3WA9A

The nucleosome containing human h2a.z.1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wa9A00
4XZQD 3KSYA 5B1LA 5CPKA 1P3KD 5B1MB 4J8XD 3AZKC 5CPID 1S32D 4AWLC 1EQZB 1A7WA 3W98C 1KX3A 4NE6A 1P3PD 5CP6C 5B24D 1P3LD 2PYOC 5GSUD 5B0YD 4YS3C 5AV8A 5AVCA 4DRBA 3O62D 5AV5B 3X1UB 3LZ1B 1P3GD 4UUZA 5B2ID 3AZMB 4WU9D 3LZ0C 4J8UD 1F66B 5B31B 3KXBD 1M19C 4WU8C 3AZGC 5C3IB 5AV6B 1M1AB 2FJ7B 1P3MD 5AVBA 4KUDB 2HIOD 5BNXB 2YFVB 3MGSD 3NQUB 4E45A 3AV2D 4CSRA 2NQBA 2L5AA 3WTPB 5DNMC 1P3FB 5E5AA 4J8VC 3WA9C 4YM6D 2AROD 2CWEA 4Z66A 3A6NC 3REHD 5GXQA 3AZEC 1TZYC 4Z2MH 1U35D 3KWQA 5DNND 3UTAB 4QLCB 3X1SB 1R4VA 1BFMA 5GT0B 4X23B 3LJAD 3AZJA 4XUJD 3MGPC 4M6BA 3TU4C 3AZID 1M18C 3V9RB 4EO5B 1BH8B 3W99D 3WTPE 3AFAA 3X1VC 2CV5C 4NE5A 3REKD 3UTBC 1P3KB 4J8XB 5B1LC 5CPKC 1S32B 1AOIA 3LELA 5CHLB 1N1JA 1KX3C 3W98D 5GSUB 5B0YB 5GT3B 3C1BD 1P3OA 5CP6D 1ZLAA 3AZFB 5AV8C 3O62B 5AVCC 4YS3D 1P3GB 5B2IB 3VH6A 4J8UB 4H9PA 5JRGB 3LZ0D 5F99A 3AZHA 3B0CW 4G91B 2YFWA 5B33D 1M19D 2HUEB 3X1TA 4LD9A 4WU8D 3W96D 3REJD 3AZGD 2HIOB 1Q9CA 3KUYC 3VH5W 1F1EA 5AVBC 4G92B 1KX5B 2RVQC 2NQBC 2F8NA 4WNNA 3AYWD 1P34B 5FUGA 5E5AC 5DNMD 4YM6B 4Z5TA 5CPJA 1KX4B 4J8VD 3WKJB 1P3IA 3REHB 3UT9D 4Z66C 3RELA 1U35B 3MGRA 5DNNB 5GXQC 3A6ND 3AZED 3KWQC 5B2JD 5BNVB 3B6FA 5B1MA 3LJAB 3AZJC 4CAYB 3MGPD 3TU4D 1EQZA 3B0DC 4JJND 1M18D 3MVDD 3AFAC 3AV1B 3X1VD 2CV5D 3UTBD 5CPKD 1P3AB 5AV5A 3X1UA 3LZ1A 3VH6T 3AZMA 1AOIC 3AZNB 1F66A 5B31A 3LELC 4WV4B 3C1BB 4H9OB 1KX3D 1P3OC 3B0CT 1ZLAC 3B6GD 5G49B 3REID 4ZBJC 5AV6A 1M1AA 5AV8D 4KUDA 5AVCD 5BNXA 2YFVA 3NQUA 3C1CB 5B32D 3WTPA 5B33B 5F99C 3AZHC 1P3FA 3W96B 3REJB 3X1TC 4LD9C 3AZLD 5B32G 5B40B 3KUYD 5AVBD 3UTAA 3AYWB 4QLCA 2F8NK 3X1SA 2NQBD 5GT0A 3WAAA 3R45B 4Z5TC 4X23A 5CPJC 3UT9B 1P3IC 4ZUXD 5AY8C 3MGQD 3RELC 5KDMB 3MGRC 3V9RA 2CV5A 5B2JB 4Z66D 3MNNB 1BH8A 5B0ZD 1P3KA 3KWQD 4J8XA 3B6FC 5B1MC 1P3BD 1H3OB 4R8PD 1S32A 3W97B 1HQ3B 4JJNB 3AZJD 3MVDB 1EQZC 4J8WD 5AV9B 2NZDB 5B0YA 5GT3A 4H9SA 3AZFA 3O62A 1P3GA 5B2IA 5AV5C 3X1UC 3LZ1C 4J8UA 1ID3B 5JRGA 3AZMC 4H9QB 1F66C 5B31C 3AN2B 1AOID 4KGCA 3LELD 1WWIA 3B6GB 4XZQB 3REIB 1P3OD 5C3IC 1ZLAD 5AV6C 2HIOA 1M1AC 5CPIB 4KUDC 3AZKD 5B32B 1KX5A 1P3PB 5B24B 1P3LB 3WTPC 1P34A 1P3FC 5BS7A 4YM6A 3AZLB 3AZHD 2PYOD 1KX4A 3WKJA 4LD9D 3KUYB 3B0BA 5AVBB 1U35A 4WU9B 3NQJB 5DNNA 3UTAC 3KXBB 5BNVA 4QLCC 3X1SC 5JA4B 5GT0C 3LJAA 3WAAC 4ZUXB 4X23C 1P3MB 3MGQB 4Z5TD 5CPJD 4CAYA 1P3ID 3MGSB 3VH5A 3AV2B 5B0ZB 5AY8D 4EO5C 3MGRD 3AV1A 1P3KC 1JFIB 4J8XC 1P3BB 4R8PB 3B6FD 2AROB 5B1MD 1P3AA 2BYKB 1KU5A 1S32C 4J8WB 3WA9D 3AZNA 2F8NH 3C1BA 1TZYD 4H9OA 5B0YC 5GT3C 5G49A 4H9NB 4H9SC 3AZFC 3O62C 2BYMB 1P3GC 4XUJB 3AZIB 5B2IC 4J8UC 1AOIB 5JRGC 3LZ1D 3C1CA 4HGAB 3W99B 4KHAB 4KGCC 5B33A 1F66D 3REKB 4G91C 3W96A 3REJA 2HUEC 1HTAA 2HIOC 3AZKB 5B1LD 5AV6D 2IO5C 5B40A 4H9RB 4G92C 3AYWA 1KX5C 4AWLB 3W98B 4NFTA 1P34C 5CP6B 2PYOB 5BS7C 4YM6C 1P3FD 3R45A 2JSSA 4YS3B 1KX4C 2FJ7A 3WKJC 3UT9A 1U35C 5KDMA 5DNNC 3VH5T 5B2JA 3MNNA 3LZ0B 1M19B 4WU8B 1B6WA 3LJAC 3AZGB 3X1SD 1H3OA 5GT0D 1P3IB 3WAAD 3W97A 1HQ3A 4X23D 4JJNA 5AY8B 3MVDA 5AV9A 2NZDA 3AV1C 2RVQD 5DNMB 5BO0B 4J8VB 5E5AD 1P3AC 3WA9B 4E44A 1ID3A 4H9QA 3AZNC 3A6NB 3AZEB 3AN2A 1TZYB 1BH9B 3C1BC 3B6GA 4XZQA 5GXQD 3REIA 4Z2MG 5GT3D 5BT1C 5CPIA 3AZFD 4DRAA 3MGPB 3TU4B 5B32A 1M18B 3C1CC 1P3PA 1TAFB 5B24A 1P3LA 5JRGD 5B33C 4KGCD 5GSUA 3X1VB 3W96C 3REJC 3AZLA 3UTBB 2CV5B 3AFAD 5B1LB 1B67A 5CPKB 3KUYA 5B40C 3NQJA 4WU9A 3AYWC 3KXBA 1KX3B 1KX5D 5JA4A 1P34D 4ZUXA 1P3MA 5AV8B 2FJ7C 3MGQA 3UT9C 5AVCB 1KX4D 3WKJD 3MGSA 3AV2A 5B0ZA 4UUZB 5B2JC 3MNNC 1JFIA 1P3BA 4R8PA 5F99D 2AROA 3WAAB 2BYKA 3X1TD 3W97C 1HQ3C 3REHA 4J8WA 4JJNC 3MVDC 5AV9C 4NE3A 2NZDC 1ULYA 4CSRB 2NQBB 4H9NA 3AV1D 2F8ND 5E5AB 2BYMA 2LY8A 4XUJA 3AZIA 1P3AD 1ID3C 4Z66B 3W99A 4KHAA 3AN2C 5GXQB 3AZND 3REKA 3RELD 2F8NG 3KWQB 3B6GC 4XZQC 3REIC 3AZKA 4WZSB 3VH6W 5CPIC 5BT1D 4H9RA 3AZJB 5B32C 3W98A 3B0DB 1P3PC 5B24C 1P3LC 4KGCB 3C1CD 5CP6A 1EQZD 2PYOA 5GSUC 3AFAB 3AZLC 4YS3A 2IO5B 4WU9C 5B40D 5AV5D 3X1UD 3LZ0A 3LELB 3KXBC 3AZMD 1N1JB 1M19A 5B31D 4WU8A 1P3OB 1ZLAB 3AZGA 1WWSA 4ZUXC 4ZBJB 1P3MC 3MGQC 5AY8A 2FJ7D 1M1AD 3MGSC 3AV2C 5B31G 5B0ZC 4KUDD 4H9PB 3MNND 5DNMA 5F99B 3AZHB 5BO0A 1P3BC 2YFWB 4R8PC 3WTPD 4J8VA 3X1TB 2AROC 4LD9B 3WA9A 3REHC 4J8WC 3W97D 1HQ3D 3A6NA 3AZEA 1TZYA 1BH9A 5AV9D 2NZDD 2F8NB 4WNNB 3UTAD 5FUGB 4QLCD 4Z5TB 4XUJC 3AZIC 5CPJB 3MGPA 3TU4A 1M18A 1TAFA 4HGAC 3W99C 3MGRB 3RELB 1ID3D 3REKC 3AN2D 3X1VA 3UTBA 3B6FB
chains in the Genus database with same CATH superfamily
4XZQD 3KSYA 5B1LA 5CPKA 1P3KD 2JE5A 5B1MB 4J8XD 3AZKC 5CPID 1S32D 4AWLC 1EQZB 1A7WA 3W98C 1KX3A 4NE6A 1P3PD 5CP6C 5B24D 1P3LD 2PYOC 5GSUD 5B0YD 4YS3C 5AV8A 5AVCA 4DRBA 3O62D 5AV5B 3X1UB 3LZ1B 1P3GD 4UUZA 5B2ID 3AZMB 4WU9D 3LZ0C 4J8UD 1F66B 5B31B 2DQNC 3KXBD 1M19C 4WU8C 3AZGC 5C3IB 5AV6B 1M1AB 2FJ7B 1P3MD 5AVBA 4KUDB 2HIOD 5BNXB 2YFVB 3MGSD 3NQUB 4E45A 3AV2D 4CSRA 2NQBA 2L5AA 3WTPB 5DNMC 1P3FB 5E5AA 4J8VC 3WA9C 4YM6D 2AROD 2CWEA 3P5JB 4Z66A 3A6NC 3REHD 5GXQA 3AZEC 1TZYC 4Z2MH 1U35D 3KWQA 5DNND 3UTAB 4QLCB 3X1SB 1R4VA 1BFMA 5GT0B 4X23B 3LJAD 3AZJA 4XUJD 3MGPC 4M6BA 3TU4C 3AZID 2Y2PA 1M18C 3V9RB 4EO5B 1BH8B 3W99D 3WTPE 3AFAA 3X1VC 2CV5C 4NE5A 3REKD 3UTBC 1P3KB 4J8XB 5B1LC 5CPKC 1S32B 1AOIA 3LELA 5CHLB 1N1JA 1KX3C 3W98D 5GSUB 5B0YB 5GT3B 3C1BD 1P3OA 5CP6D 1ZLAA 3AZFB 5AV8C 3O62B 5AVCC 4YS3D 1P3GB 5B2IB 3VH6A 4J8UB 4H9PA 5JRGB 3LZ0D 5F99A 3AZHA 3B0CW 4G91B 2YFWA 5B33D 1M19D 2HUEB 3X1TA 4LD9A 4WU8D 3W96D 3REJD 3AZGD 2HIOB 1Q9CA 3KUYC 3VH5W 1F1EA 5AVBC 4G92B 4DQYB 1KX5B 2RVQC 2NQBC 2F8NA 4WNNA 3AYWD 1P34B 5FUGA 5E5AC 5DNMD 4YM6B 4Z5TA 5CPJA 1KX4B 4J8VD 2Y2NA 3WKJB 1P3IA 3REHB 3UT9D 4Z66C 3RELA 1U35B 3MGRA 5DNNB 5GXQC 3A6ND 3AZED 3KWQC 2RIQA 5B2JD 5BNVB 3B6FA 2XD1A 5B1MA 3LJAB 3AZJC 4CAYB 2ZM5A 3MGPD 3TU4D 1EQZA 3B0DC 4JJND 1M18D 3MVDD 3AFAC 3AV1B 3X1VD 2CV5D 3UTBD 5CPKD 1P3AB 5AV5A 3X1UA 3LZ1A 3VH6T 3KFUG 3AZMA 1AOIC 3AZNB 1F66A 5B31A 3LELC 4WV4B 3C1BB 4H9OB 1KX3D 1P3OC 2Y2GA 3B0CT 1ZLAC 3B6GD 5G49B 3REID 4ZBJC 5AV6A 1M1AA 2Y2JA 5AV8D 4KUDA 3IP4C 5AVCD 5BNXA 2YFVA 3NQUA 3C1CB 5B32D 3WTPA 5B33B 5F99C 3AZHC 1P3FA 3W96B 3REJB 3X1TC 4LD9C 3AZLD 2Y2IA 5B32G 5B40B 3KUYD 5AVBD 3UTAA 3AYWB 4QLCA 2F8NK 4UPKA 3X1SA 2NQBD 5GT0A 3WAAA 3R45B 4Z5TC 4X23A 5CPJC 3UT9B 1P3IC 4ZUXD 5AY8C 3MGQD 3RELC 5KDMB 3MGRC 3V9RA 2CV5A 5B2JB 4Z66D 2G5IC 1BH8A 3MNNB 5B0ZD 1P3KA 3KWQD 4J8XA 3B6FC 3AL0C 5B1MC 1P3BD 1H3OB 4R8PD 3H0RC 1S32A 3W97B 1HQ3B 4JJNB 3AZJD 3MVDB 1EQZC 4J8WD 2DF4C 5AV9B 2NZDB 5B0YA 5GT3A 4H9SA 3AZFA 3O62A 2J8PA 1P3GA 5B2IA 5AV5C 3X1UC 3LZ1C 4J8UA 1ID3B 5JRGA 3AZMC 4H9QB 1F66C 5B31C 3AN2B 1AOID 4KGCA 2F2AC 3LELD 1WWIA 3B6GB 4XZQB 3REIB 1P3OD 5C3IC 1ZLAD 5AV6C 2HIOA 1M1AC 5CPIB 4KUDC 3AZKD 5B32B 1Z2CB 1KX5A 1P3PB 5B24B 1P3LB 3WTPC 1P34A 1P3FC 5BS7A 2VQRA 4YM6A 3AZLB 3AZHD 2PYOD 1KX4A 3WKJA 4LD9D 3KUYB 2Y2KA 3B0BA 5AVBB 2Y2OA 1U35A 4WU9B 3NQJB 5DNNA 3UTAC 3KXBB 5BNVA 2Y2LA 2ZY4A 4QLCC 3X1SC 5JA4B 5GT0C 3LJAA 3WAAC 4ZUXB 4X23C 1P3MB 3EPJA 3MGQB 4Z5TD 5CPJD 4CAYA 1P3ID 3MGSB 3VH5A 3AV2B 5B0ZB 5AY8D 4EO5C 3MGRD 3AV1A 1P3KC 1JFIB 4J8XC 1P3BB 4R8PB 3B6FD 2AROB 5B1MD 1P3AA 2BYKB 1KU5A 1S32C 4J8WB 3WA9D 3AZNA 2F8NH 3C1BA 3H0LC 1TZYD 4H9OA 5B0YC 5GT3C 5G49A 4H9NB 4H9SC 3AZFC 3O62C 2BYMB 1P3GC 4XUJB 2JCHA 3AZIB 5B2IC 4J8UC 1AOIB 5JRGC 3LZ1D 3C1CA 4HGAB 3W99B 4KHAB 4KGCC 5B33A 1F66D 3REKB 2Y2QA 4G91C 3W96A 3REJA 2HUEC 1HTAA 2HIOC 3AZKB 5B1LD 5AV6D 2IO5C 5B40A 4H9RB 4G92C 3AYWA 1KX5C 4AWLB 3W98B 4NFTA 1P34C 5CP6B 2PYOB 5BS7C 1PZRA 4YM6C 1P3FD 3R45A 2JSSA 4YS3B 1KX4C 2FJ7A 3WKJC 3UT9A 1W2EA 1U35C 5KDMA 5DNNC 3VH5T 5B2JA 3MNNA 3LZ0B 3A1KA 1M19B 4WU8B 1B6WA 3LJAC 3AZGB 3X1SD 1H3OA 5GT0D 1P3IB 3WAAD 3W97A 1HQ3A 4X23D 4JJNA 5AY8B 3MVDA 5AV9A 2NZDA 3AV1C 2RVQD 2ZY2A 5DNMB 2ZY3A 5BO0B 4J8VB 5E5AD 1P3AC 3WA9B 4E44A 1ID3A 2W8SA 4H9QA 3AZNC 3A6NB 3AZEB 3AN2A 1TZYB 1BH9B 3C1BC 3B6GA 4XZQA 5GXQD 3REIA 4Z2MG 2UWXA 5GT3D 5BT1C 5CPIA 3AZFD 4DRAA 3MGPB 3TU4B 3H0MC 5B32A 1M18B 3C1CC 1P3PA 1TAFB 5B24A 1P3LA 5JRGD 5B33C 4KGCD 5GSUA 3X1VB 3W96C 3REJC 3AZLA 3UTBB 2CV5B 3AFAD 5B1LB 1B67A 5CPKB 3KUYA 2BG1A 3A1IA 5B40C 3NQJA 4WU9A 3AYWC 3KXBA 1KX3B 1T3UA 1KX5D 5JA4A 1P34D 4ZUXA 2ZY5A 1P3MA 5AV8B 2FJ7C 3MGQA 3UT9C 5AVCB 1KX4D 3WKJD 3MGSA 3AV2A 5B0ZA 4UUZB 5B2JC 3MNNC 1JFIA 1P3BA 4R8PA 5F99D 2AROA 3WAAB 2BYKA 3X1TD 3W97C 1HQ3C 3REHA 4J8WA 4JJNC 3MVDC 5AV9C 4NE3A 2NZDC 1ULYA 4CSRB 2NQBB 3EG5B 4H9NA 3AV1D 2F8ND 5E5AB 2XD5A 2BYMA 2LY8A 4XUJA 3EPKA 3AZIA 1P3AD 1ID3C 4Z66B 3W99A 4KHAA 3AN2C 5GXQB 3AZND 3REKA 3RELD 2F8NG 3KWQB 3B6GC 4XZQC 3REIC 3EPHA 4WJ3C 3F6TA 3AZKA 4WZSB 3VH6W 5CPIC 5BT1D 4H9RA 3AZJB 2Y2MA 5B32C 3W98A 3B0DB 1P3PC 5B24C 1P3LC 4KGCB 3C1CD 5CP6A 1EQZD 2Y2HA 2PYOA 5GSUC 3AFAB 3AZLC 4YS3A 2IO5B 4WU9C 5B40D 5AV5D 3X1UD 3LZ0A 2G5HC 3KXBC 3LELB 3AZMD 1N1JB 1M19A 5B31D 4WU8A 1P3OB 1ZLAB 3AZGA 1WWSA 4ZUXC 4ZBJB 1P3MC 3MGQC 5AY8A 2FJ7D 1M1AD 3MGSC 3AV2C 5B31G 5B0ZC 4KUDD 4H9PB 3MNND 5DNMA 5F99B 3AZHB 3FDDA 5BO0A 1P3BC 2YFWB 4R8PC 3WTPD 4J8VA 3X1TB 2AROC 4LD9B 3WA9A 3REHC 4J8WC 3W97D 1HQ3D 3A6NA 3AZEA 1TZYA 1BH9A 5AV9D 2NZDD 2F8NB 4WNNB 3UTAD 5FUGB 4QLCD 4Z5TB 4XUJC 3AZIC 5CPJB 3MGPA 3TU4A 1M18A 1TAFA 4HGAC 2FFFB 3W99C 3MGRB 3RELB 1ID3D 3REKC 3AN2D 3X1VA 3EPLA 3UTBA 3B6FB
chains in the Genus database with same CATH topology
4XZQD 3KSYA 5B1LA 5CPKA 1P3KD 2JE5A 5B1MB 4J8XD 3AZKC 5CPID 1S32D 4AWLC 1EQZB 1A7WA 3W98C 1KX3A 4NE6A 1P3PD 5CP6C 5B24D 1P3LD 2PYOC 5GSUD 5B0YD 4YS3C 5AV8A 5AVCA 4DRBA 3O62D 5AV5B 3X1UB 3LZ1B 1P3GD 4UUZA 5B2ID 3AZMB 4WU9D 3LZ0C 4J8UD 1F66B 5B31B 2DQNC 3KXBD 1M19C 4WU8C 3AZGC 5C3IB 5AV6B 1M1AB 2FJ7B 1P3MD 5AVBA 4KUDB 2HIOD 5BNXB 2YFVB 3MGSD 3NQUB 4E45A 3AV2D 4CSRA 2NQBA 2L5AA 3WTPB 5DNMC 1P3FB 5E5AA 4J8VC 3WA9C 4YM6D 2AROD 2CWEA 3P5JB 4Z66A 3A6NC 3REHD 5GXQA 3AZEC 1TZYC 4Z2MH 1U35D 3KWQA 5DNND 3UTAB 4QLCB 3X1SB 1R4VA 1BFMA 5GT0B 4X23B 3LJAD 3AZJA 4XUJD 3MGPC 4M6BA 3TU4C 3AZID 2Y2PA 1M18C 3V9RB 4EO5B 1BH8B 3W99D 3WTPE 3AFAA 3X1VC 2CV5C 4NE5A 3REKD 3UTBC 1P3KB 4J8XB 5B1LC 5CPKC 1S32B 1AOIA 3LELA 5CHLB 1N1JA 1KX3C 3W98D 5GSUB 5B0YB 5GT3B 3C1BD 1P3OA 5CP6D 1ZLAA 3AZFB 5AV8C 3O62B 5AVCC 4YS3D 1P3GB 5B2IB 3VH6A 4J8UB 4H9PA 5JRGB 3LZ0D 5F99A 3AZHA 3B0CW 4G91B 2YFWA 5B33D 1M19D 2HUEB 3X1TA 4LD9A 4WU8D 3W96D 3REJD 3AZGD 2HIOB 1Q9CA 3KUYC 3VH5W 1F1EA 5AVBC 4G92B 4DQYB 1KX5B 2RVQC 2NQBC 2F8NA 4WNNA 3AYWD 1P34B 5FUGA 5E5AC 5DNMD 4YM6B 4Z5TA 5CPJA 1KX4B 4J8VD 2Y2NA 3WKJB 1P3IA 3REHB 3UT9D 4Z66C 3RELA 1U35B 3MGRA 5DNNB 5GXQC 3A6ND 3AZED 3KWQC 2RIQA 5B2JD 5BNVB 3B6FA 2XD1A 5B1MA 3LJAB 3AZJC 4CAYB 2ZM5A 3MGPD 3TU4D 1EQZA 3B0DC 4JJND 1M18D 3MVDD 3AFAC 3AV1B 3X1VD 2CV5D 3UTBD 5CPKD 1P3AB 5AV5A 3X1UA 3LZ1A 3VH6T 3KFUG 3AZMA 1AOIC 3AZNB 1F66A 5B31A 3LELC 4WV4B 3C1BB 4H9OB 1KX3D 1P3OC 2Y2GA 3B0CT 1ZLAC 3B6GD 5G49B 3REID 4ZBJC 5AV6A 1M1AA 2Y2JA 5AV8D 4KUDA 3IP4C 5AVCD 5BNXA 2YFVA 3NQUA 3C1CB 5B32D 3WTPA 5B33B 5F99C 3AZHC 1P3FA 3W96B 3REJB 3X1TC 4LD9C 3AZLD 2Y2IA 5B32G 5B40B 3KUYD 5AVBD 3UTAA 3AYWB 4QLCA 2F8NK 4UPKA 3X1SA 2NQBD 5GT0A 3WAAA 3R45B 4Z5TC 4X23A 5CPJC 3UT9B 1P3IC 4ZUXD 5AY8C 3MGQD 3RELC 5KDMB 3MGRC 3V9RA 2CV5A 5B2JB 4Z66D 2G5IC 1BH8A 3MNNB 5B0ZD 1P3KA 3KWQD 4J8XA 3B6FC 3AL0C 5B1MC 1P3BD 1H3OB 4R8PD 3H0RC 1S32A 3W97B 1HQ3B 4JJNB 3AZJD 3MVDB 1EQZC 4J8WD 2DF4C 5AV9B 2NZDB 5B0YA 5GT3A 4H9SA 3AZFA 3O62A 2J8PA 1P3GA 5B2IA 5AV5C 3X1UC 3LZ1C 4J8UA 1ID3B 5JRGA 3AZMC 4H9QB 1F66C 5B31C 3AN2B 1AOID 4KGCA 2F2AC 3LELD 1WWIA 3B6GB 4XZQB 3REIB 1P3OD 5C3IC 1ZLAD 5AV6C 2HIOA 1M1AC 5CPIB 4KUDC 3AZKD 5B32B 1Z2CB 1KX5A 1P3PB 5B24B 1P3LB 3WTPC 1P34A 1P3FC 5BS7A 2VQRA 4YM6A 3AZLB 3AZHD 2PYOD 1KX4A 3WKJA 4LD9D 3KUYB 2Y2KA 3B0BA 5AVBB 2Y2OA 1U35A 4WU9B 3NQJB 5DNNA 3UTAC 3KXBB 5BNVA 2Y2LA 2ZY4A 4QLCC 3X1SC 5JA4B 5GT0C 3LJAA 3WAAC 4ZUXB 4X23C 1P3MB 3EPJA 3MGQB 4Z5TD 5CPJD 4CAYA 1P3ID 3MGSB 3VH5A 3AV2B 5B0ZB 5AY8D 4EO5C 3MGRD 3AV1A 1P3KC 1JFIB 4J8XC 1P3BB 4R8PB 3B6FD 2AROB 5B1MD 1P3AA 2BYKB 1KU5A 1S32C 4J8WB 3WA9D 3AZNA 2F8NH 3C1BA 3H0LC 1TZYD 4H9OA 5B0YC 5GT3C 5G49A 4H9NB 4H9SC 3AZFC 3O62C 2BYMB 1P3GC 4XUJB 2JCHA 3AZIB 5B2IC 4J8UC 1AOIB 5JRGC 3LZ1D 3C1CA 4HGAB 3W99B 4KHAB 4KGCC 5B33A 1F66D 3REKB 2Y2QA 4G91C 3W96A 3REJA 2HUEC 1HTAA 2HIOC 3AZKB 5B1LD 5AV6D 2IO5C 5B40A 4H9RB 4G92C 3AYWA 1KX5C 4AWLB 3W98B 4NFTA 1P34C 5CP6B 2PYOB 5BS7C 1PZRA 4YM6C 1P3FD 3R45A 2JSSA 4YS3B 1KX4C 2FJ7A 3WKJC 3UT9A 1W2EA 1U35C 5KDMA 5DNNC 3VH5T 5B2JA 3MNNA 3LZ0B 3A1KA 1M19B 4WU8B 1B6WA 3LJAC 3AZGB 3X1SD 1H3OA 5GT0D 1P3IB 3WAAD 3W97A 1HQ3A 4X23D 4JJNA 5AY8B 3MVDA 5AV9A 2NZDA 3AV1C 2RVQD 2ZY2A 5DNMB 2ZY3A 5BO0B 4J8VB 5E5AD 1P3AC 3WA9B 4E44A 1ID3A 2W8SA 4H9QA 3AZNC 3A6NB 3AZEB 3AN2A 1TZYB 1BH9B 3C1BC 3B6GA 4XZQA 5GXQD 3REIA 4Z2MG 2UWXA 5GT3D 5BT1C 5CPIA 3AZFD 4DRAA 3MGPB 3TU4B 3H0MC 5B32A 1M18B 3C1CC 1P3PA 1TAFB 5B24A 1P3LA 5JRGD 5B33C 4KGCD 5GSUA 3X1VB 3W96C 3REJC 3AZLA 3UTBB 2CV5B 3AFAD 5B1LB 1B67A 5CPKB 3KUYA 2BG1A 3A1IA 5B40C 3NQJA 4WU9A 3AYWC 3KXBA 1KX3B 1T3UA 1KX5D 5JA4A 1P34D 4ZUXA 2ZY5A 1P3MA 5AV8B 2FJ7C 3MGQA 3UT9C 5AVCB 1KX4D 3WKJD 3MGSA 3AV2A 5B0ZA 4UUZB 5B2JC 3MNNC 1JFIA 1P3BA 4R8PA 5F99D 2AROA 3WAAB 2BYKA 3X1TD 3W97C 1HQ3C 3REHA 4J8WA 4JJNC 3MVDC 5AV9C 4NE3A 2NZDC 1ULYA 4CSRB 2NQBB 3EG5B 4H9NA 3AV1D 2F8ND 5E5AB 2XD5A 2BYMA 2LY8A 4XUJA 3EPKA 3AZIA 1P3AD 1ID3C 4Z66B 3W99A 4KHAA 3AN2C 5GXQB 3AZND 3REKA 3RELD 2F8NG 3KWQB 3B6GC 4XZQC 3REIC 3EPHA 4WJ3C 3F6TA 3AZKA 4WZSB 3VH6W 5CPIC 5BT1D 4H9RA 3AZJB 2Y2MA 5B32C 3W98A 3B0DB 1P3PC 5B24C 1P3LC 4KGCB 3C1CD 5CP6A 1EQZD 2Y2HA 2PYOA 5GSUC 3AFAB 3AZLC 4YS3A 2IO5B 4WU9C 5B40D 5AV5D 3X1UD 3LZ0A 2G5HC 3KXBC 3LELB 3AZMD 1N1JB 1M19A 5B31D 4WU8A 1P3OB 1ZLAB 3AZGA 1WWSA 4ZUXC 4ZBJB 1P3MC 3MGQC 5AY8A 2FJ7D 1M1AD 3MGSC 3AV2C 5B31G 5B0ZC 4KUDD 4H9PB 3MNND 5DNMA 5F99B 3AZHB 3FDDA 5BO0A 1P3BC 2YFWB 4R8PC 3WTPD 4J8VA 3X1TB 2AROC 4LD9B 3WA9A 3REHC 4J8WC 3W97D 1HQ3D 3A6NA 3AZEA 1TZYA 1BH9A 5AV9D 2NZDD 2F8NB 4WNNB 3UTAD 5FUGB 4QLCD 4Z5TB 4XUJC 3AZIC 5CPJB 3MGPA 3TU4A 1M18A 1TAFA 4HGAC 2FFFB 3W99C 3MGRB 3RELB 1ID3D 3REKC 3AN2D 3X1VA 3EPLA 3UTBA 3B6FB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XZQ D;  3KSY A;  5B1L A;  5CPK A;  1P3K D;  5B1M B;  4J8X D;  3AZK C;  5CPI D;  1S32 D;  4AWL C;  1EQZ B;  1A7W A;  3W98 C;  1KX3 A;  4NE6 A;  1P3P D;  5CP6 C;  5B24 D;  1P3L D;  2PYO C;  5GSU D;  5B0Y D;  4YS3 C;  5AV8 A;  5AVC A;  4DRB A;  3O62 D;  5AV5 B;  3X1U B;  3LZ1 B;  1P3G D;  4UUZ A;  5B2I D;  3AZM B;  4WU9 D;  3LZ0 C;  4J8U D;  1F66 B;  5B31 B;  3KXB D;  1M19 C;  4WU8 C;  3AZG C;  5C3I B;  5AV6 B;  1M1A B;  2FJ7 B;  1P3M D;  5AVB A;  4KUD B;  2HIO D;  5BNX B;  2YFV B;  3MGS D;  3NQU B;  4E45 A;  3AV2 D;  4CSR A;  2NQB A;  2L5A A;  3WTP B;  5DNM C;  1P3F B;  5E5A A;  4J8V C;  3WA9 C;  4YM6 D;  2ARO D;  2CWE A;  4Z66 A;  3A6N C;  3REH D;  5GXQ A;  3AZE C;  1TZY C;  4Z2M H;  1U35 D;  3KWQ A;  5DNN D;  3UTA B;  4QLC B;  3X1S B;  1R4V A;  1BFM A;  5GT0 B;  4X23 B;  3LJA D;  3AZJ A;  4XUJ D;  3MGP C;  4M6B A;  3TU4 C;  3AZI D;  1M18 C;  3V9R B;  4EO5 B;  1BH8 B;  3W99 D;  3WTP E;  3AFA A;  3X1V C;  2CV5 C;  4NE5 A;  3REK D;  3UTB C;  1P3K B;  4J8X B;  5B1L C;  5CPK C;  1S32 B;  1AOI A;  3LEL A;  5CHL B;  1N1J A;  1KX3 C;  3W98 D;  5GSU B;  5B0Y B;  5GT3 B;  3C1B D;  1P3O A;  5CP6 D;  1ZLA A;  3AZF B;  5AV8 C;  3O62 B;  5AVC C;  4YS3 D;  1P3G B;  5B2I B;  3VH6 A;  4J8U B;  4H9P A;  5JRG B;  3LZ0 D;  5F99 A;  3AZH A;  3B0C W;  4G91 B;  2YFW A;  5B33 D;  1M19 D;  2HUE B;  3X1T A;  4LD9 A;  4WU8 D;  3W96 D;  3REJ D;  3AZG D;  2HIO B;  1Q9C A;  3KUY C;  3VH5 W;  1F1E A;  5AVB C;  4G92 B;  1KX5 B;  2RVQ C;  2NQB C;  2F8N A;  4WNN A;  3AYW D;  1P34 B;  5FUG A;  5E5A C;  5DNM D;  4YM6 B;  4Z5T A;  5CPJ A;  1KX4 B;  4J8V D;  3WKJ B;  1P3I A;  3REH B;  3UT9 D;  4Z66 C;  3REL A;  1U35 B;  3MGR A;  5DNN B;  5GXQ C;  3A6N D;  3AZE D;  3KWQ C;  5B2J D;  5BNV B;  3B6F A;  5B1M A;  3LJA B;  3AZJ C;  4CAY B;  3MGP D;  3TU4 D;  1EQZ A;  3B0D C;  4JJN D;  1M18 D;  3MVD D;  3AFA C;  3AV1 B;  3X1V D;  2CV5 D;  3UTB D;  5CPK D;  1P3A B;  5AV5 A;  3X1U A;  3LZ1 A;  3VH6 T;  3AZM A;  1AOI C;  3AZN B;  1F66 A;  5B31 A;  3LEL C;  4WV4 B;  3C1B B;  4H9O B;  1KX3 D;  1P3O C;  3B0C T;  1ZLA C;  3B6G D;  5G49 B;  3REI D;  4ZBJ C;  5AV6 A;  1M1A A;  5AV8 D;  4KUD A;  5AVC D;  5BNX A;  2YFV A;  3NQU A;  3C1C B;  5B32 D;  3WTP A;  5B33 B;  5F99 C;  3AZH C;  1P3F A;  3W96 B;  3REJ B;  3X1T C;  4LD9 C;  3AZL D;  5B32 G;  5B40 B;  3KUY D;  5AVB D;  3UTA A;  3AYW B;  4QLC A;  2F8N K;  3X1S A;  2NQB D;  5GT0 A;  3WAA A;  3R45 B;  4Z5T C;  4X23 A;  5CPJ C;  3UT9 B;  1P3I C;  4ZUX D;  5AY8 C;  3MGQ D;  3REL C;  5KDM B;  3MGR C;  3V9R A;  2CV5 A;  5B2J B;  4Z66 D;  3MNN B;  1BH8 A;  5B0Z D;  1P3K A;  3KWQ D;  4J8X A;  3B6F C;  5B1M C;  1P3B D;  1H3O B;  4R8P D;  1S32 A;  3W97 B;  1HQ3 B;  4JJN B;  3AZJ D;  3MVD B;  1EQZ C;  4J8W D;  5AV9 B;  2NZD B;  5B0Y A;  5GT3 A;  4H9S A;  3AZF A;  3O62 A;  1P3G A;  5B2I A;  5AV5 C;  3X1U C;  3LZ1 C;  4J8U A;  1ID3 B;  5JRG A;  3AZM C;  4H9Q B;  1F66 C;  5B31 C;  3AN2 B;  1AOI D;  4KGC A;  3LEL D;  1WWI A;  3B6G B;  4XZQ B;  3REI B;  1P3O D;  5C3I C;  1ZLA D;  5AV6 C;  2HIO A;  1M1A C;  5CPI B;  4KUD C;  3AZK D;  5B32 B;  1KX5 A;  1P3P B;  5B24 B;  1P3L B;  3WTP C;  1P34 A;  1P3F C;  5BS7 A;  4YM6 A;  3AZL B;  3AZH D;  2PYO D;  1KX4 A;  3WKJ A;  4LD9 D;  3KUY B;  3B0B A;  5AVB B;  1U35 A;  4WU9 B;  3NQJ B;  5DNN A;  3UTA C;  3KXB B;  5BNV A;  4QLC C;  3X1S C;  5JA4 B;  5GT0 C;  3LJA A;  3WAA C;  4ZUX B;  4X23 C;  1P3M B;  3MGQ B;  4Z5T D;  5CPJ D;  4CAY A;  1P3I D;  3MGS B;  3VH5 A;  3AV2 B;  5B0Z B;  5AY8 D;  4EO5 C;  3MGR D;  3AV1 A;  1P3K C;  1JFI B;  4J8X C;  1P3B B;  4R8P B;  3B6F D;  2ARO B;  5B1M D;  1P3A A;  2BYK B;  1KU5 A;  1S32 C;  4J8W B;  3WA9 D;  3AZN A;  2F8N H;  3C1B A;  1TZY D;  4H9O A;  5B0Y C;  5GT3 C;  5G49 A;  4H9N B;  4H9S C;  3AZF C;  3O62 C;  2BYM B;  1P3G C;  4XUJ B;  3AZI B;  5B2I C;  4J8U C;  1AOI B;  5JRG C;  3LZ1 D;  3C1C A;  4HGA B;  3W99 B;  4KHA B;  4KGC C;  5B33 A;  1F66 D;  3REK B;  4G91 C;  3W96 A;  3REJ A;  2HUE C;  1HTA A;  2HIO C;  3AZK B;  5B1L D;  5AV6 D;  2IO5 C;  5B40 A;  4H9R B;  4G92 C;  3AYW A;  1KX5 C;  4AWL B;  3W98 B;  4NFT A;  1P34 C;  5CP6 B;  2PYO B;  5BS7 C;  4YM6 C;  1P3F D;  3R45 A;  2JSS A;  4YS3 B;  1KX4 C;  2FJ7 A;  3WKJ C;  3UT9 A;  1U35 C;  5KDM A;  5DNN C;  3VH5 T;  5B2J A;  3MNN A;  3LZ0 B;  1M19 B;  4WU8 B;  1B6W A;  3LJA C;  3AZG B;  3X1S D;  1H3O A;  5GT0 D;  1P3I B;  3WAA D;  3W97 A;  1HQ3 A;  4X23 D;  4JJN A;  5AY8 B;  3MVD A;  5AV9 A;  2NZD A;  3AV1 C;  2RVQ D;  5DNM B;  5BO0 B;  4J8V B;  5E5A D;  1P3A C;  3WA9 B;  4E44 A;  1ID3 A;  4H9Q A;  3AZN C;  3A6N B;  3AZE B;  3AN2 A;  1TZY B;  1BH9 B;  3C1B C;  3B6G A;  4XZQ A;  5GXQ D;  3REI A;  4Z2M G;  5GT3 D;  5BT1 C;  5CPI A;  3AZF D;  4DRA A;  3MGP B;  3TU4 B;  5B32 A;  1M18 B;  3C1C C;  1P3P A;  1TAF B;  5B24 A;  1P3L A;  5JRG D;  5B33 C;  4KGC D;  5GSU A;  3X1V B;  3W96 C;  3REJ C;  3AZL A;  3UTB B;  2CV5 B;  3AFA D;  5B1L B;  1B67 A;  5CPK B;  3KUY A;  5B40 C;  3NQJ A;  4WU9 A;  3AYW C;  3KXB A;  1KX3 B;  1KX5 D;  5JA4 A;  1P34 D;  4ZUX A;  1P3M A;  5AV8 B;  2FJ7 C;  3MGQ A;  3UT9 C;  5AVC B;  1KX4 D;  3WKJ D;  3MGS A;  3AV2 A;  5B0Z A;  4UUZ B;  5B2J C;  3MNN C;  1JFI A;  1P3B A;  4R8P A;  5F99 D;  2ARO A;  3WAA B;  2BYK A;  3X1T D;  3W97 C;  1HQ3 C;  3REH A;  4J8W A;  4JJN C;  3MVD C;  5AV9 C;  4NE3 A;  2NZD C;  1ULY A;  4CSR B;  2NQB B;  4H9N A;  3AV1 D;  2F8N D;  5E5A B;  2BYM A;  2LY8 A;  4XUJ A;  3AZI A;  1P3A D;  1ID3 C;  4Z66 B;  3W99 A;  4KHA A;  3AN2 C;  5GXQ B;  3AZN D;  3REK A;  3REL D;  2F8N G;  3KWQ B;  3B6G C;  4XZQ C;  3REI C;  3AZK A;  4WZS B;  3VH6 W;  5CPI C;  5BT1 D;  4H9R A;  3AZJ B;  5B32 C;  3W98 A;  3B0D B;  1P3P C;  5B24 C;  1P3L C;  4KGC B;  3C1C D;  5CP6 A;  1EQZ D;  2PYO A;  5GSU C;  3AFA B;  3AZL C;  4YS3 A;  2IO5 B;  4WU9 C;  5B40 D;  5AV5 D;  3X1U D;  3LZ0 A;  3LEL B;  3KXB C;  3AZM D;  1N1J B;  1M19 A;  5B31 D;  4WU8 A;  1P3O B;  1ZLA B;  3AZG A;  1WWS A;  4ZUX C;  4ZBJ B;  1P3M C;  3MGQ C;  5AY8 A;  2FJ7 D;  1M1A D;  3MGS C;  3AV2 C;  5B31 G;  5B0Z C;  4KUD D;  4H9P B;  3MNN D;  5DNM A;  5F99 B;  3AZH B;  5BO0 A;  1P3B C;  2YFW B;  4R8P C;  3WTP D;  4J8V A;  3X1T B;  2ARO C;  4LD9 B;  3WA9 A;  3REH C;  4J8W C;  3W97 D;  1HQ3 D;  3A6N A;  3AZE A;  1TZY A;  1BH9 A;  5AV9 D;  2NZD D;  2F8N B;  4WNN B;  3UTA D;  5FUG B;  4QLC D;  4Z5T B;  4XUJ C;  3AZI C;  5CPJ B;  3MGP A;  3TU4 A;  1M18 A;  1TAF A;  4HGA C;  3W99 C;  3MGR B;  3REL B;  1ID3 D;  3REK C;  3AN2 D;  3X1V A;  3UTB A;  3B6F B; 
#chains in the Genus database with same CATH topology
 4XZQ D;  3KSY A;  5B1L A;  5CPK A;  1P3K D;  2JE5 A;  5B1M B;  4J8X D;  3AZK C;  5CPI D;  1S32 D;  4AWL C;  1EQZ B;  1A7W A;  3W98 C;  1KX3 A;  4NE6 A;  1P3P D;  5CP6 C;  5B24 D;  1P3L D;  2PYO C;  5GSU D;  5B0Y D;  4YS3 C;  5AV8 A;  5AVC A;  4DRB A;  3O62 D;  5AV5 B;  3X1U B;  3LZ1 B;  1P3G D;  4UUZ A;  5B2I D;  3AZM B;  4WU9 D;  3LZ0 C;  4J8U D;  1F66 B;  5B31 B;  2DQN C;  3KXB D;  1M19 C;  4WU8 C;  3AZG C;  5C3I B;  5AV6 B;  1M1A B;  2FJ7 B;  1P3M D;  5AVB A;  4KUD B;  2HIO D;  5BNX B;  2YFV B;  3MGS D;  3NQU B;  4E45 A;  3AV2 D;  4CSR A;  2NQB A;  2L5A A;  3WTP B;  5DNM C;  1P3F B;  5E5A A;  4J8V C;  3WA9 C;  4YM6 D;  2ARO D;  2CWE A;  3P5J B;  4Z66 A;  3A6N C;  3REH D;  5GXQ A;  3AZE C;  1TZY C;  4Z2M H;  1U35 D;  3KWQ A;  5DNN D;  3UTA B;  4QLC B;  3X1S B;  1R4V A;  1BFM A;  5GT0 B;  4X23 B;  3LJA D;  3AZJ A;  4XUJ D;  3MGP C;  4M6B A;  3TU4 C;  3AZI D;  2Y2P A;  1M18 C;  3V9R B;  4EO5 B;  1BH8 B;  3W99 D;  3WTP E;  3AFA A;  3X1V C;  2CV5 C;  4NE5 A;  3REK D;  3UTB C;  1P3K B;  4J8X B;  5B1L C;  5CPK C;  1S32 B;  1AOI A;  3LEL A;  5CHL B;  1N1J A;  1KX3 C;  3W98 D;  5GSU B;  5B0Y B;  5GT3 B;  3C1B D;  1P3O A;  5CP6 D;  1ZLA A;  3AZF B;  5AV8 C;  3O62 B;  5AVC C;  4YS3 D;  1P3G B;  5B2I B;  3VH6 A;  4J8U B;  4H9P A;  5JRG B;  3LZ0 D;  5F99 A;  3AZH A;  3B0C W;  4G91 B;  2YFW A;  5B33 D;  1M19 D;  2HUE B;  3X1T A;  4LD9 A;  4WU8 D;  3W96 D;  3REJ D;  3AZG D;  2HIO B;  1Q9C A;  3KUY C;  3VH5 W;  1F1E A;  5AVB C;  4G92 B;  4DQY B;  1KX5 B;  2RVQ C;  2NQB C;  2F8N A;  4WNN A;  3AYW D;  1P34 B;  5FUG A;  5E5A C;  5DNM D;  4YM6 B;  4Z5T A;  5CPJ A;  1KX4 B;  4J8V D;  2Y2N A;  3WKJ B;  1P3I A;  3REH B;  3UT9 D;  4Z66 C;  3REL A;  1U35 B;  3MGR A;  5DNN B;  5GXQ C;  3A6N D;  3AZE D;  3KWQ C;  2RIQ A;  5B2J D;  5BNV B;  3B6F A;  2XD1 A;  5B1M A;  3LJA B;  3AZJ C;  4CAY B;  2ZM5 A;  3MGP D;  3TU4 D;  1EQZ A;  3B0D C;  4JJN D;  1M18 D;  3MVD D;  3AFA C;  3AV1 B;  3X1V D;  2CV5 D;  3UTB D;  5CPK D;  1P3A B;  5AV5 A;  3X1U A;  3LZ1 A;  3VH6 T;  3KFU G;  3AZM A;  1AOI C;  3AZN B;  1F66 A;  5B31 A;  3LEL C;  4WV4 B;  3C1B B;  4H9O B;  1KX3 D;  1P3O C;  2Y2G A;  3B0C T;  1ZLA C;  3B6G D;  5G49 B;  3REI D;  4ZBJ C;  5AV6 A;  1M1A A;  2Y2J A;  5AV8 D;  4KUD A;  3IP4 C;  5AVC D;  5BNX A;  2YFV A;  3NQU A;  3C1C B;  5B32 D;  3WTP A;  5B33 B;  5F99 C;  3AZH C;  1P3F A;  3W96 B;  3REJ B;  3X1T C;  4LD9 C;  3AZL D;  2Y2I A;  5B32 G;  5B40 B;  3KUY D;  5AVB D;  3UTA A;  3AYW B;  4QLC A;  2F8N K;  4UPK A;  3X1S A;  2NQB D;  5GT0 A;  3WAA A;  3R45 B;  4Z5T C;  4X23 A;  5CPJ C;  3UT9 B;  1P3I C;  4ZUX D;  5AY8 C;  3MGQ D;  3REL C;  5KDM B;  3MGR C;  3V9R A;  2CV5 A;  5B2J B;  4Z66 D;  2G5I C;  1BH8 A;  3MNN B;  5B0Z D;  1P3K A;  3KWQ D;  4J8X A;  3B6F C;  3AL0 C;  5B1M C;  1P3B D;  1H3O B;  4R8P D;  3H0R C;  1S32 A;  3W97 B;  1HQ3 B;  4JJN B;  3AZJ D;  3MVD B;  1EQZ C;  4J8W D;  2DF4 C;  5AV9 B;  2NZD B;  5B0Y A;  5GT3 A;  4H9S A;  3AZF A;  3O62 A;  2J8P A;  1P3G A;  5B2I A;  5AV5 C;  3X1U C;  3LZ1 C;  4J8U A;  1ID3 B;  5JRG A;  3AZM C;  4H9Q B;  1F66 C;  5B31 C;  3AN2 B;  1AOI D;  4KGC A;  2F2A C;  3LEL D;  1WWI A;  3B6G B;  4XZQ B;  3REI B;  1P3O D;  5C3I C;  1ZLA D;  5AV6 C;  2HIO A;  1M1A C;  5CPI B;  4KUD C;  3AZK D;  5B32 B;  1Z2C B;  1KX5 A;  1P3P B;  5B24 B;  1P3L B;  3WTP C;  1P34 A;  1P3F C;  5BS7 A;  2VQR A;  4YM6 A;  3AZL B;  3AZH D;  2PYO D;  1KX4 A;  3WKJ A;  4LD9 D;  3KUY B;  2Y2K A;  3B0B A;  5AVB B;  2Y2O A;  1U35 A;  4WU9 B;  3NQJ B;  5DNN A;  3UTA C;  3KXB B;  5BNV A;  2Y2L A;  2ZY4 A;  4QLC C;  3X1S C;  5JA4 B;  5GT0 C;  3LJA A;  3WAA C;  4ZUX B;  4X23 C;  1P3M B;  3EPJ A;  3MGQ B;  4Z5T D;  5CPJ D;  4CAY A;  1P3I D;  3MGS B;  3VH5 A;  3AV2 B;  5B0Z B;  5AY8 D;  4EO5 C;  3MGR D;  3AV1 A;  1P3K C;  1JFI B;  4J8X C;  1P3B B;  4R8P B;  3B6F D;  2ARO B;  5B1M D;  1P3A A;  2BYK B;  1KU5 A;  1S32 C;  4J8W B;  3WA9 D;  3AZN A;  2F8N H;  3C1B A;  3H0L C;  1TZY D;  4H9O A;  5B0Y C;  5GT3 C;  5G49 A;  4H9N B;  4H9S C;  3AZF C;  3O62 C;  2BYM B;  1P3G C;  4XUJ B;  2JCH A;  3AZI B;  5B2I C;  4J8U C;  1AOI B;  5JRG C;  3LZ1 D;  3C1C A;  4HGA B;  3W99 B;  4KHA B;  4KGC C;  5B33 A;  1F66 D;  3REK B;  2Y2Q A;  4G91 C;  3W96 A;  3REJ A;  2HUE C;  1HTA A;  2HIO C;  3AZK B;  5B1L D;  5AV6 D;  2IO5 C;  5B40 A;  4H9R B;  4G92 C;  3AYW A;  1KX5 C;  4AWL B;  3W98 B;  4NFT A;  1P34 C;  5CP6 B;  2PYO B;  5BS7 C;  1PZR A;  4YM6 C;  1P3F D;  3R45 A;  2JSS A;  4YS3 B;  1KX4 C;  2FJ7 A;  3WKJ C;  3UT9 A;  1W2E A;  1U35 C;  5KDM A;  5DNN C;  3VH5 T;  5B2J A;  3MNN A;  3LZ0 B;  3A1K A;  1M19 B;  4WU8 B;  1B6W A;  3LJA C;  3AZG B;  3X1S D;  1H3O A;  5GT0 D;  1P3I B;  3WAA D;  3W97 A;  1HQ3 A;  4X23 D;  4JJN A;  5AY8 B;  3MVD A;  5AV9 A;  2NZD A;  3AV1 C;  2RVQ D;  2ZY2 A;  5DNM B;  2ZY3 A;  5BO0 B;  4J8V B;  5E5A D;  1P3A C;  3WA9 B;  4E44 A;  1ID3 A;  2W8S A;  4H9Q A;  3AZN C;  3A6N B;  3AZE B;  3AN2 A;  1TZY B;  1BH9 B;  3C1B C;  3B6G A;  4XZQ A;  5GXQ D;  3REI A;  4Z2M G;  2UWX A;  5GT3 D;  5BT1 C;  5CPI A;  3AZF D;  4DRA A;  3MGP B;  3TU4 B;  3H0M C;  5B32 A;  1M18 B;  3C1C C;  1P3P A;  1TAF B;  5B24 A;  1P3L A;  5JRG D;  5B33 C;  4KGC D;  5GSU A;  3X1V B;  3W96 C;  3REJ C;  3AZL A;  3UTB B;  2CV5 B;  3AFA D;  5B1L B;  1B67 A;  5CPK B;  3KUY A;  2BG1 A;  3A1I A;  5B40 C;  3NQJ A;  4WU9 A;  3AYW C;  3KXB A;  1KX3 B;  1T3U A;  1KX5 D;  5JA4 A;  1P34 D;  4ZUX A;  2ZY5 A;  1P3M A;  5AV8 B;  2FJ7 C;  3MGQ A;  3UT9 C;  5AVC B;  1KX4 D;  3WKJ D;  3MGS A;  3AV2 A;  5B0Z A;  4UUZ B;  5B2J C;  3MNN C;  1JFI A;  1P3B A;  4R8P A;  5F99 D;  2ARO A;  3WAA B;  2BYK A;  3X1T D;  3W97 C;  1HQ3 C;  3REH A;  4J8W A;  4JJN C;  3MVD C;  5AV9 C;  4NE3 A;  2NZD C;  1ULY A;  4CSR B;  2NQB B;  3EG5 B;  4H9N A;  3AV1 D;  2F8N D;  5E5A B;  2XD5 A;  2BYM A;  2LY8 A;  4XUJ A;  3EPK A;  3AZI A;  1P3A D;  1ID3 C;  4Z66 B;  3W99 A;  4KHA A;  3AN2 C;  5GXQ B;  3AZN D;  3REK A;  3REL D;  2F8N G;  3KWQ B;  3B6G C;  4XZQ C;  3REI C;  3EPH A;  4WJ3 C;  3F6T A;  3AZK A;  4WZS B;  3VH6 W;  5CPI C;  5BT1 D;  4H9R A;  3AZJ B;  2Y2M A;  5B32 C;  3W98 A;  3B0D B;  1P3P C;  5B24 C;  1P3L C;  4KGC B;  3C1C D;  5CP6 A;  1EQZ D;  2Y2H A;  2PYO A;  5GSU C;  3AFA B;  3AZL C;  4YS3 A;  2IO5 B;  4WU9 C;  5B40 D;  5AV5 D;  3X1U D;  3LZ0 A;  2G5H C;  3KXB C;  3LEL B;  3AZM D;  1N1J B;  1M19 A;  5B31 D;  4WU8 A;  1P3O B;  1ZLA B;  3AZG A;  1WWS A;  4ZUX C;  4ZBJ B;  1P3M C;  3MGQ C;  5AY8 A;  2FJ7 D;  1M1A D;  3MGS C;  3AV2 C;  5B31 G;  5B0Z C;  4KUD D;  4H9P B;  3MNN D;  5DNM A;  5F99 B;  3AZH B;  3FDD A;  5BO0 A;  1P3B C;  2YFW B;  4R8P C;  3WTP D;  4J8V A;  3X1T B;  2ARO C;  4LD9 B;  3WA9 A;  3REH C;  4J8W C;  3W97 D;  1HQ3 D;  3A6N A;  3AZE A;  1TZY A;  1BH9 A;  5AV9 D;  2NZD D;  2F8N B;  4WNN B;  3UTA D;  5FUG B;  4QLC D;  4Z5T B;  4XUJ C;  3AZI C;  5CPJ B;  3MGP A;  3TU4 A;  1M18 A;  1TAF A;  4HGA C;  2FFF B;  3W99 C;  3MGR B;  3REL B;  1ID3 D;  3REK C;  3AN2 D;  3X1V A;  3EPL A;  3UTB A;  3B6F B; 
#chains in the Genus database with same CATH homology
 4XZQ D;  3KSY A;  5B1L A;  5CPK A;  1P3K D;  2JE5 A;  5B1M B;  4J8X D;  3AZK C;  5CPI D;  1S32 D;  4AWL C;  1EQZ B;  1A7W A;  3W98 C;  1KX3 A;  4NE6 A;  1P3P D;  5CP6 C;  5B24 D;  1P3L D;  2PYO C;  5GSU D;  5B0Y D;  4YS3 C;  5AV8 A;  5AVC A;  4DRB A;  3O62 D;  5AV5 B;  3X1U B;  3LZ1 B;  1P3G D;  4UUZ A;  5B2I D;  3AZM B;  4WU9 D;  3LZ0 C;  4J8U D;  1F66 B;  5B31 B;  2DQN C;  3KXB D;  1M19 C;  4WU8 C;  3AZG C;  5C3I B;  5AV6 B;  1M1A B;  2FJ7 B;  1P3M D;  5AVB A;  4KUD B;  2HIO D;  5BNX B;  2YFV B;  3MGS D;  3NQU B;  4E45 A;  3AV2 D;  4CSR A;  2NQB A;  2L5A A;  3WTP B;  5DNM C;  1P3F B;  5E5A A;  4J8V C;  3WA9 C;  4YM6 D;  2ARO D;  2CWE A;  3P5J B;  4Z66 A;  3A6N C;  3REH D;  5GXQ A;  3AZE C;  1TZY C;  4Z2M H;  1U35 D;  3KWQ A;  5DNN D;  3UTA B;  4QLC B;  3X1S B;  1R4V A;  1BFM A;  5GT0 B;  4X23 B;  3LJA D;  3AZJ A;  4XUJ D;  3MGP C;  4M6B A;  3TU4 C;  3AZI D;  2Y2P A;  1M18 C;  3V9R B;  4EO5 B;  1BH8 B;  3W99 D;  3WTP E;  3AFA A;  3X1V C;  2CV5 C;  4NE5 A;  3REK D;  3UTB C;  1P3K B;  4J8X B;  5B1L C;  5CPK C;  1S32 B;  1AOI A;  3LEL A;  5CHL B;  1N1J A;  1KX3 C;  3W98 D;  5GSU B;  5B0Y B;  5GT3 B;  3C1B D;  1P3O A;  5CP6 D;  1ZLA A;  3AZF B;  5AV8 C;  3O62 B;  5AVC C;  4YS3 D;  1P3G B;  5B2I B;  3VH6 A;  4J8U B;  4H9P A;  5JRG B;  3LZ0 D;  5F99 A;  3AZH A;  3B0C W;  4G91 B;  2YFW A;  5B33 D;  1M19 D;  2HUE B;  3X1T A;  4LD9 A;  4WU8 D;  3W96 D;  3REJ D;  3AZG D;  2HIO B;  1Q9C A;  3KUY C;  3VH5 W;  1F1E A;  5AVB C;  4G92 B;  4DQY B;  1KX5 B;  2RVQ C;  2NQB C;  2F8N A;  4WNN A;  3AYW D;  1P34 B;  5FUG A;  5E5A C;  5DNM D;  4YM6 B;  4Z5T A;  5CPJ A;  1KX4 B;  4J8V D;  2Y2N A;  3WKJ B;  1P3I A;  3REH B;  3UT9 D;  4Z66 C;  3REL A;  1U35 B;  3MGR A;  5DNN B;  5GXQ C;  3A6N D;  3AZE D;  3KWQ C;  2RIQ A;  5B2J D;  5BNV B;  3B6F A;  2XD1 A;  5B1M A;  3LJA B;  3AZJ C;  4CAY B;  2ZM5 A;  3MGP D;  3TU4 D;  1EQZ A;  3B0D C;  4JJN D;  1M18 D;  3MVD D;  3AFA C;  3AV1 B;  3X1V D;  2CV5 D;  3UTB D;  5CPK D;  1P3A B;  5AV5 A;  3X1U A;  3LZ1 A;  3VH6 T;  3KFU G;  3AZM A;  1AOI C;  3AZN B;  1F66 A;  5B31 A;  3LEL C;  4WV4 B;  3C1B B;  4H9O B;  1KX3 D;  1P3O C;  2Y2G A;  3B0C T;  1ZLA C;  3B6G D;  5G49 B;  3REI D;  4ZBJ C;  5AV6 A;  1M1A A;  2Y2J A;  5AV8 D;  4KUD A;  3IP4 C;  5AVC D;  5BNX A;  2YFV A;  3NQU A;  3C1C B;  5B32 D;  3WTP A;  5B33 B;  5F99 C;  3AZH C;  1P3F A;  3W96 B;  3REJ B;  3X1T C;  4LD9 C;  3AZL D;  2Y2I A;  5B32 G;  5B40 B;  3KUY D;  5AVB D;  3UTA A;  3AYW B;  4QLC A;  2F8N K;  4UPK A;  3X1S A;  2NQB D;  5GT0 A;  3WAA A;  3R45 B;  4Z5T C;  4X23 A;  5CPJ C;  3UT9 B;  1P3I C;  4ZUX D;  5AY8 C;  3MGQ D;  3REL C;  5KDM B;  3MGR C;  3V9R A;  2CV5 A;  5B2J B;  4Z66 D;  2G5I C;  1BH8 A;  3MNN B;  5B0Z D;  1P3K A;  3KWQ D;  4J8X A;  3B6F C;  3AL0 C;  5B1M C;  1P3B D;  1H3O B;  4R8P D;  3H0R C;  1S32 A;  3W97 B;  1HQ3 B;  4JJN B;  3AZJ D;  3MVD B;  1EQZ C;  4J8W D;  2DF4 C;  5AV9 B;  2NZD B;  5B0Y A;  5GT3 A;  4H9S A;  3AZF A;  3O62 A;  2J8P A;  1P3G A;  5B2I A;  5AV5 C;  3X1U C;  3LZ1 C;  4J8U A;  1ID3 B;  5JRG A;  3AZM C;  4H9Q B;  1F66 C;  5B31 C;  3AN2 B;  1AOI D;  4KGC A;  2F2A C;  3LEL D;  1WWI A;  3B6G B;  4XZQ B;  3REI B;  1P3O D;  5C3I C;  1ZLA D;  5AV6 C;  2HIO A;  1M1A C;  5CPI B;  4KUD C;  3AZK D;  5B32 B;  1Z2C B;  1KX5 A;  1P3P B;  5B24 B;  1P3L B;  3WTP C;  1P34 A;  1P3F C;  5BS7 A;  2VQR A;  4YM6 A;  3AZL B;  3AZH D;  2PYO D;  1KX4 A;  3WKJ A;  4LD9 D;  3KUY B;  2Y2K A;  3B0B A;  5AVB B;  2Y2O A;  1U35 A;  4WU9 B;  3NQJ B;  5DNN A;  3UTA C;  3KXB B;  5BNV A;  2Y2L A;  2ZY4 A;  4QLC C;  3X1S C;  5JA4 B;  5GT0 C;  3LJA A;  3WAA C;  4ZUX B;  4X23 C;  1P3M B;  3EPJ A;  3MGQ B;  4Z5T D;  5CPJ D;  4CAY A;  1P3I D;  3MGS B;  3VH5 A;  3AV2 B;  5B0Z B;  5AY8 D;  4EO5 C;  3MGR D;  3AV1 A;  1P3K C;  1JFI B;  4J8X C;  1P3B B;  4R8P B;  3B6F D;  2ARO B;  5B1M D;  1P3A A;  2BYK B;  1KU5 A;  1S32 C;  4J8W B;  3WA9 D;  3AZN A;  2F8N H;  3C1B A;  3H0L C;  1TZY D;  4H9O A;  5B0Y C;  5GT3 C;  5G49 A;  4H9N B;  4H9S C;  3AZF C;  3O62 C;  2BYM B;  1P3G C;  4XUJ B;  2JCH A;  3AZI B;  5B2I C;  4J8U C;  1AOI B;  5JRG C;  3LZ1 D;  3C1C A;  4HGA B;  3W99 B;  4KHA B;  4KGC C;  5B33 A;  1F66 D;  3REK B;  2Y2Q A;  4G91 C;  3W96 A;  3REJ A;  2HUE C;  1HTA A;  2HIO C;  3AZK B;  5B1L D;  5AV6 D;  2IO5 C;  5B40 A;  4H9R B;  4G92 C;  3AYW A;  1KX5 C;  4AWL B;  3W98 B;  4NFT A;  1P34 C;  5CP6 B;  2PYO B;  5BS7 C;  1PZR A;  4YM6 C;  1P3F D;  3R45 A;  2JSS A;  4YS3 B;  1KX4 C;  2FJ7 A;  3WKJ C;  3UT9 A;  1W2E A;  1U35 C;  5KDM A;  5DNN C;  3VH5 T;  5B2J A;  3MNN A;  3LZ0 B;  3A1K A;  1M19 B;  4WU8 B;  1B6W A;  3LJA C;  3AZG B;  3X1S D;  1H3O A;  5GT0 D;  1P3I B;  3WAA D;  3W97 A;  1HQ3 A;  4X23 D;  4JJN A;  5AY8 B;  3MVD A;  5AV9 A;  2NZD A;  3AV1 C;  2RVQ D;  2ZY2 A;  5DNM B;  2ZY3 A;  5BO0 B;  4J8V B;  5E5A D;  1P3A C;  3WA9 B;  4E44 A;  1ID3 A;  2W8S A;  4H9Q A;  3AZN C;  3A6N B;  3AZE B;  3AN2 A;  1TZY B;  1BH9 B;  3C1B C;  3B6G A;  4XZQ A;  5GXQ D;  3REI A;  4Z2M G;  2UWX A;  5GT3 D;  5BT1 C;  5CPI A;  3AZF D;  4DRA A;  3MGP B;  3TU4 B;  3H0M C;  5B32 A;  1M18 B;  3C1C C;  1P3P A;  1TAF B;  5B24 A;  1P3L A;  5JRG D;  5B33 C;  4KGC D;  5GSU A;  3X1V B;  3W96 C;  3REJ C;  3AZL A;  3UTB B;  2CV5 B;  3AFA D;  5B1L B;  1B67 A;  5CPK B;  3KUY A;  2BG1 A;  3A1I A;  5B40 C;  3NQJ A;  4WU9 A;  3AYW C;  3KXB A;  1KX3 B;  1T3U A;  1KX5 D;  5JA4 A;  1P34 D;  4ZUX A;  2ZY5 A;  1P3M A;  5AV8 B;  2FJ7 C;  3MGQ A;  3UT9 C;  5AVC B;  1KX4 D;  3WKJ D;  3MGS A;  3AV2 A;  5B0Z A;  4UUZ B;  5B2J C;  3MNN C;  1JFI A;  1P3B A;  4R8P A;  5F99 D;  2ARO A;  3WAA B;  2BYK A;  3X1T D;  3W97 C;  1HQ3 C;  3REH A;  4J8W A;  4JJN C;  3MVD C;  5AV9 C;  4NE3 A;  2NZD C;  1ULY A;  4CSR B;  2NQB B;  3EG5 B;  4H9N A;  3AV1 D;  2F8N D;  5E5A B;  2XD5 A;  2BYM A;  2LY8 A;  4XUJ A;  3EPK A;  3AZI A;  1P3A D;  1ID3 C;  4Z66 B;  3W99 A;  4KHA A;  3AN2 C;  5GXQ B;  3AZN D;  3REK A;  3REL D;  2F8N G;  3KWQ B;  3B6G C;  4XZQ C;  3REI C;  3EPH A;  4WJ3 C;  3F6T A;  3AZK A;  4WZS B;  3VH6 W;  5CPI C;  5BT1 D;  4H9R A;  3AZJ B;  2Y2M A;  5B32 C;  3W98 A;  3B0D B;  1P3P C;  5B24 C;  1P3L C;  4KGC B;  3C1C D;  5CP6 A;  1EQZ D;  2Y2H A;  2PYO A;  5GSU C;  3AFA B;  3AZL C;  4YS3 A;  2IO5 B;  4WU9 C;  5B40 D;  5AV5 D;  3X1U D;  3LZ0 A;  2G5H C;  3KXB C;  3LEL B;  3AZM D;  1N1J B;  1M19 A;  5B31 D;  4WU8 A;  1P3O B;  1ZLA B;  3AZG A;  1WWS A;  4ZUX C;  4ZBJ B;  1P3M C;  3MGQ C;  5AY8 A;  2FJ7 D;  1M1A D;  3MGS C;  3AV2 C;  5B31 G;  5B0Z C;  4KUD D;  4H9P B;  3MNN D;  5DNM A;  5F99 B;  3AZH B;  3FDD A;  5BO0 A;  1P3B C;  2YFW B;  4R8P C;  3WTP D;  4J8V A;  3X1T B;  2ARO C;  4LD9 B;  3WA9 A;  3REH C;  4J8W C;  3W97 D;  1HQ3 D;  3A6N A;  3AZE A;  1TZY A;  1BH9 A;  5AV9 D;  2NZD D;  2F8N B;  4WNN B;  3UTA D;  5FUG B;  4QLC D;  4Z5T B;  4XUJ C;  3AZI C;  5CPJ B;  3MGP A;  3TU4 A;  1M18 A;  1TAF A;  4HGA C;  2FFF B;  3W99 C;  3MGR B;  3REL B;  1ID3 D;  3REK C;  3AN2 D;  3X1V A;  3EPL A;  3UTB A;  3B6F B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...