3W98A

Crystal structure of human nucleosome core particle lacking h3.1 n-terminal region
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w98A00
1P34A 3AN2D 3AZKD 5F99C 1H3OA 5CPKA 1Q9CA 1F1EA 3X1VC 3AN2B 3MGSB 1TZYD 1R4VA 1WWIA 5B31A 4WU8C 3WTPD 4Z66B 3V9RB 5B0YA 3LELC 1P3PD 3W96C 3B0CT 5JRGB 3NQUB 4CSRB 3X1TD 3LZ1A 3REHC 3B0DC 3REHD 5AV9B 3UTAA 3RELC 4YS3D 2NQBA 4QLCC 3WTPC 5F99A 4H9PB 3W97A 1U35A 4G91C 3AZMB 3WA9A 3WA9D 3W99D 5F99D 5CPIB 1P3GB 4JJNA 3AN2C 5B0YC 3KXBD 1TZYA 4KHAA 2AROC 4J8XC 5B0ZC 5AY8B 3LELB 4XZQC 4Z2MH 3KUYC 5AV5D 4JJNC 3AN2A 3MNNA 3B0DB 3R45A 3UTBB 5BNVA 5E5AD 3AZEA 5B40A 5B40D 5AV5A 5BS7C 5B24D 3MGPC 5JA4B 5CPIC 5B0ZA 1P3GC 4R8PB 3MGPD 3UTAD 3AV1B 2IO5B 2F8NK 2AROB 3KXBA 5B40C 5AV9A 4J8VA 2F8NA 4NFTA 1H3OB 4WU8B 3KUYB 4Z66C 2YFWB 3TU4B 1AOIA 3TU4D 4X23D 3KUYD 1S32C 4XZQD 1WWSA 1P3LC 3AZKA 4KGCB 1F66D 1P3GA 2HIOC 1P3OC 2AROD 3C1BC 3MGPB 3KXBC 3UTAB 4R8PD 3UTBA 3AV1D 4J8WD 1P3ID 1P3LA 4YS3A 1HQ3C 5B40B 5AV6C 5DNMA 3MGRA 5E5AB 5B0ZB 3VH6A 4R8PA 3UTBD 4QLCD 4YS3C 5B24A 3B6GC 4KHAB 3NQJB 5AV5B 3AZIC 1P3MC 3B0CW 1HTAA 1P3PC 3LELA 3LELD 3UTBC 4KGCC 5C3IC 1EQZD 3WKJC 5AV6D 3R45B 3LJAA 3KXBB 1M18A 3AZFC 5BNVB 2F8NB 5G49A 4EO5B 5BT1C 1KX4C 4KUDA 1F66C 4YS3B 2CWEA 4KGCA 5KDMA 5B33A 3REHB 4X23C 3AFAA 3X1TB 4ZUXC 3X1SB 1P3PB 4Z66D 3WTPB 4WU8A 1P3AA 1P3LB 3B6FC 2F8NH 4NE3A 3TU4A 1AOIB 3MGSD 3MVDD 2RVQD 3C1BB 3UTAC 4YM6A 4XUJC 5B1MA 4WU9D 3AZKB 4H9QA 3AZLA 4EO5C 1P3BB 5AVCC 1KX3C 4J8XB 3NQJA 2PYOB 4J8UD 4CAYA 3A6ND 5GT3B 3A6NA 3AZLC 4DRAA 4ZUXB 1A7WA 3AZHC 3AZED 3X1SC 4JJND 3C1CB 3KWQA 4H9RB 4Z66A 4E45A 1KU5A 2YFVA 5AVBB 4H9OA 3O62B 3RELA 5B32D 5B0YD 2NQBB 5DNND 4KUDB 3KWQC 2BYMA 3W96A 2BYKB 2IO5C 5KDMB 5B33B 3REHA 3REIC 3AZJC 3WA9C 5B2JC 3LZ1D 5FUGA 3X1TA 3WAAD 5GT0A 3AFAD 5B1MB 3REJB 3WTPA 4WNNA 5GT3C 1M18D 3AZLB 1U35D 3W97D 1P3BA 2NZDD 4AWLB 5DNMC 3MGRC 5B1LD 3C1CC 3X1TC 1S32B 4E44A 1P34C 5CPKC 3O62C 3B6FB 3MNNB 1ZLAC 1TZYC 2FJ7D 4Z5TA 4J8XA 3AZNB 1P3PA 5B2JA 3KWQB 3X1VD 3UT9B 2CV5B 2L5AA 1M1AB 5B31C 1JFIB 3AZKC 3AZJB 3AYWD 3W98C 4Z5TC 5B2IC 4Z2MG 4YM6B 5JA4A 5CPKD 2PYOC 2BYMB 1BFMA 2HUEB 3W96B 5JRGC 3AV1A 2YFVB 3O62A 5DNMD 3MGRD 5FUGB 5AV9C 3AZIB 1P3MB 3RELB 4J8VB 1BH8A 5AV8A 3REJA 2F8NG 4CAYB 4WZSB 5C3IB 3WKJB 1B6WA 2BYKA 3AFAC 2YFWA 5CPJB 4ZUXA 3VH5T 1M19B 5B2JD 3LZ0D 5GXQB 3AV2D 3AZFB 1S32A 1P3FC 1P3KC 4H9RA 5AV8D 5AVBA 4Z5TB 3LJAC 5GXQD 5B2JB 4H9NA 3REJC 1JFIA 5CHLB 3X1UD 1ZLAA 1KX5C 1BH9B 3MGQD 4J8VD 3AZHD 5GT0B 3MGRB 5DNMB 1KX5D 4DRBA 5E5AA 4WNNB 3A6NC 3B6GA 3W98A 2FJ7A 5B2IA 5AVCD 1KX3D 4UUZA 4XUJB 1P3AC 5GSUB 1P3KD 3UT9D 2CV5D 1P3FD 1M1AD 3B6FA 3X1VB 3LJAB 5GXQA 3LZ0C 3AV2C 3MGSC 3AZNA 3AZIA 3AZND 1P3MA 3VH6W 3MNND 3UT9A 5G49B 2CV5A 4YM6C 1M1AA 3B6FD 3AZJA 5CP6B 3WTPE 5CPJA 1KX4A 1P3FA 3AZFA 4M6BA 2NZDB 5AVBC 2HIOB 1P3OB 3W99A 1BH9A 3AFAB 1KX4D 5B2ID 5CPJC 4LD9B 3X1SA 5BT1D 3W98D 1M19C 4HGAC 3AZGD 3AYWC 1ID3D 2NQBC 3REKB 5B31D 1P3AB 1EQZA 3REIB 1HQ3B 1KX5A 5DNNB 3AZGC 1ID3C 2NQBD 5B32B 1ZLAD 4XUJA 3O62D 2JSSA 5AVBD 2LY8A 1P34D 3B6GB 3X1VA 5B1LC 3C1CD 2PYOA 3B6GD 4UUZB 2NZDC 5GT0C 1P34B 1M18C 5GT3D 5GT3A 3A6NB 3MNNC 1ZLAB 3AZHA 3LZ1C 3MGSA 3AZNC 3X1UA 1HQ3D 3C1CA 3REID 3UT9C 2CV5C 1P3BD 1M1AC 2NZDA 5B31B 3REKD 1P3AD 1P3IC 1F66A 4J8WC 4H9OB 3AZGB 4WU9B 5GSUC 5B32C 5CP6A 1ID3B 3NQUA 4CSRA 3C1BD 3W98B 4LD9A 5B2IB 1KX4B 4LD9D 3MVDB 5B32G 2HIOD 1P3OD 1AOID 3REKA 1P3LD 3REIA 4QLCA 4J8WA 4H9SA 5B32A 5CP6C 3TU4C 3X1SD 4J8VC 5CP6D 3X1UC 4XZQA 1P3IA 1AOIC 4H9SC 3LJAD 1P3FB 4LD9C 1P3KB 5GSUD 5AV8C 3KSYA 5AY8A 2HIOA 3REKC 1P3OA 4XUJD 4WU9C 1P3BC 2F8ND 5B1LA 5AVCB 1KX3B 3MVDC 3VH6T 5AV6B 1EQZB 4G92B 1HQ3A 1KX5B 5GT0D 5DNNA 3AZHB 3MGQB 3MVDA 3X1UB 5BS7A 5AV5C 4QLCB 5B0ZD 4WU9A 4Z5TD 2AROA 1BH8B 5AV8B 3WKJA 3W99C 3KUYA 1P3IB 3AZFD 4J8WB 3LZ0B 3AV2B 1M19A 1M19D 2FJ7C 5CPJD 1EQZC 3WKJD 4G92C 1F66B 4KGCD 3AZGA 4XZQB 1ID3A 3RELD 3WAAA 3AZID 1P3MD 5BNXB 4X23B 1N1JA 1P3KA 3MGPA 5AV6A 1U35C 3W97C 4H9NB 3W96D 4YM6D 4WU8D 5CPKB 4ZBJB 3WAAC 4HGAB 3AYWB 3AZJD 5BO0A 3KWQD 5DNNC 4R8PC 5JRGA 5B24B 3AV1C 2FJ7B 1TAFB 3MGQA 2HUEC 4WV4B 4J8UA 5GSUA 1S32D 5B1LB 5AVCA 1KX3A 4NE6A 4H9PA 4NE5A 3AZEC 1U35B 3MGQC 3W97B 3AZLD 1M18B 3REJD 5B1MD 4J8UC 5CPIA 5AY8D 3WAAB 1ULYA 3LZ1B 5GXQC 3LZ0A 4X23A 3B0BA 4G91B 3AZMC 3AV2A 5B33D 4KUDC 1P3GD 4KUDD 5CPID 5F99B 3V9RA 5B0YB 3W99B 5B24C 2RVQC 3VH5A 3AYWA 5B33C 3AZMD 3AZMA 3WA9B 3VH5W 1N1JB 5AY8C 5B31G 5B1MC 5E5AC 4JJNB 3AZEB 1TAFA 4ZUXD 5AV9D 4AWLC 1B67A 3C1BA 5JRGD 4J8UB 5BO0B 4H9QB 2PYOD 4J8XD 5BNXA 4ZBJC 1TZYB
chains in the Genus database with same CATH superfamily
1P34A 2Y2LA 3AN2D 3AZKD 5F99C 1H3OA 5CPKA 1Q9CA 2RIQA 1F1EA 3X1VC 3AN2B 3MGSB 1TZYD 1R4VA 1WWIA 5B31A 4WU8C 3WTPD 4Z66B 3V9RB 5B0YA 3LELC 1P3PD 3W96C 3B0CT 5JRGB 3NQUB 4CSRB 3X1TD 3LZ1A 3REHC 3B0DC 3REHD 5AV9B 3UTAA 3RELC 4YS3D 2NQBA 4QLCC 3WTPC 2Y2OA 5F99A 4H9PB 3W97A 1U35A 4G91C 3AZMB 3WA9A 3WA9D 3W99D 5F99D 5CPIB 1P3GB 4JJNA 3AN2C 5B0YC 3KXBD 1TZYA 4KHAA 2AROC 4J8XC 5B0ZC 5AY8B 3LELB 4XZQC 4Z2MH 3KUYC 5AV5D 2Y2GA 4JJNC 3AN2A 3MNNA 3B0DB 3R45A 3UTBB 2ZM5A 5BNVA 5E5AD 3AZEA 5B40A 5B40D 5AV5A 5BS7C 5B24D 3MGPC 5JA4B 5CPIC 5B0ZA 1P3GC 1T3UA 4R8PB 3MGPD 3UTAD 3AV1B 2IO5B 2F8NK 2AROB 2Y2HA 3KXBA 5B40C 5AV9A 4J8VA 2F8NA 4NFTA 1H3OB 4WU8B 3KUYB 4Z66C 2YFWB 3TU4B 1AOIA 3TU4D 4X23D 3KUYD 1S32C 4XZQD 1WWSA 1P3LC 3AZKA 4KGCB 1F66D 1P3GA 2HIOC 1P3OC 3EPHA 2AROD 3C1BC 3MGPB 3KXBC 3UTAB 4R8PD 3UTBA 3AV1D 4J8WD 1P3ID 1P3LA 4YS3A 1HQ3C 5B40B 5AV6C 5DNMA 3MGRA 5E5AB 5B0ZB 3VH6A 4R8PA 3UTBD 4QLCD 4YS3C 5B24A 3B6GC 4KHAB 3NQJB 5AV5B 3AZIC 1P3MC 3B0CW 1HTAA 2Y2NA 1P3PC 3LELA 3LELD 3A1KA 3UTBC 4KGCC 5C3IC 1EQZD 3WKJC 5AV6D 3R45B 3LJAA 3KXBB 1M18A 3AZFC 5BNVB 2F8NB 5G49A 4EO5B 5BT1C 1KX4C 4KUDA 1F66C 4YS3B 2CWEA 4KGCA 5KDMA 3A1IA 5B33A 3REHB 2DF4C 4X23C 3AFAA 3X1TB 4ZUXC 3X1SB 1W2EA 1P3PB 4Z66D 3WTPB 3P5JB 4WU8A 1P3AA 1P3LB 3B6FC 2F8NH 4NE3A 3TU4A 1AOIB 3FDDA 3MGSD 3MVDD 2Y2JA 2RVQD 3C1BB 3UTAC 4YM6A 4XUJC 5B1MA 4WU9D 3AZKB 4H9QA 3AZLA 4EO5C 1P3BB 5AVCC 1KX3C 4J8XB 3NQJA 2PYOB 2ZY3A 4J8UD 4CAYA 3A6ND 5GT3B 3A6NA 3AZLC 4DRAA 4ZUXB 1A7WA 3AZHC 3AZED 3X1SC 4JJND 3C1CB 3KWQA 4H9RB 4Z66A 2UWXA 4E45A 2JE5A 1KU5A 2YFVA 5AVBB 4H9OA 3O62B 3RELA 5B32D 5B0YD 2NQBB 5DNND 4KUDB 3KWQC 2BYMA 2J8PA 3W96A 2BYKB 2IO5C 5KDMB 5B33B 3REHA 3REIC 3AZJC 3WA9C 5B2JC 3LZ1D 5FUGA 3X1TA 3WAAD 5GT0A 1Z2CB 3AFAD 5B1MB 3REJB 2DQNC 3WTPA 4WNNA 5GT3C 1M18D 3AZLB 1U35D 3W97D 1P3BA 2NZDD 4AWLB 2ZY4A 5DNMC 3MGRC 5B1LD 3C1CC 3X1TC 1S32B 4E44A 1P34C 5CPKC 3O62C 3B6FB 3MNNB 1ZLAC 1TZYC 2FJ7D 4Z5TA 2Y2MA 3KFUG 2Y2KA 4J8XA 3AZNB 1P3PA 5B2JA 3KWQB 3X1VD 3UT9B 2CV5B 2L5AA 1M1AB 5B31C 1JFIB 3AZKC 3AZJB 2ZY2A 3AYWD 3W98C 3F6TA 4Z5TC 5B2IC 4Z2MG 4YM6B 5JA4A 5CPKD 2PYOC 2BYMB 3IP4C 2HUEB 1BFMA 3W96B 5JRGC 3AV1A 2YFVB 3H0LC 4WJ3C 3O62A 5DNMD 3MGRD 5FUGB 5AV9C 3AZIB 1P3MB 3RELB 4J8VB 1BH8A 5AV8A 3REJA 2F8NG 4CAYB 4WZSB 5C3IB 3WKJB 1B6WA 2BYKA 3AFAC 2YFWA 5CPJB 4ZUXA 3VH5T 1M19B 5B2JD 5GXQB 3LZ0D 3AV2D 3AZFB 1S32A 1P3FC 1P3KC 4H9RA 1PZRA 3EPLA 5AV8D 5AVBA 4Z5TB 3LJAC 5GXQD 5B2JB 4H9NA 3REJC 1JFIA 5CHLB 3X1UD 1ZLAA 1KX5C 1BH9B 3MGQD 4J8VD 3AZHD 5GT0B 3MGRB 5DNMB 1KX5D 4DRBA 2VQRA 5E5AA 4WNNB 2Y2QA 3A6NC 3H0RC 3B6GA 3W98A 2FJ7A 5B2IA 5AVCD 1KX3D 4UUZA 4XUJB 1P3AC 5GSUB 1P3KD 3UT9D 2CV5D 1P3FD 1M1AD 3B6FA 3X1VB 3LJAB 5GXQA 3LZ0C 3AV2C 3MGSC 3AZNA 3AZIA 3AZND 1P3MA 3VH6W 3MNND 3UT9A 5G49B 2CV5A 4YM6C 1M1AA 3B6FD 3AL0C 3EPJA 3AZJA 5CP6B 3WTPE 5CPJA 1KX4A 1P3FA 3AZFA 4M6BA 2NZDB 5AVBC 2HIOB 1P3OB 3W99A 1BH9A 2ZY5A 3AFAB 2W8SA 5B2ID 5CPJC 1KX4D 4LD9B 3X1SA 5BT1D 3W98D 1M19C 4HGAC 3AZGD 3AYWC 1ID3D 2NQBC 3REKB 5B31D 1P3AB 1EQZA 3REIB 1HQ3B 1KX5A 5DNNB 3AZGC 1ID3C 2NQBD 5B32B 4DQYB 1ZLAD 4XUJA 3O62D 2JSSA 5AVBD 2LY8A 1P34D 3B6GB 3X1VA 5B1LC 3C1CD 2PYOA 3B6GD 4UUZB 2NZDC 5GT0C 1P34B 1M18C 5GT3D 5GT3A 3A6NB 2XD1A 3MNNC 1ZLAB 3AZHA 3LZ1C 3MGSA 3AZNC 3X1UA 1HQ3D 3C1CA 3REID 3UT9C 2CV5C 1P3BD 1M1AC 2NZDA 5B31B 3REKD 1P3AD 1P3IC 1F66A 4J8WC 4H9OB 3AZGB 4WU9B 5GSUC 5CP6A 5B32C 1ID3B 3NQUA 4CSRA 3C1BD 3W98B 4LD9A 5B2IB 1KX4B 4LD9D 3MVDB 5B32G 2HIOD 1P3OD 1AOID 3REKA 1P3LD 3REIA 4QLCA 3H0MC 4J8WA 4H9SA 3EG5B 2BG1A 5B32A 5CP6C 3TU4C 3X1SD 4J8VC 5CP6D 3X1UC 2XD5A 4XZQA 1P3IA 1AOIC 4H9SC 3LJAD 1P3FB 4LD9C 1P3KB 4UPKA 5GSUD 5AV8C 3KSYA 5AY8A 2HIOA 3REKC 1P3OA 4XUJD 2Y2IA 4WU9C 1P3BC 2F8ND 5B1LA 5AVCB 1KX3B 3MVDC 2F2AC 3VH6T 5AV6B 1EQZB 4G92B 1HQ3A 1KX5B 5GT0D 5DNNA 3AZHB 3MGQB 3MVDA 3X1UB 5BS7A 5AV5C 4QLCB 5B0ZD 4WU9A 4Z5TD 2AROA 1BH8B 5AV8B 3WKJA 3W99C 3KUYA 1P3IB 3AZFD 4J8WB 3LZ0B 3AV2B 1M19A 2FFFB 1M19D 2FJ7C 5CPJD 1EQZC 3WKJD 4G92C 1F66B 4KGCD 3AZGA 4XZQB 1ID3A 3RELD 3WAAA 3AZID 1P3MD 5BNXB 4X23B 1N1JA 1P3KA 3MGPA 5AV6A 1U35C 3W97C 4H9NB 3W96D 4YM6D 4WU8D 5CPKB 4ZBJB 3WAAC 4HGAB 3AYWB 3AZJD 5BO0A 3KWQD 5DNNC 4R8PC 5JRGA 5B24B 3AV1C 2FJ7B 1TAFB 3MGQA 2HUEC 4WV4B 3EPKA 4J8UA 5GSUA 1S32D 5B1LB 5AVCA 1KX3A 4NE6A 4H9PA 4NE5A 3AZEC 1U35B 3MGQC 3W97B 3AZLD 1M18B 3REJD 5B1MD 4J8UC 5CPIA 5AY8D 3WAAB 1ULYA 3LZ1B 5GXQC 3LZ0A 4X23A 3B0BA 4G91B 3AZMC 3AV2A 5B33D 4KUDC 1P3GD 4KUDD 5CPID 5F99B 3V9RA 5B0YB 3W99B 5B24C 2RVQC 3VH5A 3AYWA 5B33C 2Y2PA 3AZMD 3AZMA 3WA9B 3VH5W 1N1JB 5AY8C 2G5HC 2JCHA 5B31G 5B1MC 5E5AC 4JJNB 3AZEB 1TAFA 4ZUXD 5AV9D 4AWLC 1B67A 2G5IC 5JRGD 3C1BA 4J8UB 5BO0B 4H9QB 2PYOD 4J8XD 5BNXA 4ZBJC 1TZYB
chains in the Genus database with same CATH topology
1P34A 2Y2LA 3AN2D 3AZKD 5F99C 1H3OA 5CPKA 1Q9CA 2RIQA 1F1EA 3X1VC 3AN2B 3MGSB 1TZYD 1R4VA 1WWIA 5B31A 4WU8C 3WTPD 4Z66B 3V9RB 5B0YA 3LELC 1P3PD 3W96C 3B0CT 5JRGB 3NQUB 4CSRB 3X1TD 3LZ1A 3REHC 3B0DC 3REHD 5AV9B 3UTAA 3RELC 4YS3D 2NQBA 4QLCC 3WTPC 2Y2OA 5F99A 4H9PB 3W97A 1U35A 4G91C 3AZMB 3WA9A 3WA9D 3W99D 5F99D 5CPIB 1P3GB 4JJNA 3AN2C 5B0YC 3KXBD 1TZYA 4KHAA 2AROC 4J8XC 5B0ZC 5AY8B 3LELB 4XZQC 4Z2MH 3KUYC 5AV5D 2Y2GA 4JJNC 3AN2A 3MNNA 3B0DB 3R45A 3UTBB 2ZM5A 5BNVA 5E5AD 3AZEA 5B40A 5B40D 5AV5A 5BS7C 5B24D 3MGPC 5JA4B 5CPIC 5B0ZA 1P3GC 1T3UA 4R8PB 3MGPD 3UTAD 3AV1B 2IO5B 2F8NK 2AROB 2Y2HA 3KXBA 5B40C 5AV9A 4J8VA 2F8NA 4NFTA 1H3OB 4WU8B 3KUYB 4Z66C 2YFWB 3TU4B 1AOIA 3TU4D 4X23D 3KUYD 1S32C 4XZQD 1WWSA 1P3LC 3AZKA 4KGCB 1F66D 1P3GA 2HIOC 1P3OC 3EPHA 2AROD 3C1BC 3MGPB 3KXBC 3UTAB 4R8PD 3UTBA 3AV1D 4J8WD 1P3ID 1P3LA 4YS3A 1HQ3C 5B40B 5AV6C 5DNMA 3MGRA 5E5AB 5B0ZB 3VH6A 4R8PA 3UTBD 4QLCD 4YS3C 5B24A 3B6GC 4KHAB 3NQJB 5AV5B 3AZIC 1P3MC 3B0CW 1HTAA 2Y2NA 1P3PC 3LELA 3LELD 3A1KA 3UTBC 4KGCC 5C3IC 1EQZD 3WKJC 5AV6D 3R45B 3LJAA 3KXBB 1M18A 3AZFC 5BNVB 2F8NB 5G49A 4EO5B 5BT1C 1KX4C 4KUDA 1F66C 4YS3B 2CWEA 4KGCA 5KDMA 3A1IA 5B33A 3REHB 2DF4C 4X23C 3AFAA 3X1TB 4ZUXC 3X1SB 1W2EA 1P3PB 4Z66D 3WTPB 3P5JB 4WU8A 1P3AA 1P3LB 3B6FC 2F8NH 4NE3A 3TU4A 1AOIB 3FDDA 3MGSD 3MVDD 2Y2JA 2RVQD 3C1BB 3UTAC 4YM6A 4XUJC 5B1MA 4WU9D 3AZKB 4H9QA 3AZLA 4EO5C 1P3BB 5AVCC 1KX3C 4J8XB 3NQJA 2PYOB 2ZY3A 4J8UD 4CAYA 3A6ND 5GT3B 3A6NA 3AZLC 4DRAA 4ZUXB 1A7WA 3AZHC 3AZED 3X1SC 4JJND 3C1CB 3KWQA 4H9RB 4Z66A 2UWXA 4E45A 2JE5A 1KU5A 2YFVA 5AVBB 4H9OA 3O62B 3RELA 5B32D 5B0YD 2NQBB 5DNND 4KUDB 3KWQC 2BYMA 2J8PA 3W96A 2BYKB 2IO5C 5KDMB 5B33B 3REHA 3REIC 3AZJC 3WA9C 5B2JC 3LZ1D 5FUGA 3X1TA 3WAAD 5GT0A 1Z2CB 3AFAD 5B1MB 3REJB 2DQNC 3WTPA 4WNNA 5GT3C 1M18D 3AZLB 1U35D 3W97D 1P3BA 2NZDD 4AWLB 2ZY4A 5DNMC 3MGRC 5B1LD 3C1CC 3X1TC 1S32B 4E44A 1P34C 5CPKC 3O62C 3B6FB 3MNNB 1ZLAC 1TZYC 2FJ7D 4Z5TA 2Y2MA 3KFUG 2Y2KA 4J8XA 3AZNB 1P3PA 5B2JA 3KWQB 3X1VD 3UT9B 2CV5B 2L5AA 1M1AB 5B31C 1JFIB 3AZKC 3AZJB 2ZY2A 3AYWD 3W98C 3F6TA 4Z5TC 5B2IC 4Z2MG 4YM6B 5JA4A 5CPKD 2PYOC 2BYMB 3IP4C 2HUEB 1BFMA 3W96B 5JRGC 3AV1A 2YFVB 3H0LC 4WJ3C 3O62A 5DNMD 3MGRD 5FUGB 5AV9C 3AZIB 1P3MB 3RELB 4J8VB 1BH8A 5AV8A 3REJA 2F8NG 4CAYB 4WZSB 5C3IB 3WKJB 1B6WA 2BYKA 3AFAC 2YFWA 5CPJB 4ZUXA 3VH5T 1M19B 5B2JD 5GXQB 3LZ0D 3AV2D 3AZFB 1S32A 1P3FC 1P3KC 4H9RA 1PZRA 3EPLA 5AV8D 5AVBA 4Z5TB 3LJAC 5GXQD 5B2JB 4H9NA 3REJC 1JFIA 5CHLB 3X1UD 1ZLAA 1KX5C 1BH9B 3MGQD 4J8VD 3AZHD 5GT0B 3MGRB 5DNMB 1KX5D 4DRBA 2VQRA 5E5AA 4WNNB 2Y2QA 3A6NC 3H0RC 3B6GA 3W98A 2FJ7A 5B2IA 5AVCD 1KX3D 4UUZA 4XUJB 1P3AC 5GSUB 1P3KD 3UT9D 2CV5D 1P3FD 1M1AD 3B6FA 3X1VB 3LJAB 5GXQA 3LZ0C 3AV2C 3MGSC 3AZNA 3AZIA 3AZND 1P3MA 3VH6W 3MNND 3UT9A 5G49B 2CV5A 4YM6C 1M1AA 3B6FD 3AL0C 3EPJA 3AZJA 5CP6B 3WTPE 5CPJA 1KX4A 1P3FA 3AZFA 4M6BA 2NZDB 5AVBC 2HIOB 1P3OB 3W99A 1BH9A 2ZY5A 3AFAB 2W8SA 5B2ID 5CPJC 1KX4D 4LD9B 3X1SA 5BT1D 3W98D 1M19C 4HGAC 3AZGD 3AYWC 1ID3D 2NQBC 3REKB 5B31D 1P3AB 1EQZA 3REIB 1HQ3B 1KX5A 5DNNB 3AZGC 1ID3C 2NQBD 5B32B 4DQYB 1ZLAD 4XUJA 3O62D 2JSSA 5AVBD 2LY8A 1P34D 3B6GB 3X1VA 5B1LC 3C1CD 2PYOA 3B6GD 4UUZB 2NZDC 5GT0C 1P34B 1M18C 5GT3D 5GT3A 3A6NB 2XD1A 3MNNC 1ZLAB 3AZHA 3LZ1C 3MGSA 3AZNC 3X1UA 1HQ3D 3C1CA 3REID 3UT9C 2CV5C 1P3BD 1M1AC 2NZDA 5B31B 3REKD 1P3AD 1P3IC 1F66A 4J8WC 4H9OB 3AZGB 4WU9B 5GSUC 5CP6A 5B32C 1ID3B 3NQUA 4CSRA 3C1BD 3W98B 4LD9A 5B2IB 1KX4B 4LD9D 3MVDB 5B32G 2HIOD 1P3OD 1AOID 3REKA 1P3LD 3REIA 4QLCA 3H0MC 4J8WA 4H9SA 3EG5B 2BG1A 5B32A 5CP6C 3TU4C 3X1SD 4J8VC 5CP6D 3X1UC 2XD5A 4XZQA 1P3IA 1AOIC 4H9SC 3LJAD 1P3FB 4LD9C 1P3KB 4UPKA 5GSUD 5AV8C 3KSYA 5AY8A 2HIOA 3REKC 1P3OA 4XUJD 2Y2IA 4WU9C 1P3BC 2F8ND 5B1LA 5AVCB 1KX3B 3MVDC 2F2AC 3VH6T 5AV6B 1EQZB 4G92B 1HQ3A 1KX5B 5GT0D 5DNNA 3AZHB 3MGQB 3MVDA 3X1UB 5BS7A 5AV5C 4QLCB 5B0ZD 4WU9A 4Z5TD 2AROA 1BH8B 5AV8B 3WKJA 3W99C 3KUYA 1P3IB 3AZFD 4J8WB 3LZ0B 3AV2B 1M19A 2FFFB 1M19D 2FJ7C 5CPJD 1EQZC 3WKJD 4G92C 1F66B 4KGCD 3AZGA 4XZQB 1ID3A 3RELD 3WAAA 3AZID 1P3MD 5BNXB 4X23B 1N1JA 1P3KA 3MGPA 5AV6A 1U35C 3W97C 4H9NB 3W96D 4YM6D 4WU8D 5CPKB 4ZBJB 3WAAC 4HGAB 3AYWB 3AZJD 5BO0A 3KWQD 5DNNC 4R8PC 5JRGA 5B24B 3AV1C 2FJ7B 1TAFB 3MGQA 2HUEC 4WV4B 3EPKA 4J8UA 5GSUA 1S32D 5B1LB 5AVCA 1KX3A 4NE6A 4H9PA 4NE5A 3AZEC 1U35B 3MGQC 3W97B 3AZLD 1M18B 3REJD 5B1MD 4J8UC 5CPIA 5AY8D 3WAAB 1ULYA 3LZ1B 5GXQC 3LZ0A 4X23A 3B0BA 4G91B 3AZMC 3AV2A 5B33D 4KUDC 1P3GD 4KUDD 5CPID 5F99B 3V9RA 5B0YB 3W99B 5B24C 2RVQC 3VH5A 3AYWA 5B33C 2Y2PA 3AZMD 3AZMA 3WA9B 3VH5W 1N1JB 5AY8C 2G5HC 2JCHA 5B31G 5B1MC 5E5AC 4JJNB 3AZEB 1TAFA 4ZUXD 5AV9D 4AWLC 1B67A 2G5IC 5JRGD 3C1BA 4J8UB 5BO0B 4H9QB 2PYOD 4J8XD 5BNXA 4ZBJC 1TZYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P34 A;  3AN2 D;  3AZK D;  5F99 C;  1H3O A;  5CPK A;  1Q9C A;  1F1E A;  3X1V C;  3AN2 B;  3MGS B;  1TZY D;  1R4V A;  1WWI A;  5B31 A;  4WU8 C;  3WTP D;  4Z66 B;  3V9R B;  5B0Y A;  3LEL C;  1P3P D;  3W96 C;  3B0C T;  5JRG B;  3NQU B;  4CSR B;  3X1T D;  3LZ1 A;  3REH C;  3B0D C;  3REH D;  5AV9 B;  3UTA A;  3REL C;  4YS3 D;  2NQB A;  4QLC C;  3WTP C;  5F99 A;  4H9P B;  3W97 A;  1U35 A;  4G91 C;  3AZM B;  3WA9 A;  3WA9 D;  3W99 D;  5F99 D;  5CPI B;  1P3G B;  4JJN A;  3AN2 C;  5B0Y C;  3KXB D;  1TZY A;  4KHA A;  2ARO C;  4J8X C;  5B0Z C;  5AY8 B;  3LEL B;  4XZQ C;  4Z2M H;  3KUY C;  5AV5 D;  4JJN C;  3AN2 A;  3MNN A;  3B0D B;  3R45 A;  3UTB B;  5BNV A;  5E5A D;  3AZE A;  5B40 A;  5B40 D;  5AV5 A;  5BS7 C;  5B24 D;  3MGP C;  5JA4 B;  5CPI C;  5B0Z A;  1P3G C;  4R8P B;  3MGP D;  3UTA D;  3AV1 B;  2IO5 B;  2F8N K;  2ARO B;  3KXB A;  5B40 C;  5AV9 A;  4J8V A;  2F8N A;  4NFT A;  1H3O B;  4WU8 B;  3KUY B;  4Z66 C;  2YFW B;  3TU4 B;  1AOI A;  3TU4 D;  4X23 D;  3KUY D;  1S32 C;  4XZQ D;  1WWS A;  1P3L C;  3AZK A;  4KGC B;  1F66 D;  1P3G A;  2HIO C;  1P3O C;  2ARO D;  3C1B C;  3MGP B;  3KXB C;  3UTA B;  4R8P D;  3UTB A;  3AV1 D;  4J8W D;  1P3I D;  1P3L A;  4YS3 A;  1HQ3 C;  5B40 B;  5AV6 C;  5DNM A;  3MGR A;  5E5A B;  5B0Z B;  3VH6 A;  4R8P A;  3UTB D;  4QLC D;  4YS3 C;  5B24 A;  3B6G C;  4KHA B;  3NQJ B;  5AV5 B;  3AZI C;  1P3M C;  3B0C W;  1HTA A;  1P3P C;  3LEL A;  3LEL D;  3UTB C;  4KGC C;  5C3I C;  1EQZ D;  3WKJ C;  5AV6 D;  3R45 B;  3LJA A;  3KXB B;  1M18 A;  3AZF C;  5BNV B;  2F8N B;  5G49 A;  4EO5 B;  5BT1 C;  1KX4 C;  4KUD A;  1F66 C;  4YS3 B;  2CWE A;  4KGC A;  5KDM A;  5B33 A;  3REH B;  4X23 C;  3AFA A;  3X1T B;  4ZUX C;  3X1S B;  1P3P B;  4Z66 D;  3WTP B;  4WU8 A;  1P3A A;  1P3L B;  3B6F C;  2F8N H;  4NE3 A;  3TU4 A;  1AOI B;  3MGS D;  3MVD D;  2RVQ D;  3C1B B;  3UTA C;  4YM6 A;  4XUJ C;  5B1M A;  4WU9 D;  3AZK B;  4H9Q A;  3AZL A;  4EO5 C;  1P3B B;  5AVC C;  1KX3 C;  4J8X B;  3NQJ A;  2PYO B;  4J8U D;  4CAY A;  3A6N D;  5GT3 B;  3A6N A;  3AZL C;  4DRA A;  4ZUX B;  1A7W A;  3AZH C;  3AZE D;  3X1S C;  4JJN D;  3C1C B;  3KWQ A;  4H9R B;  4Z66 A;  4E45 A;  1KU5 A;  2YFV A;  5AVB B;  4H9O A;  3O62 B;  3REL A;  5B32 D;  5B0Y D;  2NQB B;  5DNN D;  4KUD B;  3KWQ C;  2BYM A;  3W96 A;  2BYK B;  2IO5 C;  5KDM B;  5B33 B;  3REH A;  3REI C;  3AZJ C;  3WA9 C;  5B2J C;  3LZ1 D;  5FUG A;  3X1T A;  3WAA D;  5GT0 A;  3AFA D;  5B1M B;  3REJ B;  3WTP A;  4WNN A;  5GT3 C;  1M18 D;  3AZL B;  1U35 D;  3W97 D;  1P3B A;  2NZD D;  4AWL B;  5DNM C;  3MGR C;  5B1L D;  3C1C C;  3X1T C;  1S32 B;  4E44 A;  1P34 C;  5CPK C;  3O62 C;  3B6F B;  3MNN B;  1ZLA C;  1TZY C;  2FJ7 D;  4Z5T A;  4J8X A;  3AZN B;  1P3P A;  5B2J A;  3KWQ B;  3X1V D;  3UT9 B;  2CV5 B;  2L5A A;  1M1A B;  5B31 C;  1JFI B;  3AZK C;  3AZJ B;  3AYW D;  3W98 C;  4Z5T C;  5B2I C;  4Z2M G;  4YM6 B;  5JA4 A;  5CPK D;  2PYO C;  2BYM B;  1BFM A;  2HUE B;  3W96 B;  5JRG C;  3AV1 A;  2YFV B;  3O62 A;  5DNM D;  3MGR D;  5FUG B;  5AV9 C;  3AZI B;  1P3M B;  3REL B;  4J8V B;  1BH8 A;  5AV8 A;  3REJ A;  2F8N G;  4CAY B;  4WZS B;  5C3I B;  3WKJ B;  1B6W A;  2BYK A;  3AFA C;  2YFW A;  5CPJ B;  4ZUX A;  3VH5 T;  1M19 B;  5B2J D;  3LZ0 D;  5GXQ B;  3AV2 D;  3AZF B;  1S32 A;  1P3F C;  1P3K C;  4H9R A;  5AV8 D;  5AVB A;  4Z5T B;  3LJA C;  5GXQ D;  5B2J B;  4H9N A;  3REJ C;  1JFI A;  5CHL B;  3X1U D;  1ZLA A;  1KX5 C;  1BH9 B;  3MGQ D;  4J8V D;  3AZH D;  5GT0 B;  3MGR B;  5DNM B;  1KX5 D;  4DRB A;  5E5A A;  4WNN B;  3A6N C;  3B6G A;  3W98 A;  2FJ7 A;  5B2I A;  5AVC D;  1KX3 D;  4UUZ A;  4XUJ B;  1P3A C;  5GSU B;  1P3K D;  3UT9 D;  2CV5 D;  1P3F D;  1M1A D;  3B6F A;  3X1V B;  3LJA B;  5GXQ A;  3LZ0 C;  3AV2 C;  3MGS C;  3AZN A;  3AZI A;  3AZN D;  1P3M A;  3VH6 W;  3MNN D;  3UT9 A;  5G49 B;  2CV5 A;  4YM6 C;  1M1A A;  3B6F D;  3AZJ A;  5CP6 B;  3WTP E;  5CPJ A;  1KX4 A;  1P3F A;  3AZF A;  4M6B A;  2NZD B;  5AVB C;  2HIO B;  1P3O B;  3W99 A;  1BH9 A;  3AFA B;  1KX4 D;  5B2I D;  5CPJ C;  4LD9 B;  3X1S A;  5BT1 D;  3W98 D;  1M19 C;  4HGA C;  3AZG D;  3AYW C;  1ID3 D;  2NQB C;  3REK B;  5B31 D;  1P3A B;  1EQZ A;  3REI B;  1HQ3 B;  1KX5 A;  5DNN B;  3AZG C;  1ID3 C;  2NQB D;  5B32 B;  1ZLA D;  4XUJ A;  3O62 D;  2JSS A;  5AVB D;  2LY8 A;  1P34 D;  3B6G B;  3X1V A;  5B1L C;  3C1C D;  2PYO A;  3B6G D;  4UUZ B;  2NZD C;  5GT0 C;  1P34 B;  1M18 C;  5GT3 D;  5GT3 A;  3A6N B;  3MNN C;  1ZLA B;  3AZH A;  3LZ1 C;  3MGS A;  3AZN C;  3X1U A;  1HQ3 D;  3C1C A;  3REI D;  3UT9 C;  2CV5 C;  1P3B D;  1M1A C;  2NZD A;  5B31 B;  3REK D;  1P3A D;  1P3I C;  1F66 A;  4J8W C;  4H9O B;  3AZG B;  4WU9 B;  5GSU C;  5B32 C;  5CP6 A;  1ID3 B;  3NQU A;  4CSR A;  3C1B D;  3W98 B;  4LD9 A;  5B2I B;  1KX4 B;  4LD9 D;  3MVD B;  5B32 G;  2HIO D;  1P3O D;  1AOI D;  3REK A;  1P3L D;  3REI A;  4QLC A;  4J8W A;  4H9S A;  5B32 A;  5CP6 C;  3TU4 C;  3X1S D;  4J8V C;  5CP6 D;  3X1U C;  4XZQ A;  1P3I A;  1AOI C;  4H9S C;  3LJA D;  1P3F B;  4LD9 C;  1P3K B;  5GSU D;  5AV8 C;  3KSY A;  5AY8 A;  2HIO A;  3REK C;  1P3O A;  4XUJ D;  4WU9 C;  1P3B C;  2F8N D;  5B1L A;  5AVC B;  1KX3 B;  3MVD C;  3VH6 T;  5AV6 B;  1EQZ B;  4G92 B;  1HQ3 A;  1KX5 B;  5GT0 D;  5DNN A;  3AZH B;  3MGQ B;  3MVD A;  3X1U B;  5BS7 A;  5AV5 C;  4QLC B;  5B0Z D;  4WU9 A;  4Z5T D;  2ARO A;  1BH8 B;  5AV8 B;  3WKJ A;  3W99 C;  3KUY A;  1P3I B;  3AZF D;  4J8W B;  3LZ0 B;  3AV2 B;  1M19 A;  1M19 D;  2FJ7 C;  5CPJ D;  1EQZ C;  3WKJ D;  4G92 C;  1F66 B;  4KGC D;  3AZG A;  4XZQ B;  1ID3 A;  3REL D;  3WAA A;  3AZI D;  1P3M D;  5BNX B;  4X23 B;  1N1J A;  1P3K A;  3MGP A;  5AV6 A;  1U35 C;  3W97 C;  4H9N B;  3W96 D;  4YM6 D;  4WU8 D;  5CPK B;  4ZBJ B;  3WAA C;  4HGA B;  3AYW B;  3AZJ D;  5BO0 A;  3KWQ D;  5DNN C;  4R8P C;  5JRG A;  5B24 B;  3AV1 C;  2FJ7 B;  1TAF B;  3MGQ A;  2HUE C;  4WV4 B;  4J8U A;  5GSU A;  1S32 D;  5B1L B;  5AVC A;  1KX3 A;  4NE6 A;  4H9P A;  4NE5 A;  3AZE C;  1U35 B;  3MGQ C;  3W97 B;  3AZL D;  1M18 B;  3REJ D;  5B1M D;  4J8U C;  5CPI A;  5AY8 D;  3WAA B;  1ULY A;  3LZ1 B;  5GXQ C;  3LZ0 A;  4X23 A;  3B0B A;  4G91 B;  3AZM C;  3AV2 A;  5B33 D;  4KUD C;  1P3G D;  4KUD D;  5CPI D;  5F99 B;  3V9R A;  5B0Y B;  3W99 B;  5B24 C;  2RVQ C;  3VH5 A;  3AYW A;  5B33 C;  3AZM D;  3AZM A;  3WA9 B;  3VH5 W;  1N1J B;  5AY8 C;  5B31 G;  5B1M C;  5E5A C;  4JJN B;  3AZE B;  1TAF A;  4ZUX D;  5AV9 D;  4AWL C;  1B67 A;  3C1B A;  5JRG D;  4J8U B;  5BO0 B;  4H9Q B;  2PYO D;  4J8X D;  5BNX A;  4ZBJ C;  1TZY B; 
#chains in the Genus database with same CATH topology
 1P34 A;  2Y2L A;  3AN2 D;  3AZK D;  5F99 C;  1H3O A;  5CPK A;  1Q9C A;  2RIQ A;  1F1E A;  3X1V C;  3AN2 B;  3MGS B;  1TZY D;  1R4V A;  1WWI A;  5B31 A;  4WU8 C;  3WTP D;  4Z66 B;  3V9R B;  5B0Y A;  3LEL C;  1P3P D;  3W96 C;  3B0C T;  5JRG B;  3NQU B;  4CSR B;  3X1T D;  3LZ1 A;  3REH C;  3B0D C;  3REH D;  5AV9 B;  3UTA A;  3REL C;  4YS3 D;  2NQB A;  4QLC C;  3WTP C;  2Y2O A;  5F99 A;  4H9P B;  3W97 A;  1U35 A;  4G91 C;  3AZM B;  3WA9 A;  3WA9 D;  3W99 D;  5F99 D;  5CPI B;  1P3G B;  4JJN A;  3AN2 C;  5B0Y C;  3KXB D;  1TZY A;  4KHA A;  2ARO C;  4J8X C;  5B0Z C;  5AY8 B;  3LEL B;  4XZQ C;  4Z2M H;  3KUY C;  5AV5 D;  2Y2G A;  4JJN C;  3AN2 A;  3MNN A;  3B0D B;  3R45 A;  3UTB B;  2ZM5 A;  5BNV A;  5E5A D;  3AZE A;  5B40 A;  5B40 D;  5AV5 A;  5BS7 C;  5B24 D;  3MGP C;  5JA4 B;  5CPI C;  5B0Z A;  1P3G C;  1T3U A;  4R8P B;  3MGP D;  3UTA D;  3AV1 B;  2IO5 B;  2F8N K;  2ARO B;  2Y2H A;  3KXB A;  5B40 C;  5AV9 A;  4J8V A;  2F8N A;  4NFT A;  1H3O B;  4WU8 B;  3KUY B;  4Z66 C;  2YFW B;  3TU4 B;  1AOI A;  3TU4 D;  4X23 D;  3KUY D;  1S32 C;  4XZQ D;  1WWS A;  1P3L C;  3AZK A;  4KGC B;  1F66 D;  1P3G A;  2HIO C;  1P3O C;  3EPH A;  2ARO D;  3C1B C;  3MGP B;  3KXB C;  3UTA B;  4R8P D;  3UTB A;  3AV1 D;  4J8W D;  1P3I D;  1P3L A;  4YS3 A;  1HQ3 C;  5B40 B;  5AV6 C;  5DNM A;  3MGR A;  5E5A B;  5B0Z B;  3VH6 A;  4R8P A;  3UTB D;  4QLC D;  4YS3 C;  5B24 A;  3B6G C;  4KHA B;  3NQJ B;  5AV5 B;  3AZI C;  1P3M C;  3B0C W;  1HTA A;  2Y2N A;  1P3P C;  3LEL A;  3LEL D;  3A1K A;  3UTB C;  4KGC C;  5C3I C;  1EQZ D;  3WKJ C;  5AV6 D;  3R45 B;  3LJA A;  3KXB B;  1M18 A;  3AZF C;  5BNV B;  2F8N B;  5G49 A;  4EO5 B;  5BT1 C;  1KX4 C;  4KUD A;  1F66 C;  4YS3 B;  2CWE A;  4KGC A;  5KDM A;  3A1I A;  5B33 A;  3REH B;  2DF4 C;  4X23 C;  3AFA A;  3X1T B;  4ZUX C;  3X1S B;  1W2E A;  1P3P B;  4Z66 D;  3WTP B;  3P5J B;  4WU8 A;  1P3A A;  1P3L B;  3B6F C;  2F8N H;  4NE3 A;  3TU4 A;  1AOI B;  3FDD A;  3MGS D;  3MVD D;  2Y2J A;  2RVQ D;  3C1B B;  3UTA C;  4YM6 A;  4XUJ C;  5B1M A;  4WU9 D;  3AZK B;  4H9Q A;  3AZL A;  4EO5 C;  1P3B B;  5AVC C;  1KX3 C;  4J8X B;  3NQJ A;  2PYO B;  2ZY3 A;  4J8U D;  4CAY A;  3A6N D;  5GT3 B;  3A6N A;  3AZL C;  4DRA A;  4ZUX B;  1A7W A;  3AZH C;  3AZE D;  3X1S C;  4JJN D;  3C1C B;  3KWQ A;  4H9R B;  4Z66 A;  2UWX A;  4E45 A;  2JE5 A;  1KU5 A;  2YFV A;  5AVB B;  4H9O A;  3O62 B;  3REL A;  5B32 D;  5B0Y D;  2NQB B;  5DNN D;  4KUD B;  3KWQ C;  2BYM A;  2J8P A;  3W96 A;  2BYK B;  2IO5 C;  5KDM B;  5B33 B;  3REH A;  3REI C;  3AZJ C;  3WA9 C;  5B2J C;  3LZ1 D;  5FUG A;  3X1T A;  3WAA D;  5GT0 A;  1Z2C B;  3AFA D;  5B1M B;  3REJ B;  2DQN C;  3WTP A;  4WNN A;  5GT3 C;  1M18 D;  3AZL B;  1U35 D;  3W97 D;  1P3B A;  2NZD D;  4AWL B;  2ZY4 A;  5DNM C;  3MGR C;  5B1L D;  3C1C C;  3X1T C;  1S32 B;  4E44 A;  1P34 C;  5CPK C;  3O62 C;  3B6F B;  3MNN B;  1ZLA C;  1TZY C;  2FJ7 D;  4Z5T A;  2Y2M A;  3KFU G;  2Y2K A;  4J8X A;  3AZN B;  1P3P A;  5B2J A;  3KWQ B;  3X1V D;  3UT9 B;  2CV5 B;  2L5A A;  1M1A B;  5B31 C;  1JFI B;  3AZK C;  3AZJ B;  2ZY2 A;  3AYW D;  3W98 C;  3F6T A;  4Z5T C;  5B2I C;  4Z2M G;  4YM6 B;  5JA4 A;  5CPK D;  2PYO C;  2BYM B;  3IP4 C;  2HUE B;  1BFM A;  3W96 B;  5JRG C;  3AV1 A;  2YFV B;  3H0L C;  4WJ3 C;  3O62 A;  5DNM D;  3MGR D;  5FUG B;  5AV9 C;  3AZI B;  1P3M B;  3REL B;  4J8V B;  1BH8 A;  5AV8 A;  3REJ A;  2F8N G;  4CAY B;  4WZS B;  5C3I B;  3WKJ B;  1B6W A;  2BYK A;  3AFA C;  2YFW A;  5CPJ B;  4ZUX A;  3VH5 T;  1M19 B;  5B2J D;  5GXQ B;  3LZ0 D;  3AV2 D;  3AZF B;  1S32 A;  1P3F C;  1P3K C;  4H9R A;  1PZR A;  3EPL A;  5AV8 D;  5AVB A;  4Z5T B;  3LJA C;  5GXQ D;  5B2J B;  4H9N A;  3REJ C;  1JFI A;  5CHL B;  3X1U D;  1ZLA A;  1KX5 C;  1BH9 B;  3MGQ D;  4J8V D;  3AZH D;  5GT0 B;  3MGR B;  5DNM B;  1KX5 D;  4DRB A;  2VQR A;  5E5A A;  4WNN B;  2Y2Q A;  3A6N C;  3H0R C;  3B6G A;  3W98 A;  2FJ7 A;  5B2I A;  5AVC D;  1KX3 D;  4UUZ A;  4XUJ B;  1P3A C;  5GSU B;  1P3K D;  3UT9 D;  2CV5 D;  1P3F D;  1M1A D;  3B6F A;  3X1V B;  3LJA B;  5GXQ A;  3LZ0 C;  3AV2 C;  3MGS C;  3AZN A;  3AZI A;  3AZN D;  1P3M A;  3VH6 W;  3MNN D;  3UT9 A;  5G49 B;  2CV5 A;  4YM6 C;  1M1A A;  3B6F D;  3AL0 C;  3EPJ A;  3AZJ A;  5CP6 B;  3WTP E;  5CPJ A;  1KX4 A;  1P3F A;  3AZF A;  4M6B A;  2NZD B;  5AVB C;  2HIO B;  1P3O B;  3W99 A;  1BH9 A;  2ZY5 A;  3AFA B;  2W8S A;  5B2I D;  5CPJ C;  1KX4 D;  4LD9 B;  3X1S A;  5BT1 D;  3W98 D;  1M19 C;  4HGA C;  3AZG D;  3AYW C;  1ID3 D;  2NQB C;  3REK B;  5B31 D;  1P3A B;  1EQZ A;  3REI B;  1HQ3 B;  1KX5 A;  5DNN B;  3AZG C;  1ID3 C;  2NQB D;  5B32 B;  4DQY B;  1ZLA D;  4XUJ A;  3O62 D;  2JSS A;  5AVB D;  2LY8 A;  1P34 D;  3B6G B;  3X1V A;  5B1L C;  3C1C D;  2PYO A;  3B6G D;  4UUZ B;  2NZD C;  5GT0 C;  1P34 B;  1M18 C;  5GT3 D;  5GT3 A;  3A6N B;  2XD1 A;  3MNN C;  1ZLA B;  3AZH A;  3LZ1 C;  3MGS A;  3AZN C;  3X1U A;  1HQ3 D;  3C1C A;  3REI D;  3UT9 C;  2CV5 C;  1P3B D;  1M1A C;  2NZD A;  5B31 B;  3REK D;  1P3A D;  1P3I C;  1F66 A;  4J8W C;  4H9O B;  3AZG B;  4WU9 B;  5GSU C;  5CP6 A;  5B32 C;  1ID3 B;  3NQU A;  4CSR A;  3C1B D;  3W98 B;  4LD9 A;  5B2I B;  1KX4 B;  4LD9 D;  3MVD B;  5B32 G;  2HIO D;  1P3O D;  1AOI D;  3REK A;  1P3L D;  3REI A;  4QLC A;  3H0M C;  4J8W A;  4H9S A;  3EG5 B;  2BG1 A;  5B32 A;  5CP6 C;  3TU4 C;  3X1S D;  4J8V C;  5CP6 D;  3X1U C;  2XD5 A;  4XZQ A;  1P3I A;  1AOI C;  4H9S C;  3LJA D;  1P3F B;  4LD9 C;  1P3K B;  4UPK A;  5GSU D;  5AV8 C;  3KSY A;  5AY8 A;  2HIO A;  3REK C;  1P3O A;  4XUJ D;  2Y2I A;  4WU9 C;  1P3B C;  2F8N D;  5B1L A;  5AVC B;  1KX3 B;  3MVD C;  2F2A C;  3VH6 T;  5AV6 B;  1EQZ B;  4G92 B;  1HQ3 A;  1KX5 B;  5GT0 D;  5DNN A;  3AZH B;  3MGQ B;  3MVD A;  3X1U B;  5BS7 A;  5AV5 C;  4QLC B;  5B0Z D;  4WU9 A;  4Z5T D;  2ARO A;  1BH8 B;  5AV8 B;  3WKJ A;  3W99 C;  3KUY A;  1P3I B;  3AZF D;  4J8W B;  3LZ0 B;  3AV2 B;  1M19 A;  2FFF B;  1M19 D;  2FJ7 C;  5CPJ D;  1EQZ C;  3WKJ D;  4G92 C;  1F66 B;  4KGC D;  3AZG A;  4XZQ B;  1ID3 A;  3REL D;  3WAA A;  3AZI D;  1P3M D;  5BNX B;  4X23 B;  1N1J A;  1P3K A;  3MGP A;  5AV6 A;  1U35 C;  3W97 C;  4H9N B;  3W96 D;  4YM6 D;  4WU8 D;  5CPK B;  4ZBJ B;  3WAA C;  4HGA B;  3AYW B;  3AZJ D;  5BO0 A;  3KWQ D;  5DNN C;  4R8P C;  5JRG A;  5B24 B;  3AV1 C;  2FJ7 B;  1TAF B;  3MGQ A;  2HUE C;  4WV4 B;  3EPK A;  4J8U A;  5GSU A;  1S32 D;  5B1L B;  5AVC A;  1KX3 A;  4NE6 A;  4H9P A;  4NE5 A;  3AZE C;  1U35 B;  3MGQ C;  3W97 B;  3AZL D;  1M18 B;  3REJ D;  5B1M D;  4J8U C;  5CPI A;  5AY8 D;  3WAA B;  1ULY A;  3LZ1 B;  5GXQ C;  3LZ0 A;  4X23 A;  3B0B A;  4G91 B;  3AZM C;  3AV2 A;  5B33 D;  4KUD C;  1P3G D;  4KUD D;  5CPI D;  5F99 B;  3V9R A;  5B0Y B;  3W99 B;  5B24 C;  2RVQ C;  3VH5 A;  3AYW A;  5B33 C;  2Y2P A;  3AZM D;  3AZM A;  3WA9 B;  3VH5 W;  1N1J B;  5AY8 C;  2G5H C;  2JCH A;  5B31 G;  5B1M C;  5E5A C;  4JJN B;  3AZE B;  1TAF A;  4ZUX D;  5AV9 D;  4AWL C;  1B67 A;  2G5I C;  5JRG D;  3C1B A;  4J8U B;  5BO0 B;  4H9Q B;  2PYO D;  4J8X D;  5BNX A;  4ZBJ C;  1TZY B; 
#chains in the Genus database with same CATH homology
 1P34 A;  2Y2L A;  3AN2 D;  3AZK D;  5F99 C;  1H3O A;  5CPK A;  1Q9C A;  2RIQ A;  1F1E A;  3X1V C;  3AN2 B;  3MGS B;  1TZY D;  1R4V A;  1WWI A;  5B31 A;  4WU8 C;  3WTP D;  4Z66 B;  3V9R B;  5B0Y A;  3LEL C;  1P3P D;  3W96 C;  3B0C T;  5JRG B;  3NQU B;  4CSR B;  3X1T D;  3LZ1 A;  3REH C;  3B0D C;  3REH D;  5AV9 B;  3UTA A;  3REL C;  4YS3 D;  2NQB A;  4QLC C;  3WTP C;  2Y2O A;  5F99 A;  4H9P B;  3W97 A;  1U35 A;  4G91 C;  3AZM B;  3WA9 A;  3WA9 D;  3W99 D;  5F99 D;  5CPI B;  1P3G B;  4JJN A;  3AN2 C;  5B0Y C;  3KXB D;  1TZY A;  4KHA A;  2ARO C;  4J8X C;  5B0Z C;  5AY8 B;  3LEL B;  4XZQ C;  4Z2M H;  3KUY C;  5AV5 D;  2Y2G A;  4JJN C;  3AN2 A;  3MNN A;  3B0D B;  3R45 A;  3UTB B;  2ZM5 A;  5BNV A;  5E5A D;  3AZE A;  5B40 A;  5B40 D;  5AV5 A;  5BS7 C;  5B24 D;  3MGP C;  5JA4 B;  5CPI C;  5B0Z A;  1P3G C;  1T3U A;  4R8P B;  3MGP D;  3UTA D;  3AV1 B;  2IO5 B;  2F8N K;  2ARO B;  2Y2H A;  3KXB A;  5B40 C;  5AV9 A;  4J8V A;  2F8N A;  4NFT A;  1H3O B;  4WU8 B;  3KUY B;  4Z66 C;  2YFW B;  3TU4 B;  1AOI A;  3TU4 D;  4X23 D;  3KUY D;  1S32 C;  4XZQ D;  1WWS A;  1P3L C;  3AZK A;  4KGC B;  1F66 D;  1P3G A;  2HIO C;  1P3O C;  3EPH A;  2ARO D;  3C1B C;  3MGP B;  3KXB C;  3UTA B;  4R8P D;  3UTB A;  3AV1 D;  4J8W D;  1P3I D;  1P3L A;  4YS3 A;  1HQ3 C;  5B40 B;  5AV6 C;  5DNM A;  3MGR A;  5E5A B;  5B0Z B;  3VH6 A;  4R8P A;  3UTB D;  4QLC D;  4YS3 C;  5B24 A;  3B6G C;  4KHA B;  3NQJ B;  5AV5 B;  3AZI C;  1P3M C;  3B0C W;  1HTA A;  2Y2N A;  1P3P C;  3LEL A;  3LEL D;  3A1K A;  3UTB C;  4KGC C;  5C3I C;  1EQZ D;  3WKJ C;  5AV6 D;  3R45 B;  3LJA A;  3KXB B;  1M18 A;  3AZF C;  5BNV B;  2F8N B;  5G49 A;  4EO5 B;  5BT1 C;  1KX4 C;  4KUD A;  1F66 C;  4YS3 B;  2CWE A;  4KGC A;  5KDM A;  3A1I A;  5B33 A;  3REH B;  2DF4 C;  4X23 C;  3AFA A;  3X1T B;  4ZUX C;  3X1S B;  1W2E A;  1P3P B;  4Z66 D;  3WTP B;  3P5J B;  4WU8 A;  1P3A A;  1P3L B;  3B6F C;  2F8N H;  4NE3 A;  3TU4 A;  1AOI B;  3FDD A;  3MGS D;  3MVD D;  2Y2J A;  2RVQ D;  3C1B B;  3UTA C;  4YM6 A;  4XUJ C;  5B1M A;  4WU9 D;  3AZK B;  4H9Q A;  3AZL A;  4EO5 C;  1P3B B;  5AVC C;  1KX3 C;  4J8X B;  3NQJ A;  2PYO B;  2ZY3 A;  4J8U D;  4CAY A;  3A6N D;  5GT3 B;  3A6N A;  3AZL C;  4DRA A;  4ZUX B;  1A7W A;  3AZH C;  3AZE D;  3X1S C;  4JJN D;  3C1C B;  3KWQ A;  4H9R B;  4Z66 A;  2UWX A;  4E45 A;  2JE5 A;  1KU5 A;  2YFV A;  5AVB B;  4H9O A;  3O62 B;  3REL A;  5B32 D;  5B0Y D;  2NQB B;  5DNN D;  4KUD B;  3KWQ C;  2BYM A;  2J8P A;  3W96 A;  2BYK B;  2IO5 C;  5KDM B;  5B33 B;  3REH A;  3REI C;  3AZJ C;  3WA9 C;  5B2J C;  3LZ1 D;  5FUG A;  3X1T A;  3WAA D;  5GT0 A;  1Z2C B;  3AFA D;  5B1M B;  3REJ B;  2DQN C;  3WTP A;  4WNN A;  5GT3 C;  1M18 D;  3AZL B;  1U35 D;  3W97 D;  1P3B A;  2NZD D;  4AWL B;  2ZY4 A;  5DNM C;  3MGR C;  5B1L D;  3C1C C;  3X1T C;  1S32 B;  4E44 A;  1P34 C;  5CPK C;  3O62 C;  3B6F B;  3MNN B;  1ZLA C;  1TZY C;  2FJ7 D;  4Z5T A;  2Y2M A;  3KFU G;  2Y2K A;  4J8X A;  3AZN B;  1P3P A;  5B2J A;  3KWQ B;  3X1V D;  3UT9 B;  2CV5 B;  2L5A A;  1M1A B;  5B31 C;  1JFI B;  3AZK C;  3AZJ B;  2ZY2 A;  3AYW D;  3W98 C;  3F6T A;  4Z5T C;  5B2I C;  4Z2M G;  4YM6 B;  5JA4 A;  5CPK D;  2PYO C;  2BYM B;  3IP4 C;  2HUE B;  1BFM A;  3W96 B;  5JRG C;  3AV1 A;  2YFV B;  3H0L C;  4WJ3 C;  3O62 A;  5DNM D;  3MGR D;  5FUG B;  5AV9 C;  3AZI B;  1P3M B;  3REL B;  4J8V B;  1BH8 A;  5AV8 A;  3REJ A;  2F8N G;  4CAY B;  4WZS B;  5C3I B;  3WKJ B;  1B6W A;  2BYK A;  3AFA C;  2YFW A;  5CPJ B;  4ZUX A;  3VH5 T;  1M19 B;  5B2J D;  5GXQ B;  3LZ0 D;  3AV2 D;  3AZF B;  1S32 A;  1P3F C;  1P3K C;  4H9R A;  1PZR A;  3EPL A;  5AV8 D;  5AVB A;  4Z5T B;  3LJA C;  5GXQ D;  5B2J B;  4H9N A;  3REJ C;  1JFI A;  5CHL B;  3X1U D;  1ZLA A;  1KX5 C;  1BH9 B;  3MGQ D;  4J8V D;  3AZH D;  5GT0 B;  3MGR B;  5DNM B;  1KX5 D;  4DRB A;  2VQR A;  5E5A A;  4WNN B;  2Y2Q A;  3A6N C;  3H0R C;  3B6G A;  3W98 A;  2FJ7 A;  5B2I A;  5AVC D;  1KX3 D;  4UUZ A;  4XUJ B;  1P3A C;  5GSU B;  1P3K D;  3UT9 D;  2CV5 D;  1P3F D;  1M1A D;  3B6F A;  3X1V B;  3LJA B;  5GXQ A;  3LZ0 C;  3AV2 C;  3MGS C;  3AZN A;  3AZI A;  3AZN D;  1P3M A;  3VH6 W;  3MNN D;  3UT9 A;  5G49 B;  2CV5 A;  4YM6 C;  1M1A A;  3B6F D;  3AL0 C;  3EPJ A;  3AZJ A;  5CP6 B;  3WTP E;  5CPJ A;  1KX4 A;  1P3F A;  3AZF A;  4M6B A;  2NZD B;  5AVB C;  2HIO B;  1P3O B;  3W99 A;  1BH9 A;  2ZY5 A;  3AFA B;  2W8S A;  5B2I D;  5CPJ C;  1KX4 D;  4LD9 B;  3X1S A;  5BT1 D;  3W98 D;  1M19 C;  4HGA C;  3AZG D;  3AYW C;  1ID3 D;  2NQB C;  3REK B;  5B31 D;  1P3A B;  1EQZ A;  3REI B;  1HQ3 B;  1KX5 A;  5DNN B;  3AZG C;  1ID3 C;  2NQB D;  5B32 B;  4DQY B;  1ZLA D;  4XUJ A;  3O62 D;  2JSS A;  5AVB D;  2LY8 A;  1P34 D;  3B6G B;  3X1V A;  5B1L C;  3C1C D;  2PYO A;  3B6G D;  4UUZ B;  2NZD C;  5GT0 C;  1P34 B;  1M18 C;  5GT3 D;  5GT3 A;  3A6N B;  2XD1 A;  3MNN C;  1ZLA B;  3AZH A;  3LZ1 C;  3MGS A;  3AZN C;  3X1U A;  1HQ3 D;  3C1C A;  3REI D;  3UT9 C;  2CV5 C;  1P3B D;  1M1A C;  2NZD A;  5B31 B;  3REK D;  1P3A D;  1P3I C;  1F66 A;  4J8W C;  4H9O B;  3AZG B;  4WU9 B;  5GSU C;  5CP6 A;  5B32 C;  1ID3 B;  3NQU A;  4CSR A;  3C1B D;  3W98 B;  4LD9 A;  5B2I B;  1KX4 B;  4LD9 D;  3MVD B;  5B32 G;  2HIO D;  1P3O D;  1AOI D;  3REK A;  1P3L D;  3REI A;  4QLC A;  3H0M C;  4J8W A;  4H9S A;  3EG5 B;  2BG1 A;  5B32 A;  5CP6 C;  3TU4 C;  3X1S D;  4J8V C;  5CP6 D;  3X1U C;  2XD5 A;  4XZQ A;  1P3I A;  1AOI C;  4H9S C;  3LJA D;  1P3F B;  4LD9 C;  1P3K B;  4UPK A;  5GSU D;  5AV8 C;  3KSY A;  5AY8 A;  2HIO A;  3REK C;  1P3O A;  4XUJ D;  2Y2I A;  4WU9 C;  1P3B C;  2F8N D;  5B1L A;  5AVC B;  1KX3 B;  3MVD C;  2F2A C;  3VH6 T;  5AV6 B;  1EQZ B;  4G92 B;  1HQ3 A;  1KX5 B;  5GT0 D;  5DNN A;  3AZH B;  3MGQ B;  3MVD A;  3X1U B;  5BS7 A;  5AV5 C;  4QLC B;  5B0Z D;  4WU9 A;  4Z5T D;  2ARO A;  1BH8 B;  5AV8 B;  3WKJ A;  3W99 C;  3KUY A;  1P3I B;  3AZF D;  4J8W B;  3LZ0 B;  3AV2 B;  1M19 A;  2FFF B;  1M19 D;  2FJ7 C;  5CPJ D;  1EQZ C;  3WKJ D;  4G92 C;  1F66 B;  4KGC D;  3AZG A;  4XZQ B;  1ID3 A;  3REL D;  3WAA A;  3AZI D;  1P3M D;  5BNX B;  4X23 B;  1N1J A;  1P3K A;  3MGP A;  5AV6 A;  1U35 C;  3W97 C;  4H9N B;  3W96 D;  4YM6 D;  4WU8 D;  5CPK B;  4ZBJ B;  3WAA C;  4HGA B;  3AYW B;  3AZJ D;  5BO0 A;  3KWQ D;  5DNN C;  4R8P C;  5JRG A;  5B24 B;  3AV1 C;  2FJ7 B;  1TAF B;  3MGQ A;  2HUE C;  4WV4 B;  3EPK A;  4J8U A;  5GSU A;  1S32 D;  5B1L B;  5AVC A;  1KX3 A;  4NE6 A;  4H9P A;  4NE5 A;  3AZE C;  1U35 B;  3MGQ C;  3W97 B;  3AZL D;  1M18 B;  3REJ D;  5B1M D;  4J8U C;  5CPI A;  5AY8 D;  3WAA B;  1ULY A;  3LZ1 B;  5GXQ C;  3LZ0 A;  4X23 A;  3B0B A;  4G91 B;  3AZM C;  3AV2 A;  5B33 D;  4KUD C;  1P3G D;  4KUD D;  5CPI D;  5F99 B;  3V9R A;  5B0Y B;  3W99 B;  5B24 C;  2RVQ C;  3VH5 A;  3AYW A;  5B33 C;  2Y2P A;  3AZM D;  3AZM A;  3WA9 B;  3VH5 W;  1N1J B;  5AY8 C;  2G5H C;  2JCH A;  5B31 G;  5B1M C;  5E5A C;  4JJN B;  3AZE B;  1TAF A;  4ZUX D;  5AV9 D;  4AWL C;  1B67 A;  2G5I C;  5JRG D;  3C1B A;  4J8U B;  5BO0 B;  4H9Q B;  2PYO D;  4J8X D;  5BNX A;  4ZBJ C;  1TZY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...