UTBB 2LY8A 5AV5A 1TZYA 4J8WD 4R8PC 4J8XD 4Z5TD 4LD9A 3REKA 3REIC 4HGAB 1S32B 3MGPB 3AZFC 5AV6A 3AZGD 3W98B 3O62C 4YS3D 1KX5B 2L5AA 4WU9A 1P34A 1M19C 5B32D 4YM6A 3B6GC 2AROC 4KUDB 1M1AD 3W99D 3KXBB 1P3MD 5B33A 4J8VA 5AV5C 1TZYC 5AV9D 2CV5B 1KX4D 3MNNA 1EQZD 3MGRA 4LD9C 3MGSA 5B2IB 2F8NA 3UTBD 2HUEB 3AN2A 1AOIB 5JA4B 5AV6C 4X23B 3AZEA 3AZKB 1S32D 3MGPD 2BYMB 5GXQC 4WU9C 1P34C 1TAFA 3W98D 4YM6C 4J8UA 1P3OC 1P3GB 4KGCC 4WU8B 1KX5D 3VH6A 5B33C 3W98A 3LELB 5CPKA 5B0YC 3MNNC 4KUDD 5CPIA 3MGSC 3KXBD 5GT0B 3AN2C 3MVDB 5GSUD 2CV5D 3LZ1A 5B2ID 3C1BB 3AZEC 4H9QB 2IO5C 1AOID 2CV5A 5E5AB 4X23D 3AZKD 4J8UC 4Z66A 1P3KA 5CPKC 1P3FA 2HIOB 3VH5A 3REHA 1P3GD 5B24B 3X1TA 4DRBA 2BYMA 5CPIC 3LELD 4Z2MH 3LZ1C 4G91B 3AZMA 4WU8A 2BYKB 5GT0D 3MVDD 4H9PB 4XUJB 4QLCB 3C1BD 4CSRB 1BH9B 2NQBA 5BNXA 3V9RB 5JRGA 4Z66C 5E5AD 1P3KC 4XZQB 1P3BA 5DNMD 1P3FC 3WTPA 3REHC 3AYWB 3X1TC 3R45A 1ID3C 2PYOB 2HIOD 3KUYB 5B24D 1N1JA 3AZMC 2YFWA 4H9SA 3W96B 5B0ZA 5CHLB 3AZLB 1U35B 2RVQD 4CAYA 2NQBC 5JRGC 1M18C
chains in the Genus database with same CATH superfamily
3WKJA 3KWQB 4XUJD 3AV2A 2BYKA 4QLCD 1KX3C 1P3BC 5B40B 3WTPC 1P3AA 3X1VA 3AYWD 3X1SB 3WA9A 3RELA 5BT1D 4H9SC 4XZQA 5B31B 3AZGB 2PYOD 5B0ZC 3KUYD 3LZ0A 4KHAB 5B2JC 3B0CT 4ZUXB 3B6FD 3MGQA 2Y2IA 5BS7A 3W97A 3W96D 5GT3B 3WKJC 3AZLD 1U35D 1P3IA 3AV2C 1M1AB 1F1EA 1F66A 1P3MB 2JCHA 4WZSB 2NZDA 1BH8A 3KWQD 3LJAA 1P3AC 4R8PD 5AV8A 3X1VC 5B40D 3A1IA 5C3IC 3REID 3RELC 3KWQA 3WA9C 3B0DB 2FJ7A 2ZY3A 4JJNA 2DF4C 2ZY4A 4AWLB 3X1SD 4J8WA 3LZ0C 4WNNB 4Z5TA 5B31D 5BS7C 3MGQC 4J8XA 3W97C 3EG5B 4ZBJC 4ZUXD 1P3IC 2Y2GA 3AZGA 1F66C 1H3OB 5GT3D 2NZDC 5AY8C 3LJAC 5AV8C 1JFIB 4YS3A 3AV1B 5AVCB 5B32A 5GSUB 1R4VA 3AZNB 2FJ7C 1M1AA 3AFAB 3W99A 4JJNC 5CPJB 3REKC 1P3MA 4J8WC 5F99B 5AV9A 1KX4A 1EQZA 2F8NH 4J8XC 4Z5TC 5GXQD 3UTBA 1P3OD 4NE6A 2CWEA 3UTAB 3H0RC 5B31G 1S32A 3X1UB 3MGPA 5B0YD 3NQUB 4YS3C 2XD1A 5AVBB 4J8VC 5B32C 2YFVB 3AZHB 1ULYA 3MGRC 1KX5A 3W99C 3AV1D 5FUGB 5AVCD 1ZLAB 1H3OA 5AV9C 1KX4C 3AZND 1EQZC 4KUDA 3AFAD 5CPJD 3KXBA 3REJB 3VH6T 3UTBC 5CP6B 3IP4C 5F99D 5GSUA 3AZNA 5B2IA 5DNMB 4HGAC 1S32C 1AOIA 4WV4B 5JA4A 3MGPC 3EPJA 3UTAD 3A1KA 4X23A 1HQ3B 3AZKA 3W98C 3X1UD 4G92B 4NFTA 1KX5C 5AVBD 3A6NB 1P3GA 4H9RB 2Y2QA 3AZHD 4KUDC 3NQUA 1KU5A 3WTPE 5BNVB 4UUZB 5DNNB 5G49B 4EO5B 3KXBC 1ZLAD 3LELA 2CV5C 3VH5T 5KDMB 5B2IC 3TU4B 1Q9CA 3REJD 2HUEC 5GT0A 5CP6D 1P3LB 3MVDA 1AOIC 4X23C 3UT9B 3B0BA 3C1BA 3AZKC 4H9NB 4H9QA 2ZY2A 5E5AA 2FFFB 5B1MB 1HQ3D 3AZIB 5DNMA 1P3GC 4WU8C 3B6FB 1HQ3A 1P3PB 3A6ND 3LELC 3C1CB 2HIOA 3AZJB 5B1LB 5B24A 1M18D 4H9OB 5DNND 3NQJB 1KX3D 5GT0C 3WAAB 3MVDC 4R8PB 3C1BC 3TU4D 5G49A 5BO0B 1P3LD 4H9PA 3REIB 1Z2CB 4XUJA 5E5AC 3UT9D 3AZFB 2ZY5A 4QLCA 2XD5A 4CSRA 1BH9A 4Z2MG 1BFMA 3V9RA 3B0CW 5B1MD 3O62B 3AZID 4UPKA 3AYWA 2HIOC 1M19B 5B24C 3B6GB 2AROB 1P3PD 2PYOA 3C1CD 3KUYA 3AZJD 5B1LD 4M6BA 4G91C 1TZYB 5AV5B 2RVQC 3AL0C 3B6FA 3KSYA 3WAAD 1P3PA 4LD9B 3W96A 3AZLA 1U35A 4XUJC 2Y2LA 5AV6B 4QLCC 1B67A 4R8PA 3AZFD 4XZQC 3H0MC 5GXQB 5B40A 4WU9B 1P34B 3AYWC 4YM6B 3REIA 1P3OB 5BT1C 3O62D 4KGCB 2PYOC 5B33B 3X1SA 3KUYC 1M19D 5AY8D 3B6GD 5B0YB 2AROD 3MNNB 5B31A 3MGSB 2F8NB 3W96C 3AN2B 2Y2KA 3AZLC 4KHAA 5AV5D 1TZYD 1U35C 4ZUXA 4LD9D 3AZEB 5GT3A 2IO5B 3KWQC 5AV6D 5B40C 1TAFB 4J8UB 2Y2OA 4WU9D 1P34D 3X1SC 4YM6D 5CPKB 4KGCD 5B31C 3AZGC 5CPIB 5GXQA 2Y2PA 5B33D 4J8VD 1P3OA 4ZUXC 3LZ1B 4KGCA 3MNND 4WNNA 3MGRD 2F2AC 2F8NK 3MGSD 2F8ND 5GT3C 2Y2JA 3AN2D 5B0YA 1M1AC 2UWXA 1P3MC 3FDDA 3VH6W 2ZM5A 3AZED 1JFIA 4Z66B 2W8SA 3AV1A 1P3KB 5AVCA 4J8UD 1P3FB 3REHB 3B0DC 3X1TB 3AFAA 1ID3B 5CPJA 1HTAA 4AWLC 5CPKD 2Y2MA 5F99A 4E45A 3AZMB 5CPID 3EPKA 3LZ1D 5B32G 3UTAA 2NQBB 5BNXB 2JE5A 3X1UA 5JRGB 1M18B 2F8NG 2G5HC 2JSSA 3VH5W 3AV1C 5AVCC 5AVBA 1P3BB 1KX3B 3WTPB 5GSUC 2YFVA 3AZNC 3AZHA 4Z66D 3R45B 3AFAC 5FUGA 5CPJC 1P3KD 1ZLAA 5F99C 1P3FD 3REHD 1N1JB 3X1TD 2J8PA 1ID3D 2YFWB 3REJA 5CP6A 5B0ZB 3UTAC 5B2JB 3AZMD 2DQNC 4WU8D 1ID3A 4CAYB 3KFUG 4DRAA 3X1UC 3WKJB 3AV2B 3EPHA 5AVBC 3P5JB 2NQBD 5JRGD 3AZHC 1P3AB 3A6NA 1P3BD 1ZLAC 3X1VB 3WTPD 1M18A 5C3IB 4H9RA 3WA9B 3RELB 2VQRA 4UUZA 5BNVA 5DNNA 3REJC 1KX3A 5CP6C 4NE5A 3LZ0B 5KDMA 3TU4A 3MGQB 4NE3A 1P3LA 5DNMC 3W97B 5B0ZD 4ZBJB 1WWSA 5B2JD 3UT9A 2Y2HA 1P3IB 1HQ3C 4H9NA 1F66B 4G92C 2NZDB 5AY8B 1BH8B 3WKJD 3LJAB 5B1MA 5B2JA 5AV8B 3AV2D 3A6NC 3AZIA 1P3AD 2FJ7B 1WWIA 5DNNC 4EO5C 4JJNB 2RIQA 3C1CA 3X1VD 3REKB 3AZJA 5B1LA 4J8WB 1B6WA 4H9OA 3RELD 3WA9D 3TU4C 4J8XB 3NQJA 4Z5TB 4XZQD 1P3LC 3WAAA 3LZ0D 3UT9C 3MGQD 5BO0A 3W97D 3AZFA 5B1MC 1P3ID 2BG1A 4YS3B 3AZIC 1F66D 4J8VB 5B32B 2NZDD 3LJAD 3O62A 3B6FC 5AV8D 3MGRB 1P3PC 3W99B 3C1CC 4E44A 3AZJC 1A7WA 5B1LC 1M19A 5AY8A 3B6GA 5AV9B 2AROA 1KX4B 1EQZB 2FJ7D 3WAAC 4JJND 3REKD 3UTBB 2LY8A 5AV5A 1TZYA 4J8WD 4R8PC 4J8XD 4Z5TD 4LD9A 3REKA 3REIC 4HGAB 1S32B 3MGPB 3AZFC 5AV6A 3AZGD 3W98B 3O62C 4YS3D 1KX5B 2L5AA 4WU9A 1P34A 1M19C 5B32D 4YM6A 3B6GC 2AROC 4KUDB 1M1AD 3W99D 3KXBB 1P3MD 5B33A 4J8VA 5AV5C 1TZYC 5AV9D 2CV5B 1KX4D 3MNNA 1EQZD 3MGRA 4LD9C 3MGSA 5B2IB 2F8NA 3UTBD 2HUEB 3AN2A 1AOIB 5JA4B 5AV6C 4X23B 4DQYB 3AZEA 3AZKB 1S32D 4WJ3C 3MGPD 1W2EA 2BYMB 5GXQC 4WU9C 1P34C 1TAFA 3W98D 1T3UA 4YM6C 4J8UA 1P3OC 1P3GB 4KGCC 4WU8B 1KX5D 3VH6A 5B33C 3W98A 3LELB 5CPKA 2Y2NA 5B0YC 3MNNC 4KUDD 5CPIA 3MGSC 3KXBD 5GT0B 3AN2C 3MVDB 5GSUD 2CV5D 3LZ1A 3F6TA 5B2ID 3C1BB 3AZEC 4H9QB 3H0LC 2IO5C 1AOID 2CV5A 1PZRA 5E5AB 4X23D 3AZKD 4J8UC 4Z66A 1P3KA 5CPKC 1P3FA 2HIOB 3VH5A 3REHA 1P3GD 5B24B 3X1TA 4DRBA 2BYMA 5CPIC 3LELD 4Z2MH 3LZ1C 4G91B 3AZMA 4WU8A 2BYKB 5GT0D 3MVDD 4H9PB 4XUJB 4QLCB 3C1BD 4CSRB 1BH9B 2NQBA 5BNXA 3V9RB 5JRGA 4Z66C 5E5AD 1P3KC 4XZQB 1P3BA 5DNMD 1P3FC 3WTPA 3REHC 3AYWB 3EPLA 3X1TC 3R45A 1ID3C 2PYOB 2HIOD 3KUYB 5B24D 1N1JA 3AZMC 2YFWA 4H9SA 3W96B 2G5IC 5B0ZA 5CHLB 3AZLB 1U35B 2RVQD 4CAYA 2NQBC 5JRGC 1M18C
chains in the Genus database with same CATH topology
3WKJA 3KWQB 4XUJD 3AV2A 2BYKA 4QLCD 1KX3C 1P3BC 5B40B 3WTPC 1P3AA 3X1VA 3AYWD 3X1SB 3WA9A 3RELA 5BT1D 4H9SC 4XZQA 5B31B 3AZGB 2PYOD 5B0ZC 3KUYD 3LZ0A 4KHAB 5B2JC 3B0CT 4ZUXB 3B6FD 3MGQA 2Y2IA 5BS7A 3W97A 3W96D 5GT3B 3WKJC 3AZLD 1U35D 1P3IA 3AV2C 1M1AB 1F1EA 1F66A 1P3MB 2JCHA 4WZSB 2NZDA 1BH8A 3KWQD 3LJAA 1P3AC 4R8PD 5AV8A 3X1VC 5B40D 3A1IA 5C3IC 3REID 3RELC 3KWQA 3WA9C 3B0DB 2FJ7A 2ZY3A 4JJNA 2DF4C 2ZY4A 4AWLB 3X1SD 4J8WA 3LZ0C 4WNNB 4Z5TA 5B31D 5BS7C 3MGQC 4J8XA 3W97C 3EG5B 4ZBJC 4ZUXD 1P3IC 2Y2GA 3AZGA 1F66C 1H3OB 5GT3D 2NZDC 5AY8C 3LJAC 5AV8C 1JFIB 4YS3A 3AV1B 5AVCB 5B32A 5GSUB 1R4VA 3AZNB 2FJ7C 1M1AA 3AFAB 3W99A 4JJNC 5CPJB 3REKC 1P3MA 4J8WC 5F99B 5AV9A 1KX4A 1EQZA 2F8NH 4J8XC 4Z5TC 5GXQD 3UTBA 1P3OD 4NE6A 2CWEA 3UTAB 3H0RC 5B31G 1S32A 3X1UB 3MGPA 5B0YD 3NQUB 4YS3C 2XD1A 5AVBB 4J8VC 5B32C 2YFVB 3AZHB 1ULYA 3MGRC 1KX5A 3W99C 3AV1D 5FUGB 5AVCD 1ZLAB 1H3OA 5AV9C 1KX4C 3AZND 1EQZC 4KUDA 3AFAD 5CPJD 3KXBA 3REJB 3VH6T 3UTBC 5CP6B 3IP4C 5F99D 5GSUA 3AZNA 5B2IA 5DNMB 4HGAC 1S32C 1AOIA 4WV4B 5JA4A 3MGPC 3EPJA 3UTAD 3A1KA 4X23A 1HQ3B 3AZKA 3W98C 3X1UD 4G92B 4NFTA 1KX5C 5AVBD 3A6NB 1P3GA 4H9RB 2Y2QA 3AZHD 4KUDC 3NQUA 1KU5A 3WTPE 5BNVB 4UUZB 5DNNB 5G49B 4EO5B 3KXBC 1ZLAD 3LELA 2CV5C 3VH5T 5KDMB 5B2IC 3TU4B 1Q9CA 3REJD 2HUEC 5GT0A 5CP6D 1P3LB 3MVDA 1AOIC 4X23C 3UT9B 3B0BA 3C1BA 3AZKC 4H9NB 4H9QA 2ZY2A 5E5AA 2FFFB 5B1MB 1HQ3D 3AZIB 5DNMA 1P3GC 4WU8C 3B6FB 1HQ3A 1P3PB 3A6ND 3LELC 3C1CB 2HIOA 3AZJB 5B1LB 5B24A 1M18D 4H9OB 5DNND 3NQJB 1KX3D 5GT0C 3WAAB 3MVDC 4R8PB 3C1BC 3TU4D 5G49A 5BO0B 1P3LD 4H9PA 3REIB 1Z2CB 4XUJA 5E5AC 3UT9D 3AZFB 2ZY5A 4QLCA 2XD5A 4CSRA 1BH9A 4Z2MG 1BFMA 3V9RA 3B0CW 5B1MD 3O62B 3AZID 4UPKA 3AYWA 2HIOC 1M19B 5B24C 3B6GB 2AROB 1P3PD 2PYOA 3C1CD 3KUYA 3AZJD 5B1LD 4M6BA 4G91C 1TZYB 5AV5B 2RVQC 3AL0C 3B6FA 3KSYA 3WAAD 1P3PA 4LD9B 3W96A 3AZLA 1U35A 4XUJC 2Y2LA 5AV6B 4QLCC 1B67A 4R8PA 3AZFD 4XZQC 3H0MC 5GXQB 5B40A 4WU9B 1P34B 3AYWC 4YM6B 3REIA 1P3OB 5BT1C 3O62D 4KGCB 2PYOC 5B33B 3X1SA 3KUYC 1M19D 5AY8D 3B6GD 5B0YB 2AROD 3MNNB 5B31A 3MGSB 2F8NB 3W96C 3AN2B 2Y2KA 3AZLC 4KHAA 5AV5D 1TZYD 1U35C 4ZUXA 4LD9D 3AZEB 5GT3A 2IO5B 3KWQC 5AV6D 5B40C 1TAFB 4J8UB 2Y2OA 4WU9D 1P34D 3X1SC 4YM6D 5CPKB 4KGCD 5B31C 3AZGC 5CPIB 5GXQA 2Y2PA 5B33D 4J8VD 1P3OA 4ZUXC 3LZ1B 4KGCA 3MNND 4WNNA 3MGRD 2F2AC 2F8NK 3MGSD 2F8ND 5GT3C 2Y2JA 3AN2D 5B0YA 1M1AC 2UWXA 1P3MC 3FDDA 3VH6W 2ZM5A 3AZED 1JFIA 4Z66B 2W8SA 3AV1A 1P3KB 5AVCA 4J8UD 1P3FB 3REHB 3B0DC 3X1TB 3AFAA 1ID3B 5CPJA 1HTAA 4AWLC 5CPKD 2Y2MA 5F99A 4E45A 3AZMB 5CPID 3EPKA 3LZ1D 5B32G 3UTAA 2NQBB 5BNXB 2JE5A 3X1UA 5JRGB 1M18B 2F8NG 2G5HC 2JSSA 3VH5W 3AV1C 5AVCC 5AVBA 1P3BB 1KX3B 3WTPB 5GSUC 2YFVA 3AZNC 3AZHA 4Z66D 3R45B 3AFAC 5FUGA 5CPJC 1P3KD 1ZLAA 5F99C 1P3FD 3REHD 1N1JB 3X1TD 2J8PA 1ID3D 2YFWB 3REJA 5CP6A 5B0ZB 3UTAC 5B2JB 3AZMD 2DQNC 4WU8D 1ID3A 4CAYB 3KFUG 4DRAA 3X1UC 3WKJB 3AV2B 3EPHA 5AVBC 3P5JB 2NQBD 5JRGD 3AZHC 1P3AB 3A6NA 1P3BD 1ZLAC 3X1VB 3WTPD 1M18A 5C3IB 4H9RA 3WA9B 3RELB 2VQRA 4UUZA 5BNVA 5DNNA 3REJC 1KX3A 5CP6C 4NE5A 3LZ0B 5KDMA 3TU4A 3MGQB 4NE3A 1P3LA 5DNMC 3W97B 5B0ZD 4ZBJB 1WWSA 5B2JD 3UT9A 2Y2HA 1P3IB 1HQ3C 4H9NA 1F66B 4G92C 2NZDB 5AY8B 1BH8B 3WKJD 3LJAB 5B1MA 5B2JA 5AV8B 3AV2D 3A6NC 3AZIA 1P3AD 2FJ7B 1WWIA 5DNNC 4EO5C 4JJNB 2RIQA 3C1CA 3X1VD 3REKB 3AZJA 5B1LA 4J8WB 1B6WA 4H9OA 3RELD 3WA9D 3TU4C 4J8XB 3NQJA 4Z5TB 4XZQD 1P3LC 3WAAA 3LZ0D 3UT9C 3MGQD 5BO0A 3W97D 3AZFA 5B1MC 1P3ID 2BG1A 4YS3B 3AZIC 1F66D 4J8VB 5B32B 2NZDD 3LJAD 3O62A 3B6FC 5AV8D 3MGRB 1P3PC 3W99B 3C1CC 4E44A 3AZJC 1A7WA 5B1LC 1M19A 5AY8A 3B6GA 5AV9B 2AROA 1KX4B 1EQZB 2FJ7D 3WAAC 4JJND 3REKD 3UTBB 2LY8A 5AV5A 1TZYA 4J8WD 4R8PC 4J8XD 4Z5TD 4LD9A 3REKA 3REIC 4HGAB 1S32B 3MGPB 3AZFC 5AV6A 3AZGD 3W98B 3O62C 4YS3D 1KX5B 2L5AA 4WU9A 1P34A 1M19C 5B32D 4YM6A 3B6GC 2AROC 4KUDB 1M1AD 3W99D 3KXBB 1P3MD 5B33A 4J8VA 5AV5C 1TZYC 5AV9D 2CV5B 1KX4D 3MNNA 1EQZD 3MGRA 4LD9C 3MGSA 5B2IB 2F8NA 3UTBD 2HUEB 3AN2A 1AOIB 5JA4B 5AV6C 4X23B 4DQYB 3AZEA 3AZKB 1S32D 4WJ3C 3MGPD 1W2EA 2BYMB 5GXQC 4WU9C 1P34C 1TAFA 3W98D 1T3UA 4YM6C 4J8UA 1P3OC 1P3GB 4KGCC 4WU8B 1KX5D 3VH6A 5B33C 3W98A 3LELB 5CPKA 2Y2NA 5B0YC 3MNNC 4KUDD 5CPIA 3MGSC 3KXBD 5GT0B 3AN2C 3MVDB 5GSUD 2CV5D 3LZ1A 3F6TA 5B2ID 3C1BB 3AZEC 4H9QB 3H0LC 2IO5C 1AOID 2CV5A 1PZRA 5E5AB 4X23D 3AZKD 4J8UC 4Z66A 1P3KA 5CPKC 1P3FA 2HIOB 3VH5A 3REHA 1P3GD 5B24B 3X1TA 4DRBA 2BYMA 5CPIC 3LELD 4Z2MH 3LZ1C 4G91B 3AZMA 4WU8A 2BYKB 5GT0D 3MVDD 4H9PB 4XUJB 4QLCB 3C1BD 4CSRB 1BH9B 2NQBA 5BNXA 3V9RB 5JRGA 4Z66C 5E5AD 1P3KC 4XZQB 1P3BA 5DNMD 1P3FC 3WTPA 3REHC 3AYWB 3EPLA 3X1TC 3R45A 1ID3C 2PYOB 2HIOD 3KUYB 5B24D 1N1JA 3AZMC 2YFWA 4H9SA 3W96B 2G5IC 5B0ZA 5CHLB 3AZLB 1U35B 2RVQD 4CAYA 2NQBC 5JRGC 1M18C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WKJ A;  3KWQ B;  4XUJ D;  3AV2 A;  2BYK A;  4QLC D;  1KX3 C;  1P3B C;  5B40 B;  3WTP C;  1P3A A;  3X1V A;  3AYW D;  3X1S B;  3WA9 A;  3REL A;  5BT1 D;  4H9S C;  4XZQ A;  5B31 B;  3AZG B;  2PYO D;  5B0Z C;  3KUY D;  3LZ0 A;  4KHA B;  5B2J C;  3B0C T;  4ZUX B;  3B6F D;  3MGQ A;  5BS7 A;  3W97 A;  3W96 D;  5GT3 B;  3WKJ C;  3AZL D;  1U35 D;  1P3I A;  3AV2 C;  1M1A B;  1F1E A;  1F66 A;  1P3M B;  4WZS B;  2NZD A;  1BH8 A;  3KWQ D;  3LJA A;  1P3A C;  4R8P D;  5AV8 A;  3X1V C;  5B40 D;  5C3I C;  3REI D;  3REL C;  3KWQ A;  3WA9 C;  3B0D B;  2FJ7 A;  4JJN A;  4AWL B;  3X1S D;  4J8W A;  3LZ0 C;  4WNN B;  4Z5T A;  5B31 D;  5BS7 C;  3MGQ C;  4J8X A;  3W97 C;  4ZBJ C;  4ZUX D;  1P3I C;  3AZG A;  1F66 C;  1H3O B;  5GT3 D;  2NZD C;  5AY8 C;  3LJA C;  5AV8 C;  1JFI B;  4YS3 A;  3AV1 B;  5AVC B;  5B32 A;  5GSU B;  1R4V A;  3AZN B;  2FJ7 C;  1M1A A;  3AFA B;  3W99 A;  4JJN C;  5CPJ B;  3REK C;  1P3M A;  4J8W C;  5F99 B;  5AV9 A;  1KX4 A;  1EQZ A;  2F8N H;  4J8X C;  4Z5T C;  5GXQ D;  3UTB A;  1P3O D;  4NE6 A;  2CWE A;  3UTA B;  5B31 G;  1S32 A;  3X1U B;  3MGP A;  5B0Y D;  3NQU B;  4YS3 C;  5AVB B;  4J8V C;  5B32 C;  2YFV B;  3AZH B;  1ULY A;  3MGR C;  1KX5 A;  3W99 C;  3AV1 D;  5FUG B;  5AVC D;  1ZLA B;  1H3O A;  5AV9 C;  1KX4 C;  3AZN D;  1EQZ C;  4KUD A;  3AFA D;  5CPJ D;  3KXB A;  3REJ B;  3VH6 T;  3UTB C;  5CP6 B;  5F99 D;  5GSU A;  3AZN A;  5B2I A;  5DNM B;  4HGA C;  1S32 C;  1AOI A;  4WV4 B;  5JA4 A;  3MGP C;  3UTA D;  4X23 A;  1HQ3 B;  3AZK A;  3W98 C;  3X1U D;  4G92 B;  4NFT A;  1KX5 C;  5AVB D;  3A6N B;  1P3G A;  4H9R B;  3AZH D;  4KUD C;  3NQU A;  1KU5 A;  3WTP E;  5BNV B;  4UUZ B;  5DNN B;  5G49 B;  4EO5 B;  3KXB C;  1ZLA D;  3LEL A;  2CV5 C;  3VH5 T;  5KDM B;  5B2I C;  3TU4 B;  1Q9C A;  3REJ D;  2HUE C;  5GT0 A;  5CP6 D;  1P3L B;  3MVD A;  1AOI C;  4X23 C;  3UT9 B;  3B0B A;  3C1B A;  3AZK C;  4H9N B;  4H9Q A;  5E5A A;  5B1M B;  1HQ3 D;  3AZI B;  5DNM A;  1P3G C;  4WU8 C;  3B6F B;  1HQ3 A;  1P3P B;  3A6N D;  3LEL C;  3C1C B;  2HIO A;  3AZJ B;  5B1L B;  5B24 A;  1M18 D;  4H9O B;  5DNN D;  3NQJ B;  1KX3 D;  5GT0 C;  3WAA B;  3MVD C;  4R8P B;  3C1B C;  3TU4 D;  5G49 A;  5BO0 B;  1P3L D;  4H9P A;  3REI B;  4XUJ A;  5E5A C;  3UT9 D;  3AZF B;  4QLC A;  4CSR A;  1BH9 A;  4Z2M G;  1BFM A;  3V9R A;  3B0C W;  5B1M D;  3O62 B;  3AZI D;  3AYW A;  2HIO C;  1M19 B;  5B24 C;  3B6G B;  2ARO B;  1P3P D;  2PYO A;  3C1C D;  3KUY A;  3AZJ D;  5B1L D;  4M6B A;  4G91 C;  1TZY B;  5AV5 B;  2RVQ C;  3B6F A;  3KSY A;  3WAA D;  1P3P A;  4LD9 B;  3W96 A;  3AZL A;  1U35 A;  4XUJ C;  5AV6 B;  4QLC C;  1B67 A;  4R8P A;  3AZF D;  4XZQ C;  5GXQ B;  5B40 A;  4WU9 B;  1P34 B;  3AYW C;  4YM6 B;  3REI A;  1P3O B;  5BT1 C;  3O62 D;  4KGC B;  2PYO C;  5B33 B;  3X1S A;  3KUY C;  1M19 D;  5AY8 D;  3B6G D;  5B0Y B;  2ARO D;  3MNN B;  5B31 A;  3MGS B;  2F8N B;  3W96 C;  3AN2 B;  3AZL C;  4KHA A;  5AV5 D;  1TZY D;  1U35 C;  4ZUX A;  4LD9 D;  3AZE B;  5GT3 A;  2IO5 B;  3KWQ C;  5AV6 D;  5B40 C;  1TAF B;  4J8U B;  4WU9 D;  1P34 D;  3X1S C;  4YM6 D;  5CPK B;  4KGC D;  5B31 C;  3AZG C;  5CPI B;  5GXQ A;  5B33 D;  4J8V D;  1P3O A;  4ZUX C;  3LZ1 B;  4KGC A;  3MNN D;  4WNN A;  3MGR D;  2F8N K;  3MGS D;  2F8N D;  5GT3 C;  3AN2 D;  5B0Y A;  1M1A C;  1P3M C;  3VH6 W;  3AZE D;  1JFI A;  4Z66 B;  3AV1 A;  1P3K B;  5AVC A;  4J8U D;  1P3F B;  3REH B;  3B0D C;  3X1T B;  3AFA A;  1ID3 B;  5CPJ A;  1HTA A;  4AWL C;  5CPK D;  5F99 A;  4E45 A;  3AZM B;  5CPI D;  3LZ1 D;  5B32 G;  3UTA A;  2NQB B;  5BNX B;  3X1U A;  5JRG B;  1M18 B;  2F8N G;  2JSS A;  3VH5 W;  3AV1 C;  5AVC C;  5AVB A;  1P3B B;  1KX3 B;  3WTP B;  5GSU C;  2YFV A;  3AZN C;  3AZH A;  4Z66 D;  3R45 B;  3AFA C;  5FUG A;  5CPJ C;  1P3K D;  1ZLA A;  5F99 C;  1P3F D;  3REH D;  1N1J B;  3X1T D;  1ID3 D;  2YFW B;  3REJ A;  5CP6 A;  5B0Z B;  3UTA C;  5B2J B;  3AZM D;  4WU8 D;  1ID3 A;  4CAY B;  4DRA A;  3X1U C;  3WKJ B;  3AV2 B;  5AVB C;  2NQB D;  5JRG D;  3AZH C;  1P3A B;  3A6N A;  1P3B D;  1ZLA C;  3X1V B;  3WTP D;  1M18 A;  5C3I B;  4H9R A;  3WA9 B;  3REL B;  4UUZ A;  5BNV A;  5DNN A;  3REJ C;  1KX3 A;  5CP6 C;  4NE5 A;  3LZ0 B;  5KDM A;  3TU4 A;  3MGQ B;  4NE3 A;  1P3L A;  5DNM C;  3W97 B;  5B0Z D;  4ZBJ B;  1WWS A;  5B2J D;  3UT9 A;  1P3I B;  1HQ3 C;  4H9N A;  1F66 B;  4G92 C;  2NZD B;  5AY8 B;  1BH8 B;  3WKJ D;  3LJA B;  5B1M A;  5B2J A;  5AV8 B;  3AV2 D;  3A6N C;  3AZI A;  1P3A D;  2FJ7 B;  1WWI A;  5DNN C;  4EO5 C;  4JJN B;  3C1C A;  3X1V D;  3REK B;  3AZJ A;  5B1L A;  4J8W B;  1B6W A;  4H9O A;  3REL D;  3WA9 D;  3TU4 C;  4J8X B;  3NQJ A;  4Z5T B;  4XZQ D;  1P3L C;  3WAA A;  3LZ0 D;  3UT9 C;  3MGQ D;  5BO0 A;  3W97 D;  3AZF A;  5B1M C;  1P3I D;  4YS3 B;  3AZI C;  1F66 D;  4J8V B;  5B32 B;  2NZD D;  3LJA D;  3O62 A;  3B6F C;  5AV8 D;  3MGR B;  1P3P C;  3W99 B;  3C1C C;  4E44 A;  3AZJ C;  1A7W A;  5B1L C;  1M19 A;  5AY8 A;  3B6G A;  5AV9 B;  2ARO A;  1KX4 B;  1EQZ B;  2FJ7 D;  3WAA C;  4JJN D;  3REK D;  3UTB B;  2LY8 A;  5AV5 A;  1TZY A;  4J8W D;  4R8P C;  4J8X D;  4Z5T D;  4LD9 A;  3REK A;  3REI C;  4HGA B;  1S32 B;  3MGP B;  3AZF C;  5AV6 A;  3AZG D;  3W98 B;  3O62 C;  4YS3 D;  1KX5 B;  2L5A A;  4WU9 A;  1P34 A;  1M19 C;  5B32 D;  4YM6 A;  3B6G C;  2ARO C;  4KUD B;  1M1A D;  3W99 D;  3KXB B;  1P3M D;  5B33 A;  4J8V A;  5AV5 C;  1TZY C;  5AV9 D;  2CV5 B;  1KX4 D;  3MNN A;  1EQZ D;  3MGR A;  4LD9 C;  3MGS A;  5B2I B;  2F8N A;  3UTB D;  2HUE B;  3AN2 A;  1AOI B;  5JA4 B;  5AV6 C;  4X23 B;  3AZE A;  3AZK B;  1S32 D;  3MGP D;  2BYM B;  5GXQ C;  4WU9 C;  1P34 C;  1TAF A;  3W98 D;  4YM6 C;  4J8U A;  1P3O C;  1P3G B;  4KGC C;  4WU8 B;  1KX5 D;  3VH6 A;  5B33 C;  3W98 A;  3LEL B;  5CPK A;  5B0Y C;  3MNN C;  4KUD D;  5CPI A;  3MGS C;  3KXB D;  5GT0 B;  3AN2 C;  3MVD B;  5GSU D;  2CV5 D;  3LZ1 A;  5B2I D;  3C1B B;  3AZE C;  4H9Q B;  2IO5 C;  1AOI D;  2CV5 A;  5E5A B;  4X23 D;  3AZK D;  4J8U C;  4Z66 A;  1P3K A;  5CPK C;  1P3F A;  2HIO B;  3VH5 A;  3REH A;  1P3G D;  5B24 B;  3X1T A;  4DRB A;  2BYM A;  5CPI C;  3LEL D;  4Z2M H;  3LZ1 C;  4G91 B;  3AZM A;  4WU8 A;  2BYK B;  5GT0 D;  3MVD D;  4H9P B;  4XUJ B;  4QLC B;  3C1B D;  4CSR B;  1BH9 B;  2NQB A;  5BNX A;  3V9R B;  5JRG A;  4Z66 C;  5E5A D;  1P3K C;  4XZQ B;  1P3B A;  5DNM D;  1P3F C;  3WTP A;  3REH C;  3AYW B;  3X1T C;  3R45 A;  1ID3 C;  2PYO B;  2HIO D;  3KUY B;  5B24 D;  1N1J A;  3AZM C;  2YFW A;  4H9S A;  3W96 B;  5B0Z A;  5CHL B;  3AZL B;  1U35 B;  2RVQ D;  4CAY A;  2NQB C;  5JRG C;  1M18 C; 
#chains in the Genus database with same CATH topology
 3WKJ A;  3KWQ B;  4XUJ D;  3AV2 A;  2BYK A;  4QLC D;  1KX3 C;  1P3B C;  5B40 B;  3WTP C;  1P3A A;  3X1V A;  3AYW D;  3X1S B;  3WA9 A;  3REL A;  5BT1 D;  4H9S C;  4XZQ A;  5B31 B;  3AZG B;  2PYO D;  5B0Z C;  3KUY D;  3LZ0 A;  4KHA B;  5B2J C;  3B0C T;  4ZUX B;  3B6F D;  3MGQ A;  2Y2I A;  5BS7 A;  3W97 A;  3W96 D;  5GT3 B;  3WKJ C;  3AZL D;  1U35 D;  1P3I A;  3AV2 C;  1M1A B;  1F1E A;  1F66 A;  1P3M B;  2JCH A;  4WZS B;  2NZD A;  1BH8 A;  3KWQ D;  3LJA A;  1P3A C;  4R8P D;  5AV8 A;  3X1V C;  5B40 D;  3A1I A;  5C3I C;  3REI D;  3REL C;  3KWQ A;  3WA9 C;  3B0D B;  2FJ7 A;  2ZY3 A;  4JJN A;  2DF4 C;  2ZY4 A;  4AWL B;  3X1S D;  4J8W A;  3LZ0 C;  4WNN B;  4Z5T A;  5B31 D;  5BS7 C;  3MGQ C;  4J8X A;  3W97 C;  3EG5 B;  4ZBJ C;  4ZUX D;  1P3I C;  2Y2G A;  3AZG A;  1F66 C;  1H3O B;  5GT3 D;  2NZD C;  5AY8 C;  3LJA C;  5AV8 C;  1JFI B;  4YS3 A;  3AV1 B;  5AVC B;  5B32 A;  5GSU B;  1R4V A;  3AZN B;  2FJ7 C;  1M1A A;  3AFA B;  3W99 A;  4JJN C;  5CPJ B;  3REK C;  1P3M A;  4J8W C;  5F99 B;  5AV9 A;  1KX4 A;  1EQZ A;  2F8N H;  4J8X C;  4Z5T C;  5GXQ D;  3UTB A;  1P3O D;  4NE6 A;  2CWE A;  3UTA B;  3H0R C;  5B31 G;  1S32 A;  3X1U B;  3MGP A;  5B0Y D;  3NQU B;  4YS3 C;  2XD1 A;  5AVB B;  4J8V C;  5B32 C;  2YFV B;  3AZH B;  1ULY A;  3MGR C;  1KX5 A;  3W99 C;  3AV1 D;  5FUG B;  5AVC D;  1ZLA B;  1H3O A;  5AV9 C;  1KX4 C;  3AZN D;  1EQZ C;  4KUD A;  3AFA D;  5CPJ D;  3KXB A;  3REJ B;  3VH6 T;  3UTB C;  5CP6 B;  3IP4 C;  5F99 D;  5GSU A;  3AZN A;  5B2I A;  5DNM B;  4HGA C;  1S32 C;  1AOI A;  4WV4 B;  5JA4 A;  3MGP C;  3EPJ A;  3UTA D;  3A1K A;  4X23 A;  1HQ3 B;  3AZK A;  3W98 C;  3X1U D;  4G92 B;  4NFT A;  1KX5 C;  5AVB D;  3A6N B;  1P3G A;  4H9R B;  2Y2Q A;  3AZH D;  4KUD C;  3NQU A;  1KU5 A;  3WTP E;  5BNV B;  4UUZ B;  5DNN B;  5G49 B;  4EO5 B;  3KXB C;  1ZLA D;  3LEL A;  2CV5 C;  3VH5 T;  5KDM B;  5B2I C;  3TU4 B;  1Q9C A;  3REJ D;  2HUE C;  5GT0 A;  5CP6 D;  1P3L B;  3MVD A;  1AOI C;  4X23 C;  3UT9 B;  3B0B A;  3C1B A;  3AZK C;  4H9N B;  4H9Q A;  2ZY2 A;  5E5A A;  2FFF B;  5B1M B;  1HQ3 D;  3AZI B;  5DNM A;  1P3G C;  4WU8 C;  3B6F B;  1HQ3 A;  1P3P B;  3A6N D;  3LEL C;  3C1C B;  2HIO A;  3AZJ B;  5B1L B;  5B24 A;  1M18 D;  4H9O B;  5DNN D;  3NQJ B;  1KX3 D;  5GT0 C;  3WAA B;  3MVD C;  4R8P B;  3C1B C;  3TU4 D;  5G49 A;  5BO0 B;  1P3L D;  4H9P A;  3REI B;  1Z2C B;  4XUJ A;  5E5A C;  3UT9 D;  3AZF B;  2ZY5 A;  4QLC A;  2XD5 A;  4CSR A;  1BH9 A;  4Z2M G;  1BFM A;  3V9R A;  3B0C W;  5B1M D;  3O62 B;  3AZI D;  4UPK A;  3AYW A;  2HIO C;  1M19 B;  5B24 C;  3B6G B;  2ARO B;  1P3P D;  2PYO A;  3C1C D;  3KUY A;  3AZJ D;  5B1L D;  4M6B A;  4G91 C;  1TZY B;  5AV5 B;  2RVQ C;  3AL0 C;  3B6F A;  3KSY A;  3WAA D;  1P3P A;  4LD9 B;  3W96 A;  3AZL A;  1U35 A;  4XUJ C;  2Y2L A;  5AV6 B;  4QLC C;  1B67 A;  4R8P A;  3AZF D;  4XZQ C;  3H0M C;  5GXQ B;  5B40 A;  4WU9 B;  1P34 B;  3AYW C;  4YM6 B;  3REI A;  1P3O B;  5BT1 C;  3O62 D;  4KGC B;  2PYO C;  5B33 B;  3X1S A;  3KUY C;  1M19 D;  5AY8 D;  3B6G D;  5B0Y B;  2ARO D;  3MNN B;  5B31 A;  3MGS B;  2F8N B;  3W96 C;  3AN2 B;  2Y2K A;  3AZL C;  4KHA A;  5AV5 D;  1TZY D;  1U35 C;  4ZUX A;  4LD9 D;  3AZE B;  5GT3 A;  2IO5 B;  3KWQ C;  5AV6 D;  5B40 C;  1TAF B;  4J8U B;  2Y2O A;  4WU9 D;  1P34 D;  3X1S C;  4YM6 D;  5CPK B;  4KGC D;  5B31 C;  3AZG C;  5CPI B;  5GXQ A;  2Y2P A;  5B33 D;  4J8V D;  1P3O A;  4ZUX C;  3LZ1 B;  4KGC A;  3MNN D;  4WNN A;  3MGR D;  2F2A C;  2F8N K;  3MGS D;  2F8N D;  5GT3 C;  2Y2J A;  3AN2 D;  5B0Y A;  1M1A C;  2UWX A;  1P3M C;  3FDD A;  3VH6 W;  2ZM5 A;  3AZE D;  1JFI A;  4Z66 B;  2W8S A;  3AV1 A;  1P3K B;  5AVC A;  4J8U D;  1P3F B;  3REH B;  3B0D C;  3X1T B;  3AFA A;  1ID3 B;  5CPJ A;  1HTA A;  4AWL C;  5CPK D;  2Y2M A;  5F99 A;  4E45 A;  3AZM B;  5CPI D;  3EPK A;  3LZ1 D;  5B32 G;  3UTA A;  2NQB B;  5BNX B;  2JE5 A;  3X1U A;  5JRG B;  1M18 B;  2F8N G;  2G5H C;  2JSS A;  3VH5 W;  3AV1 C;  5AVC C;  5AVB A;  1P3B B;  1KX3 B;  3WTP B;  5GSU C;  2YFV A;  3AZN C;  3AZH A;  4Z66 D;  3R45 B;  3AFA C;  5FUG A;  5CPJ C;  1P3K D;  1ZLA A;  5F99 C;  1P3F D;  3REH D;  1N1J B;  3X1T D;  2J8P A;  1ID3 D;  2YFW B;  3REJ A;  5CP6 A;  5B0Z B;  3UTA C;  5B2J B;  3AZM D;  2DQN C;  4WU8 D;  1ID3 A;  4CAY B;  3KFU G;  4DRA A;  3X1U C;  3WKJ B;  3AV2 B;  3EPH A;  5AVB C;  3P5J B;  2NQB D;  5JRG D;  3AZH C;  1P3A B;  3A6N A;  1P3B D;  1ZLA C;  3X1V B;  3WTP D;  1M18 A;  5C3I B;  4H9R A;  3WA9 B;  3REL B;  2VQR A;  4UUZ A;  5BNV A;  5DNN A;  3REJ C;  1KX3 A;  5CP6 C;  4NE5 A;  3LZ0 B;  5KDM A;  3TU4 A;  3MGQ B;  4NE3 A;  1P3L A;  5DNM C;  3W97 B;  5B0Z D;  4ZBJ B;  1WWS A;  5B2J D;  3UT9 A;  2Y2H A;  1P3I B;  1HQ3 C;  4H9N A;  1F66 B;  4G92 C;  2NZD B;  5AY8 B;  1BH8 B;  3WKJ D;  3LJA B;  5B1M A;  5B2J A;  5AV8 B;  3AV2 D;  3A6N C;  3AZI A;  1P3A D;  2FJ7 B;  1WWI A;  5DNN C;  4EO5 C;  4JJN B;  2RIQ A;  3C1C A;  3X1V D;  3REK B;  3AZJ A;  5B1L A;  4J8W B;  1B6W A;  4H9O A;  3REL D;  3WA9 D;  3TU4 C;  4J8X B;  3NQJ A;  4Z5T B;  4XZQ D;  1P3L C;  3WAA A;  3LZ0 D;  3UT9 C;  3MGQ D;  5BO0 A;  3W97 D;  3AZF A;  5B1M C;  1P3I D;  2BG1 A;  4YS3 B;  3AZI C;  1F66 D;  4J8V B;  5B32 B;  2NZD D;  3LJA D;  3O62 A;  3B6F C;  5AV8 D;  3MGR B;  1P3P C;  3W99 B;  3C1C C;  4E44 A;  3AZJ C;  1A7W A;  5B1L C;  1M19 A;  5AY8 A;  3B6G A;  5AV9 B;  2ARO A;  1KX4 B;  1EQZ B;  2FJ7 D;  3WAA C;  4JJN D;  3REK D;  3UTB B;  2LY8 A;  5AV5 A;  1TZY A;  4J8W D;  4R8P C;  4J8X D;  4Z5T D;  4LD9 A;  3REK A;  3REI C;  4HGA B;  1S32 B;  3MGP B;  3AZF C;  5AV6 A;  3AZG D;  3W98 B;  3O62 C;  4YS3 D;  1KX5 B;  2L5A A;  4WU9 A;  1P34 A;  1M19 C;  5B32 D;  4YM6 A;  3B6G C;  2ARO C;  4KUD B;  1M1A D;  3W99 D;  3KXB B;  1P3M D;  5B33 A;  4J8V A;  5AV5 C;  1TZY C;  5AV9 D;  2CV5 B;  1KX4 D;  3MNN A;  1EQZ D;  3MGR A;  4LD9 C;  3MGS A;  5B2I B;  2F8N A;  3UTB D;  2HUE B;  3AN2 A;  1AOI B;  5JA4 B;  5AV6 C;  4X23 B;  4DQY B;  3AZE A;  3AZK B;  1S32 D;  4WJ3 C;  3MGP D;  1W2E A;  2BYM B;  5GXQ C;  4WU9 C;  1P34 C;  1TAF A;  3W98 D;  1T3U A;  4YM6 C;  4J8U A;  1P3O C;  1P3G B;  4KGC C;  4WU8 B;  1KX5 D;  3VH6 A;  5B33 C;  3W98 A;  3LEL B;  5CPK A;  2Y2N A;  5B0Y C;  3MNN C;  4KUD D;  5CPI A;  3MGS C;  3KXB D;  5GT0 B;  3AN2 C;  3MVD B;  5GSU D;  2CV5 D;  3LZ1 A;  3F6T A;  5B2I D;  3C1B B;  3AZE C;  4H9Q B;  3H0L C;  2IO5 C;  1AOI D;  2CV5 A;  1PZR A;  5E5A B;  4X23 D;  3AZK D;  4J8U C;  4Z66 A;  1P3K A;  5CPK C;  1P3F A;  2HIO B;  3VH5 A;  3REH A;  1P3G D;  5B24 B;  3X1T A;  4DRB A;  2BYM A;  5CPI C;  3LEL D;  4Z2M H;  3LZ1 C;  4G91 B;  3AZM A;  4WU8 A;  2BYK B;  5GT0 D;  3MVD D;  4H9P B;  4XUJ B;  4QLC B;  3C1B D;  4CSR B;  1BH9 B;  2NQB A;  5BNX A;  3V9R B;  5JRG A;  4Z66 C;  5E5A D;  1P3K C;  4XZQ B;  1P3B A;  5DNM D;  1P3F C;  3WTP A;  3REH C;  3AYW B;  3EPL A;  3X1T C;  3R45 A;  1ID3 C;  2PYO B;  2HIO D;  3KUY B;  5B24 D;  1N1J A;  3AZM C;  2YFW A;  4H9S A;  3W96 B;  2G5I C;  5B0Z A;  5CHL B;  3AZL B;  1U35 B;  2RVQ D;  4CAY A;  2NQB C;  5JRG C;  1M18 C; 
#chains in the Genus database with same CATH homology
 3WKJ A;  3KWQ B;  4XUJ D;  3AV2 A;  2BYK A;  4QLC D;  1KX3 C;  1P3B C;  5B40 B;  3WTP C;  1P3A A;  3X1V A;  3AYW D;  3X1S B;  3WA9 A;  3REL A;  5BT1 D;  4H9S C;  4XZQ A;  5B31 B;  3AZG B;  2PYO D;  5B0Z C;  3KUY D;  3LZ0 A;  4KHA B;  5B2J C;  3B0C T;  4ZUX B;  3B6F D;  3MGQ A;  2Y2I A;  5BS7 A;  3W97 A;  3W96 D;  5GT3 B;  3WKJ C;  3AZL D;  1U35 D;  1P3I A;  3AV2 C;  1M1A B;  1F1E A;  1F66 A;  1P3M B;  2JCH A;  4WZS B;  2NZD A;  1BH8 A;  3KWQ D;  3LJA A;  1P3A C;  4R8P D;  5AV8 A;  3X1V C;  5B40 D;  3A1I A;  5C3I C;  3REI D;  3REL C;  3KWQ A;  3WA9 C;  3B0D B;  2FJ7 A;  2ZY3 A;  4JJN A;  2DF4 C;  2ZY4 A;  4AWL B;  3X1S D;  4J8W A;  3LZ0 C;  4WNN B;  4Z5T A;  5B31 D;  5BS7 C;  3MGQ C;  4J8X A;  3W97 C;  3EG5 B;  4ZBJ C;  4ZUX D;  1P3I C;  2Y2G A;  3AZG A;  1F66 C;  1H3O B;  5GT3 D;  2NZD C;  5AY8 C;  3LJA C;  5AV8 C;  1JFI B;  4YS3 A;  3AV1 B;  5AVC B;  5B32 A;  5GSU B;  1R4V A;  3AZN B;  2FJ7 C;  1M1A A;  3AFA B;  3W99 A;  4JJN C;  5CPJ B;  3REK C;  1P3M A;  4J8W C;  5F99 B;  5AV9 A;  1KX4 A;  1EQZ A;  2F8N H;  4J8X C;  4Z5T C;  5GXQ D;  3UTB A;  1P3O D;  4NE6 A;  2CWE A;  3UTA B;  3H0R C;  5B31 G;  1S32 A;  3X1U B;  3MGP A;  5B0Y D;  3NQU B;  4YS3 C;  2XD1 A;  5AVB B;  4J8V C;  5B32 C;  2YFV B;  3AZH B;  1ULY A;  3MGR C;  1KX5 A;  3W99 C;  3AV1 D;  5FUG B;  5AVC D;  1ZLA B;  1H3O A;  5AV9 C;  1KX4 C;  3AZN D;  1EQZ C;  4KUD A;  3AFA D;  5CPJ D;  3KXB A;  3REJ B;  3VH6 T;  3UTB C;  5CP6 B;  3IP4 C;  5F99 D;  5GSU A;  3AZN A;  5B2I A;  5DNM B;  4HGA C;  1S32 C;  1AOI A;  4WV4 B;  5JA4 A;  3MGP C;  3EPJ A;  3UTA D;  3A1K A;  4X23 A;  1HQ3 B;  3AZK A;  3W98 C;  3X1U D;  4G92 B;  4NFT A;  1KX5 C;  5AVB D;  3A6N B;  1P3G A;  4H9R B;  2Y2Q A;  3AZH D;  4KUD C;  3NQU A;  1KU5 A;  3WTP E;  5BNV B;  4UUZ B;  5DNN B;  5G49 B;  4EO5 B;  3KXB C;  1ZLA D;  3LEL A;  2CV5 C;  3VH5 T;  5KDM B;  5B2I C;  3TU4 B;  1Q9C A;  3REJ D;  2HUE C;  5GT0 A;  5CP6 D;  1P3L B;  3MVD A;  1AOI C;  4X23 C;  3UT9 B;  3B0B A;  3C1B A;  3AZK C;  4H9N B;  4H9Q A;  2ZY2 A;  5E5A A;  2FFF B;  5B1M B;  1HQ3 D;  3AZI B;  5DNM A;  1P3G C;  4WU8 C;  3B6F B;  1HQ3 A;  1P3P B;  3A6N D;  3LEL C;  3C1C B;  2HIO A;  3AZJ B;  5B1L B;  5B24 A;  1M18 D;  4H9O B;  5DNN D;  3NQJ B;  1KX3 D;  5GT0 C;  3WAA B;  3MVD C;  4R8P B;  3C1B C;  3TU4 D;  5G49 A;  5BO0 B;  1P3L D;  4H9P A;  3REI B;  1Z2C B;  4XUJ A;  5E5A C;  3UT9 D;  3AZF B;  2ZY5 A;  4QLC A;  2XD5 A;  4CSR A;  1BH9 A;  4Z2M G;  1BFM A;  3V9R A;  3B0C W;  5B1M D;  3O62 B;  3AZI D;  4UPK A;  3AYW A;  2HIO C;  1M19 B;  5B24 C;  3B6G B;  2ARO B;  1P3P D;  2PYO A;  3C1C D;  3KUY A;  3AZJ D;  5B1L D;  4M6B A;  4G91 C;  1TZY B;  5AV5 B;  2RVQ C;  3AL0 C;  3B6F A;  3KSY A;  3WAA D;  1P3P A;  4LD9 B;  3W96 A;  3AZL A;  1U35 A;  4XUJ C;  2Y2L A;  5AV6 B;  4QLC C;  1B67 A;  4R8P A;  3AZF D;  4XZQ C;  3H0M C;  5GXQ B;  5B40 A;  4WU9 B;  1P34 B;  3AYW C;  4YM6 B;  3REI A;  1P3O B;  5BT1 C;  3O62 D;  4KGC B;  2PYO C;  5B33 B;  3X1S A;  3KUY C;  1M19 D;  5AY8 D;  3B6G D;  5B0Y B;  2ARO D;  3MNN B;  5B31 A;  3MGS B;  2F8N B;  3W96 C;  3AN2 B;  2Y2K A;  3AZL C;  4KHA A;  5AV5 D;  1TZY D;  1U35 C;  4ZUX A;  4LD9 D;  3AZE B;  5GT3 A;  2IO5 B;  3KWQ C;  5AV6 D;  5B40 C;  1TAF B;  4J8U B;  2Y2O A;  4WU9 D;  1P34 D;  3X1S C;  4YM6 D;  5CPK B;  4KGC D;  5B31 C;  3AZG C;  5CPI B;  5GXQ A;  2Y2P A;  5B33 D;  4J8V D;  1P3O A;  4ZUX C;  3LZ1 B;  4KGC A;  3MNN D;  4WNN A;  3MGR D;  2F2A C;  2F8N K;  3MGS D;  2F8N D;  5GT3 C;  2Y2J A;  3AN2 D;  5B0Y A;  1M1A C;  2UWX A;  1P3M C;  3FDD A;  3VH6 W;  2ZM5 A;  3AZE D;  1JFI A;  4Z66 B;  2W8S A;  3AV1 A;  1P3K B;  5AVC A;  4J8U D;  1P3F B;  3REH B;  3B0D C;  3X1T B;  3AFA A;  1ID3 B;  5CPJ A;  1HTA A;  4AWL C;  5CPK D;  2Y2M A;  5F99 A;  4E45 A;  3AZM B;  5CPI D;  3EPK A;  3LZ1 D;  5B32 G;  3UTA A;  2NQB B;  5BNX B;  2JE5 A;  3X1U A;  5JRG B;  1M18 B;  2F8N G;  2G5H C;  2JSS A;  3VH5 W;  3AV1 C;  5AVC C;  5AVB A;  1P3B B;  1KX3 B;  3WTP B;  5GSU C;  2YFV A;  3AZN C;  3AZH A;  4Z66 D;  3R45 B;  3AFA C;  5FUG A;  5CPJ C;  1P3K D;  1ZLA A;  5F99 C;  1P3F D;  3REH D;  1N1J B;  3X1T D;  2J8P A;  1ID3 D;  2YFW B;  3REJ A;  5CP6 A;  5B0Z B;  3UTA C;  5B2J B;  3AZM D;  2DQN C;  4WU8 D;  1ID3 A;  4CAY B;  3KFU G;  4DRA A;  3X1U C;  3WKJ B;  3AV2 B;  3EPH A;  5AVB C;  3P5J B;  2NQB D;  5JRG D;  3AZH C;  1P3A B;  3A6N A;  1P3B D;  1ZLA C;  3X1V B;  3WTP D;  1M18 A;  5C3I B;  4H9R A;  3WA9 B;  3REL B;  2VQR A;  4UUZ A;  5BNV A;  5DNN A;  3REJ C;  1KX3 A;  5CP6 C;  4NE5 A;  3LZ0 B;  5KDM A;  3TU4 A;  3MGQ B;  4NE3 A;  1P3L A;  5DNM C;  3W97 B;  5B0Z D;  4ZBJ B;  1WWS A;  5B2J D;  3UT9 A;  2Y2H A;  1P3I B;  1HQ3 C;  4H9N A;  1F66 B;  4G92 C;  2NZD B;  5AY8 B;  1BH8 B;  3WKJ D;  3LJA B;  5B1M A;  5B2J A;  5AV8 B;  3AV2 D;  3A6N C;  3AZI A;  1P3A D;  2FJ7 B;  1WWI A;  5DNN C;  4EO5 C;  4JJN B;  2RIQ A;  3C1C A;  3X1V D;  3REK B;  3AZJ A;  5B1L A;  4J8W B;  1B6W A;  4H9O A;  3REL D;  3WA9 D;  3TU4 C;  4J8X B;  3NQJ A;  4Z5T B;  4XZQ D;  1P3L C;  3WAA A;  3LZ0 D;  3UT9 C;  3MGQ D;  5BO0 A;  3W97 D;  3AZF A;  5B1M C;  1P3I D;  2BG1 A;  4YS3 B;  3AZI C;  1F66 D;  4J8V B;  5B32 B;  2NZD D;  3LJA D;  3O62 A;  3B6F C;  5AV8 D;  3MGR B;  1P3P C;  3W99 B;  3C1C C;  4E44 A;  3AZJ C;  1A7W A;  5B1L C;  1M19 A;  5AY8 A;  3B6G A;  5AV9 B;  2ARO A;  1KX4 B;  1EQZ B;  2FJ7 D;  3WAA C;  4JJN D;  3REK D;  3UTB B;  2LY8 A;  5AV5 A;  1TZY A;  4J8W D;  4R8P C;  4J8X D;  4Z5T D;  4LD9 A;  3REK A;  3REI C;  4HGA B;  1S32 B;  3MGP B;  3AZF C;  5AV6 A;  3AZG D;  3W98 B;  3O62 C;  4YS3 D;  1KX5 B;  2L5A A;  4WU9 A;  1P34 A;  1M19 C;  5B32 D;  4YM6 A;  3B6G C;  2ARO C;  4KUD B;  1M1A D;  3W99 D;  3KXB B;  1P3M D;  5B33 A;  4J8V A;  5AV5 C;  1TZY C;  5AV9 D;  2CV5 B;  1KX4 D;  3MNN A;  1EQZ D;  3MGR A;  4LD9 C;  3MGS A;  5B2I B;  2F8N A;  3UTB D;  2HUE B;  3AN2 A;  1AOI B;  5JA4 B;  5AV6 C;  4X23 B;  4DQY B;  3AZE A;  3AZK B;  1S32 D;  4WJ3 C;  3MGP D;  1W2E A;  2BYM B;  5GXQ C;  4WU9 C;  1P34 C;  1TAF A;  3W98 D;  1T3U A;  4YM6 C;  4J8U A;  1P3O C;  1P3G B;  4KGC C;  4WU8 B;  1KX5 D;  3VH6 A;  5B33 C;  3W98 A;  3LEL B;  5CPK A;  2Y2N A;  5B0Y C;  3MNN C;  4KUD D;  5CPI A;  3MGS C;  3KXB D;  5GT0 B;  3AN2 C;  3MVD B;  5GSU D;  2CV5 D;  3LZ1 A;  3F6T A;  5B2I D;  3C1B B;  3AZE C;  4H9Q B;  3H0L C;  2IO5 C;  1AOI D;  2CV5 A;  1PZR A;  5E5A B;  4X23 D;  3AZK D;  4J8U C;  4Z66 A;  1P3K A;  5CPK C;  1P3F A;  2HIO B;  3VH5 A;  3REH A;  1P3G D;  5B24 B;  3X1T A;  4DRB A;  2BYM A;  5CPI C;  3LEL D;  4Z2M H;  3LZ1 C;  4G91 B;  3AZM A;  4WU8 A;  2BYK B;  5GT0 D;  3MVD D;  4H9P B;  4XUJ B;  4QLC B;  3C1B D;  4CSR B;  1BH9 B;  2NQB A;  5BNX A;  3V9R B;  5JRG A;  4Z66 C;  5E5A D;  1P3K C;  4XZQ B;  1P3B A;  5DNM D;  1P3F C;  3WTP A;  3REH C;  3AYW B;  3EPL A;  3X1T C;  3R45 A;  1ID3 C;  2PYO B;  2HIO D;  3KUY B;  5B24 D;  1N1J A;  3AZM C;  2YFW A;  4H9S A;  3W96 B;  2G5I C;  5B0Z A;  5CHL B;  3AZL B;  1U35 B;  2RVQ D;  4CAY A;  2NQB C;  5JRG C;  1M18 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...