3W9EA

Structure of human monoclonal antibody e317 fab complex with hsv-2 gd
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
222
structure length
215
Chain Sequence
b'QVTLKQSGAEVKKPGSSVKVSCTASGGTLRTYGVSWVRQAPGQGLEWLGRTIPLFGKTDYAQKFQGRVTITADKSMDTSFMELTSLTSEDTAVYYCARDLTTLTSYNWWDLWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein D
publication title Structural basis for the antibody neutralization of herpes simplex virus
pubmed doi rcsb
source organism Human herpesvirus 2
molecule tags Viral protein/immune system
total genus 40
structure length 215
sequence length 222
ec nomenclature
pdb deposition date 2013-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w9eA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3w9eA01
3MLVH 3D85B 4MA1B 3LCYA 3X13A 5I1KL 5D2NA 3AU1B 3GRWA 3IFOA 2IBBA 4HUXB 4XCCL 3NABL 4IRJD 2R23B 1W8NA 4WFEE 4C4KO 3MOAL 5C07B 2ID5A 1BBDH 3O2DA 5JDSB 3W5NA 5IHZA 2ZG2A 1IAIL 5FYJE 3OKDB 5EBWB 3MUGB 2LAGB 4Y88A 4UIMB 4M8QB 3BHBB 4L8SA 4WWID 3ULUC 3OKNB 5TE4H 3HE7D 1QFWI 5JW4N 1W72A 3KYNA 1HSAA 1JUFB 2B20A 5JTWA 4MAYC 1SYSB 4YIQB 1OTTD 2APVA 4NKIH 4MD0A 2IBGA 2YBRA 1JHTB 2V2WA 3AS0A 4NQVA 1OP5K 2V5RA 3BPLB 2OL3B 4UV7H 2AQ3A 4PRIA 2JE8A 4PGEA 4F7CB 3AXLB 5FV2A 2P8LB 3L3HA 1UC6A 4NQXA 4FTVA 1C12B 4M6MH 1RULH 4RMTA 5E5MA 1DLFL 1QBBA 1MIEL 3OG4B 5JNYB 1NJ9A 4OKVA 3T0DA 2BRRH 5DD1H 2L7UA 4KAQL 4N0YH 3V7AE 1LWRA 4RFEA 1GC1L 2UWEA 1U8JA 2HLFC 3C09C 3TA3A 3MCLL 4NCDA 3V5KA 1QUNA 4C56E 1MWAH 1MH5A 1NEZG 4ZO9A 4EVNA 1PYWA 2V5SA 2YD7A 3TO4D 3WUWA 1BM3L 3QH3A 5E8OB 5IMOA 1PJ9A 1U3JA 2ZNXA 1FN4A 3OSKA 5IFHL 2CMRH 3MNWB 2IALB 3IDMA 1GH7A 3KPQA 3BYTA 4JHAL 4FQXC 3AM8C 4L29B 5D7IE 4EJ1C 3AMKA 5DUPL 2ZKHH 1V3MA 2C7UA 4N9GA 5GSRA 1CTOA 2ZCLL 3Q5YA 2IPUK 1RQ5A 3SBWA 4YZFF 2DN7A 2Y7QB 2EXWC 4P4KD 3GBMH 2UVFA 4G8IB 3HR5A 1EXUA 2IAMC 2VZ3A 4K7PY 4Z77A 3QUZC 2KZWA 4UAOB 2F53A 1QR1A 3HMWL 4NJAL 2OTPA 3IAQA 4NSKA 2XKNA 2AEPH 4FFWD 4JRWA 4P9HH 4JG0L 4BSJA 1OPGH 4G8EA 4KFZC 4J6RH 1BFSA 1QQDA 4JY6A 4GRLD 1JPSL 4C56B 2ZUSA 3MODH 5F3HB 2WV3A 3BPCB 1KF9B 4HWBA 5I75C 4S11A 1FLRH 1S3KL 1YPZE 2CPCA 2ZJSL 1I3GL 3IXAA 3VXUE 3W9EA 2FO1A 1T7YA 5DK2A 3MBEB 1XR8B 5DVNA 5EUKA 1JWSB 4DN4H 1IC4L 3I9GH 3HI1B 3QUMH 4KJWC 3PGFL 4LNRA 4OZHA 1YNTA 4IMKA 1N7MH 4L4TB 1DBKL 4U1MA 3NCJL 4GS7B 4OZIE 3ZKND 4MA1C 5D7IB 4UB0H 5F88B 1TVDA 3RX5A 2FLBT 5DRNA 5IVOA 4X0KB 1GGCH 3PABB 2P5WD 3V6OE 4NNPH 5ESVA 5EO9B 4QRQA 3T8XB 4PRAA 3CFDA 3QEUA 2H2SD 3BH8A 4KQ3L 1CK0L 4I2XA 3IDIB 1NMBH 4S1RL 3RA7H 4I5BA 4LKCB 5C0ND 4QNPE 1H15B 3OHXB 5HGDB 2R39A 1OB1A 3BPLC 2GEEA 2GKIA 4KK8C 4LSQL 2C3GA 4NM8H 2DQFB 4LAJH 1MHCB 4X5XB 2GK0B 2BY2A 4OZIB 1A2YB 3ZT6A 4Z7UA 3MRCA 3CZJA 2BNRB 4NQSB 1Q0YL 5T1LD 1HKLL 4I8DA 3BD4A 3TBTA 3RZCD 5MEND 3RJQB 2DF3A 2R1YB 3EDFA 3S97C 5T3ZD 1JK8B 3F7VA 4P5MA 4MD4A 4GBXD 2C9AA 5FGBC 1MQKL 4MJIE 3VGBA 2HFGH 4QXGL 2VXSL 3LN9A 3HE6A 2XI9A 3S35L 1MJ8H 3O9WA 4KK6C 1QPPA 2X05A 3ZSTA 4LLYB 1IKFL 2PXYD 1EAPB 5I1DA 3I6GA 2W9LA 3BKCH 3P9MB 2QTEA 5BW7C 5DF0A 5EIQA 4N0UE 1YZZA 1MNUL 3RBGA 1U8LB 4Q9CA 1I8MB 1BQHA 3RWIA 3FMGH 4XVJL 3OZ9L 3VDAA 4DW2H 5KVEL 3DIFB 4RGNE 4KWUA 3TP4A 1ITCA 5CJ8A 5I17B 4TQEH 2H26A 5F7MC 3C8HA 2X41A 4WFGD 4XCFL 1A7OL 3DUUA 3VXRD 4U2YA 1TXKA 2BHUA 4QHKJ 4QCIA 4BSVA 5KG9B 3RJDA 2A6JA 4YFEA 3OAZK 3ZSSA 4UAOC 2DQHH 5A2FA 3MA7B 1PG7W 4S10A 1KXQE 5FO8A 4PJBA 4YHNB 2PW2B 5FA3A 1P9MC 5ACZA 2NXZB 1I4FA 4XVUD 3D0VB 3KXFE 1F90L 3CDGB 3ZDYE 1YYMH 2XQYK 5GGRB 2XWJB 1I8LA 1NKRA 3WIFB 3CMOH 4KKAC 2PO6B 1T21A 1QSZA 1U58B 3MNVA 3QULB 1FNAA 1RJCA 4XBPA 5MEQA 2FDBP 5DD6A 2JJSC 3MBEC 1CBVH 3U1SL 4BFIA 4N0UB 1B6DA 5BS0D 1N6UA 1B0RB 1X9QA 2IMNA 3M1BA 1BF2A 3T2OA 4ZFZA 2VDQH 4FG6D 2G2RA 5FFLA 2AV1A 4DKEH 4PJ7A 4GS7C 1UXSA 4JCLA 3MLPA 4G6AD 3QXDB 4OGAD 2EYRA 4FQ1L 4PB9H 1S78C 3X12A 4ZUVB 2A6IB 3SE3A 4NQEA 1QSFE 3NA4A 5DVMA 3ZHKA 1W0VA 4HJJL 1BIIB 2QSTA 1TVBA 2NZIA 4R26L 2Y36H 3VCLB 1Z0MA 4LCWD 4BH7A 4JQVC 4MQXD 4YDLB 4CVZB 2NY6D 1S7RB 4WFFD 1D7FA 2ZPKH 4P46A 1OM3H 5FDWA 4C57C 5D4QA 2HFEB 1OP3H 5IOPA 5KZCD 2Q8BH 3MYJB 1S7XB 4RBPH 2Q76B 4G6JL 3IVKB 4HJ0D 1FSKB 4FQJH 2VXQL 4LSDA 4AIZB 2FZ3A 3OX8B 3QFDA 5EFIB 1J0IA 2H9GA 3LEXB 1KULA 3BMVA 3S4SB 1LEKA 4F9PA 3N85H 4XI5D 2DRUA 1EMTL 2OZ4H 2GQHA 4DGYH 3D39A 1W0WB 5EU6E 1UEYA 3OXSA 4UQ2A 2GY5A 1QSFB 2RIKA 5DK3A 4JVUA 3RX7A 2GT9A 1J5OL 2XQBH 4LLVB 5K59E 3BD5A 1NGXB 1P5UA 2MCPH 5D1QA 5T5FL 3QA3A 3EYSL 2ITCB 4YDVB 4AMKL 1CXLA 2XXMB 3NCBB 5GZOD 2ZCKH 2K7QA 5C8JA 2Y5EA 1WTGT 3GSNL 3KLAA 3NA9H 5FEBA 5IQ7H 1ZHLA 1S7VA 3H0TA 4P5KA 5F6HI 5DC9B 2VXUH 4LCUB 1YN7A 1KCUL 2W65A 5DJ6A 2HVJA 4Q0XH 1GOGA 5D5ME 5IG7B 3RFZC 3OJVC 1JPTH 4R4NC 1J1XH 4OM0L 4D8PB 2DLEA 3NZ8A 3AS3A 3MRPA 5HI3C 2BOBB 1B88A 2AJXH 2AK4B 5EU6B 3MJ7B 4NJ9H 3I3EA 3JV4B 4Q2ZA 4JDVA 3I75A 4KI1A 4NHCH 2WM0A 4OQTH 5IV2B 1P84J 2EH8L 3O2VH 1SM3H 2NXZC 1DQTA 2AJUL 3V4UL 4GW5A 5F1IA 2AXJA 5K9JL 3WHE0 5ICZA 4S2SB 1A47A 2R4RH 3IFPB 4ZDHA 3T3MF 3QFJE 4GOSA 1MCSA 2VLJB 4WHYG 3VFTA 4QOKA 1FL6A 2BFVL 3IDNB 1AXTH 4RGOL 5AAWA 5E2VL 2NY2D 1INEL 4RAVA 3HLAA 3MV11 4XCEB 2J8UE 5DHVB 5F9OH 1UZ6E 3PNWB 1IC5L 2Q7NA 5DJ8A 1BLNB 2OQJA 5AAMA 3ARBB 5I1AA 4U1LA 5EN2A 5CP3A 1UVQB 4M7KL 1CDYA 2OR9H 1P4BH 4P57A 4YDJB 1LK2A 3DXAB 3BVNB 3TYFA 1CL7H 5I8EA 5HYEA 4HKZB 5AD0B 5D1XA 4M00A 1FYTA 1NPUA 3MCKA 2NY4D 1RIHH 3TBWB 3MBXH 3RVVC 5TE7H 3LKSB 5KTEL 1FAIH 3C6SA 3BO8A 4KKCC 5KSAB 3MR9B 1B2WL 4K3DL 5ITBH 4Z8FH 1U0QA 3TZVB 3MZGB 5IEHA 1JHLH 4KJQC 4FFVD 3VFPA 4TNWF 3DO7A 3CFBB 3ARGD 3TT3L 1AR1D 4LSRL 3L3OB 1I3RA 3H9SA 3LS4H 2M26A 2NX5D 4X7SL 1FSKC 3FKUS 3C5ZA 5MERA 1K2DB 2EE3A 1IQWL 4GG6A 3D5OF 4DUXA 3DVNB 4WFHE 3G08B 1IGIL 5E9DD 1BX2A 5DSCA 1WEJH 1TETH 2PTTA 3VGDA 5J8OA 3UTSA 3P3YA 2AXHA 3D25B 3FFDA 4AEHL 3RGHA 5HHQB 4XC3L 1SEBA 4YHZL 1IKNA 4WJ5A 3A6CH 1LE9A 1R5IB 4D9RE 3ULUD 4ELKB 4U6XB 5EZIH 3QDGB 5MEPA 4PJ5D 4JPKH 3VFWA 2A1WL 3RY4A 4MAYD 2R9HC 5FYLL 1EFXB 1TVHA 2ZG1A 3VA2C 4HBCH 5CP7A 1CLZL 4LU5H 5DRZA 4ONFL 1UWXK 1Q94B 1T5XA 1J11A 2BMKA 3DGGB 4YE4L 3B9AA 4KKLC 1DQDH 2LU3A 1BZ7A 5ILTH 3C5SB 3UAJC 4MHHG 5F70A 1S7UA 1W2KT 1VFUA 4LEOA 4X4YA 1QBMH 1FJ1B 3MV7A 1ZSDB 3U0PA 2ARJQ 1S9KC 1BQLL 3QNZB 1BREA 5CBEB 4NIKB 1QHPA 1MAKA 3P9WB 1FNSH 1T7XA 3S98A 5GGQL 2A38A 1IM9B 2IGFH 4E41D 1OWWA 4XWOC 1KJVA 5BRZA 4MJ2A 4NZJA 2WUCL 1JBJA 2AJSL 4J8RA 3JWNC 3HUJE 4WWKB 5FHAH 3DX6A 5GJSH 3TNMA 4G3YH 5MHSE 3FQRA 3WN5A 2FD6H 2DQJL 3S35X 1MFCL 3QUYB 4KJYA 3ARZA 3OL2A 4AM0A 3RVXC 4FQXD 4D0BA 3V5HA 4GRMA 2E7CA 4CADB 4LRNL 5IVXF 1GGIL 3RPIB 3ZE0E 5C1MB 1CFNA 4YXHH 2EXWD 2IAMD 1WUNT 3BZDA 3QUZD 3DVFA 3D0LA 2ZUYA 3UTZA 3QDME 5DO2C 4XMKL 3A67H 5GPRA 1A1NB 3FQWB 5KSAC 4FQ2L 4D2NA 2VXVH 3GK8H 4E5XB 1RZIB 4R7NA 1WWBX 4CGTA 3KWWA 4NNYA 5HDLA 3TZVC 3MMEA 1ZS8B 4LASL 3U2SA 3MC0A 1G9ML 2D03H 1I9IH 2CLVB 1KCRH 2IEPA 4HCRH 1YYLL 2VO5A 2X4OB 2P24A 4K3JH 1YA5A 4WO4C 1AHWA 3HI6L 2E7LA 5J1AA 5DJXA 4KJWD 4WU7A 4Y5XB 3C08H 1MLBB 4P0DA 4R97B 3D85D 5D2LE 4RAHA 1RZ7L 3O3AB 4K2UL 4WCYL 4PRHE 4PG9A 5DLML 3TO4A 4F33A 1L0YA 4NO3A 3WFBL 3SKMB 5C07D 2MQCA 2FJFB 3HS0A 4MNGE 4HGWA 5B3JE 3WUZA 1RJLA 4NRZA 5L8JB 2XWTB 4EDXA 1MEXL 2B0SH 5EZOH 1IT9L 1XF2A 1QRND 4PR5B 1A4JB 3R1GL 5DMKA 2F54B 1FVCB 4JFDB 5EOQL 2QBWA 1NAKL 2YC1B 4HC1H 4P4KA 2B7DT 4RMQA 5T1DH 1FVDA 3H6JA 1ED3A 3QG7L 4UV4H 4KK8D 3O41B 3ILQC 1X5HA 1A7BA 3VXMA 1ZT1B 4CMHB 5C7XH 1DE4B 1X5LA 2EC9T 3M8OL 4U0RB 1Z9LA 1J1OH 1S9XA 3B43A 2GUOB 1P69B 2P8PB 1G7IA 4HH9B 2BX5A 3B3IB 4PTTA 1AXSB 1FFQA 1A1OB 5AZ2L 1K85A 1ADQH 4PJ9B 1GPOH 4JB9L 4Z5RB 1GAFL 4I0PB 4OLXH 4PGDB 4X4ME 4ODSL 3ELAT 3OKYA 3W82A 1MLCB 4KK6D 1I1AA 1CZ8L 4BKLA 1EZVY 4GXUN 1AY1L 3V52H 2VDOL 4WWKC 1Y18A 4JFFD 3DUSB 3TN0B 2BSED 1K8IA 4RSVA 4OLWH 3A6BL 3EYQC 1JF1A 2V7HB 3ROOB 1NMAH 5FYKL 3QUYC 4IDJL 4LHUB 3X14B 5CMAB 5C0RL 1J0KA 3UJIH 3WV0A 3MRRB 1CE6A 3ARQA 4P2OD 1IGYB 4H8WH 4POUB 2W07A 1RU9L 4GKSB 3KHOA 4KTEH 5DZOA 1MCOH 4BFEA 1QTYT 1FBIL 5B39B 2Z8WC 3L7FA 2M8XA 3A6OA 4GKZB 3RVUC 2FRGP 2MPAH 1C8PA 4TUJA 4EI6A 3S6CA 3K1DA 2VC2L 4IM8A 1HCFX 4YPGB 4KKAD 4S0SD 4NQDB 3D2UD 3GSVA 5IB1B 1A3RL 3HNSH 4OLVH 1QD0A 1U8MB 5T1LA 2FHCA 2WINA 2X42A 2OXGA 3RZCA 3MBED 2CLRB 1OQXA 4NM4H 3QEGL 3VFUB 1U92A 4Y5XC 2ICWB 3G5YA 4GBXA 2J4WL 4L4TD 4R97C 1WIOA 4QXTA 4Z7QE 3O6KH 1M7IB 4PREB 1S78D 2JJWA 5DA0B 4F15B 4U7SA 5DRXB 4MNQB 3WIIL 3W39A 3SDXB 4JEGB 5DHYA 3O81A 2EDWA 1NGZA 5SWZE 3BUYA 5GRUH 1BFOB 4XNUH 4QRUA 3UPCA 1KIRB 5F1NA 3GGWB 2OP4H 3IDGB 5F7DB 4LEXH 2BVOA 4QLRA 4OFIA 1PEWA 5IVZB 4AQ1B 4Z76A 2JJTA 4ZOCA 3SKOA 1FFOB 2CH8A 1YEIH 3CXHJ 1F3RB 4NPYB 1MIML 2HKFH 1N0XL 1RZGB 5DUBA 5D7LE 5E56A 4CMHC 4KMQA 5D7IF 3BPNB 4U0RC 3J8F7 1KG0B 1XIWC 2BNRD 3PIQA 5I1JH 4QHMB 3ROLA 4JY5L 4DGIH 3T0AA 3NN8A 3U9PH 1RIVL 4F80A 5H2BB 1IMHC 5E00A 2DQDL 2VLKE 1FL5A 1J87A 1SJHB 1VGEH 3NFPB 4TVPD 1MUJA 5SWZB 1MI5E 4I0PC 4JFXB 4ZD3H 4JO2H 1E6OL 4JRXE 1RSFA 1I8IA 3TYGL 3BGFB 5D9SB 1NLDH 3M17B 3NACH 5C2UB 1P5VA 4XPGL 2VYRE 3G5VB 1OAUH 1CE1L 2E6PA 5D1ZD 2AK1L 5GGSA 4BK4A 3QNXB 5FUOL 1E28A 3CD4A 1YPZF 3B5GA 5T1MB 25C8H 4A6YH 5DZNA 3LMJH 3E6FB 1CGSL 3VFGH 2R2HB 2V7NB 4HFWA 4OZIF 1E4XL 4LCWA 3MUJA 1S7WA 5ADPH 4XP1H 1NC4A 1P7KB 1FNEB 2HWZH 5TH2A 3NOIA 1M71B 4NZTH 2FJGA 3D87B 5F9JB 2VLKB 5K9OB 4YPJA 2AGJL 2NXZD 4U6YB 1MI5B 4YHMH 3O3EA 4OUUA 4AEIH 4RFOL 4LLQB 3IJHB 5I30H 1T1WB 3WFEL 3AREA 1KIQB 2VZTA 3KNBA 3T0ED 4EDWH 1T1YA 4QNPF 1D9KA 5J3HD 1E4WH 4F8QA 3X17A 5IB5A 3NAAL 4HFUL 4WI5A 5HYQA 5C9JB 4I1NB 1ND0B 3OB8A 4J3OC 3MJGX 3LRSA 4Y5VB 4F15C 5B38A 1WFUA 2YPKB 1ZVHA 2R2EA 2YD8A 1H9VA 2ATPB 2BNQB 3QI9B 1WAAE 5IMKA 5TPWH 1XGTA 3WHXA 4RNRA 3DVGB 3EYFA 3VI3E 4KKCD 3L3KB 1INDH 1KJ3H 1NGWA 3I6LE 1TITA 4M5ZL 1AJ7H 2FX8L 3SE9H 2VSDA 4WI7A 4Z7VE 1GYAA 1G7QB 2D31A 3BZ4A 3DETC 1BBDL 4KJQD 5F9DC 4LLMA 2G5BA 4L4VE 2MQ0A 1GZPB 5ALCL 3MX0A 4ZXBB 1D5XA 5L2JB 2Z31B 4XBGB 5EA0H 1B9ZA 5TE4L 5KVGH 5GS0C 4HLZG 1T0NB 2LVEA 3QIWA 2HFFB 3BPNC 1XH3A 3VMOA 4PUBH 3RL2B 4NKIL 5LAXB 1VENA 5A2KH 4IRZH 2VLME 2J7LA 1IEAA 1J8HB 2CIKB 1J8KA 5C08A 3GJEB 1FNGB 1CVRA 4M62H 3FCTA 2R0ZL 5INDA 3KLDA 3K80A 2X44D 1KCSL 3BGFC 3THML 4GFTB 2LFGA 3H3PH 3VGEA 5DK0B 5FK9A 3X11A 4Y5YB 2VAJA 3MOQA 2BRRL 3TNNA 3UTTB 5DD1L 2R9HD 4N0YL 3B6SA 5JIPA 1WBXB 3FB5B 4K23H 5GS3A 5FYJL 3VDCA 5CLTA 2NW2B 1CGWA 1GGTA 1ZA6B 4L4VB 4XPHH 5KOMC 4AH2B 4KKLD 4WU5A 1C5BL 4WW1A 3ZL4L 3GM0A 1IBGH 1MWAL 3LQAC 3LH2H 4K3EH 3UAJD 2MHAA 5ISZE 4HH8A 2YA1A 3EJJX 2ZUTA 3RZWA 1DN2A 1XGYL 4YFDB 1C08A 3V4PL 3IFLH 1IQDB 2CKBB 3F12A 4GW1A 4P2YA 4YJZL 1TFHA 3V8OA 5A2LH 3Q3GA 2CMRL 3SE4A 5DS8A 2AK4D 4KPHL 4UZGA 4PJHE 1R0AH 2ERJB 5TFSH 2YK1L 1A7RH 1JNNH 5EOTB 2ZKHL 1X5FA 4X9FA 2HVKB 4HHAB 4TNWK 1PZUB 3E3QE 5DD3H 1IAKB 2VXTH 5IJVB 3GSOB 2VLJD 1OGAB 5L2KA 3PWUA 4JANA 2AEPL 3I2CH 2KL6A 4BA8A 5EUOE 3AAZA 1YJDC 5MP6L 4O5LH 4G9FE 2IG2H 1NEZB 1NGPH 3RVXD 4PJAE 2J6EL 3VWKA 5EC1B 4EXKA 3MODL 5ISZB 1HQ4B 4JQXC 5IB3A 1Q72H 4JDTH 2K1MA 4PJ5A 4IMLA 3S36L 3DXAD 4MAYA 4Y5VC 4BFGA 4MSWA 4DN4L 1IZJA 3I9GL 3EOAB 4OCYL 4PJHB 4ZODA 5DO2D 1MSPA 1KPVA 3UZQA 1N7ML 3QI9C 2H41A 1MRCH 5K59F 4JN1H 5KSAD 4DKAA 3S96A 5DMIH 4Y4FB 3ARTA 3KHQA 3MGAA 4JN2B 3V0WH 4BYHA 5IVXA 4U7MA 1BBJB 2ZOLA 1I7UA 2Y25A 2VISB 3HZKB 4NNXB 4PGCB 4ZO8A 5DQDH 1T5WB 4WO4D 4D9LH 1HHHB 4P9MH 4YAQA 2CR3A 1BWWA 4UUJB 4ZXBC 3VFOA 4B7IA 2Z31C 4XAWH 4HKJB 1EIBA 4R6UA 5IR1A 1JNHB 2FYYA 3MLUL 1DZBA 3QEQD 4G9FB 5D5MF 4E41A 5HYJA 5IEKA 4NKQB 1TCRB 3R0NA 5ENWA 4H5SA 3QUXD 1LD9A 1JV5B 1LO2L 5C0BE 3I84A 4XNXH 3NFNB 3ESUF 4ZQKA 3T2PA 4ODXA 1OVZA 3VXPB 1VKXA 1RHHA 4GT7A 2AJZB 3RUGE 1IEHA 3AM8A 3L6FB 4EQ3A 1VPOL 3QDGD 4EZMA 2Y9RT 5DFVC 1I8KA 3QBTB 4Y5YC 4XP6H 4F7MB 3TWCH 5A3IC 2KQNA 1EFXD 2VN4A 4NRYB 1MFEH 1PW3A 2IBZY 5F1SA 4XP9H 2GTZB 4ORZC 2HFTA 2NW3B 1LP9E 2IPKB 2ESVE 3G9AB 2DQCH 2E8YA 2HRPL 3HG1E 5ESAB 5JOFB 2HFGL 2E9IA 4WTXA 1MJ8L 2J8UF 3LQZA 3AUVA 4N8VG 4YK4B 5IROA 2XN9E 5IIEA 2CLZB 1HWHB 4BJLA 5IB4A 3T2QA 1JN6B 1AGEA 4WFHD 4OAWA 1DQLL 1VFAA 3EIFA 5C0BB 5HYSA 4OI9A 5JHLH 3STZB 3ULVE 2ERJC 4S1DC 1EK3A 3WLBA 4QHNB 3RPKA 2OBGA 1WT5C 3PGDA 4LARH 1IM9D 5KVFL 3JUZA 1CR9H 1Q0XL 1JHKH 3RKDC 1RURH 5FDYA 1FQ9C 1QBAA 1YNLH 4XVSH 3V4VL 5DHXB 1KELL 2OMNA 2RQ8A 2F15A 4WWKD 4HUXA 2QQNL 2YD6A 2R23A 2X9YA 2ADGB 4NC0B 3UJJL 3IU4H 2FR4B 4K71C 1ZEAH 5C07A 3QUYD 5JDSA 1DSFH 1LP9B 1EO5A 1BGXL 4P59H 2ESVB 3OKDA 3MUGA 1FCGA 3LS5H 3QUMB 1GOHA 4M8QA 3BHBA 4XRCB 3CMOL 2YPVH 5KJRH 4RDQG 5F93C 1FZKB 1NCAH 2XN9B 1HIMH 3TIDB 5CJXC 3T09A 3OKNA 3IDJB 3W2DH 1JUFA 3HNVL 4FS0A 4KMTH 1YEKH 1SYSA 4CN6A 1CBVL 4YIQA 3LB6C 3OJDB 5I1HL 3ULVH 3F62A 1PSKH 5L88H 3MTRA 1JHTA 2VDQL 4NT6B 4L8CB 4N5EC 3RVUD 5JO5B 5I71B 2OL3A 2VLRE 4Z7OE 3AS1A 5IFAL 3CSYB 2WIIB 5F9WB 4F7CA 2X89D 1IE5A 3AXLA 2Z93B 4Y4FC 2I9LA 2P8LA 1QFHA 2EC9U 4HAFA 1C12A 1W8OA 5FCUL 1T7VA 3QPQC 5JNYA 5IF0B 1UZ8A 5HGBA 1YEFH 1NBZA 3SCMA 4TULL 3BE1H 4Y1AB 3RIFF 5FAAA 1UCBL 1CFBA 4FQCL 5FGBA 4JPIB 3U0TB 1TQCB 2VDNL 4X80H 4GW4B 2VQUA 4LDLB 2Q8BL 5T1KB 2Z8VC 4FXLA 5E8OA 5HGHB 5J7CC 3WLWC 1KFAH 2H8PA 5TDOB 4U0QB 2BY3A 3MNWA 3NH7H 4OZGE 3GM8A 4JHZA 4YHKH 3RKPA 2IALA 4OFVA 2WZPD 4LPUA 5J0BA 4K3HA 2F54D 4JFDD 4JO1L 4YDIL 2OZ4L 4PJ8B 3D3VD 1JP5A 3ALXA 4ERSH 3T1FB 2FCBA 2Y7QA 4UT6L 4G8IA 3QEHB 3JUYA 3RY6A 2BP3A 1CXFA 1QRKA 5CEZH 3KVQA 1P9MA 3WSQH 4YK4C 4HEME 5FGCB 4B5EA 1RY7B 3O8XA 1XIWD 2HT4C 4C56A 1OAZL 5F3HA 2J6EA 5GGRY 1TNNA 1DEEB 3BPCA 2YD2A 4BELD 2WMPA 4LLAA 4XPTH 3V5DB 4HG4K 2YD4A 4Q0XL 1HINH 2FJHB 1XR8A 3MBEA 4I0PD 5DI8B 2P8MB 5IB2A 2Z92B 2YD1A 1JPTL 3HI1A 2DICA 5EU5B 1UB6B 1J1XL 2AEIT 2AABH 4LGSB 4QXUL 4L4TA 5K33A 2JK5B 1XGQA 1J0YA 2WQRA 5D7IA 4OM1H 2Y5TB 5F88A 1C5DB 1KPUB 4KK5C 3HZMB 3MRJB 4NJ9L 1YNKL 3C87A 4X0KA 3PABA 4NHCL 4QHLB 4OQTL 5I8OH 4JM2B 4LHUD 5B21A 1RUPH 4LHQB 4JR9H 1IEBA 3T8XA 3KPRB 4L3EE 2BXZA 2D0FA 2ADFL 3TT1L 5D2LF 1RJZB 4F37F 5HHPA 4TN9A 5GGTH 4O58L 5E8DL 5HHXL 2O5ZH 1AXTL 1GGBH 4Y4HB 4LKCA 1H15A 5E6IB 5HGDA 2X4NB 5FO9B 5F9OL 1YPZA 3HC3L 5I71C 1JGVH 1PY4A 5I9QB 2EDNA 5DR5H 2DQFA 5F9WC 1MHCA 4X5XA 4M9OA 2GK0A 1DTUA 3L3JB 4GQPH 4J2XA 4NQDD 4OZIA 1A2YA 4NO0B 3BP7B 4NQSA 1PBYA 2R0LL 3STBA 1PKQE 3G6DH 4NKMB 3F5WB 5CKAA 1KJ2H 5CLWA 2FWOB 5TE7L 2EO9A 3FT4B 2R1YA 3SGKA 3V6OA 2ICEB 3U82B 1ZANL 5FM8A 1MCLA 4ONGL 3FQNB 4UOW1 3T2NH 4Z8FL 4L3EB 2ORBL 1TQCC 2IANB 4XH2B 4WHYH 5IGXH 4LLYA 3IRZA 4YHOH 1EAPA 4MNQD 3ZYOA 1KGCE 4Z6AT 3P9MA 1KB9K 2DBLL 2YD9A 3U0WH 2X1PA 1QZ1A 1U8LA 1IGMH 2AEQL 2PYFB 2NY0B 3EFFA 3PV6B 1I8MA 1MHHA 4OFYD 3DIFA 3S36X 4O2EA 4ZFFB 1MQ8A 3VRLE 1MRDH 1WEJL 1DLHB 1TETL 1NDMA 5I17A 3SOBH 2VITB 3KPNB 4P5TB 4PJ8C 4YUEH 3DETD 1NAMH 1YQVH 4P3CH 4KGJA 5CWSB 5BVPH 2PCPB 5C09B 5EC2B 2ZCHH 4GG8B 1AQDA 1IZKA 1UH4A 3IDXL 5I18H 1I7RB 3KPSE 3BKYL 5BV7H 3MA7A 4WDIA 3TH4T 2LU7A 2PW2A 4YHNA 3D0VA 1SEQH 4PJGB 2X7LB 1IRAY 4MJIA 3CDCA 2XWJA 4QF1B 4QTIL 5FECB 5B3NA 4MA7L 3WJLC 3WIFA 1XF5B 4H1LH 4QRTA 2PO6A 1HEZB 1FNHA 3QULA 3SDXF 1FIGH 1KN4H 3IB4A 4ODHL 5SWZD 1CFSB 4N0UA 1ZKAA 1B0RA 5ID1B 3LRHA 1QLRB 5D71H 3MOBL 4PRPB 1S5IL 1QBML 3PP3K 3FB7A 2EKSB 3KAAA 1C7SA 1URLA 2BOCA 1UM5H 3MV8D 4MS8D 3QXDA 1HQRB 1FG2A 1CXKA 4ZUVA 4XP4H 2A6IA 1OP5H 4NC2B 5D96B 2FBJH 3FZUC 5ICXB 4PLKD 4ZFOB 3QXAB 2IGFL 4JM2C 3W11C 4TRPH 4E0RB 2A6DB 3KPSB 1BIIA 4KGLA 3MRQB 1OARH 2Q1EA 2P43B 4JRYD 4U6VH 3WFHB 3VCLA 4Z7QF 3I6KB 5GRJH 4YEEA 1A6PA 4G3YL 1S9VB 3KYMB 1V05A 2F5AL 2FD6L 4Y4HC 5JZ7C 2J12B 1QHOA 4U49A 3GRWH 4FTVE 2JIXB 3MYJA 1S7XA 3BW9B 4HGMA 1WZKA 1OCWH 2Q76A 3IVKA 3LHPH 5EULV 1A4KB 1IJ9A 1MI5D 3O2DH 4NZDA 2R0KH 1HHKB 4LCYB 3OX8A 5HHOE 1LDPH 5EFIA 3CH8A 4X6DE 3LEXA 4XGZB 3SKNB 4LGRB 1NUFA 3S4SA 4PY7B 5IT2L 4WHTA 5INCB 2X4PA 4GO6B 1JRHL 3R8BB 1W0WA 1W72H 3EYOA 2DLIA 3A67L 3ET9F 1QSFA 2YN5A 5TF1H 2VXVL 3GK8L 4LLVA 3DURB 2N7AA 2AKRB 1NGXA 5E4IA 3EZ8A 1PY9A 5E99H 3QHTC 2ITCA 1OAQH 2NY5H 1OHQA 3GSRB 4HCRL 1B0WA 4K3JL 3O6MH 5IW6B 1K4CB 2IMMA 1JGLL 4U1GB 3T1WA 4S1SH 1IC1A 3CGTA 3C08L 2BNQD 3QI9D 3DYOA 2L0DA 3FRPG 4LCUA 2NY0C 2GJZB 3DV4B 8FABB 5HHOB 4OLUH 4FZ8H 4P5TC 2DQGL 3BQUA 5B8CB 2UY7A 5I6XB 5EG6C 1BPVA 4U33A 1UXWB 4LSVH 3O4LD 1TJGH 2BOBA 2AK4A 3FO1B 5EU6A 3MJ7A 3V6ZB 4DAGL 2B0SL 3JV4A 4ZXBD 1BD2E 4G5ZH 3BEVB 5IV2A 1R24A 1V7NH 3OGCB 1EO7A 5JUEH 5MEOB 4UT7H 3EDKA 1RZJL 2X40A 4S2SA 2GY7B 4HC1L 5T1DL 4AENB 3IFPA 2BVTA 3WFDH 2X70B 4O02H 2VLJA 5EU7C 4UV4L 1SJVA 1C16B 1YMMD 1J8HD 1T83C 2BK8A 5C7XL 2WLYA 4GH7B 4XCEA 1KBGH 5DHVA 3PNWA 1J1OL 3INUH 5D5MA 1IAOA 3T77B 5DFVD 3ARBA 3S88H 3UTTD 5E8PB 1UVQA 1ZGLB 5D6CB 4I2XE 1T89C 1ADQL 4YDJA 3DXAA 5D7SH 1GPOL 1QFWH 3BVNA 1QSEE 3G5ZB 2IC2A 5KN5B 4HWBH 4HKZA 4OLXL 1DQMH 3MRLB 5AD0A 3TBWA 5I76B 1BD2B 1T80A 3SE8H 3LKSA 1CI5A 5KSAA 4OIIL 3MR9A 5I15L 4HPOL 1O0VA 1P2CB 4LDEB 3HNTH 4IOFC 1ZXQA 3DECA 3TZVA 3CXDH 1AIFA 2HT2C 4MLIA 1HI6B 4P2QD 3CFBA 2FATL 3L3OA 1AO7B 5F7NC 4I0KA 5C0CD 4FRWA 4HUUB 4D3CH 2H32B 2QQKH 3VI3F 3RKDD 5AYUH 3PWPE 1YC8A 2J8UA 4KTEL 4L8DB 1K2DA 5LGKA 2VWEE 3P73B 3DVNA 3QQ4B 3G08A 4P48A 1OGAD 3QAZB 3BMWA 1JPFB 3TO2B 4DZ8B 2HG5B 4YHLL 3D25A 12E8H 5HXMA 5HHQA 4MJ4A 2MPAL 4RA3A 3VI4E 4RRPA 1B3JA 4K9EH 4K8RL 2FL5B 1R5IA 2BERA 1NUNB 5ISZD 4ELKA 4U6XA 3S9DB 3HNSL 4OLVL 1OW0C 2WLZA 2G9HB 2X4TB 3QDGA 1NUGA 4QRRE 3IFNL 3W0WB 4PG2A 1K3ZA 3OAZH 4YDKL 1EFXA 2ILLA 3LB6D 4ZUTA 4NM4L 4U1GC 3PL6D 1Q94A 4KKNA 1H3GA 4G7VL 3GNMH 5KBNC 3AB0B 3DGGA 3WD5H 3O6KL 8CGTA 4IOIB 4MVBD 3X3GL 3C5SA 4UNTA 5IVNA 2MQ3A 2C1OB 3PWPB 3IGAB 1NFIB 2A74B 3R06B 1XMWA 4OCSH 5B8CC 1FJ1A 3PJSB 5I6XC 1U95B 3QPQD 2OSLA 1MPAL 1ZSDA 4ZTPH 4OCWL 1PEZA 1YECL 3QNZA 4GRWB 5CBEA 2FIRT 5DGQA 1I1YA 4RZCA 4KXZI 2OP4L 2AXFB 1IM9A 4WTZG 2F58H 4OZFG 3U6RB 4R3SB 4XPAH 1BJMA 3LAFA 1YEIL 3VFVB 2CDFB 4WWKA 1OAXH 1P7QA 5IHLB 3WLWD 5J1SC 2HKFL 3IYLW 4K7PH 4PJHF 5I16B 5GS0L 3QUYA 1P7HL 2NMSA 5I1KH 4NUJA 2B2XH 4XNMB 2FO4A 3NCFB 3NABH 5E8EB 4TUOB 4EN3D 5F89B 3MOAH 4CADA 2YUXA 5FHBL 4DGIL 1CLYH 1G6RB 3N9GH 1IAIH 1A6VL 1UWEL 3S37L 3UBXA 4RGMB 1VGEL 1Y6MR 4ZD3L 2A73A 3O3BB 1KB5B 1WK0A 2ICCA 4GMSH 3MGTB 2DTSA 1A1NA 3BSZH 4E5XA 1RZIA 2HT4D 3AFLA 5A16B 1ORSB 1ZS8A 3JWOL 4ZS7L 4W4OA 4A6YL 1AR2A 2CLVA 1FG9C 2Q6WB 3MYZA 3LMJL 3D39E 1T6VN 3TPKA 5JA8B 5E8NB 3P2TA 4Y5XA 2YA0A 3N1PC 1MLBA 1DLFH 3PHOB 1MIEH 3H3BC 3MZTA 3CPLB 4XP1L 1DQJB 3O3AA 5FM5O 1Q1JL 1D5IH 4KK5D 4Y19D 2O26U 3VFMB 3RIFK 2A6KB 3QAZC 1GC1H 4QRPD 3SKMA 2FJFA 2V9QA 4HS3B 2ESVD 3G5XB 5I66B 4AEIL 4KI5E 3MCG1 1UM4L 2XWTA 3MRKB 1BM3H 4IIQA 1R3LB 2I60H 3OR6B 4PR5A 2XN9D 3SDAD 3VGAB 1A4JA 4C83A 2F54A 1FVCA 4EDWL 3GBLA 4HQQL 5DTFA 1DP0A 1HYSD 1YJDL 1KCKA 3B9KB 2YC1A 5L0QB 4UIKH 3ZKXB 3EO1A 4PRNB 3AB0C 3NPZB 3O41A 5FB8B 1ZT1A 1SVZA 4KRPC 1GSMA 5ETUB 4HK0B 1DE4A 5D2LA 5TDNB 1DCLA 3HMWH 5F44A 2NPLX 4NJAH 1T1XB 2P8PA 4J3SA 1BECA 3B3IA 4JG0H 4Y1AD 1Y6NR 1AXSA 5GS2H 1LP9F 1A1OA 1MFDH 1F13A 4PJ9A 1INDL 1K8DB 5KS9B 4Z5RA 1AJ7L 4I0PA 4MNGA 1EV2E 3GJFB 4GAFB 4U6TA 3GO1H 3VRJB 2QR0B 1MLCA 1S3KH 2ZJSH 1I3GH 3TCLB 3FB8B 2B4CC 1A5FH 1FO0L 4JQIL 5T1KD 3UXFA 2QHRH 3DUSA 3TN0A 2ATKA 5DMYA 3A0OA 4IRSB 3G6JB 3ROOA 4CDGC 1DBKH 4LHUA 4UBDD 2CJUL 2D0GA 5CMAA 5GSVB 3MRRA 4NWTL 1IGYA 1F6LL 2JJVA 1NANI 4PJ8D 1X5YA 4GKSA 5FOBB 3SGEH 4S1QH 5CJ5A 4RGMC 4PB0L 1JE6A 4AL8L 1YMHB 5EBMB 3BZFB 1WVZA 5B39A 4FFYH 4KQ3H 1CK0H 3LRGA 4GKZA 2GJ6B 1PAMA 4F37K 5LQBL 1EEZB 3H3PL 2PTVA 4PP2B 4LSTL 4S1RH 1G9EA 1YC7A 4X4MA 4JLRA 1IILE 4WUUE 4N1EA 2H6PB 2FGZA 4YPGA 5IB1A 5FA4B 5C0JA 3DTXB 3C5JB 1U8MA 4LSQH 5JPNB 1VEOA 5CP3H 1FRGL 1I7TB 2APWA 1IBGL 4DUVA 3LH2L 2CLRA 2H3NB 2L4OA 2DI8A 2X6MA 1WGOA 5DQJB 4YQXL 1B0GB 1U8NB 3VFUA 3MRNB 4Z7OF 2EO1A 2ICWA 4X9BA 3SKJH 4NN6B 1Q0YH 2OJZL 4LVEA 3O6FB 1HKLH 3IFLL 3HAEG 1ZT7B 1M7IA 4PREA 1FGNH 3IJSB 4LP5A 5J57B 1R0AL 1UWXH 4OB5L 4X8XA 4XPFH 3FZUD 5DRXA 2UZYB 4MNQA 4ALAL 3SDXA 4JM2D 3W11D 2VXSH 4JE4B 3FQXB 3FO2A 1BFOA 3KPRD 3QIBA 2XWBB 1R3HB 1IKFH 3GGWA 5F7DA 2VXTL 2HT3C 5IVZA 1YN6B 3VGAC 4I3RL 4WUUB 2NLJB 4Y4HD 5JZ7D 2VIRB 1VFBB 3I2CL 5JQ6L 4HKBA 1FFOA 1XF4B 4HUNB 3B9KC 5L0QC 1MCBA 3ZKXC 3FONB 5JHDE 3GMMB 1GCFA 2IG2L 3P0GB 1G9NC 4NPYA 4RMRA 5A40E 4I48B 4XCFH 3T0VA 1A7OH 2E3VA 1RZGA 1ZHKB 4JDTL 3BP6B 4ZPVB 3REVA 1KG0A 1Q9OB 4NO0D 3D1MC 4QHMA 4ZUWB 2EH7L 2R15A 5IJKC 1JFQL 4JZOA 5H2BA 2XACC 4JM2F 2CUHA 1U8PA 1F90H 3KPMB 1UWGL 1SJHA 2AVGA 3NFPA 4JGMA 1JNJA 5SWZA 4JFXA 1Y6KR 4KI5C 3NIGF 5C0AD 4KHXL 3UC0H 2IAND 2AAVA 5CJBA 5D9SA 5LWYL 5F9AC 1LO5B 2PF6A 3M17A 3G5VA 4D9LL 1A3LL 2I07B 3QNXA 1BFVH 4IRSC 2F9BT 2BXYA 4XAWL 5JHDB 1JF5A 1OTUC 1NBVH 3JTSB 3SDCA 1OQOA 4EUPG 4J3UA 2V7NA 5CSZB 4PGZA 4P5TD 5D7LA 1NC2B 4XNXL 1Z9SA 5C09D 1HCVA 2YR3A 3GMQB 1U9KA 1FNEA 2H1PH 4TUKL 5I74B 1M71A 2VLKA 3KPPB 4YZFE 2NY7L 5EIIB 4IRJB 3QDAA 2CRMA 4G8FB 4Q97A 2Y07H 3RVTC 4U6YA 5JDJA 1MI5A 5GGVY 4UMGA 1VSCA 4JRXA 3TWCL 4LLQA 3IJHA 1T1WA 4M6NH 1KIQA 2B8OT 1EEYB 3QWOB 3MGOB 1E4XI 2DQCL 3WL9B 3S5LB 3Q0HA 3TBSB 3Q5OA 2EIBA 5SWSB 3ARDB 4R96B 4PRPD 4NN6C 1OTSC 3O6FC 1E4JA 4OCMC 5C9JA 1ND0A 2ZUVA 4P23B 1LEIA 4MNHB 4X99A 2IQAB 4Y5VA 3IAGC 4LARL 2RJMA 5C0GB 2YPKA 1CR9L 2VQ1B 3EYSH 2ATPA 4MZ2A 2BNQA 4AYFA 1RURL 4BZYA 3DVGA 2C1PB 4XVSL 4AMKH 3L3KA 3S37X 3T0WA 3GSNH 4IOFD 4OD3L 1FAKT 3IU4L 1G7QA 2R1WB 1DSFL 2JIXD 4P59L 2HJKA 1N59B 2IFFH 2X1OA 3GSUB 5LXGH 3FO0L 1CT8B 1FO0A 3TJEL 2ADIB 4DVBB 4ZXBA 5L2JA 5L8LB 2QSVA 2Z31A 4XBGA 3NPSB 4OLYL 1I9RL 4RX4D 1TTFA 3OTTA 3VRLF 1T0NA 1YEKL 4UILL 2HFFA 2P49B 3ULVL 1CD1B 4KRMB 3RL2A 1PSKL 5LAXA 3AMLA 2JJUA 5J06A 2AJUH 1J8HA 4OQ1A 5J6HB 15C8L 1KTKE 1YY8B 2CIKA 2VB5A 1FNGA 3GJEA 5K9JH 5IKCB 2Q86A 3TESA 2P5WE 4HXAL 4RMVA 3LKPA 1CFTA 4RFNB 3PGCB 4GSDL 2BFVH 5DK0A 1L4IA 4PY8J 3KDMA 1QEWB 1YEFL 3S3SA 3UTTA 1INEH 2V6HA 3BE1L 1WBXA 2EIDA 3KYAA 1XZ0B 4HIXL 4NFDA 2NW2A 4C59B 3EDJA 1IC5H 4L4VA 4AH2A 1A02N 3MUY1 1KYOJ 1MHEB 2SEBA 4M7KH 3UZEA 3QO0B 4X80L 1NL0L 2D7OA 5DWUH 4AK1A 2PW1B 3IS0X 1IQDA 2BVEA 2CKBA 4LQFH 2EZ0C 3O0RH 4OCXL 4ETQB 4MJ5B 5IUSA 4DKFL 5I74C 5KTEH 4CN1A 4IRJC 3JBG7 4K3DH 2XZAH 3MRDB 4MYWB 3ALWA 5EOTA 3DRTB 5MENE 1OY3B 2P5WB 1MRFL 4HHAA 1UB5B 3ZTNH 4ERSL 2CO7B 2OR7A 4EIZC 5IJVA 3GSOA 3WXVL 1KTDB 1OGAA 4M7JH 4UOW0 5HDBE 2RGSA 1SJXA 2XZCL 4K94C 5CEZL 1FFPB 1IQWH 3WSQL 3ARDC 1NEZA 4JKMA 3KGRA 5EC1A 3O2WL 5ISZA 4X6DF 5CJXA 1HQ4A 4XC3H 4GMTL 2B1HL 1GGYA 4JAMA 2HJLB 1PDKA 4P23C 3ZE1F 2IPTL 1HINL 2HN7B 4J3WA 4WFGE 3VXOB 1F58H 3VXRE 3EOAA 2RFXB 4PJHA 2AABL 3KPLB 3QWQB 4FXGB 4OM1L 4X6EA 5IBTL 5T3ZH 1WIUA 4Y4FA 3VXNA 4JN2A 3FQUB 4OLZH 4ONFH 1P4LB 1Z9OA 4JFYB 1BBJA 4YE4H 3C8KB 5EPMB 1JZ4A 2VISA 3HZKA 1XR9B 1E6JL 1RUPL 4NNXA 1T5WA 3MXWH 1HHHA 1AO7D 3MRGB 5JR1L 5FKAB 2HKHL 4Y16B 5LGHH 4Y4KB 4PY8I 2PXYB 2X4QB 4PRDA 1B4JH 1S7SB 4WY7H 3AC0A 4G9FA 5GGTL 3DROB 4H20L 4ZTOH 1GGBL 5BS0E 1TCRA 1D5ZB 1F2QA 4M61B 4Y7MA 1N6QH 3QT2A 1MCNA 1F11B 3WO4B 5GGQH 1A7NH 2VABA 1OWRM 2CUMA 1JGVL 2VLLB 5GISH 5DR5L 2Z4QB 4WW2C 4PGJA 2NZ9D 4WIQA 3VXPA 1XF1A 2AJSH 3RWFA 2AJZA 2DQUH 3L6FA 3S3PA 3BT2L 3QIUD 3W0WD 4OV5B 4GAYB 4FFWC 3BGMA 2DQJH 1MFCH 4F7MA 4NRYA 4Z7WE 2GTZA 2IPKA 4WFFE 1PQZB 5C3TA 3DRQB 3C6LB 5HSFA 5ESAA 3S34L 1T4KA 4KRPD 2ADJB 5IGXL 2CLZA 5AG9A 1WJ3A 4YHOL 2UUDK 2OI9B 2PNDA 3B8YA 1JN6A 3JV6B 5BS0B 5FYJU 2DL2A 1FFNB 3WS6C 2QLVB 1HDMB 4CVWA 1Q9LB 5C0BA 1ZHNB 1VACB 3U0WL 1UFUA 4R2GB 4FQ2H 5K9KB 4UTAL 4QHNA 3BX7C 2AJVH 1CVSC 1MRDL 2VH5H 1KJMB 5DJAB 4LASH 2CDGB 1G9MH 1NBYB 4P3CL 5BVPL 1YYLH 1FNFA 3HI6H 3NIFE 4AEFA 4H0IA 2ADGA 5LGJB 3MV9D 2FR4A 3TPUB 1NCCH 4Z7WB 2X4RB 4CMMB 3HR6A 3BRDA 2F74B 2NY6B 1LP9A 1RZ7H 4O2FB 2ESVA 1SEQL 3ZDZE 5AYQA 4K2UH 2KQMA 3DHMA 5E4EB 3WFBH 4XRCA 3QDJB 1FZKA 1T22B 2XN9A 3MJ6A 3CC5B 3IDJA 2ED9A 2FH6A 4GRWF 5IK3B 3D48R 3OJDA 4NT6A 3TBYA 5D71L 3R1GH 4X7EC 5JO5A 5EOQH 3FQTB 2WIIA 4LPTA 1NAKH 2Z93A 4XP4L 5CCKL 4ZFOL 3QG7H 2FGWL 4LHUG 3MRMA 5IF0A 4TRPL 2Q87A 3IT8D 4Y1AA 5F97E 3LQMA 5B4MC 4Y16C 4OCLC 3M8OH 5EO0B 4U6VL 4Y4KC 2BSSB 4AQOA 1GRWA 5C0DB 3UPRB 1CIUA 3U0TA 4F57L 5DJ0B 4ZS6C 1IL1B 5JXEC 4D0DB 3DI2B 4F9LC 4GW4A 5AZ2H 2F8XC 3WO4C 2FIKB 4JB9H 1GAFH 1IFHL 5HGHA 3WJJC 2MTPA 1OCWL 1L6ZA 1KJ2B 3DVIA 3LHPL 4ODSH 4UNUA 3D18A 3O2DL 5TDOA 2DD8H 2F19H 2R0KL 3LPWA 3MREB 1CZ8H 4W68A 2VDOH 1V7MH 4X5WA 4LRIC 2HT3D 3UTOA 2DWEB 5E7FA 4JZNB 4J1UA 1ZVSA 1FGVL 3EUUA 4PJ8A 1U3YA 1HHGB 1W72L 3B8SA 3T1FA 4XVUC 3WFZA 4XWGH 2GITB 2IQ9H 5DDHB 1A6AB 4G8GB 3QEHA 3C6LC 4RMWA 3EGSB 3MO1B 2WBJC 4Y2DC 3C60B 4JFPB 5H94B 2GW5A 1OAQL 3K7UA 2NY5L 4Q6IB 3EOBB 2NX5E 2OI9C 2AW2A 1MCQA 1NAMB 1F6FB 4S1SL 1L0XA 1CICA 1F4AA 2QADB 1DEEA 3CX5K 4WEBH 3GHBL 2E6JA 3OBAA 3HZYA 5E9DE 3V5DA 4R2GC 3HMXA 2HTKC 3OXRA 2VC2H 2FJHA 1IAMA 1FZJA 5DI8A 2P8MA 4KI5D 4XPBL 4XXDB 5EU5A 1CXIA 1UB6A 1A3RH 4OLEA 2BCKA 2JK5A 4LSVL 1RK1B 1XGPB 1TJGL 4HUKB 2Y5TA 3ULUE 1KPUA 3BEWB 3HZMA 3QEGH 3MRJA 4IRSD 4OJFL 1XGRA 4PJCB 5TQ2H 2J4WH 4MX7B 4QHLA 1JZ8A 4JM2A 2NY6C 3T4YB 1OTUD 4HS6B 4U1JB 5E4EC 3OB0K 4F3FB 3ARGB 3IF1B 5DEFB 5FKPA 3HPJB 3WFDL 3WIIH 9CGTA 4O02L 1RJZA 5FO7B 5DRWB 5KSBE 2EDLA 4Y4HA 3MUHL 4LSUL 5IVXE 5E6IA 2X4NA 4GUPB 5FO9A 1X4YA 1KBGL 5TQ0H 3PXJA 5E9DB 5KS9F 2GJ6D 3CJJA 3INUL 1PFCA 3RVTD 4KI5F 3TGXA 1L0QA 2X2YA 2QQLH 3DMMC 4XVTH 1WFNA 4WRLA 4KMLB 5DD5L 4QT5B 5D7SL 4E41E 1QFWL 4NO0A 5DMJB 3BP7A 1MIMH 4NGHL 4XTRC 1FYHB 1DQML 2VERN 3IFOB 3GHEH 3VGGA 3G6JF 3ZZ1A 3F5WA 3CVHB 3OGOE 4LSSL 2FWOA 3FT4A 3NFSL 2ICEA 3GKZA 4PIRF 4G7YL 1CXEA 5F8RC 4N0FA 4ZG1A 3FQNA 4JVPA 1OTSD 3DX9B 3O6FD 4L3EA 3CXDL 3HN3A 4FABL 2IANA 4XH2A 1TJHL 4ONHB 2XICA 3PDOB 5ECJE 4YX2L 2GCYB 2ED8A 4PV8B 5IWLC 4LPCA 5KSBB 3Q1SL 1CL7I 1E6OH 4D3CL 2NY3B 2QQKL 5AYUL 2PYFA 3PV6A 2YBRB 4XPGH 4NQVB 1CE1H 2BHYA 3RVWC 1WISA 4JKPL 4ZFFA 5FUOH 4PRIB 1NCBH 4PJXE 4CKVX 4WUUD 2VITA 3KPNA 3BWAB 2G75B 4JKKA 2IWGA 5CWSA 3MLTB 2PCPA 2EDQA 4NQXB 3TJHC 5C2BL 4GLRH 5JIIA 5EC2A 4GG8A 5E5MB 5IW1A 4K9EL 1NJ9B 1I7RA 1LE5B 4NQCD 2DJ4A 2K7PA 1AH1A 5CSGA 2W9EL 1U8OB 3C60C 1Y0LB 1ZE3C 3E6HB 1H3UA 4HWZB 2UYLA 1U8JB 1SHMA 1KCVL 2X7LA 2X4UB 3J7HA 4UNVA 5FECA 3MLYH 4QF1A 5AEAA 1XF5A 4ZO7A 2DYPB 3T4AB 1MH5B 2W60B 2QADC 1PYWB 2AGJH 1HEZA 3BDYL 3E1F1 3B5HA 3GMLA 3BXNB 4H26B 5HY9B 5BV7C 4ISVB 1CFSA 3WFEH 5E2TL 5C07E 1R3IL 5ID1A 1MFAH 1QLRA 4PRPA 3QUZB 4OIBA 2EKSA 4G6KL 1L9MA 1EUTA 2HA1A 4ZTPL 2XT1B 3KPQB 4HV8B 1N6VA 1HQRA 1QRNE 3SJVB 4P99A 2C7UB 1T89A 1KTLB 4ODTH 2YHGA 5ICXA 4ZFOA 4FXKA 3QXAA 1NFKA 1NCTA 1N4XL 1WBYB 3CFCL 4HWEL 5A2JH 2A6DA 2F58L 3KPSA 3WKMH 3MRQA 5AZEL 3ARGC 4TTDC 4NSKB 4XPAL 3P4MB 2BVPB 1OSPL 3WFHA 1NC2D 2PETA 3I6KA 4G8EB 5GRXG 2EZ0D 3G04B 1S9VA 3KYMA 4K7PL 4LBEB 2B2XL 3BW9A 4M5ZH 1IAIM 2FX8H 2I5YL 5D70H 3IXAB 3W9EB 3BWUC 2EICA 3DBXB 2DQEL 5TJWK 5EUKB 5M7QA 1JYWA 2B5IB 4LCYA 1CLYL 5SV4A 2CXGA 3N9GL 1WITA 4XGZA 4OZHB 4MJ6B 4RX4A 3SKNA 1OD9A 1YUHB 4PY7A 4N8PA 5ALCH 4EXPX 5INCA 3PV7A 1QRNB 3HTLX 3VG0H 5DRNB 4GMSL 4JFFE 5CD3B 1D6VL 3F7YA 5E03A 5SWSD 3BSZL 4D9QD 3ARDD 1VESA 3DURA 32C2B 4OZFB 2AKRA 2WK2A 2OL3H 3DPBA 1Z3GL 4NC1E 1OW0A 4P23D 1AC0A 4QYOB 2EDDA 2W9DH 3VE0B 1K4CA 3HRZB 5F21B 2NY3C 1I3UA 2R0ZH 4I5BB 1U8QB 1KCSH 5H37H 3THMH 1UM6H 1N64H 4HF5L 3U36B 1CDCA 4Z0BL 2GJZA 1D5IL 3DV4A 3UJTL 8FABA 2DLHA 5FYJH 5HHOA 2ZNWA 1RK0A 1ES0B 4X6DA 1RZ8B 5B8CA 3CZFA 2HH0H 4X9IA 4YWGL 4RIRB 4YGVB 5IMLB 1C5BH 1UXWA 3ZL4H 1JIBA 1J86A 3FO1A 2MKLC 3V6ZA 5L9DH 2YXMA 1O7SA 5LVEA 2I60L 1XGYH 4NP4H 4JFFB 5ID0B 1U8HA 3V4PH 4DKDC 2DKSA 3OGCA 4BFBD 3ZTJH 4P5MB 3BIKB 4KPHH 5MEOA 7CGTA 1FDLH 3SHSA 4ZPTB 4L4TE 4UIKL 3MFGB 4AENA 2YK1H 2X70A 4EOWH 1D5BA 1OAKH 5DFWH 4P2OB 1C16A 2BNUA 3DYPA 3QJFB 1CWVA 1RD6A 3EOYG 3GB7B 1T03H 1F4WL 2PR4H 4MD5B 3RWIB 1MCWM 4PJEE 3T77A 3CCHB 3VFSB 4JPWL 1HXYB 4PYHA 5E8PA 1ZGLA 3CX2A 4ZO6A 2DS4A 5D6CA 1MFDL 5MP6H 3TV3L 3DUUB 1ZGLP 4YO0A 3SBWC 1MJJB 2J6EH 1X44A 2JKXA 3G5ZA 5KN5A 3BN9D 3D2UB 3MRLA 1QLFB 3GO1L 1CS6A 4ZOAA 1CF8L 1BD2A 5A43C 1WICA 4PV9B 4PTUB 5SWQB 3S36H 1A5FL 2QHRL 4AG4H 2DWDB 4OCYH 3BP5B 3U30B 1FVEB 3RNKB 4XNZB 2DB8A 2BNRE 3QCTH 1CDUA 1AO7A 4ORGB 3OKLB 4HUUA 2A83B 2H32A 3MLXL 2B5IC 4LPVA 1WCBB 1RUKH 4L8DA 1NQBA 5C92A 4TVPE 1F4XH 3PWJB 5I2IB 3ARRA 4S1QL 3P73A 4PJEB 4IMKC 1DUYB 3BKMH 3QQ4A 3ILPB 4P3DB 4FFYL 1JPFA 3TO2A 2EYRB 5CIPB 5IQ9A 3X12B 3VU2A 1WIPA 4KKBC 3MLUH 1QSEA 4NQEB 4RDQF 4R4BA 3V2AR 3MLSL 1P53A 3RWCA 1LO2H 2FL5A 1QPXA 4N8CL 4HW6A 3UYOD 4D94A 4Q9QL 3U7AA 5EO1B 2X4TA 4B53A 3W0WA 1BVKB 4DZBA 4M6AA 3BAEH 2EDFA 4HDIB 4P46B 4MQTB 2ZG3A 2CK2A 1VPOH 1WZ1H 3SKJL 2Z35B 5JORB 4IOIA 1FGNL 4TVPH 2C1OA 3PWPA 3IGAA 1NFIA 4XPFL 2FZ3B 4CN4A 2A74A 3R06A 4AIOA 4HXBL 3PJSA 5DD0L 1U95A 2HRPH 4O9HH 1LEKB 3N06B 1DVFB 1MAJA 3B9DA 5B4MD 4Y16D 3T0EE 5D1ZB 2AXFA 3PP3H 4NFCA 4Y4KD 3N1GC 1DQLH 4PD4K 4ZS6D 5JXED 3MRHB 2FX7H 3O45B 1T0PB 2JB6B 3U6RA 4NC1C 5T3XD 3VFVA 5I1EL 4QRRA 3O9WC 5KVFH 4OV6F 4P2OC 1Q0XH 1AGBA 2APBA 2YMXL 1NBQA 4ESKA 3V4VH 1KELH 3HB3D 4DTGH 2HLAB 4XNMA 1ZHLB 3HAEB 2QQNH 4P5KB 5E8EA 4TUOA 3UJJH 3KJ6L 5F89A 4HWUA 1S9YB 2EIZB 3WNLA 4MCYA 1G6RA 4U7KA 3GIZH 5GS1B 1BGXH 5HDBF 3X3FL 3MFFB 4M1GL 3C6LD 1EEQA 2WBJD 5SX5K 4Y2DD 3O3BA 3UC0L 4TSAL 1KB5A 3T0EB 1FCCA 2F8OA 4Q2ZB 3HNVH 4JDVB 3MGTA 1QBLH 5SX4I 5I1HH 1BFVL 4U1SA 3K3QA 3VG9B 4GW5B 1ORSA 3U30C 1RZKL 4L9LB 4XNZC 5IFAH 1S8DB 1J10A 4R2GD 2HTKD 2Q6WA 1WBZB 3IXTA 4W6XB 1NBVL 2CXKA 5HVFB 5E8NA 3U48A 3HKFA 5FCUH 5CD5D 4AJ0A 1K3IA 4UI2A 3PHOA 1I9JL 1DQJA 3L5JA 3C8DA 4TULH 1MAMH 4G6FB 2H1PL 3VFMA 2A6KA 1UCBH 4FQCH 4IHOB 4ZUSB 5I1LB 2Y07L 2N1KA 4P57B 3TIEB 4R90L 5CBAB 4FQHB 2LAAA 5I8EB 2J1KA 2VUYA 3MRKA 2VDNH 3FN0L 5D1XB 1R3LA 4M6NL 3QDJD 3OR6A 5LJYH 3Q2CA 3UYRL 1T7ZA 1F42A 1GC1C 1RVFL 5DQ9B 3B9KA 4P46C 4ENEC 3FFCD 5M95B 3WCYA 4JO1H 4EUPB 4YDIH 1EFQA 4L8BB 1A8JH 2AK4E 5FB8A 3DMMD 1INQA 1UJTA 3PWNB 3P0VL 4K7PX 4ZMAT 2CR6A 4BUGA 1I7ZB 1AGFB 3QPXH 5ETUA 4UT6H 5E70A 2O93L 4HK0A 4XHQA 1JZ5A 4Z18A 5TDNA 2E7BA 3QQNA 4B0MM 3U4BH 3VA6A 4XTRD 1T1XA 4QHKI 2KDGA 5J6GB 2XY2A 5IJKA 4HUWB 4F9PC 4BZ2L 1DVFC 4Z7WF 5E24E 2DLGA 3UTSB 4PLOB 1E0OB 2VLJE 1ETZB 5D1ZC 2W0KA 5KS9A 1OAZH 3GJFA 4FQPA 4WV1B 3VRJA 2QR0A 2YSSB 1UT9A 3TCLA 4X83A 5TE6L 2IFFL 2FBOJ 5MEPB 5LXGL 3SQOH 3CFKA 4B7LA 3G6JA 3G6AB 5B22A 4QXUH 1DBAH 3K81A 3QDHA 2O61A 3DXAE 5DZLA 3RVWD 4HJGB 5GSVA 1MOEA 4K07A 4BSWB 1YNKH 2I26N 1LQSR 1VFOA 3SN6N 4M03A 5EU4B 5FOBA 1S7UB 1I1FB 5GS1C 4U3XA 4O2CA 3NIFF 3TJHD 3VXSB 4JO3L 1YMHA 4G8GD 5F7YC 4RMSA 4UTBL 2G60L 1RJYB 2ADFH 4CJ0A 3TT1H 4TSCL 2D7TH 2GJ6A 2OXHA 3C60D 3ZDZF 3T0EC 3EO0A 4O58H 5E8DH 1R3KB 4PP2A 5HHXH 2D4FA 4QHUB 5BZWB 4XNQB 1L7TL 5J3HC 2KKQA 1XT5A 5DHVH 2H6PA 3WFCH 2RCSH 3VG9C 3KJ4C 2QADD 3QEQE 3FL7A 3HC3H 3IS1X 3GJFK 4JDZB 5FA4A 3DTXA 3C5JA 4L9LC 1T04B 4J8RB 5JPNA 4F7PB 1I7TA 3DX6B 4WI9A 2H3NA 3EOTH 4MXVE 3HI5L 1B0GA 1CDIA 1I85C 5DWUL 3MRNA 3O6FA 2R0LH 4LQFL 1EGJA 5TF0A 3L5IA 3O0RL 2J3SA 1ZT7A 3K74B 1FZOA 3RWJB 1E27B 3IJSA 5L6YH 3CNKA 4MAUH 1ZANH 3QDGE 4ONGH 5C71A 3FHAA 1CFNB 1M7DB 3OKMB 3MLRH 2XZAL 2ORBH 3FQXA 3F7QA 3U7WH 1F45A 3ZTNL 2XWBA 4TTDD 5D1XC 2X9XA 4WO4B 5J13B 2FEEI 2VL5A 1C5CH 4M7JL 1WWAX 2DBLH 2R1XB 3L3GA 2NLJA 4WUUA 3LSOB 2AEQH 4WI6A 3QEQB 1U93B 1F6AB 4M43H 2AV7B 3U2SB 4PJDE 1XAUA 3FONA 3GMMA 1VHPA 3QUXB 1X5KA 4U1KB 1WWCA 3E8UH 1ZHKA 3DX8A 3GSNB 5DJXB 1G84A 4WU7B 3MJ8B 4ZPVA 1G6VK 1WFTA 1Q9OA 2E27H 1MCPL 3IDXH 4WI4A 3BKYH 4ZUWA 1F58L 2AI0L 4M6OH 4PJCF 1HHJB 1QA9B 1ZLWK 1J9CT 3U79A 4QTIH 4G43B 5T3ZL 4MA7H 4OLZL 4XP5L 1IARB 1TQBC 1RJLB 4WV1C 4F7TB 2JTDA 1LO5A 4DK3A 3T08A 4M3JA 4ODHH 4L3CA 3TVMB 3MXWL 3BZEB 5CUSL 2WUBL 5LGHL 2NY3D 5E2UL 3MOBH 1S5IH 3BIBX 1B4JL 2DQTH 4PJDB 1TTGA 4EKXA 4WY7L 5JHDA 5I73B 1F4YH 4ZTOL 3K2MC 1N6QL 3JTSA 5DJZB 1EHNA 4PRID 2B1AL 5CSZA 3WXWL 4MDJB 1NC2A 1A7NL 1LK3H 3ULUF 3ZDXE 1X6NA 3GMQA 4V1DB 5DJDB 5GISL 2YZ8A 1JYVA 2J8OA 4MXWH 4FQLH 3V7MA 5EIIA 4IRJA 2E6QA 2DQUL 4G8FA 4WEMB 1LO4H 4ZNCD 3EDDA 1JI2A 2F5AH 3TA3D 4GKNB 5IM7B 3I85A 1T3FB 2DYPD 1EEYA 3LIZH 3QWOA 3MGOA 4NRXB 5E1AB 1PD6A 5KSBF 1I1AB 4BKLB 4U1NB 1K8IB 4KUCD 2X4SB 3HE7A 2V5MA 3TBSA 3PQYE 4JJ5B 3LKRB 1JF1B 3ARDA 4R96A 2BJMH 3LZFH 5FYLE 5IT2H 3WO3B 5E95B 3D69B 1JRHH 1Z2KA 4M5YL 3V8CA 1D5MB 2FHBA 4IJ3B 1OGTB 3SJVD 4P23A 4MNHA 3TBVA 2F54E 4JFDE 2IQAA 5JIHA 2BSRB 2DKUA 2AJVL 5C0GA 3D3VE 5KOVC 2VH5L 2QSCH 2OJEB 2VQ1A 2XYCA 5FM5M 1JZ2A 5IBUG 1VA9A 4KVCL 4KZDL 3L7FB 2C1PA 3U46B 5HI5C 2VRAA 5J13C 1GL4B 2AXGB 1JGLH 4TUJB 4EI6B 1NCCL 2R1WA 1QLEL 5HI4C 1R3JB 4ZNEA 3GSUA 4KUCF 3QUXC 3S3JA 1CT8A 4N8VA 2ADIA 3N1MC 3PQYB 4DVBA 2DQGH 1OSZB 3TF7C 5DEGB 4V2CB 4LGPB 3BISA 2E7LC 1JZ7A 1U92B 1LO3H 4PJXF 5HDQH 3QHFH 3KPOB 4DAGH 5DUMH 2A9NH 4DGVL 4CW1B 3K4ZA 4KKBD 3WKNA 3K8KA 5EBLB 4YHYB 3D3VB 3DX7B 5J6HA 2AEWA 3VJ6B 1ZT4A 1RZJH 1L9NA 2FB4L 1YQ2A 3OMZA 4U05A 2NQCA 3O11B 1K6QL 5F1NB 3WIHL 5I1IH 4W81A 4QRSB 3TVMC 1BOGB 1P84K 1CU4L 1O5DT 1UKQA 1XZ0A 2EIEA 2D9CA 4GRLA 1XIWB 2BSTB 1ZA3B 3SO5A 3JSSA 2VAAA 3ME0A 4J4PC 5I73C 1MHEA 3P9LB 3QO0A 4LAQL 3KS0H 2PW1A 3WE6A 2I9TB 4PJIB 3TH2T 1QG3A 3WS6A 2DD8L 2F19L 1DFBL 4NQDE 4UOJA 4ETQA 3PIQB 4JVWA 4WHCA 4OIIH 3NN8B 5I15H 1V7ML 4HPOH 1FL5B 1T2QL 2D7QA 2VZ1A 3MRDA 2FX9L 3DRTA 4AT6B 2P5WA 1UB5A 4KVNH 4XWGL 2MOVA 2FATH 2IQ9L 1I3VA 1CGTA 3HE6D 3JWDL 3O9WD 3IKCB 1I1AC 1KTDA 1XFPA 3H42H 1TCMA 2O5XL 4MNQE 2DLFH 1BZQK 3SDXE 1GIGH 3UCRA 2V2TA 3QO1A 3MJ9A 4YHLH 3ZYIA 3MV01 3VWJB 5D72H 4WEBL 4IJ3C 4G42B 4UU9B 1Q9KB 1AKJB 2Z8SA 3MLZL 2VDKL 4M4RA 1SBSL 2HN7A 4K8RH 4QGYA 3BH9B 3VXOA 4ETYA 3PWLB 1LMKA 1S7WB 4U3CA 2A77L 1CGXA 2RFXA 2EYSB 1YEJL 1CLCA 2ARJB 3KPLA 3IFNH 4FXGA 5MENA 4YDKH 2XPGB 5BVJB 1IGFL 3C2SA 3JTTB 3FQUA 3O3EB 1GZQB 1NGQL 2W92A 4JFOA 1P4LA 3ORJA 5TQ2L 4G7VH 1BQUA 4JFYA 5EPMA 5HHNA 5L8KB 1XR9A 4OFKA 4IBLT 3X3GH 3MRGA 4LF3B 2R29H 2M1KA 4Y16A 1D9KB 2WAHA 4Y4KA 2PXYA 2X4QA 2WBKA 1S7SA 2YUZA 1MPAH 1EHAA 1B90A 1OL0A 5C3LD 3DROA 2FECL 4OCWH 5JXEA 2OS7A 1D5ZA 1YECH 4B41A 4F9LA 2ZSWB 1F11A 1TPXC 5HYQB 2ZSVB 5DXWA 3SEPA 3QRGH 5TQ0L 4BQCA 3WJJA 3MV8E 5KSVB 4M7ZC 4CVUA 3LRSB 1TNMA 4NQED 3WNOA 4YHYC 2QQLL 2Z4QA 4XVTL 5E08L 3VXRA 4QY8B 4NQTA 3VGFA 3WHXB 4LRIA 2EKJA 3ULUL 3EYFB 2Q3ZA 1T7WA 3U4EB 1U8KA 4OV5A 4GAYA 3CVHL 1NGWB 3GHEL 1VADB 5GS0H 4LMQI 4JRYE 1UH2A 2JJTC 4BZ1H 4P46D 4ENED 3DSNA 4LVNB 2DJSA 3DRQA 3C6LA 4LLMB 3RQ3A 4HIJB 4Q9RH 5FHBH 5E94B 4XNYH 1A6VH 1UWEH 2ADJA 3S37H 1G7HA 4N1CA 2DDQL 4MA8H 4W4NA 4X7TB 3ARFB 3KYKH 1ZLUH 4PJEF 3JV6A 5BS0A 5GZND 3DSFH 1WLHA 1FFNA 3QIWB 1HDMA 3WBDA 4KZEL 1Q9LA 1DVFD 1XH3B 1VACA 1ZHNA 5CGTA 3UP1A 4YBLB 3MV8B 4OBSA 1OT2A 1MJUL 5K9KA 3HCVB 1MY5A 3VD3A 4JY4B 2XV6B 3FN3A 1QR4A 1TZGL 3ECBB 4WHDA 1NCBL 1KJMA 3JWOH 5DJAA 4ZS7H 2CDGA 1NBYA 4NFBA 2X10A 1KV3A 3FCTB 5INDB 1N3NB 3WDHA 4NO5A 4N1HB 5FK9B 4JRYB 1CD8A 5LGJA 5GS2D 3VFRB 3B2VL 3TNNB 3TPUA 4MWFB 3B6SB 1SY6L 4Z7WA 2X4RA 5F7UA 2F74A 3GIVB 4KROD 4DWHA 2VDML 1Q1JH 3MLYL 4WW1B 3W9DB 2BNQE 2A9MH 5DA4A 4BK5A 1J05B 3VWJC 3GUTA 3FAXA 1T22A 4JJHA 5DEZA 3CC5A 4JFHE 2FHFA 3MSPA 1KXVC 1KACB 1A7QH 1C08B 2VOTA 1UM4H 5IK3A 1FH5H 3QHZL 1MFAL 3UTPD 5DS8B 4IEFB 3O4LE 4OT1H 3FQTA 4HQQH 4I13B 1LNUB 1YJDH 4WI3A 2WANA 4LFHD 3QP3A 4ODTL 4ZSOE 3LN4A 1AE6H 4JFEB 4TYUA 1GJIA 3WIHA 3WKML 2JCCB 3BI9X 3ZKSD 4QOKD 4EQ2A 4JANB 5EO0A 1D9KC 1X4ZA 2BSSA 5FCSH 1YMME 1J8HE 5C0DA 5F72S 3UPRA 4JGJA 5DJ0A 4H0GA 3VWKB 4D0DA 4G6FD 1HE7A 2FIKA 1N2RB 1KJ2A 1HN1A 5D70L 3UTTE 1EZVX 1KIPB 3P77B 1RUML 4NBXB 5D1XD 3QWRD 3O4LB 5AWNL 1FO0H 4JQIH 1F2XK 4JZNA 3LY6A 3S96B 4HSQA 4Y8AA 3IU3B 1HHGA 3VG0L 4ZSOB 1A9EB 1N5AB 2CJUH 4LVNC 5DDHA 1A6AA 4NWTH 5HVHB 3MRFA 4ONOA 5J4MA 3MO1A 3HC4H 1KN2L 5BOZG 3H9SD 3FRUA 1JPGA 2C3WA 2OL3L 4GAJH 4JG1H 3C60A 1HSBB 4JFPA 3EKCA 4P2QE 5H94A 2EDYA 1YMMB 4Q6IA 5C0CE 4PB0H 4S0TD 3C5ZD 3ARFC 4YFLI 4AL8H 3CFEA 5IR1B 2W9DL 5T5NG 1AD0B 4ELME 5HGGS 3QIWC 1AD9A 5ENWB 2W0PA 5LQBH 1QYGH 2P47B 3UTSD 4KDWA 1UM6L 4LSTH 1N64L 1L7IL 4YBLC 1OGAE 4MS8C 4YHIB 3L1OH 4N90D 3T0BA 4XXDA 3D6GA 1D3CA 4PLKC 2HH0L 3GSXB 1FRGH 2ZUWA 1RK1A 1XGPA 3BEWA 1RFDH 5L9DL 4YQXH 1I8KB 5DGRA 4PJCA 3ULSA 4KTDL 4NP4L 2CKBH 3HPLA 2YPLE 3LN5B 4MX7A 2OJZH 3FT3A 4NHUB 2XA3A 3CLFL 4HS6A 4U1JA 3H9YA 4P2QB 4F3FA 1FDLL 3ARGA 3IF1A 4OB5H 1Z5LB 1XCQB 5DEFA 4YXKL 1XCTA 4OCNC 3HPJA 5C0CB 4ALAH 4EOWL 2NX5A 1OAKL 1NGYB 5IIEB 5FO7A 3VXSD 3QCVL 3D9AH 3LD8B 4ELMB 2BVQB 1MHPH 3W81A 1QO3A 4GUPA 3P11L 1A9BB 2E7MA 3FRPA 1T03L 3SE4C 5E9DA 5FIEA 4I3RH 2PR4L 3EYVB 4K71B 3H7BB 3UYPA 1MJ7H 5JQ6H 3ZT7A 5BRZD 2NNAB 4QT5A 2Y06H 4LDOB 1MCKA 2FH8A 5CGMA 3ARSA 1DL7H 4OBRA 2C3VB 3CVHA 3EO9L 2YPLB 4F2MB 3MUZ1 4O4YL 1UACH 5HDOA 4CVXB 4AG4L 3ZYJA 2PYEB 3DX9A 35C8H 2EH7H 3CXHK 3PL6B 1XF3A 1JFQH 1Q8MA 1GHFH 1ZLSL 3RL1A 4RQQB 4ONHA 5EZJA 5EZLA 3VWKC 3PDOA 2GCYA 1UWGH 4PV8A 3QCTL 2MMXA 5KSBA 4LKXB 5I1CL 4KHXH 1NCDL 4GAGL 4LSPH 5LWYH 1A6WH 2V5YA 1RUKL 3OAYK 2HYMA 1F4XL 2UUDH 2WQ8A 5HI5D 2EDJA 1A3LH 2NCMA 1YEDB 5DT1L 3BKML 1BZ9B 2DQIH 3S5LG 4FHBD 1KLUB 3BWAA 4LLDA 2G75A 2WNGA 3QYCA 2I9LB 3MLTA 3GBNL 4FMFA 5HI4D 5HVHC 1UZ8B 1LE5A 5ICYB 3MA9L 5HGBB 1NBZB 3SCMB 1U8OA 5K93A 2HRLA 1Y0LA 3E6HA 1SY6A 4HWZA 5HYIA 2X4UA 2YS4A 3K46A 4I3GA 4TUKH 3BAEL 4WENB 4PBWD 3VD7A 1G7MB 3T4AA 2DYPA 2NY7H 2W60A 1V3KA 4FQXA 1MWAB 4EN3B 1WZ1L 1VEMA 4Y19E 3BXNA 4H26A 4KRLB 3E0GA 1MVFA 2DIBA 2YUWA 5HY9A 4NOFA 4ISVA 3BRGC 3VD9A 2H8PB 4QRPE 4TVPL 4MA3B 2IAMA 5I8CA 2OTUB 2CGRL 3QUZA 1DJSA 1Z9MA 5TDPB 4RWYL 4O9HL 1UA6L 1AI1L 4HV8A 3TVMD 4PJXA 1A1MA 3SJVA 1KTLA 5F7FA 1AFVL 5BMFL 5DVLA 2PKDA 2YOCA 4KRNA 2DAVA 5JW5B 1SYVB 1WBYA 4J4PD 4MXVF 2FX7L 4PJFE 2GFBB 3L5XL 5KVMC 4U2ZA 1EEUA 3P4MA 2BVPA 3VXMD 5IROC 3EZJB 3PE9A 3G04A 3O8XB 4V1DD 5C6PB 1EERB 5AUMB 3WNMA 3LD8C 3D85A 1A7PH 4LBEA 3MPCA 4DVRL 4DTGL 3AU1A 3H3KA 3R4DA 4M48L 4POYA 4Y19B 3IDUA 3V0VB 2P4AB 4OD3H 5HGAB 4QRPB 3DBXA 4Y1AE 1DDHB 5IB2B 1CGYA 3GIZL 5EBWA 3HA0A 5A1AA 4MJ6A 3RDTB 2B39A 3FO0H 4UIMA 1XGQB 1YUHA 1U6AH 3TJEH 1I1AD 1QRNA 1T1ZB 1ZMYA 5LCVH 3SDAB 4ZFGH 1AXIB 4PJDF 2NYYD 4OLYH 5JMOC 1I9RH 4ODUB 5CD3A 4UILH 4WTZA 3MRBB 3ABZA 4HKXB 1QBLL 1DBMH 32C2A 4OZFA 4PJFB 3PL6C 1IEBB 4K7FB 1DN0B 1M05B 2VDLH 4PGBB 1IAII 4QYOA 1IGCL 4ACPA 15C8H 4MVBC 2IJ0C 5HHPB 3VE0A 2X1XR 4HXAH 3HRZA 4Z95L 1U8QA 1GOFA 4GSDH 4KK9C 1YPZB 3U36A 3VXUB 1FC2D 3V0AC 1MAML 1UEMA 2P5EE 4J3VA 4HIXH 1XGUB 4L4JA 1ES0A 4PS4L 1RZ8A 5BJTB 1QFOA 4DQOL 5FGCE 3OV6A 3ES6B 4RIRA 4YGVA 5IMLA 4WUKL 3KYOB 1JYXA 1NL0H 2AQ1A 2D3VA 1X6LA 1AGDB 4X7FC 1I1RA 1M7XA 1N8ZB 3PQYD 3SCMC 4JFFA 5ID0A 5FYLD 4P4RB 5BW7A 4OCXH 5DJ2B 3BIKA 1BJ1H 3OWEA 4DKFH 4ZPTA 2R2CA 1RUAL 4JKWA 3ZDXF 5F7EL 4L29A 4EN3C 4P2OA 1KLGB 3QZWG 1MRFH 3OB0H 3QJFA 3QPXL 3PHSA 3GB7A 4I77L 5CZVL 5EDXA 4DUWA 5DURB 2EDTA 3WXVH 3EFFB 4MD5A 1MHHB 3B2UC 3U4BL 4X98B 4NKOB 1G7JB 3GKWL 3KPRE 2XZCH 1CDBA 5ESQB 3CCHA 4O2EB 3VFSA 2P5EB 3NIGE 1HXYA 1NDMB 3NIDF 5IESH 5GRZA 1B4RA 1ZTXL 1MJJA 2QV2A 2HP4A 1DBJL 3D2UA 4JHBA 3O2WH 1QLFA 1G7PB 3PHQB 1LO0H 4GMTH 4OF8A 2B1HH 1AQDB 3RY6C 1SVCP 3HMXH 2AJYH 3VH8G 3RNQB 2KBGA 4PV9A 4PTUA 4KV5F 3JZ7A 5SWQA 2IPTH 4WDIB 2JJSA 4LPXA 1JWSA 2DWDA 3SQOL 4P9HC 3BP5A 4MJIB 3O8XC 3BYYA 1DBAL 1FVEA 1JGDB 1HZHL 5F6HJ 3RNKA 2Z9TA 5KW9H 5JLZB 4QRTB 3K1KC 2CKNA 4DCQB 2EC8A 5IBTH 2JELL 4ORGA 3OKLA 2A83A 2YWYA 4Y0GA 1WCBA 5I19H 1H0DB 3H9ZA 2EECA 3PWJA 5EO9A 3PWVB 1E6JH 5ACLA 5I2IA 5JR1H 3RDTC 4PJEA 1DUYA 3FB7B 5C0AE 2HKHH 3ILPA 4P3DA 4RGNB 1A14L 2BOCB 2DMCA 2IANE 1ERNA 3SDAC 4JQVA 1FG2B 2D7TL 4XT1C 3IDIA 5CIPA 4E9LA 1QNZL 2MKWA 5EORL 4H20H 5GQBA 1HYSC 4NN7B 3F58L 3OHXA 3LPGA 3WFCL 2RCSL 4BQBA 2JF1A 3VWJD 1CXHA 2E7HA 4D0CB 4PJIF 5EO1A 1OAYL 1AKJD 3SGEI 1BVKA 3DV6B 3CU1A 3KXFB 4YGAB 3EOTL 4HDIA 1NC4D 1X5JA 2APTA 2VSCA 5C09E 2BNRA 1AGCB 3BT2H 1BVZA 1UJ3B 2Z35A 5JORA 2IBZX 4JHWL 4LNVA 4N5UA 5L6YL 4HMCA 4MAUL 1JK8A 1FV1B 4PJGE 3MLRL 1T2XA 2YA2A 3LV3B 3ARED 5C0AB 3S34H 1QACA 3U7WL 1DVFA 3VDBA 1YEGH 4WHTB 2X4PB 4QTHB 1D9KD 5EU7E 5D1ZA 3FT2B 3EYOB 1Z0NA 3FO9B 4IDLA 4IOSD 1C5CL 3SGKC 2P7TB 3V6OC 1GXEA 1R5WB 3MRHA 1TZHB 3O45A 2JB6A 3P4NB 2D7PA 4UBDC 4PRPE 3OKKB 4UTAH 4M43L 5D93B 4OD2B 2HMIC 1ORQB 4M02A 1J12A 4CNIB 3NTCL 4G80B 1MFBH 1NCUA 3NGBB 3R8QA 3E8UL 1CGUA 1MCWW 2HLAA 3HAEA 4XZUB 2Y6SC 5ITFB 5KG9A 5E1HB 2E27L 1S9YA 3BKJH 5C6WH 1FFRA 1HNFA 2EIZA 4M6OL 1REIA 4HGKC 5GS1A 5J9PB 3CDGA 3BQUB 5GGRA 2BVUA 2D7NA 3O3DB 1JWUB 3MFFA 4I9WD 1F3DH 3SGDH 3CH1B 1U58A 3BDBA 3T0EA 4GXVL 4W6WB 1UKSA 3GFUA 3WYRA 2XZQL 3ARFD 1KEGH 1MREL 1KUMA 4YNYB 1R24B 5FYKD 3WDIA 3HFML 5GGUB 3LKQB 5DC4B 1EO8H 1JI1A 3QIWD 1F8TL 2ITDB 4L9LA 2DQTL 1S8DA 2DTML 2Z8RA 2PO6C 2C4XA 4C55A 3MRIB 1F4YL 1WBZA 2V5TA 5BQ7B 2YRLA 5CCKH 4NYLB 2DI9A 1R5VB 4OTXL 1I85A 5C08D 2Z91B 2FGWH 3CUPB 4XBEL 1LK3L 2R69H 1I75A 3QR2A 2DM7A 5EB9A 3SDDB 5CEYB 5D5MB 1IAOB 4RGNC 5IHUL 2CK0L 4HUVB 4MXWL 3VXTB 4FQLL 1A6ZB 4IHOA 4CVZA 4ZUSA 5I1LA 3QNYB 43CAB 4F57H 1S7RA 1LO4L 3TIEA 5CBAA 4FQHA 4NN7C 3CAFA 2HFEA 2IH3B 4J23A 3QWRA 4HPYL 5GRYA 1MCDA 1IFHH 3LIZL 4RWHA 1NDGB 4AIZA 2KUTA 4YDLC 5DQ9A 3V95A 1P6AB 3RWGB 2QKIB 1AIFB 4UQ3B 3OKEB 4I4WB 2BJML 3LZFL 1IGJB 3QFJB 3ZE1E 4EUPA 1UJ3C 4L8BA 5CJQH 1FGVH 4H1LG 3LKNB 3PWNA 1KENH 4MQ7B 1I7ZA 1AGFA 2J8UB 2GIYA 1EA9C 3B83A 4JFED 3VFNB 5J6GA 2QSCL 4NBYB 4HUWA 1U8IB 4YDVA 5L2KD 3WMSA 1HXMB 1VGKB 1ETZA 1S9WB 1KPRB 2DKMA 1OOAA 5KSUB 4UINH 3IETB 3CLEH 4WV1A 1HH9B 3GHBH 3HZVB 3MNZB 2YSSA 3CK0L 3VWKD 5C86A 4DOHE 4JFHD 5LG1A 5JOPD 5D93C 4CDHA 4LOUC 1G0YR 5IG7A 1KNOB 1NSNL 1RUQH 4XPBH 4YXLL 4B50A 1QFUH 1FZMB 2OMBA 3G6AA 3Q5TA 4D8PA 1AQKL 5HPMB 3VD4A 3NGBC 1HYRC 4ZUTB 2ZUQB 1FPTL 3ZT5A 1LO3L