3W9KA

Crystal structure of thermoacidophile-specific protein stk_08120 complexed with myristic acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
135
structure length
135
Chain Sequence
MKVEKEIKTNQDIDVVMTIFSDPAFTIPQIFPGIASIKCIEPEIFEAEGKFLAFSYKVKGRVYKGVDEVRIIYDSDRGNGILYIRKKDNNTLQIILEHDNKLTAFLGKPYVSSNLDRLAENIDEIIRLERIKRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FATTY ACID-BINDING PROTEIN
publication title A Thermoacidophile-Specific Protein Family, DUF3211, Functions as a Fatty Acid Carrier with Novel Binding Mode
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Lipid binding protein
total genus 44
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2013-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11485 DUF3211 Protein of unknown function (DUF3211)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3w9kA00
4IGWA 2Q3QA 2NN5A 1BV1A 4LGBA 5E4BA 3PU2A 3ZVUA 4A8GA 3UQHA 1H2OA 4BTZA 3NMVA 1TXCA 3H3RA 1XUVA 3Q6AA 2RERA 3KDHA 3NMTA 3W9KA 1QMRA 1XDFA 1LN3A 2QIMA 5E46A 3OJIA 3NI8A 3W9RA 5JNNA 1IFVA 3RT2A 3TVQA 1FM4A 3TVRA 4JDAA 3NJOA 3QSZA 3K3KA 3K90A 2GKDA 2VQ5A 2LDKA 2NS9A 4BKDA 4A85A 1JSSA 3NEFA 1LN2A 4A88A 3P51A 2E3SA 2LEQA 3P0LA 4JDLA 4MNSA 3RD6A 1LN1A 3CNWA 2N4BA 2A1LA 3KDIA 1FSKA 1TW0A 4A80A 4FPWA 3F08A 3NMPA 4N0GC 1T27A 1Z94A 1ICXA 2E3MA 2LUZA 2KEWA 2R55A 3NEGA 3NR4A 4A86A 3IJTA 3JRSA 2KTEA 4A8UA 2Z9YA 1B6FA 2K7HA 4Y31A 1XN6A 2L9PA 4JHIA 4A8VA 3PUTA 1T17A 4Z3LA 3UIDA 3KL1A 3WG8A 3R6PA 4LG5A 4OICA 4REHA 2N4AA 3UJLA 2I9YA 2LGHA 4IGYA 4IGXA 4A84A 4REIA 2L8OA 2PCSA 2FLHA 1BTVA 4PSBA 1ZXFA 2PSOA 4IGVA 4XRTA 4IHRA 2MOUA 4JHGA 4Q0KA 3H3TA 2D4RA 2RESA 3NS2A 1LLTA 3NJ1A 3TL1A 4XRWA 4A83A 5JO2A 3IE5A 5E4MA 4DSBA 2KCZA 4IH2A 1KCMA 4IH0A 3FO5A 2M47A 2E3QA 5C9YA 4BK6A 5E4DA 1UW5A 3OQUA 4RYVA 4REJA 1EM2A 1XN5A 3KAZA 4R7KA 2LAKA 4MAPA 3H3SA 2E3NA 2K5GA 4DS8A 3RT0C 3KDJA 4C94A 1X53A 4C9IA 1E09A 3E85A 2VNEA 3Q64A 3NMNA 4M9WA 5BRLA 2KF2A 4LGAA 5I9JA 2LPXA 3OTLA 2LF2A 4A87A 3JRQB 4C9CA 5JO1A 4GY9A 2BK0A 2LIOA 3KB0A 2LCGA 2EJXA 3TFZA 3KB3A 3P9VA 2E3PA 4BKCA 2Z9ZA 1VJHA 3ELIA 2FFSA 3C0VA 3QN1A 4JHHA 4N3EA 4M9BA 4B9RA 2E3RA 3KAYA 3H3QA 2LE1A 5I8FA 2WQLA 2REZA 2M89A 5AMWA 4A81A 4WVOA 4LA7A 3Q63A 4BK7A 2E3OA 3OH8A 4DSCA 3GGNA 2IL5A 2QPVA 3NMHA 1XFSA 3KLXA 4QIPA 4MA6A 3NJ0A 2L65A
chains in the Genus database with same CATH superfamily
4IGWA 2Q3QA 2NN5A 1BV1A 4LGBA 5E4BA 3PU2A 3GTSA 4QDCA 3ZVUA 4A8GA 2ZYLA 4BTZA 3UQHA 3GL0A 3NMVA 1TXCA 3H3RA 1XUVA 3Q6AA 2RERA 3KDHA 3NMTA 3GKEA 4QDDA 3W9KA 3HJFA 1QMRA 1XDFA 1LN3A 2QIMA 4E6FA 5E46A 3OJIA 3NI8A 3W9RA 5JNNA 1IFVA 3RT2A 3TVQA 1H2OA 1FM4A 3TVRA 3GL2A 4JDAA 3NJOA 3QSZA 3K3KA 3K90A 2GKDA 2VQ5A 2LDKA 2NS9A 2YH6A 4A85A 4QCKA 4BKDA 1JSSA 3NEFA 1LN2A 4A88A 3P51A 2E3SA 2LEQA 3P0LA 4JDLA 4MNSA 3RD6A 4N41A 1LN1A 3CNWA 2N4BA 3HM9A 2A1LA 3KDIA 3GOBA 1FSKA 1TW0A 4A80A 4FPWA 3HO1A 3F08A 3NMPA 4N0GC 1T27A 1Z94A 1ICXA 2E3MA 2LUZA 2KEWA 2R55A 3NEGA 3NR4A 4JHYA 3IJTA 3JRSA 2KTEA 4A86A 4A8UA 2Z9YA 1B6FA 2K7HA 4Y31A 4KPYA 1XN6A 4NCAA 3F73A 2L9PA 4JHIA 4A8VA 3PUTA 1T17A 4Z3LA 3DLHA 3UIDA 3KL1A 3WG8A 3R6PA 4LG5A 4OICA 4REHA 2N4AA 3NQNA 3UJLA 2I9YA 2LGHA 4IGYA 4IGXA 4A84A 4REIA 3HXMA 2L8OA 2PCSA 2FLHA 4QDFB 1BTVA 4PSBA 1ZXFA 2PSOA 4IGVA 4XRTA 4IHRA 2MOUA 4JHGA 4Q0KA 3H3TA 2D4RA 2RESA 3NS2A 1LLTA 3NJ1A 4N47A 3TL1A 4XRWA 4A83A 5JO2A 3HK2A 3IE5A 5E4MA 4DSBA 2KCZA 4IH2A 1KCMA 4IH0A 3FO5A 2M47A 2E3QA 5C9YA 4BK6A 5E4DA 1UW5A 3OQUA 4RYVA 4REJA 1EM2A 1XN5A 3KAZA 4R7KA 4NCBA 2LAKA 4MAPA 3H3SA 2E3NA 2K5GA 4DS8A 3RT0C 3KDJA 4C94A 1X53A 4C9IA 1E09A 3E85A 2VNEA 3Q64A 3DLBA 5EKQC 3NMNA 4M9WA 5BRLA 2KF2A 4LGAA 5I9JA 2LPXA 2LAFA 2LF2A 3OTLA 3JRQB 4A87A 4C9CA 5JO1A 4GY9A 2BK0A 2LIOA 3GTEA 3KB0A 2LCGA 2EJXA 3TFZA 3KB3A 3P9VA 2E3PA 4BKCA 4N76A 2Z9ZA 1VJHA 3ELIA 2FFSA 3C0VA 3QN1A 4JHHA 4N3EA 4M9BA 4B9RA 2E3RA 3KAYA 3H3QA 2LE1A 5I8FA 2WQLA 2REZA 2M89A 5AMWA 4A81A 4QDFA 4WVOA 3TGOC 4LA7A 3Q63A 4BK7A 2E3OA 3OH8A 4DSCA 3GGNA 2IL5A 2QPVA 3NMHA 1XFSA 3KLXA 4QIPA 3GB4A 4MA6A 3NJ0A 3HVRA 2L65A
chains in the Genus database with same CATH topology
4IGWA 2Q3QA 2NN5A 1BV1A 4LGBA 5E4BA 3PU2A 3GTSA 4QDCA 3ZVUA 4A8GA 2ZYLA 4BTZA 3UQHA 3GL0A 3NMVA 1TXCA 3H3RA 1XUVA 3Q6AA 2RERA 3KDHA 3NMTA 3GKEA 4QDDA 3W9KA 3HJFA 1QMRA 1XDFA 1LN3A 2QIMA 4E6FA 5E46A 3OJIA 3NI8A 3W9RA 5JNNA 1IFVA 3RT2A 3TVQA 1H2OA 1FM4A 3TVRA 3GL2A 4JDAA 3NJOA 3QSZA 3K3KA 3K90A 2GKDA 2VQ5A 2LDKA 2NS9A 2YH6A 4A85A 4QCKA 4BKDA 1JSSA 3NEFA 1LN2A 4A88A 3P51A 2E3SA 2LEQA 3P0LA 4JDLA 4MNSA 3RD6A 4N41A 1LN1A 3CNWA 2N4BA 3HM9A 2A1LA 3KDIA 3GOBA 1FSKA 1TW0A 4A80A 4FPWA 3HO1A 3F08A 3NMPA 4N0GC 1T27A 1Z94A 1ICXA 2E3MA 2LUZA 2KEWA 2R55A 3NEGA 3NR4A 4JHYA 3IJTA 3JRSA 2KTEA 4A86A 4A8UA 2Z9YA 1B6FA 2K7HA 4Y31A 4KPYA 1XN6A 4NCAA 3F73A 2L9PA 4JHIA 4A8VA 3PUTA 1T17A 4Z3LA 3DLHA 3UIDA 3KL1A 3WG8A 3R6PA 4LG5A 4OICA 4REHA 2N4AA 3NQNA 3UJLA 2I9YA 2LGHA 4IGYA 4IGXA 4A84A 4REIA 3HXMA 2L8OA 2PCSA 2FLHA 4QDFB 1BTVA 4PSBA 1ZXFA 2PSOA 4IGVA 4XRTA 4IHRA 2MOUA 4JHGA 4Q0KA 3H3TA 2D4RA 2RESA 3NS2A 1LLTA 3NJ1A 4N47A 3TL1A 4XRWA 4A83A 5JO2A 3HK2A 3IE5A 5E4MA 4DSBA 2KCZA 4IH2A 1KCMA 4IH0A 3FO5A 2M47A 2E3QA 5C9YA 4BK6A 5E4DA 1UW5A 3OQUA 4RYVA 4REJA 1EM2A 1XN5A 3KAZA 4R7KA 4NCBA 2LAKA 4MAPA 3H3SA 2E3NA 2K5GA 4DS8A 3RT0C 3KDJA 4C94A 1X53A 4C9IA 1E09A 3E85A 2VNEA 3Q64A 3DLBA 5EKQC 3NMNA 4M9WA 5BRLA 2KF2A 4LGAA 5I9JA 2LPXA 2LAFA 2LF2A 3OTLA 3JRQB 4A87A 4C9CA 5JO1A 4GY9A 2BK0A 2LIOA 3GTEA 3KB0A 2LCGA 2EJXA 3TFZA 3KB3A 3P9VA 2E3PA 4BKCA 4N76A 2Z9ZA 1VJHA 3ELIA 2FFSA 3C0VA 3QN1A 4JHHA 4N3EA 4M9BA 4B9RA 2E3RA 3KAYA 3H3QA 2LE1A 5I8FA 2WQLA 2REZA 2M89A 5AMWA 4A81A 4QDFA 4WVOA 3TGOC 4LA7A 3Q63A 4BK7A 2E3OA 3OH8A 4DSCA 3GGNA 2IL5A 2QPVA 3NMHA 1XFSA 3KLXA 4QIPA 3GB4A 4MA6A 3NJ0A 3HVRA 2L65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IGW A;  2Q3Q A;  2NN5 A;  1BV1 A;  4LGB A;  5E4B A;  3PU2 A;  3ZVU A;  4A8G A;  3UQH A;  1H2O A;  4BTZ A;  3NMV A;  1TXC A;  3H3R A;  1XUV A;  3Q6A A;  2RER A;  3KDH A;  3NMT A;  3W9K A;  1QMR A;  1XDF A;  1LN3 A;  2QIM A;  5E46 A;  3OJI A;  3NI8 A;  3W9R A;  5JNN A;  1IFV A;  3RT2 A;  3TVQ A;  1FM4 A;  3TVR A;  4JDA A;  3NJO A;  3QSZ A;  3K3K A;  3K90 A;  2GKD A;  2VQ5 A;  2LDK A;  2NS9 A;  4BKD A;  4A85 A;  1JSS A;  3NEF A;  1LN2 A;  4A88 A;  3P51 A;  2E3S A;  2LEQ A;  3P0L A;  4JDL A;  4MNS A;  3RD6 A;  1LN1 A;  3CNW A;  2N4B A;  2A1L A;  3KDI A;  1FSK A;  1TW0 A;  4A80 A;  4FPW A;  3F08 A;  3NMP A;  4N0G C;  1T27 A;  1Z94 A;  1ICX A;  2E3M A;  2LUZ A;  2KEW A;  2R55 A;  3NEG A;  3NR4 A;  4A86 A;  3IJT A;  3JRS A;  2KTE A;  4A8U A;  2Z9Y A;  1B6F A;  2K7H A;  4Y31 A;  1XN6 A;  2L9P A;  4JHI A;  4A8V A;  3PUT A;  1T17 A;  4Z3L A;  3UID A;  3KL1 A;  3WG8 A;  3R6P A;  4LG5 A;  4OIC A;  4REH A;  2N4A A;  3UJL A;  2I9Y A;  2LGH A;  4IGY A;  4IGX A;  4A84 A;  4REI A;  2L8O A;  2PCS A;  2FLH A;  1BTV A;  4PSB A;  1ZXF A;  2PSO A;  4IGV A;  4XRT A;  4IHR A;  2MOU A;  4JHG A;  4Q0K A;  3H3T A;  2D4R A;  2RES A;  3NS2 A;  1LLT A;  3NJ1 A;  3TL1 A;  4XRW A;  4A83 A;  5JO2 A;  3IE5 A;  5E4M A;  4DSB A;  2KCZ A;  4IH2 A;  1KCM A;  4IH0 A;  3FO5 A;  2M47 A;  2E3Q A;  5C9Y A;  4BK6 A;  5E4D A;  1UW5 A;  3OQU A;  4RYV A;  4REJ A;  1EM2 A;  1XN5 A;  3KAZ A;  4R7K A;  2LAK A;  4MAP A;  3H3S A;  2E3N A;  2K5G A;  4DS8 A;  3RT0 C;  3KDJ A;  4C94 A;  1X53 A;  4C9I A;  1E09 A;  3E85 A;  2VNE A;  3Q64 A;  3NMN A;  4M9W A;  5BRL A;  2KF2 A;  4LGA A;  5I9J A;  2LPX A;  3OTL A;  2LF2 A;  4A87 A;  3JRQ B;  4C9C A;  5JO1 A;  4GY9 A;  2BK0 A;  2LIO A;  3KB0 A;  2LCG A;  2EJX A;  3TFZ A;  3KB3 A;  3P9V A;  2E3P A;  4BKC A;  2Z9Z A;  1VJH A;  3ELI A;  2FFS A;  3C0V A;  3QN1 A;  4JHH A;  4N3E A;  4M9B A;  4B9R A;  2E3R A;  3KAY A;  3H3Q A;  2LE1 A;  5I8F A;  2WQL A;  2REZ A;  2M89 A;  5AMW A;  4A81 A;  4WVO A;  4LA7 A;  3Q63 A;  4BK7 A;  2E3O A;  3OH8 A;  4DSC A;  3GGN A;  2IL5 A;  2QPV A;  3NMH A;  1XFS A;  3KLX A;  4QIP A;  4MA6 A;  3NJ0 A;  2L65 A; 
#chains in the Genus database with same CATH topology
 4IGW A;  2Q3Q A;  2NN5 A;  1BV1 A;  4LGB A;  5E4B A;  3PU2 A;  3GTS A;  4QDC A;  3ZVU A;  4A8G A;  2ZYL A;  4BTZ A;  3UQH A;  3GL0 A;  3NMV A;  1TXC A;  3H3R A;  1XUV A;  3Q6A A;  2RER A;  3KDH A;  3NMT A;  3GKE A;  4QDD A;  3W9K A;  3HJF A;  1QMR A;  1XDF A;  1LN3 A;  2QIM A;  4E6F A;  5E46 A;  3OJI A;  3NI8 A;  3W9R A;  5JNN A;  1IFV A;  3RT2 A;  3TVQ A;  1H2O A;  1FM4 A;  3TVR A;  3GL2 A;  4JDA A;  3NJO A;  3QSZ A;  3K3K A;  3K90 A;  2GKD A;  2VQ5 A;  2LDK A;  2NS9 A;  2YH6 A;  4A85 A;  4QCK A;  4BKD A;  1JSS A;  3NEF A;  1LN2 A;  4A88 A;  3P51 A;  2E3S A;  2LEQ A;  3P0L A;  4JDL A;  4MNS A;  3RD6 A;  4N41 A;  1LN1 A;  3CNW A;  2N4B A;  3HM9 A;  2A1L A;  3KDI A;  3GOB A;  1FSK A;  1TW0 A;  4A80 A;  4FPW A;  3HO1 A;  3F08 A;  3NMP A;  4N0G C;  1T27 A;  1Z94 A;  1ICX A;  2E3M A;  2LUZ A;  2KEW A;  2R55 A;  3NEG A;  3NR4 A;  4JHY A;  3IJT A;  3JRS A;  2KTE A;  4A86 A;  4A8U A;  2Z9Y A;  1B6F A;  2K7H A;  4Y31 A;  4KPY A;  1XN6 A;  4NCA A;  3F73 A;  2L9P A;  4JHI A;  4A8V A;  3PUT A;  1T17 A;  4Z3L A;  3DLH A;  3UID A;  3KL1 A;  3WG8 A;  3R6P A;  4LG5 A;  4OIC A;  4REH A;  2N4A A;  3NQN A;  3UJL A;  2I9Y A;  2LGH A;  4IGY A;  4IGX A;  4A84 A;  4REI A;  3HXM A;  2L8O A;  2PCS A;  2FLH A;  4QDF B;  1BTV A;  4PSB A;  1ZXF A;  2PSO A;  4IGV A;  4XRT A;  4IHR A;  2MOU A;  4JHG A;  4Q0K A;  3H3T A;  2D4R A;  2RES A;  3NS2 A;  1LLT A;  3NJ1 A;  4N47 A;  3TL1 A;  4XRW A;  4A83 A;  5JO2 A;  3HK2 A;  3IE5 A;  5E4M A;  4DSB A;  2KCZ A;  4IH2 A;  1KCM A;  4IH0 A;  3FO5 A;  2M47 A;  2E3Q A;  5C9Y A;  4BK6 A;  5E4D A;  1UW5 A;  3OQU A;  4RYV A;  4REJ A;  1EM2 A;  1XN5 A;  3KAZ A;  4R7K A;  4NCB A;  2LAK A;  4MAP A;  3H3S A;  2E3N A;  2K5G A;  4DS8 A;  3RT0 C;  3KDJ A;  4C94 A;  1X53 A;  4C9I A;  1E09 A;  3E85 A;  2VNE A;  3Q64 A;  3DLB A;  5EKQ C;  3NMN A;  4M9W A;  5BRL A;  2KF2 A;  4LGA A;  5I9J A;  2LPX A;  2LAF A;  2LF2 A;  3OTL A;  3JRQ B;  4A87 A;  4C9C A;  5JO1 A;  4GY9 A;  2BK0 A;  2LIO A;  3GTE A;  3KB0 A;  2LCG A;  2EJX A;  3TFZ A;  3KB3 A;  3P9V A;  2E3P A;  4BKC A;  4N76 A;  2Z9Z A;  1VJH A;  3ELI A;  2FFS A;  3C0V A;  3QN1 A;  4JHH A;  4N3E A;  4M9B A;  4B9R A;  2E3R A;  3KAY A;  3H3Q A;  2LE1 A;  5I8F A;  2WQL A;  2REZ A;  2M89 A;  5AMW A;  4A81 A;  4QDF A;  4WVO A;  3TGO C;  4LA7 A;  3Q63 A;  4BK7 A;  2E3O A;  3OH8 A;  4DSC A;  3GGN A;  2IL5 A;  2QPV A;  3NMH A;  1XFS A;  3KLX A;  4QIP A;  3GB4 A;  4MA6 A;  3NJ0 A;  3HVR A;  2L65 A; 
#chains in the Genus database with same CATH homology
 4IGW A;  2Q3Q A;  2NN5 A;  1BV1 A;  4LGB A;  5E4B A;  3PU2 A;  3GTS A;  4QDC A;  3ZVU A;  4A8G A;  2ZYL A;  4BTZ A;  3UQH A;  3GL0 A;  3NMV A;  1TXC A;  3H3R A;  1XUV A;  3Q6A A;  2RER A;  3KDH A;  3NMT A;  3GKE A;  4QDD A;  3W9K A;  3HJF A;  1QMR A;  1XDF A;  1LN3 A;  2QIM A;  4E6F A;  5E46 A;  3OJI A;  3NI8 A;  3W9R A;  5JNN A;  1IFV A;  3RT2 A;  3TVQ A;  1H2O A;  1FM4 A;  3TVR A;  3GL2 A;  4JDA A;  3NJO A;  3QSZ A;  3K3K A;  3K90 A;  2GKD A;  2VQ5 A;  2LDK A;  2NS9 A;  2YH6 A;  4A85 A;  4QCK A;  4BKD A;  1JSS A;  3NEF A;  1LN2 A;  4A88 A;  3P51 A;  2E3S A;  2LEQ A;  3P0L A;  4JDL A;  4MNS A;  3RD6 A;  4N41 A;  1LN1 A;  3CNW A;  2N4B A;  3HM9 A;  2A1L A;  3KDI A;  3GOB A;  1FSK A;  1TW0 A;  4A80 A;  4FPW A;  3HO1 A;  3F08 A;  3NMP A;  4N0G C;  1T27 A;  1Z94 A;  1ICX A;  2E3M A;  2LUZ A;  2KEW A;  2R55 A;  3NEG A;  3NR4 A;  4JHY A;  3IJT A;  3JRS A;  2KTE A;  4A86 A;  4A8U A;  2Z9Y A;  1B6F A;  2K7H A;  4Y31 A;  4KPY A;  1XN6 A;  4NCA A;  3F73 A;  2L9P A;  4JHI A;  4A8V A;  3PUT A;  1T17 A;  4Z3L A;  3DLH A;  3UID A;  3KL1 A;  3WG8 A;  3R6P A;  4LG5 A;  4OIC A;  4REH A;  2N4A A;  3NQN A;  3UJL A;  2I9Y A;  2LGH A;  4IGY A;  4IGX A;  4A84 A;  4REI A;  3HXM A;  2L8O A;  2PCS A;  2FLH A;  4QDF B;  1BTV A;  4PSB A;  1ZXF A;  2PSO A;  4IGV A;  4XRT A;  4IHR A;  2MOU A;  4JHG A;  4Q0K A;  3H3T A;  2D4R A;  2RES A;  3NS2 A;  1LLT A;  3NJ1 A;  4N47 A;  3TL1 A;  4XRW A;  4A83 A;  5JO2 A;  3HK2 A;  3IE5 A;  5E4M A;  4DSB A;  2KCZ A;  4IH2 A;  1KCM A;  4IH0 A;  3FO5 A;  2M47 A;  2E3Q A;  5C9Y A;  4BK6 A;  5E4D A;  1UW5 A;  3OQU A;  4RYV A;  4REJ A;  1EM2 A;  1XN5 A;  3KAZ A;  4R7K A;  4NCB A;  2LAK A;  4MAP A;  3H3S A;  2E3N A;  2K5G A;  4DS8 A;  3RT0 C;  3KDJ A;  4C94 A;  1X53 A;  4C9I A;  1E09 A;  3E85 A;  2VNE A;  3Q64 A;  3DLB A;  5EKQ C;  3NMN A;  4M9W A;  5BRL A;  2KF2 A;  4LGA A;  5I9J A;  2LPX A;  2LAF A;  2LF2 A;  3OTL A;  3JRQ B;  4A87 A;  4C9C A;  5JO1 A;  4GY9 A;  2BK0 A;  2LIO A;  3GTE A;  3KB0 A;  2LCG A;  2EJX A;  3TFZ A;  3KB3 A;  3P9V A;  2E3P A;  4BKC A;  4N76 A;  2Z9Z A;  1VJH A;  3ELI A;  2FFS A;  3C0V A;  3QN1 A;  4JHH A;  4N3E A;  4M9B A;  4B9R A;  2E3R A;  3KAY A;  3H3Q A;  2LE1 A;  5I8F A;  2WQL A;  2REZ A;  2M89 A;  5AMW A;  4A81 A;  4QDF A;  4WVO A;  3TGO C;  4LA7 A;  3Q63 A;  4BK7 A;  2E3O A;  3OH8 A;  4DSC A;  3GGN A;  2IL5 A;  2QPV A;  3NMH A;  1XFS A;  3KLX A;  4QIP A;  3GB4 A;  4MA6 A;  3NJ0 A;  3HVR A;  2L65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...