3WA9B

The nucleosome containing human h2a.z.1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
b'NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wa9B00
4Z5TD 2L5AA 3UTBC 4UUZB 4H9RB 5KDMA 5AY8B 3W97D 3AZID 4WU8C 3LJAC 3X1TB 5JA4A 3X1VA 5DNMC 3KUYA 4YM6B 2NQBA 1P3LA 3W98B 5DNNA 1KX3B 2IO5C 1A7WA 1BH9A 3MNNA 3V9RB 3WAAC 3AZKB 5CPKB 5GXQC 4QLCC 3REKC 4AWLC 1ID3D 5B33B 5GSUD 1U35D 5CP6A 4JJND 1P3OB 1AOIC 1EQZD 1P3AB 2FJ7A 3WKJD 3B0BA 3AV2A 4Z5TC 3X1SA 4YS3D 2F8NA 5JRGB 3W97C 3AZIC 2YFVA 3UTAD 1TAFA 3KWQD 1P3GA 3AZND 3WTPD 2LY8A 5E5AD 4LD9A 3UTBA 3X1UB 2AROD 5BO0A 3AFAD 3AZMB 4WU8A 3C1CD 1ID3C 5GSUC 1U35C 1EQZC 4JJNC 1S32D 1P3PB 3WKJC 5B24A 3REHD 4YS3C 3UT9D 4ZUXD 4H9SC 3WTPE 5BT1D 2HIOB 2CV5B 3MGRB 3C1BB 3W96D 3B6GD 4WNNA 4ZBJC 3UTAC 5GXQA 5B32D 3KWQC 3MGSD 3AZNC 4QLCA 3REKA 3WTPC 5E5AC 1TZYD 5C3IB 2AROC 3AFAC 3W97A 5FUGA 3AZIA 3C1CC 4WZSB 1S32C 3MGQD 2CWEA 3REHC 1P3BD 5AVBB 4ZUXC 4G92B 3UT9C 2NZDB 1P3LD 5BT1C 1ZLAD 4KGCD 3O62D 4EO5C 5BNXB 3LZ1A 3W96C 4J8UB 3TU4B 1R4VA 1M19A 3AZJB 5F99B 3B6GC 2RVQD 5B32C 2PYOD 3MGSC 5B31C 3AZFA 1ID3A 5GSUA 1U35A 1TZYC 1EQZA 3NQJA 4H9PA 4Z66B 3WA9D 3KXBB 1P3MB 3B6FD 4H9SA 3AV1B 2F8ND 4R8PD 1KX5B 3MGQC 1P3BC 5AV8D 3UTAA 1P3LC 3KWQA 1ZLAC 4KGCC 3O62C 3LZ0B 3WTPA 1P3ID 2RVQC 2PYOC 3W99B 3AZHD 3C1CA 5AV9D 1S32A 1M18A 1F66D 4WU9B 3WA9C 3REHA 5B24D 1BFMA 3UT9A 4ZUXA 3B6FC 2HUEB 4R8PC 1BH8B 3B6GA 3AYWD 4KHAB 5GT3D 5AV8C 4M6BA 5B32A 4E44A 3MGSA 1TZYA 1HQ3B 5B1LA 1P3IC 4H9QA 4NE5A 3VH6A 5BNVA 4YM6D 5AV9C 4CSRA 3AZHC 3W98D 2BYMB 1JFIA 5B0YB 1KU5A 4H9NA 1KX4B 1F66C 3MGQA 5B24C 1P3BA 3LJAB 3AZKD 1ZLAA 4KGCA 5DNMB 3AN2B 3O62A 1M19D 3LZ1D 5B33D 1P34B 3AYWC 5GT3C 1P3OD 2PYOA 5B1MB 3AZFD 3WAAB 1P3FA 4J8XB 5B2IB 3WA9A 4X23A 1M1AB 3REIB 3B6FA 4J8VB 3NQUB 4YM6C 3LELB 4R8PA 3W98C 4Z5TB 5B40B 1ULYA 5AV8A 3AZKC 3X1UD 5GT0B 4Z2MH 5B0ZB 3AZEA 1H3OB 3LZ1C 5CPJA 5B33C 3AZGB 1M19C 1P3OC 1P3PD 3B0CT 3R45A 4KUDB 1P3IA 4H9OB 3AZHA 5AV9A 3AZFC 5G49A 2HIOD 2CV5D 3MGRD 1Q9CA 1F66A 3C1BD 1M18D 4JJNB 3RELB 3WKJB 4J8WB 3A6NB 3AYWA 5GT3A 3VH6T 1B67A 2BYKA 3REJB 3MVDB 2YFWB 4UUZA 3AZLB 3X1UC 4H9RA 1N1JB 5AY8A 4CAYB 5B1LD 1P3PC 3AZNB 3X1TA 5E5AB 4YM6A 5AVBD 2NZDD 3W98A 1KX3A 3AN2A 2HIOC 2CV5C 2AROB 3AFAB 5AV6B 3MGRC 4DRBA 5AV5B 3C1BC 4J8UD 1M18C 3AZJD 5F99D 3V9RA 5CPIB 3AZKA 5CPKA 5B33A 5AVCB 4XUJB 1P3OA 5C3IC 4Z66D 1P3AA 3VH5A 3KXBD 3W96B 4HGAB 5JRGA 1P3FD 3MGPB 5B1LC 5B31B 4XZQB 4X23D 5AVBC 2NZDC 1P3KB 3LZ0D 5B0ZA 5KDMB 4J8UC 3AZJC 5F99C 5B2JB 3X1UA 5JA4B 3X1VB 3AZMA 3W99D 3B0DC 3KUYB 5CPJD 3AZED 2NQBB 5DNNB 1P3PA 1BH9B 4NE6A 4Z66C 3MNNB 4WU9D 3KXBC 4NE3A 3RELA 4J8WA 2HIOA 2CV5A 1P3FC 3MGRA 3C1BA 1WWSA 4X23C 5CP6B 2FJ7B 3AZLA 3B0CW 4G91B 3AV2B 3X1SB 3LZ0C 2F8NB 3W99C 5AY8D 2YFVB 3AZEC 5CPJC 1P3GB 5B0YD 3X1TD 1KX4D 4WU9C 5AVBA 2NZDA 4LD9B 2HUEC 1KX3D 3VH6W 3UTBB 3AN2D 4LD9C 5CHLB 5BNXA 3VH5T 4J8UA 3TU4A 4WU8B 3AZJA 5F99A 1P34D 5CPKD 5B1MD 4J8XD 5B2ID 2IO5B 4Z66A 1P3AD 3KXBA 1P3MA 1M1AD 3REID 4J8VD 3AV1A 5AY8C 4WNNB 5JRGD 3LELD 5GXQB 5B40D 5B0YC 3X1TC 4QLCB 3REKB 4AWLB 1KX4C 1KX5A 1AOIB 5B2JA 1KX3C 3AN2C 5GT0D 3LZ0A 5B0ZD 3W97B 2JSSA 5FUGB 3AZIB 1B6WA 5B32G 3AZGD 1P34C 5B31G 4KUDD 5CPKC 3W99A 3AZMD 5B1MC 4J8XC 5B2IC 1P3AC 4WU9A 1M19B 3LZ1B 1M1AC 3REIC 4J8VC 3RELD 3LELC 5JRGC 4J8WD 5B40C 1BH8A 3A6ND 3AZFB 1ID3B 5GSUB 4KHAA 1U35B 1EQZB 4WV4B 3NQJB 4H9PB 3REJD 3MVDD 3AZLD 5GT0C 4YS3B 5B0ZC 1HQ3A 3AZGC 4KUDC 3AZMC 4ZBJB 3UTAB 2BYMA 3KWQB 5AV6D 5B0YA 1KX4A 5AV5D 2F8NG 3WTPB 3LJAA 5CPID 3RELC 5DNMA 4J8WC 3A6NC 5AVCD 3C1CB 3TU4D 4XUJD 1P34A 1S32B 3REJC 3MVDC 1M18B 3AZLC 3REHB 5B1MA 3UT9B 4ZUXB 3WAAA 4J8XA 5B2IA 3MGPD 5B31D 4EO5B 1WWIA 2F8NK 3VH5W 4XZQD 3REIA 1P3MD 4J8VA 1M1AA 3NQUA 3LELA 3AV1D 1AOIA 3B6GB 1P3KD 4Z5TA 3KSYA 5B32B 5B40A 5AV6C 3MGSB 5AV5C 1KX5D 1TZYB 5B1LB 5CPIC 4G92C 5B2JD 5GT0A 3X1VD 3KUYD 1H3OA 4H9QB 5BNVB 2NQBD 5AVCC 3TU4C 3AZGA 4CSRB 5DNND 4XUJC 1JFIB 3MNND 4KUDA 4H9NB 4H9OA 3MGQB 4HGAC 1P3BB 1P3LB 1ZLAB 3MGPC 4KGCB 3O62B 3B0DB 4XZQC 1P3MC 4JJNA 5CP6D 3WKJA 3AV1C 2FJ7D 1P3KC 5BS7C 4Z2MG 3AV2D 2PYOB 3X1SD 4YS3A 4DRAA 3A6NA 1KX5C 1P3FB 3REJA 3MVDA 1HTAA 4E45A 3WA9B 2YFWA 5B2JC 3X1VC 4X23B 1N1JA 3B6FB 3KUYC 4CAYA 1HQ3D 4R8PB 2NQBC 5DNNC 1F1EA 3AZNA 1P3GD 3MNNC 5E5AA 5AV8B 4LD9D 1TAFB 3UTBD 2AROA 3AFAA 5AV6A 5AV5A 3AZEB 4WU8D 5CPJB 5CPIA 3LJAD 5CP6C 2FJ7C 3R45B 5DNMD 3AV2C 4G91C 1P3IB 5BO0B 3X1SC 3AZHB 5AVCA 5AV9B 4XUJA 5G49B 1F66B 3W96A 5B24B 2F8NH 4NFTA 3WAAD 1HQ3C 3MGPA 5GXQD 1P3GC 5B31A 4QLCD 3REKD 4XZQA 1AOID 3AYWB 5GT3B 2BYKB 1P3KA 5BS7A
chains in the Genus database with same CATH superfamily
4Z5TD 2L5AA 3UTBC 4UUZB 4H9RB 5KDMA 5AY8B 3W97D 3AZID 4WU8C 3LJAC 1PZRA 3X1TB 5JA4A 3X1VA 5DNMC 3KUYA 4YM6B 2NQBA 1P3LA 3W98B 5DNNA 1KX3B 2IO5C 1A7WA 1BH9A 3MNNA 2XD5A 3V9RB 3WAAC 3AZKB 5CPKB 5GXQC 4QLCC 3REKC 4AWLC 1ID3D 5B33B 5GSUD 1U35D 5CP6A 4JJND 1P3OB 1AOIC 1EQZD 1P3AB 2FJ7A 3WKJD 3B0BA 3AV2A 4Z5TC 3X1SA 4YS3D 2F8NA 5JRGB 3W97C 3AZIC 2ZY2A 2G5HC 1T3UA 2YFVA 3UTAD 1TAFA 3A1IA 3KWQD 1P3GA 3AZND 3WTPD 2LY8A 5E5AD 4LD9A 3UTBA 1W2EA 3IP4C 2AROD 5BO0A 3X1UB 3AFAD 3AZMB 4WU8A 3C1CD 1ID3C 5GSUC 1U35C 1EQZC 4JJNC 1S32D 1P3PB 3WKJC 2ZM5A 5B24A 3REHD 4YS3C 3UT9D 4ZUXD 4H9SC 2JE5A 3WTPE 5BT1D 2HIOB 2CV5B 3MGRB 3C1BB 3W96D 3B6GD 4WNNA 4ZBJC 3UTAC 5GXQA 5B32D 3KWQC 3MGSD 3AZNC 4QLCA 3REKA 3WTPC 5E5AC 1TZYD 5C3IB 2AROC 3AFAC 3W97A 5FUGA 3AZIA 3C1CC 4WZSB 1S32C 2W8SA 3MGQD 2CWEA 3REHC 1P3BD 5AVBB 4ZUXC 4G92B 3UT9C 2NZDB 1P3LD 5BT1C 1ZLAD 4KGCD 3O62D 4EO5C 5BNXB 3LZ1A 3W96C 4J8UB 3TU4B 1R4VA 1M19A 2Y2QA 3AZJB 5F99B 3B6GC 2F2AC 2Y2GA 2ZY5A 2RVQD 5B32C 2PYOD 3MGSC 5B31C 3AZFA 1ID3A 3EG5B 5GSUA 1TZYC 1U35A 1EQZA 3NQJA 4H9PA 4Z66B 3WA9D 3KXBB 1P3MB 3B6FD 4H9SA 3AV1B 2F8ND 4R8PD 1KX5B 3MGQC 1P3BC 5AV8D 3UTAA 1P3LC 3KWQA 1ZLAC 4KGCC 3O62C 3LZ0B 3WTPA 1P3ID 2RVQC 2PYOC 3W99B 3AZHD 3C1CA 3KFUG 5AV9D 1S32A 1M18A 1F66D 4WU9B 3WA9C 3REHA 5B24D 1BFMA 3EPJA 3UT9A 4ZUXA 3B6FC 2HUEB 4R8PC 1BH8B 3B6GA 3AYWD 4KHAB 5GT3D 5AV8C 2DQNC 4M6BA 5B32A 4E44A 3MGSA 1TZYA 1HQ3B 5B1LA 1P3IC 4H9QA 4NE5A 3VH6A 5BNVA 4YM6D 5AV9C 4CSRA 3AZHC 3W98D 2BYMB 1JFIA 2Y2KA 5B0YB 1KU5A 4H9NA 1KX4B 1F66C 3MGQA 5B24C 1P3BA 3LJAB 3AZKD 1ZLAA 4KGCA 5DNMB 3AN2B 3O62A 1M19D 3LZ1D 5B33D 3FDDA 3AYWC 5GT3C 1P34B 1P3OD 3EPHA 2PYOA 5B1MB 3AZFD 3WAAB 1P3FA 4J8XB 5B2IB 3WA9A 4X23A 1M1AB 3REIB 3B6FA 4J8VB 3NQUB 4YM6C 3LELB 4R8PA 3W98C 4Z5TB 4UPKA 5B40B 3AL0C 1ULYA 5AV8A 3AZKC 3X1UD 5GT0B 4Z2MH 5B0ZB 3AZEA 1H3OB 3LZ1C 5CPJA 2Y2IA 5B33C 3AZGB 1M19C 1P3OC 1P3PD 3B0CT 3R45A 4KUDB 1P3IA 4H9OB 3AZHA 5AV9A 3AZFC 5G49A 2HIOD 2CV5D 3MGRD 1Q9CA 1F66A 3C1BD 1M18D 4DQYB 4JJNB 3RELB 3WKJB 4J8WB 3A6NB 3AYWA 5GT3A 3VH6T 1B67A 2BYKA 3REJB 3MVDB 2YFWB 4UUZA 3AZLB 4H9RA 3X1UC 1N1JB 5AY8A 4CAYB 5B1LD 1P3PC 3AZNB 3X1TA 5E5AB 2Y2JA 4YM6A 5AVBD 2NZDD 3W98A 1KX3A 3AN2A 2HIOC 2CV5C 2AROB 3AFAB 5AV6B 3MGRC 4DRBA 5AV5B 3C1BC 4J8UD 1M18C 2Y2NA 3AZJD 5F99D 3V9RA 5CPIB 3AZKA 5CPKA 2XD1A 5B33A 5AVCB 2VQRA 4XUJB 1P3OA 5C3IC 4Z66D 1P3AA 3VH5A 3KXBD 3W96B 4HGAB 2Y2PA 5JRGA 1P3FD 3MGPB 5B1LC 5B31B 4XZQB 4X23D 5AVBC 2NZDC 1P3KB 2JCHA 3LZ0D 5B0ZA 5KDMB 4J8UC 3AZJC 5F99C 5B2JB 3X1UA 5JA4B 3X1VB 3AZMA 3W99D 3B0DC 3KUYB 5CPJD 3AZED 2NQBB 5DNNB 1P3PA 1BH9B 4NE6A 4Z66C 3MNNB 4WU9D 3KXBC 4NE3A 3RELA 4J8WA 2HIOA 2CV5A 1P3FC 3MGRA 3C1BA 1WWSA 4X23C 5CP6B 2FJ7B 3AZLA 3B0CW 4G91B 3AV2B 3X1SB 3LZ0C 2F8NB 3H0MC 3W99C 5AY8D 2YFVB 3AZEC 5CPJC 1P3GB 5B0YD 3X1TD 1KX4D 4WU9C 5AVBA 2NZDA 4LD9B 2HUEC 1KX3D 3VH6W 3UTBB 3AN2D 4LD9C 5CHLB 5BNXA 3VH5T 4J8UA 3TU4A 4WU8B 3AZJA 5F99A 1P34D 2FFFB 5CPKD 2ZY3A 2BG1A 3EPKA 5B1MD 4J8XD 5B2ID 2IO5B 4Z66A 1P3AD 3KXBA 1P3MA 1M1AD 3REID 4J8VD 3AV1A 5AY8C 4WNNB 5JRGD 3LELD 2Y2OA 5GXQB 2J8PA 5B40D 5B0YC 3X1TC 4QLCB 3REKB 4AWLB 1KX4C 1KX5A 2G5IC 1AOIB 5B2JA 1KX3C 3AN2C 5GT0D 3LZ0A 5B0ZD 3W97B 2JSSA 5FUGB 3AZIB 1B6WA 5B32G 3H0LC 3AZGD 1P34C 5B31G 4KUDD 5CPKC 3W99A 3AZMD 5B1MC 4J8XC 5B2IC 2Y2MA 1P3AC 4WU9A 1M19B 3LZ1B 1M1AC 3REIC 4J8VC 2ZY4A 3RELD 3LELC 5JRGC 3H0RC 4J8WD 5B40C 1BH8A 3A6ND 3AZFB 1ID3B 5GSUB 4KHAA 1U35B 1EQZB 4WV4B 3NQJB 4H9PB 3REJD 3MVDD 3AZLD 5GT0C 2Y2LA 4YS3B 5B0ZC 1HQ3A 3AZGC 2DF4C 4KUDC 3AZMC 4ZBJB 3UTAB 2BYMA 3KWQB 5AV6D 5B0YA 1KX4A 5AV5D 2F8NG 3WTPB 3LJAA 5CPID 3RELC 5DNMA 4J8WC 3A6NC 5AVCD 3C1CB 3TU4D 4XUJD 1P34A 4WJ3C 1S32B 3REJC 3MVDC 1M18B 2RIQA 3AZLC 3REHB 5B1MA 3UT9B 4ZUXB 3WAAA 4J8XA 5B2IA 3MGPD 5B31D 4EO5B 1WWIA 2UWXA 2F8NK 3VH5W 4XZQD 3REIA 1P3MD 4J8VA 1M1AA 3NQUA 3LELA 3AV1D 1AOIA 3B6GB 1P3KD 4Z5TA 3KSYA 5B32B 5B40A 5AV6C 3MGSB 5AV5C 1KX5D 1TZYB 5B1LB 5CPIC 1Z2CB 4G92C 5B2JD 5GT0A 3X1VD 3KUYD 1H3OA 4H9QB 5BNVB 2NQBD 5AVCC 3TU4C 3AZGA 4CSRB 5DNND 4XUJC 1JFIB 3MNND 4KUDA 4H9NB 4H9OA 3MGQB 4HGAC 1P3BB 3F6TA 1P3LB 1ZLAB 3MGPC 4KGCB 3P5JB 3O62B 3B0DB 4XZQC 1P3MC 4JJNA 5CP6D 3WKJA 3AV1C 2FJ7D 1P3KC 5BS7C 4Z2MG 3AV2D 2PYOB 3X1SD 4YS3A 4DRAA 3A6NA 1KX5C 1P3FB 3REJA 3MVDA 1HTAA 4E45A 3WA9B 2YFWA 5B2JC 3X1VC 4X23B 1N1JA 3B6FB 3KUYC 2Y2HA 4CAYA 1HQ3D 4R8PB 2NQBC 5DNNC 1F1EA 3AZNA 3EPLA 3MNNC 1P3GD 5E5AA 5AV8B 4LD9D 1TAFB 3UTBD 2AROA 3AFAA 5AV6A 5AV5A 3AZEB 4WU8D 5CPJB 5CPIA 3LJAD 5CP6C 2FJ7C 3R45B 5DNMD 3AV2C 4G91C 1P3IB 5BO0B 3X1SC 3AZHB 5AVCA 5AV9B 4XUJA 5G49B 1F66B 3W96A 5B24B 2F8NH 4NFTA 3WAAD 1HQ3C 3MGPA 5GXQD 1P3GC 5B31A 4QLCD 3REKD 4XZQA 1AOID 3AYWB 5GT3B 3A1KA 2BYKB 1P3KA 5BS7A
chains in the Genus database with same CATH topology
4Z5TD 2L5AA 3UTBC 4UUZB 4H9RB 5KDMA 5AY8B 3W97D 3AZID 4WU8C 3LJAC 1PZRA 3X1TB 5JA4A 3X1VA 5DNMC 3KUYA 4YM6B 2NQBA 1P3LA 3W98B 5DNNA 1KX3B 2IO5C 1A7WA 1BH9A 3MNNA 2XD5A 3V9RB 3WAAC 3AZKB 5CPKB 5GXQC 4QLCC 3REKC 4AWLC 1ID3D 5B33B 5GSUD 1U35D 5CP6A 4JJND 1P3OB 1AOIC 1EQZD 1P3AB 2FJ7A 3WKJD 3B0BA 3AV2A 4Z5TC 3X1SA 4YS3D 2F8NA 5JRGB 3W97C 3AZIC 2ZY2A 2G5HC 1T3UA 2YFVA 3UTAD 1TAFA 3A1IA 3KWQD 1P3GA 3AZND 3WTPD 2LY8A 5E5AD 4LD9A 3UTBA 1W2EA 3IP4C 2AROD 5BO0A 3X1UB 3AFAD 3AZMB 4WU8A 3C1CD 1ID3C 5GSUC 1U35C 1EQZC 4JJNC 1S32D 1P3PB 3WKJC 2ZM5A 5B24A 3REHD 4YS3C 3UT9D 4ZUXD 4H9SC 2JE5A 3WTPE 5BT1D 2HIOB 2CV5B 3MGRB 3C1BB 3W96D 3B6GD 4WNNA 4ZBJC 3UTAC 5GXQA 5B32D 3KWQC 3MGSD 3AZNC 4QLCA 3REKA 3WTPC 5E5AC 1TZYD 5C3IB 2AROC 3AFAC 3W97A 5FUGA 3AZIA 3C1CC 4WZSB 1S32C 2W8SA 3MGQD 2CWEA 3REHC 1P3BD 5AVBB 4ZUXC 4G92B 3UT9C 2NZDB 1P3LD 5BT1C 1ZLAD 4KGCD 3O62D 4EO5C 5BNXB 3LZ1A 3W96C 4J8UB 3TU4B 1R4VA 1M19A 2Y2QA 3AZJB 5F99B 3B6GC 2F2AC 2Y2GA 2ZY5A 2RVQD 5B32C 2PYOD 3MGSC 5B31C 3AZFA 1ID3A 3EG5B 5GSUA 1TZYC 1U35A 1EQZA 3NQJA 4H9PA 4Z66B 3WA9D 3KXBB 1P3MB 3B6FD 4H9SA 3AV1B 2F8ND 4R8PD 1KX5B 3MGQC 1P3BC 5AV8D 3UTAA 1P3LC 3KWQA 1ZLAC 4KGCC 3O62C 3LZ0B 3WTPA 1P3ID 2RVQC 2PYOC 3W99B 3AZHD 3C1CA 3KFUG 5AV9D 1S32A 1M18A 1F66D 4WU9B 3WA9C 3REHA 5B24D 1BFMA 3EPJA 3UT9A 4ZUXA 3B6FC 2HUEB 4R8PC 1BH8B 3B6GA 3AYWD 4KHAB 5GT3D 5AV8C 2DQNC 4M6BA 5B32A 4E44A 3MGSA 1TZYA 1HQ3B 5B1LA 1P3IC 4H9QA 4NE5A 3VH6A 5BNVA 4YM6D 5AV9C 4CSRA 3AZHC 3W98D 2BYMB 1JFIA 2Y2KA 5B0YB 1KU5A 4H9NA 1KX4B 1F66C 3MGQA 5B24C 1P3BA 3LJAB 3AZKD 1ZLAA 4KGCA 5DNMB 3AN2B 3O62A 1M19D 3LZ1D 5B33D 3FDDA 3AYWC 5GT3C 1P34B 1P3OD 3EPHA 2PYOA 5B1MB 3AZFD 3WAAB 1P3FA 4J8XB 5B2IB 3WA9A 4X23A 1M1AB 3REIB 3B6FA 4J8VB 3NQUB 4YM6C 3LELB 4R8PA 3W98C 4Z5TB 4UPKA 5B40B 3AL0C 1ULYA 5AV8A 3AZKC 3X1UD 5GT0B 4Z2MH 5B0ZB 3AZEA 1H3OB 3LZ1C 5CPJA 2Y2IA 5B33C 3AZGB 1M19C 1P3OC 1P3PD 3B0CT 3R45A 4KUDB 1P3IA 4H9OB 3AZHA 5AV9A 3AZFC 5G49A 2HIOD 2CV5D 3MGRD 1Q9CA 1F66A 3C1BD 1M18D 4DQYB 4JJNB 3RELB 3WKJB 4J8WB 3A6NB 3AYWA 5GT3A 3VH6T 1B67A 2BYKA 3REJB 3MVDB 2YFWB 4UUZA 3AZLB 4H9RA 3X1UC 1N1JB 5AY8A 4CAYB 5B1LD 1P3PC 3AZNB 3X1TA 5E5AB 2Y2JA 4YM6A 5AVBD 2NZDD 3W98A 1KX3A 3AN2A 2HIOC 2CV5C 2AROB 3AFAB 5AV6B 3MGRC 4DRBA 5AV5B 3C1BC 4J8UD 1M18C 2Y2NA 3AZJD 5F99D 3V9RA 5CPIB 3AZKA 5CPKA 2XD1A 5B33A 5AVCB 2VQRA 4XUJB 1P3OA 5C3IC 4Z66D 1P3AA 3VH5A 3KXBD 3W96B 4HGAB 2Y2PA 5JRGA 1P3FD 3MGPB 5B1LC 5B31B 4XZQB 4X23D 5AVBC 2NZDC 1P3KB 2JCHA 3LZ0D 5B0ZA 5KDMB 4J8UC 3AZJC 5F99C 5B2JB 3X1UA 5JA4B 3X1VB 3AZMA 3W99D 3B0DC 3KUYB 5CPJD 3AZED 2NQBB 5DNNB 1P3PA 1BH9B 4NE6A 4Z66C 3MNNB 4WU9D 3KXBC 4NE3A 3RELA 4J8WA 2HIOA 2CV5A 1P3FC 3MGRA 3C1BA 1WWSA 4X23C 5CP6B 2FJ7B 3AZLA 3B0CW 4G91B 3AV2B 3X1SB 3LZ0C 2F8NB 3H0MC 3W99C 5AY8D 2YFVB 3AZEC 5CPJC 1P3GB 5B0YD 3X1TD 1KX4D 4WU9C 5AVBA 2NZDA 4LD9B 2HUEC 1KX3D 3VH6W 3UTBB 3AN2D 4LD9C 5CHLB 5BNXA 3VH5T 4J8UA 3TU4A 4WU8B 3AZJA 5F99A 1P34D 2FFFB 5CPKD 2ZY3A 2BG1A 3EPKA 5B1MD 4J8XD 5B2ID 2IO5B 4Z66A 1P3AD 3KXBA 1P3MA 1M1AD 3REID 4J8VD 3AV1A 5AY8C 4WNNB 5JRGD 3LELD 2Y2OA 5GXQB 2J8PA 5B40D 5B0YC 3X1TC 4QLCB 3REKB 4AWLB 1KX4C 1KX5A 2G5IC 1AOIB 5B2JA 1KX3C 3AN2C 5GT0D 3LZ0A 5B0ZD 3W97B 2JSSA 5FUGB 3AZIB 1B6WA 5B32G 3H0LC 3AZGD 1P34C 5B31G 4KUDD 5CPKC 3W99A 3AZMD 5B1MC 4J8XC 5B2IC 2Y2MA 1P3AC 4WU9A 1M19B 3LZ1B 1M1AC 3REIC 4J8VC 2ZY4A 3RELD 3LELC 5JRGC 3H0RC 4J8WD 5B40C 1BH8A 3A6ND 3AZFB 1ID3B 5GSUB 4KHAA 1U35B 1EQZB 4WV4B 3NQJB 4H9PB 3REJD 3MVDD 3AZLD 5GT0C 2Y2LA 4YS3B 5B0ZC 1HQ3A 3AZGC 2DF4C 4KUDC 3AZMC 4ZBJB 3UTAB 2BYMA 3KWQB 5AV6D 5B0YA 1KX4A 5AV5D 2F8NG 3WTPB 3LJAA 5CPID 3RELC 5DNMA 4J8WC 3A6NC 5AVCD 3C1CB 3TU4D 4XUJD 1P34A 4WJ3C 1S32B 3REJC 3MVDC 1M18B 2RIQA 3AZLC 3REHB 5B1MA 3UT9B 4ZUXB 3WAAA 4J8XA 5B2IA 3MGPD 5B31D 4EO5B 1WWIA 2UWXA 2F8NK 3VH5W 4XZQD 3REIA 1P3MD 4J8VA 1M1AA 3NQUA 3LELA 3AV1D 1AOIA 3B6GB 1P3KD 4Z5TA 3KSYA 5B32B 5B40A 5AV6C 3MGSB 5AV5C 1KX5D 1TZYB 5B1LB 5CPIC 1Z2CB 4G92C 5B2JD 5GT0A 3X1VD 3KUYD 1H3OA 4H9QB 5BNVB 2NQBD 5AVCC 3TU4C 3AZGA 4CSRB 5DNND 4XUJC 1JFIB 3MNND 4KUDA 4H9NB 4H9OA 3MGQB 4HGAC 1P3BB 3F6TA 1P3LB 1ZLAB 3MGPC 4KGCB 3P5JB 3O62B 3B0DB 4XZQC 1P3MC 4JJNA 5CP6D 3WKJA 3AV1C 2FJ7D 1P3KC 5BS7C 4Z2MG 3AV2D 2PYOB 3X1SD 4YS3A 4DRAA 3A6NA 1KX5C 1P3FB 3REJA 3MVDA 1HTAA 4E45A 3WA9B 2YFWA 5B2JC 3X1VC 4X23B 1N1JA 3B6FB 3KUYC 2Y2HA 4CAYA 1HQ3D 4R8PB 2NQBC 5DNNC 1F1EA 3AZNA 3EPLA 3MNNC 1P3GD 5E5AA 5AV8B 4LD9D 1TAFB 3UTBD 2AROA 3AFAA 5AV6A 5AV5A 3AZEB 4WU8D 5CPJB 5CPIA 3LJAD 5CP6C 2FJ7C 3R45B 5DNMD 3AV2C 4G91C 1P3IB 5BO0B 3X1SC 3AZHB 5AVCA 5AV9B 4XUJA 5G49B 1F66B 3W96A 5B24B 2F8NH 4NFTA 3WAAD 1HQ3C 3MGPA 5GXQD 1P3GC 5B31A 4QLCD 3REKD 4XZQA 1AOID 3AYWB 5GT3B 3A1KA 2BYKB 1P3KA 5BS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z5T D;  2L5A A;  3UTB C;  4UUZ B;  4H9R B;  5KDM A;  5AY8 B;  3W97 D;  3AZI D;  4WU8 C;  3LJA C;  3X1T B;  5JA4 A;  3X1V A;  5DNM C;  3KUY A;  4YM6 B;  2NQB A;  1P3L A;  3W98 B;  5DNN A;  1KX3 B;  2IO5 C;  1A7W A;  1BH9 A;  3MNN A;  3V9R B;  3WAA C;  3AZK B;  5CPK B;  5GXQ C;  4QLC C;  3REK C;  4AWL C;  1ID3 D;  5B33 B;  5GSU D;  1U35 D;  5CP6 A;  4JJN D;  1P3O B;  1AOI C;  1EQZ D;  1P3A B;  2FJ7 A;  3WKJ D;  3B0B A;  3AV2 A;  4Z5T C;  3X1S A;  4YS3 D;  2F8N A;  5JRG B;  3W97 C;  3AZI C;  2YFV A;  3UTA D;  1TAF A;  3KWQ D;  1P3G A;  3AZN D;  3WTP D;  2LY8 A;  5E5A D;  4LD9 A;  3UTB A;  3X1U B;  2ARO D;  5BO0 A;  3AFA D;  3AZM B;  4WU8 A;  3C1C D;  1ID3 C;  5GSU C;  1U35 C;  1EQZ C;  4JJN C;  1S32 D;  1P3P B;  3WKJ C;  5B24 A;  3REH D;  4YS3 C;  3UT9 D;  4ZUX D;  4H9S C;  3WTP E;  5BT1 D;  2HIO B;  2CV5 B;  3MGR B;  3C1B B;  3W96 D;  3B6G D;  4WNN A;  4ZBJ C;  3UTA C;  5GXQ A;  5B32 D;  3KWQ C;  3MGS D;  3AZN C;  4QLC A;  3REK A;  3WTP C;  5E5A C;  1TZY D;  5C3I B;  2ARO C;  3AFA C;  3W97 A;  5FUG A;  3AZI A;  3C1C C;  4WZS B;  1S32 C;  3MGQ D;  2CWE A;  3REH C;  1P3B D;  5AVB B;  4ZUX C;  4G92 B;  3UT9 C;  2NZD B;  1P3L D;  5BT1 C;  1ZLA D;  4KGC D;  3O62 D;  4EO5 C;  5BNX B;  3LZ1 A;  3W96 C;  4J8U B;  3TU4 B;  1R4V A;  1M19 A;  3AZJ B;  5F99 B;  3B6G C;  2RVQ D;  5B32 C;  2PYO D;  3MGS C;  5B31 C;  3AZF A;  1ID3 A;  5GSU A;  1U35 A;  1TZY C;  1EQZ A;  3NQJ A;  4H9P A;  4Z66 B;  3WA9 D;  3KXB B;  1P3M B;  3B6F D;  4H9S A;  3AV1 B;  2F8N D;  4R8P D;  1KX5 B;  3MGQ C;  1P3B C;  5AV8 D;  3UTA A;  1P3L C;  3KWQ A;  1ZLA C;  4KGC C;  3O62 C;  3LZ0 B;  3WTP A;  1P3I D;  2RVQ C;  2PYO C;  3W99 B;  3AZH D;  3C1C A;  5AV9 D;  1S32 A;  1M18 A;  1F66 D;  4WU9 B;  3WA9 C;  3REH A;  5B24 D;  1BFM A;  3UT9 A;  4ZUX A;  3B6F C;  2HUE B;  4R8P C;  1BH8 B;  3B6G A;  3AYW D;  4KHA B;  5GT3 D;  5AV8 C;  4M6B A;  5B32 A;  4E44 A;  3MGS A;  1TZY A;  1HQ3 B;  5B1L A;  1P3I C;  4H9Q A;  4NE5 A;  3VH6 A;  5BNV A;  4YM6 D;  5AV9 C;  4CSR A;  3AZH C;  3W98 D;  2BYM B;  1JFI A;  5B0Y B;  1KU5 A;  4H9N A;  1KX4 B;  1F66 C;  3MGQ A;  5B24 C;  1P3B A;  3LJA B;  3AZK D;  1ZLA A;  4KGC A;  5DNM B;  3AN2 B;  3O62 A;  1M19 D;  3LZ1 D;  5B33 D;  1P34 B;  3AYW C;  5GT3 C;  1P3O D;  2PYO A;  5B1M B;  3AZF D;  3WAA B;  1P3F A;  4J8X B;  5B2I B;  3WA9 A;  4X23 A;  1M1A B;  3REI B;  3B6F A;  4J8V B;  3NQU B;  4YM6 C;  3LEL B;  4R8P A;  3W98 C;  4Z5T B;  5B40 B;  1ULY A;  5AV8 A;  3AZK C;  3X1U D;  5GT0 B;  4Z2M H;  5B0Z B;  3AZE A;  1H3O B;  3LZ1 C;  5CPJ A;  5B33 C;  3AZG B;  1M19 C;  1P3O C;  1P3P D;  3B0C T;  3R45 A;  4KUD B;  1P3I A;  4H9O B;  3AZH A;  5AV9 A;  3AZF C;  5G49 A;  2HIO D;  2CV5 D;  3MGR D;  1Q9C A;  1F66 A;  3C1B D;  1M18 D;  4JJN B;  3REL B;  3WKJ B;  4J8W B;  3A6N B;  3AYW A;  5GT3 A;  3VH6 T;  1B67 A;  2BYK A;  3REJ B;  3MVD B;  2YFW B;  4UUZ A;  3AZL B;  3X1U C;  4H9R A;  1N1J B;  5AY8 A;  4CAY B;  5B1L D;  1P3P C;  3AZN B;  3X1T A;  5E5A B;  4YM6 A;  5AVB D;  2NZD D;  3W98 A;  1KX3 A;  3AN2 A;  2HIO C;  2CV5 C;  2ARO B;  3AFA B;  5AV6 B;  3MGR C;  4DRB A;  5AV5 B;  3C1B C;  4J8U D;  1M18 C;  3AZJ D;  5F99 D;  3V9R A;  5CPI B;  3AZK A;  5CPK A;  5B33 A;  5AVC B;  4XUJ B;  1P3O A;  5C3I C;  4Z66 D;  1P3A A;  3VH5 A;  3KXB D;  3W96 B;  4HGA B;  5JRG A;  1P3F D;  3MGP B;  5B1L C;  5B31 B;  4XZQ B;  4X23 D;  5AVB C;  2NZD C;  1P3K B;  3LZ0 D;  5B0Z A;  5KDM B;  4J8U C;  3AZJ C;  5F99 C;  5B2J B;  3X1U A;  5JA4 B;  3X1V B;  3AZM A;  3W99 D;  3B0D C;  3KUY B;  5CPJ D;  3AZE D;  2NQB B;  5DNN B;  1P3P A;  1BH9 B;  4NE6 A;  4Z66 C;  3MNN B;  4WU9 D;  3KXB C;  4NE3 A;  3REL A;  4J8W A;  2HIO A;  2CV5 A;  1P3F C;  3MGR A;  3C1B A;  1WWS A;  4X23 C;  5CP6 B;  2FJ7 B;  3AZL A;  3B0C W;  4G91 B;  3AV2 B;  3X1S B;  3LZ0 C;  2F8N B;  3W99 C;  5AY8 D;  2YFV B;  3AZE C;  5CPJ C;  1P3G B;  5B0Y D;  3X1T D;  1KX4 D;  4WU9 C;  5AVB A;  2NZD A;  4LD9 B;  2HUE C;  1KX3 D;  3VH6 W;  3UTB B;  3AN2 D;  4LD9 C;  5CHL B;  5BNX A;  3VH5 T;  4J8U A;  3TU4 A;  4WU8 B;  3AZJ A;  5F99 A;  1P34 D;  5CPK D;  5B1M D;  4J8X D;  5B2I D;  2IO5 B;  4Z66 A;  1P3A D;  3KXB A;  1P3M A;  1M1A D;  3REI D;  4J8V D;  3AV1 A;  5AY8 C;  4WNN B;  5JRG D;  3LEL D;  5GXQ B;  5B40 D;  5B0Y C;  3X1T C;  4QLC B;  3REK B;  4AWL B;  1KX4 C;  1KX5 A;  1AOI B;  5B2J A;  1KX3 C;  3AN2 C;  5GT0 D;  3LZ0 A;  5B0Z D;  3W97 B;  2JSS A;  5FUG B;  3AZI B;  1B6W A;  5B32 G;  3AZG D;  1P34 C;  5B31 G;  4KUD D;  5CPK C;  3W99 A;  3AZM D;  5B1M C;  4J8X C;  5B2I C;  1P3A C;  4WU9 A;  1M19 B;  3LZ1 B;  1M1A C;  3REI C;  4J8V C;  3REL D;  3LEL C;  5JRG C;  4J8W D;  5B40 C;  1BH8 A;  3A6N D;  3AZF B;  1ID3 B;  5GSU B;  4KHA A;  1U35 B;  1EQZ B;  4WV4 B;  3NQJ B;  4H9P B;  3REJ D;  3MVD D;  3AZL D;  5GT0 C;  4YS3 B;  5B0Z C;  1HQ3 A;  3AZG C;  4KUD C;  3AZM C;  4ZBJ B;  3UTA B;  2BYM A;  3KWQ B;  5AV6 D;  5B0Y A;  1KX4 A;  5AV5 D;  2F8N G;  3WTP B;  3LJA A;  5CPI D;  3REL C;  5DNM A;  4J8W C;  3A6N C;  5AVC D;  3C1C B;  3TU4 D;  4XUJ D;  1P34 A;  1S32 B;  3REJ C;  3MVD C;  1M18 B;  3AZL C;  3REH B;  5B1M A;  3UT9 B;  4ZUX B;  3WAA A;  4J8X A;  5B2I A;  3MGP D;  5B31 D;  4EO5 B;  1WWI A;  2F8N K;  3VH5 W;  4XZQ D;  3REI A;  1P3M D;  4J8V A;  1M1A A;  3NQU A;  3LEL A;  3AV1 D;  1AOI A;  3B6G B;  1P3K D;  4Z5T A;  3KSY A;  5B32 B;  5B40 A;  5AV6 C;  3MGS B;  5AV5 C;  1KX5 D;  1TZY B;  5B1L B;  5CPI C;  4G92 C;  5B2J D;  5GT0 A;  3X1V D;  3KUY D;  1H3O A;  4H9Q B;  5BNV B;  2NQB D;  5AVC C;  3TU4 C;  3AZG A;  4CSR B;  5DNN D;  4XUJ C;  1JFI B;  3MNN D;  4KUD A;  4H9N B;  4H9O A;  3MGQ B;  4HGA C;  1P3B B;  1P3L B;  1ZLA B;  3MGP C;  4KGC B;  3O62 B;  3B0D B;  4XZQ C;  1P3M C;  4JJN A;  5CP6 D;  3WKJ A;  3AV1 C;  2FJ7 D;  1P3K C;  5BS7 C;  4Z2M G;  3AV2 D;  2PYO B;  3X1S D;  4YS3 A;  4DRA A;  3A6N A;  1KX5 C;  1P3F B;  3REJ A;  3MVD A;  1HTA A;  4E45 A;  3WA9 B;  2YFW A;  5B2J C;  3X1V C;  4X23 B;  1N1J A;  3B6F B;  3KUY C;  4CAY A;  1HQ3 D;  4R8P B;  2NQB C;  5DNN C;  1F1E A;  3AZN A;  1P3G D;  3MNN C;  5E5A A;  5AV8 B;  4LD9 D;  1TAF B;  3UTB D;  2ARO A;  3AFA A;  5AV6 A;  5AV5 A;  3AZE B;  4WU8 D;  5CPJ B;  5CPI A;  3LJA D;  5CP6 C;  2FJ7 C;  3R45 B;  5DNM D;  3AV2 C;  4G91 C;  1P3I B;  5BO0 B;  3X1S C;  3AZH B;  5AVC A;  5AV9 B;  4XUJ A;  5G49 B;  1F66 B;  3W96 A;  5B24 B;  2F8N H;  4NFT A;  3WAA D;  1HQ3 C;  3MGP A;  5GXQ D;  1P3G C;  5B31 A;  4QLC D;  3REK D;  4XZQ A;  1AOI D;  3AYW B;  5GT3 B;  2BYK B;  1P3K A;  5BS7 A; 
#chains in the Genus database with same CATH topology
 4Z5T D;  2L5A A;  3UTB C;  4UUZ B;  4H9R B;  5KDM A;  5AY8 B;  3W97 D;  3AZI D;  4WU8 C;  3LJA C;  1PZR A;  3X1T B;  5JA4 A;  3X1V A;  5DNM C;  3KUY A;  4YM6 B;  2NQB A;  1P3L A;  3W98 B;  5DNN A;  1KX3 B;  2IO5 C;  1A7W A;  1BH9 A;  3MNN A;  2XD5 A;  3V9R B;  3WAA C;  3AZK B;  5CPK B;  5GXQ C;  4QLC C;  3REK C;  4AWL C;  1ID3 D;  5B33 B;  5GSU D;  1U35 D;  5CP6 A;  4JJN D;  1P3O B;  1AOI C;  1EQZ D;  1P3A B;  2FJ7 A;  3WKJ D;  3B0B A;  3AV2 A;  4Z5T C;  3X1S A;  4YS3 D;  2F8N A;  5JRG B;  3W97 C;  3AZI C;  2ZY2 A;  2G5H C;  1T3U A;  2YFV A;  3UTA D;  1TAF A;  3A1I A;  3KWQ D;  1P3G A;  3AZN D;  3WTP D;  2LY8 A;  5E5A D;  4LD9 A;  3UTB A;  1W2E A;  3IP4 C;  2ARO D;  5BO0 A;  3X1U B;  3AFA D;  3AZM B;  4WU8 A;  3C1C D;  1ID3 C;  5GSU C;  1U35 C;  1EQZ C;  4JJN C;  1S32 D;  1P3P B;  3WKJ C;  2ZM5 A;  5B24 A;  3REH D;  4YS3 C;  3UT9 D;  4ZUX D;  4H9S C;  2JE5 A;  3WTP E;  5BT1 D;  2HIO B;  2CV5 B;  3MGR B;  3C1B B;  3W96 D;  3B6G D;  4WNN A;  4ZBJ C;  3UTA C;  5GXQ A;  5B32 D;  3KWQ C;  3MGS D;  3AZN C;  4QLC A;  3REK A;  3WTP C;  5E5A C;  1TZY D;  5C3I B;  2ARO C;  3AFA C;  3W97 A;  5FUG A;  3AZI A;  3C1C C;  4WZS B;  1S32 C;  2W8S A;  3MGQ D;  2CWE A;  3REH C;  1P3B D;  5AVB B;  4ZUX C;  4G92 B;  3UT9 C;  2NZD B;  1P3L D;  5BT1 C;  1ZLA D;  4KGC D;  3O62 D;  4EO5 C;  5BNX B;  3LZ1 A;  3W96 C;  4J8U B;  3TU4 B;  1R4V A;  1M19 A;  2Y2Q A;  3AZJ B;  5F99 B;  3B6G C;  2F2A C;  2Y2G A;  2ZY5 A;  2RVQ D;  5B32 C;  2PYO D;  3MGS C;  5B31 C;  3AZF A;  1ID3 A;  3EG5 B;  5GSU A;  1TZY C;  1U35 A;  1EQZ A;  3NQJ A;  4H9P A;  4Z66 B;  3WA9 D;  3KXB B;  1P3M B;  3B6F D;  4H9S A;  3AV1 B;  2F8N D;  4R8P D;  1KX5 B;  3MGQ C;  1P3B C;  5AV8 D;  3UTA A;  1P3L C;  3KWQ A;  1ZLA C;  4KGC C;  3O62 C;  3LZ0 B;  3WTP A;  1P3I D;  2RVQ C;  2PYO C;  3W99 B;  3AZH D;  3C1C A;  3KFU G;  5AV9 D;  1S32 A;  1M18 A;  1F66 D;  4WU9 B;  3WA9 C;  3REH A;  5B24 D;  1BFM A;  3EPJ A;  3UT9 A;  4ZUX A;  3B6F C;  2HUE B;  4R8P C;  1BH8 B;  3B6G A;  3AYW D;  4KHA B;  5GT3 D;  5AV8 C;  2DQN C;  4M6B A;  5B32 A;  4E44 A;  3MGS A;  1TZY A;  1HQ3 B;  5B1L A;  1P3I C;  4H9Q A;  4NE5 A;  3VH6 A;  5BNV A;  4YM6 D;  5AV9 C;  4CSR A;  3AZH C;  3W98 D;  2BYM B;  1JFI A;  2Y2K A;  5B0Y B;  1KU5 A;  4H9N A;  1KX4 B;  1F66 C;  3MGQ A;  5B24 C;  1P3B A;  3LJA B;  3AZK D;  1ZLA A;  4KGC A;  5DNM B;  3AN2 B;  3O62 A;  1M19 D;  3LZ1 D;  5B33 D;  3FDD A;  3AYW C;  5GT3 C;  1P34 B;  1P3O D;  3EPH A;  2PYO A;  5B1M B;  3AZF D;  3WAA B;  1P3F A;  4J8X B;  5B2I B;  3WA9 A;  4X23 A;  1M1A B;  3REI B;  3B6F A;  4J8V B;  3NQU B;  4YM6 C;  3LEL B;  4R8P A;  3W98 C;  4Z5T B;  4UPK A;  5B40 B;  3AL0 C;  1ULY A;  5AV8 A;  3AZK C;  3X1U D;  5GT0 B;  4Z2M H;  5B0Z B;  3AZE A;  1H3O B;  3LZ1 C;  5CPJ A;  2Y2I A;  5B33 C;  3AZG B;  1M19 C;  1P3O C;  1P3P D;  3B0C T;  3R45 A;  4KUD B;  1P3I A;  4H9O B;  3AZH A;  5AV9 A;  3AZF C;  5G49 A;  2HIO D;  2CV5 D;  3MGR D;  1Q9C A;  1F66 A;  3C1B D;  1M18 D;  4DQY B;  4JJN B;  3REL B;  3WKJ B;  4J8W B;  3A6N B;  3AYW A;  5GT3 A;  3VH6 T;  1B67 A;  2BYK A;  3REJ B;  3MVD B;  2YFW B;  4UUZ A;  3AZL B;  4H9R A;  3X1U C;  1N1J B;  5AY8 A;  4CAY B;  5B1L D;  1P3P C;  3AZN B;  3X1T A;  5E5A B;  2Y2J A;  4YM6 A;  5AVB D;  2NZD D;  3W98 A;  1KX3 A;  3AN2 A;  2HIO C;  2CV5 C;  2ARO B;  3AFA B;  5AV6 B;  3MGR C;  4DRB A;  5AV5 B;  3C1B C;  4J8U D;  1M18 C;  2Y2N A;  3AZJ D;  5F99 D;  3V9R A;  5CPI B;  3AZK A;  5CPK A;  2XD1 A;  5B33 A;  5AVC B;  2VQR A;  4XUJ B;  1P3O A;  5C3I C;  4Z66 D;  1P3A A;  3VH5 A;  3KXB D;  3W96 B;  4HGA B;  2Y2P A;  5JRG A;  1P3F D;  3MGP B;  5B1L C;  5B31 B;  4XZQ B;  4X23 D;  5AVB C;  2NZD C;  1P3K B;  2JCH A;  3LZ0 D;  5B0Z A;  5KDM B;  4J8U C;  3AZJ C;  5F99 C;  5B2J B;  3X1U A;  5JA4 B;  3X1V B;  3AZM A;  3W99 D;  3B0D C;  3KUY B;  5CPJ D;  3AZE D;  2NQB B;  5DNN B;  1P3P A;  1BH9 B;  4NE6 A;  4Z66 C;  3MNN B;  4WU9 D;  3KXB C;  4NE3 A;  3REL A;  4J8W A;  2HIO A;  2CV5 A;  1P3F C;  3MGR A;  3C1B A;  1WWS A;  4X23 C;  5CP6 B;  2FJ7 B;  3AZL A;  3B0C W;  4G91 B;  3AV2 B;  3X1S B;  3LZ0 C;  2F8N B;  3H0M C;  3W99 C;  5AY8 D;  2YFV B;  3AZE C;  5CPJ C;  1P3G B;  5B0Y D;  3X1T D;  1KX4 D;  4WU9 C;  5AVB A;  2NZD A;  4LD9 B;  2HUE C;  1KX3 D;  3VH6 W;  3UTB B;  3AN2 D;  4LD9 C;  5CHL B;  5BNX A;  3VH5 T;  4J8U A;  3TU4 A;  4WU8 B;  3AZJ A;  5F99 A;  1P34 D;  2FFF B;  5CPK D;  2ZY3 A;  2BG1 A;  3EPK A;  5B1M D;  4J8X D;  5B2I D;  2IO5 B;  4Z66 A;  1P3A D;  3KXB A;  1P3M A;  1M1A D;  3REI D;  4J8V D;  3AV1 A;  5AY8 C;  4WNN B;  5JRG D;  3LEL D;  2Y2O A;  5GXQ B;  2J8P A;  5B40 D;  5B0Y C;  3X1T C;  4QLC B;  3REK B;  4AWL B;  1KX4 C;  1KX5 A;  2G5I C;  1AOI B;  5B2J A;  1KX3 C;  3AN2 C;  5GT0 D;  3LZ0 A;  5B0Z D;  3W97 B;  2JSS A;  5FUG B;  3AZI B;  1B6W A;  5B32 G;  3H0L C;  3AZG D;  1P34 C;  5B31 G;  4KUD D;  5CPK C;  3W99 A;  3AZM D;  5B1M C;  4J8X C;  5B2I C;  2Y2M A;  1P3A C;  4WU9 A;  1M19 B;  3LZ1 B;  1M1A C;  3REI C;  4J8V C;  2ZY4 A;  3REL D;  3LEL C;  5JRG C;  3H0R C;  4J8W D;  5B40 C;  1BH8 A;  3A6N D;  3AZF B;  1ID3 B;  5GSU B;  4KHA A;  1U35 B;  1EQZ B;  4WV4 B;  3NQJ B;  4H9P B;  3REJ D;  3MVD D;  3AZL D;  5GT0 C;  2Y2L A;  4YS3 B;  5B0Z C;  1HQ3 A;  3AZG C;  2DF4 C;  4KUD C;  3AZM C;  4ZBJ B;  3UTA B;  2BYM A;  3KWQ B;  5AV6 D;  5B0Y A;  1KX4 A;  5AV5 D;  2F8N G;  3WTP B;  3LJA A;  5CPI D;  3REL C;  5DNM A;  4J8W C;  3A6N C;  5AVC D;  3C1C B;  3TU4 D;  4XUJ D;  1P34 A;  4WJ3 C;  1S32 B;  3REJ C;  3MVD C;  1M18 B;  2RIQ A;  3AZL C;  3REH B;  5B1M A;  3UT9 B;  4ZUX B;  3WAA A;  4J8X A;  5B2I A;  3MGP D;  5B31 D;  4EO5 B;  1WWI A;  2UWX A;  2F8N K;  3VH5 W;  4XZQ D;  3REI A;  1P3M D;  4J8V A;  1M1A A;  3NQU A;  3LEL A;  3AV1 D;  1AOI A;  3B6G B;  1P3K D;  4Z5T A;  3KSY A;  5B32 B;  5B40 A;  5AV6 C;  3MGS B;  5AV5 C;  1KX5 D;  1TZY B;  5B1L B;  5CPI C;  1Z2C B;  4G92 C;  5B2J D;  5GT0 A;  3X1V D;  3KUY D;  1H3O A;  4H9Q B;  5BNV B;  2NQB D;  5AVC C;  3TU4 C;  3AZG A;  4CSR B;  5DNN D;  4XUJ C;  1JFI B;  3MNN D;  4KUD A;  4H9N B;  4H9O A;  3MGQ B;  4HGA C;  1P3B B;  3F6T A;  1P3L B;  1ZLA B;  3MGP C;  4KGC B;  3P5J B;  3O62 B;  3B0D B;  4XZQ C;  1P3M C;  4JJN A;  5CP6 D;  3WKJ A;  3AV1 C;  2FJ7 D;  1P3K C;  5BS7 C;  4Z2M G;  3AV2 D;  2PYO B;  3X1S D;  4YS3 A;  4DRA A;  3A6N A;  1KX5 C;  1P3F B;  3REJ A;  3MVD A;  1HTA A;  4E45 A;  3WA9 B;  2YFW A;  5B2J C;  3X1V C;  4X23 B;  1N1J A;  3B6F B;  3KUY C;  2Y2H A;  4CAY A;  1HQ3 D;  4R8P B;  2NQB C;  5DNN C;  1F1E A;  3AZN A;  3EPL A;  3MNN C;  1P3G D;  5E5A A;  5AV8 B;  4LD9 D;  1TAF B;  3UTB D;  2ARO A;  3AFA A;  5AV6 A;  5AV5 A;  3AZE B;  4WU8 D;  5CPJ B;  5CPI A;  3LJA D;  5CP6 C;  2FJ7 C;  3R45 B;  5DNM D;  3AV2 C;  4G91 C;  1P3I B;  5BO0 B;  3X1S C;  3AZH B;  5AVC A;  5AV9 B;  4XUJ A;  5G49 B;  1F66 B;  3W96 A;  5B24 B;  2F8N H;  4NFT A;  3WAA D;  1HQ3 C;  3MGP A;  5GXQ D;  1P3G C;  5B31 A;  4QLC D;  3REK D;  4XZQ A;  1AOI D;  3AYW B;  5GT3 B;  3A1K A;  2BYK B;  1P3K A;  5BS7 A; 
#chains in the Genus database with same CATH homology
 4Z5T D;  2L5A A;  3UTB C;  4UUZ B;  4H9R B;  5KDM A;  5AY8 B;  3W97 D;  3AZI D;  4WU8 C;  3LJA C;  1PZR A;  3X1T B;  5JA4 A;  3X1V A;  5DNM C;  3KUY A;  4YM6 B;  2NQB A;  1P3L A;  3W98 B;  5DNN A;  1KX3 B;  2IO5 C;  1A7W A;  1BH9 A;  3MNN A;  2XD5 A;  3V9R B;  3WAA C;  3AZK B;  5CPK B;  5GXQ C;  4QLC C;  3REK C;  4AWL C;  1ID3 D;  5B33 B;  5GSU D;  1U35 D;  5CP6 A;  4JJN D;  1P3O B;  1AOI C;  1EQZ D;  1P3A B;  2FJ7 A;  3WKJ D;  3B0B A;  3AV2 A;  4Z5T C;  3X1S A;  4YS3 D;  2F8N A;  5JRG B;  3W97 C;  3AZI C;  2ZY2 A;  2G5H C;  1T3U A;  2YFV A;  3UTA D;  1TAF A;  3A1I A;  3KWQ D;  1P3G A;  3AZN D;  3WTP D;  2LY8 A;  5E5A D;  4LD9 A;  3UTB A;  1W2E A;  3IP4 C;  2ARO D;  5BO0 A;  3X1U B;  3AFA D;  3AZM B;  4WU8 A;  3C1C D;  1ID3 C;  5GSU C;  1U35 C;  1EQZ C;  4JJN C;  1S32 D;  1P3P B;  3WKJ C;  2ZM5 A;  5B24 A;  3REH D;  4YS3 C;  3UT9 D;  4ZUX D;  4H9S C;  2JE5 A;  3WTP E;  5BT1 D;  2HIO B;  2CV5 B;  3MGR B;  3C1B B;  3W96 D;  3B6G D;  4WNN A;  4ZBJ C;  3UTA C;  5GXQ A;  5B32 D;  3KWQ C;  3MGS D;  3AZN C;  4QLC A;  3REK A;  3WTP C;  5E5A C;  1TZY D;  5C3I B;  2ARO C;  3AFA C;  3W97 A;  5FUG A;  3AZI A;  3C1C C;  4WZS B;  1S32 C;  2W8S A;  3MGQ D;  2CWE A;  3REH C;  1P3B D;  5AVB B;  4ZUX C;  4G92 B;  3UT9 C;  2NZD B;  1P3L D;  5BT1 C;  1ZLA D;  4KGC D;  3O62 D;  4EO5 C;  5BNX B;  3LZ1 A;  3W96 C;  4J8U B;  3TU4 B;  1R4V A;  1M19 A;  2Y2Q A;  3AZJ B;  5F99 B;  3B6G C;  2F2A C;  2Y2G A;  2ZY5 A;  2RVQ D;  5B32 C;  2PYO D;  3MGS C;  5B31 C;  3AZF A;  1ID3 A;  3EG5 B;  5GSU A;  1TZY C;  1U35 A;  1EQZ A;  3NQJ A;  4H9P A;  4Z66 B;  3WA9 D;  3KXB B;  1P3M B;  3B6F D;  4H9S A;  3AV1 B;  2F8N D;  4R8P D;  1KX5 B;  3MGQ C;  1P3B C;  5AV8 D;  3UTA A;  1P3L C;  3KWQ A;  1ZLA C;  4KGC C;  3O62 C;  3LZ0 B;  3WTP A;  1P3I D;  2RVQ C;  2PYO C;  3W99 B;  3AZH D;  3C1C A;  3KFU G;  5AV9 D;  1S32 A;  1M18 A;  1F66 D;  4WU9 B;  3WA9 C;  3REH A;  5B24 D;  1BFM A;  3EPJ A;  3UT9 A;  4ZUX A;  3B6F C;  2HUE B;  4R8P C;  1BH8 B;  3B6G A;  3AYW D;  4KHA B;  5GT3 D;  5AV8 C;  2DQN C;  4M6B A;  5B32 A;  4E44 A;  3MGS A;  1TZY A;  1HQ3 B;  5B1L A;  1P3I C;  4H9Q A;  4NE5 A;  3VH6 A;  5BNV A;  4YM6 D;  5AV9 C;  4CSR A;  3AZH C;  3W98 D;  2BYM B;  1JFI A;  2Y2K A;  5B0Y B;  1KU5 A;  4H9N A;  1KX4 B;  1F66 C;  3MGQ A;  5B24 C;  1P3B A;  3LJA B;  3AZK D;  1ZLA A;  4KGC A;  5DNM B;  3AN2 B;  3O62 A;  1M19 D;  3LZ1 D;  5B33 D;  3FDD A;  3AYW C;  5GT3 C;  1P34 B;  1P3O D;  3EPH A;  2PYO A;  5B1M B;  3AZF D;  3WAA B;  1P3F A;  4J8X B;  5B2I B;  3WA9 A;  4X23 A;  1M1A B;  3REI B;  3B6F A;  4J8V B;  3NQU B;  4YM6 C;  3LEL B;  4R8P A;  3W98 C;  4Z5T B;  4UPK A;  5B40 B;  3AL0 C;  1ULY A;  5AV8 A;  3AZK C;  3X1U D;  5GT0 B;  4Z2M H;  5B0Z B;  3AZE A;  1H3O B;  3LZ1 C;  5CPJ A;  2Y2I A;  5B33 C;  3AZG B;  1M19 C;  1P3O C;  1P3P D;  3B0C T;  3R45 A;  4KUD B;  1P3I A;  4H9O B;  3AZH A;  5AV9 A;  3AZF C;  5G49 A;  2HIO D;  2CV5 D;  3MGR D;  1Q9C A;  1F66 A;  3C1B D;  1M18 D;  4DQY B;  4JJN B;  3REL B;  3WKJ B;  4J8W B;  3A6N B;  3AYW A;  5GT3 A;  3VH6 T;  1B67 A;  2BYK A;  3REJ B;  3MVD B;  2YFW B;  4UUZ A;  3AZL B;  4H9R A;  3X1U C;  1N1J B;  5AY8 A;  4CAY B;  5B1L D;  1P3P C;  3AZN B;  3X1T A;  5E5A B;  2Y2J A;  4YM6 A;  5AVB D;  2NZD D;  3W98 A;  1KX3 A;  3AN2 A;  2HIO C;  2CV5 C;  2ARO B;  3AFA B;  5AV6 B;  3MGR C;  4DRB A;  5AV5 B;  3C1B C;  4J8U D;  1M18 C;  2Y2N A;  3AZJ D;  5F99 D;  3V9R A;  5CPI B;  3AZK A;  5CPK A;  2XD1 A;  5B33 A;  5AVC B;  2VQR A;  4XUJ B;  1P3O A;  5C3I C;  4Z66 D;  1P3A A;  3VH5 A;  3KXB D;  3W96 B;  4HGA B;  2Y2P A;  5JRG A;  1P3F D;  3MGP B;  5B1L C;  5B31 B;  4XZQ B;  4X23 D;  5AVB C;  2NZD C;  1P3K B;  2JCH A;  3LZ0 D;  5B0Z A;  5KDM B;  4J8U C;  3AZJ C;  5F99 C;  5B2J B;  3X1U A;  5JA4 B;  3X1V B;  3AZM A;  3W99 D;  3B0D C;  3KUY B;  5CPJ D;  3AZE D;  2NQB B;  5DNN B;  1P3P A;  1BH9 B;  4NE6 A;  4Z66 C;  3MNN B;  4WU9 D;  3KXB C;  4NE3 A;  3REL A;  4J8W A;  2HIO A;  2CV5 A;  1P3F C;  3MGR A;  3C1B A;  1WWS A;  4X23 C;  5CP6 B;  2FJ7 B;  3AZL A;  3B0C W;  4G91 B;  3AV2 B;  3X1S B;  3LZ0 C;  2F8N B;  3H0M C;  3W99 C;  5AY8 D;  2YFV B;  3AZE C;  5CPJ C;  1P3G B;  5B0Y D;  3X1T D;  1KX4 D;  4WU9 C;  5AVB A;  2NZD A;  4LD9 B;  2HUE C;  1KX3 D;  3VH6 W;  3UTB B;  3AN2 D;  4LD9 C;  5CHL B;  5BNX A;  3VH5 T;  4J8U A;  3TU4 A;  4WU8 B;  3AZJ A;  5F99 A;  1P34 D;  2FFF B;  5CPK D;  2ZY3 A;  2BG1 A;  3EPK A;  5B1M D;  4J8X D;  5B2I D;  2IO5 B;  4Z66 A;  1P3A D;  3KXB A;  1P3M A;  1M1A D;  3REI D;  4J8V D;  3AV1 A;  5AY8 C;  4WNN B;  5JRG D;  3LEL D;  2Y2O A;  5GXQ B;  2J8P A;  5B40 D;  5B0Y C;  3X1T C;  4QLC B;  3REK B;  4AWL B;  1KX4 C;  1KX5 A;  2G5I C;  1AOI B;  5B2J A;  1KX3 C;  3AN2 C;  5GT0 D;  3LZ0 A;  5B0Z D;  3W97 B;  2JSS A;  5FUG B;  3AZI B;  1B6W A;  5B32 G;  3H0L C;  3AZG D;  1P34 C;  5B31 G;  4KUD D;  5CPK C;  3W99 A;  3AZM D;  5B1M C;  4J8X C;  5B2I C;  2Y2M A;  1P3A C;  4WU9 A;  1M19 B;  3LZ1 B;  1M1A C;  3REI C;  4J8V C;  2ZY4 A;  3REL D;  3LEL C;  5JRG C;  3H0R C;  4J8W D;  5B40 C;  1BH8 A;  3A6N D;  3AZF B;  1ID3 B;  5GSU B;  4KHA A;  1U35 B;  1EQZ B;  4WV4 B;  3NQJ B;  4H9P B;  3REJ D;  3MVD D;  3AZL D;  5GT0 C;  2Y2L A;  4YS3 B;  5B0Z C;  1HQ3 A;  3AZG C;  2DF4 C;  4KUD C;  3AZM C;  4ZBJ B;  3UTA B;  2BYM A;  3KWQ B;  5AV6 D;  5B0Y A;  1KX4 A;  5AV5 D;  2F8N G;  3WTP B;  3LJA A;  5CPI D;  3REL C;  5DNM A;  4J8W C;  3A6N C;  5AVC D;  3C1C B;  3TU4 D;  4XUJ D;  1P34 A;  4WJ3 C;  1S32 B;  3REJ C;  3MVD C;  1M18 B;  2RIQ A;  3AZL C;  3REH B;  5B1M A;  3UT9 B;  4ZUX B;  3WAA A;  4J8X A;  5B2I A;  3MGP D;  5B31 D;  4EO5 B;  1WWI A;  2UWX A;  2F8N K;  3VH5 W;  4XZQ D;  3REI A;  1P3M D;  4J8V A;  1M1A A;  3NQU A;  3LEL A;  3AV1 D;  1AOI A;  3B6G B;  1P3K D;  4Z5T A;  3KSY A;  5B32 B;  5B40 A;  5AV6 C;  3MGS B;  5AV5 C;  1KX5 D;  1TZY B;  5B1L B;  5CPI C;  1Z2C B;  4G92 C;  5B2J D;  5GT0 A;  3X1V D;  3KUY D;  1H3O A;  4H9Q B;  5BNV B;  2NQB D;  5AVC C;  3TU4 C;  3AZG A;  4CSR B;  5DNN D;  4XUJ C;  1JFI B;  3MNN D;  4KUD A;  4H9N B;  4H9O A;  3MGQ B;  4HGA C;  1P3B B;  3F6T A;  1P3L B;  1ZLA B;  3MGP C;  4KGC B;  3P5J B;  3O62 B;  3B0D B;  4XZQ C;  1P3M C;  4JJN A;  5CP6 D;  3WKJ A;  3AV1 C;  2FJ7 D;  1P3K C;  5BS7 C;  4Z2M G;  3AV2 D;  2PYO B;  3X1S D;  4YS3 A;  4DRA A;  3A6N A;  1KX5 C;  1P3F B;  3REJ A;  3MVD A;  1HTA A;  4E45 A;  3WA9 B;  2YFW A;  5B2J C;  3X1V C;  4X23 B;  1N1J A;  3B6F B;  3KUY C;  2Y2H A;  4CAY A;  1HQ3 D;  4R8P B;  2NQB C;  5DNN C;  1F1E A;  3AZN A;  3EPL A;  3MNN C;  1P3G D;  5E5A A;  5AV8 B;  4LD9 D;  1TAF B;  3UTB D;  2ARO A;  3AFA A;  5AV6 A;  5AV5 A;  3AZE B;  4WU8 D;  5CPJ B;  5CPI A;  3LJA D;  5CP6 C;  2FJ7 C;  3R45 B;  5DNM D;  3AV2 C;  4G91 C;  1P3I B;  5BO0 B;  3X1S C;  3AZH B;  5AVC A;  5AV9 B;  4XUJ A;  5G49 B;  1F66 B;  3W96 A;  5B24 B;  2F8N H;  4NFT A;  3WAA D;  1HQ3 C;  3MGP A;  5GXQ D;  1P3G C;  5B31 A;  4QLC D;  3REK D;  4XZQ A;  1AOI D;  3AYW B;  5GT3 B;  3A1K A;  2BYK B;  1P3K A;  5BS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...