3WA9B

The nucleosome containing human h2a.z.1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wa9B00
5JA4A 2HIOA 3B0DB 3UTAC 5B24B 3O62D 1P3OB 3REHB 3KWQB 5AVCB 5B31C 3MGPB 5B40B 5DNND 4G92C 5GSUD 5AV9A 2CV5D 5AV5B 1ZLAB 4YM6A 3REHC 3AZFA 3WAAB 5AVCC 3MGPC 2BYMB 4H9SC 3VH5A 5FUGB 3REKD 5AY8C 5CPJD 4KHAB 3X1TC 1HQ3D 3AZEB 5AV5C 4R8PC 5B2JA 2FJ7D 1KX3B 5E5AD 4HGAC 3UTBD 3AZNB 3B0BA 1ID3C 5BNVA 1AOIA 4WU9B 3WKJC 1P3PA 1KX4C 1P3GD 4DRBA 4QLCD 4CAYA 1B67A 3WA9C 3AZIB 5B2ID 5GT3B 3W96D 5BO0B 4JJND 3KUYD 2NZDD 3VH6T 2F8NB 3WTPA 1R4VA 3RELB 4WNNB 3AN2D 3B0CT 3AZMC 3B6GA 5BS7C 4YS3A 1EQZC 5BNXA 4NFTA 1U35A 3MGSB 5AV6A 4J8VB 2HIOB 4ZUXD 2PYOA 1P3MA 5G49B 2NQBD 3TU4B 3LJAA 1P3KB 3KXBA 3AFAB 4J8XB 4Z66B 1P3AA 3X1SA 3AZLB 5JRGD 5B0YA 5AV9B 1M19D 4XUJD 5CP6B 3W97C 5AV8C 1ULYA 2F8NH 3AZGB 3AZMD 3AZFB 3AZKA 4WU8C 4J8XC 5GT0B 3NQUA 3AZLC 3AV1A 5CPKB 4EO5B 4X23A 1EQZD 5DNMB 3MVDD 3AZHD 3X1VD 3UT9C 1P3BC 3AYWB 5B33D 5CP6C 3LZ0D 2IO5C 5B24A 3AZGC 1P3OA 3C1CB 3REHA 4E44A 4XZQB 5CPIC 3KWQA 5AVCA 3MGPA 5B40A 4EO5C 4Z5TB 4H9SA 3B6FD 1P34C 3X1TA 5AV8D 4AWLC 1P3ID 1M18B 5AV5A 3REIC 1P3FB 5AVBB 1ZLAA 3WAAA 3A6NC 2BYMA 5B1LB 4J8UD 1KX5B 3W98C 2YFWA 5FUGA 3WTPB 4KHAA 4UUZB 3AV2B 1P3BD 4KUDD 3AZEA 1M18C 5B1MD 2AROD 1KX3A 3LELB 5AV6B 3C1BC 3MNND 1P3LB 3W99C 2CV5B 5GXQB 3O62C 4J8WC 4M6BA 4H9OB 5F99D 5DNNC 3MGRB 3REKB 5GSUC 5GT3A 5BO0A 3UTAB 2F8NA 2CV5C 2FJ7B 3RELA 4WNNA 5B31B 3C1BD 5B32G 4G92B 5CPJC 3MGSA 4J8VA 1HQ3C 4LD9D 3W99D 5G49A 5B2JD 2FJ7C 4J8WD 1P3GB 5E5AC 3TU4A 3UTBC 1P3KA 3AFAA 4J8XA 4Z66A 4Z2MH 5B2IB 3AZLA 2HUEB 5AY8B 3X1TB 3LZ1D 3AN2B 5CP6A 4R8PB 1P3GC 4HGAB 4QLCC 3AZGA 4G91C 5CPIA 5GT0A 2CWEA 1ID3B 2YFWB 4H9RB 3W96C 5B2IC 2HUEC 4ZUXB 5CPKA 5DNMA 4JJNC 3KUYC 3X1UD 2NZDC 3WKJB 1KX4B 3AN2C 5KDMA 2L5AA 3AYWA 3B6GD 3C1CA 4YS3D 4XZQA 3WA9B 1TZYD 1F66D 4ZUXC 4H9PB 4Z5TA 3W98A 1JFIB 2NQBC 3AZMB 3LJAD 3REJC 2BYKB 1M18A 1P3FA 5AVBA 5B0ZC 1EQZB 3MVDB 5JRGC 5B1LA 3V9RB 5B0YD 2YFVB 1M19C 1KX5A 4XUJC 4UUZA 3AV2A 3O62A 3AV1D 5CHLB 5BT1D 4X23D 3LELA 5DNNA 3MGQD 3MVDC 3AZHC 3B6FB 3X1VC 3W97B 5B33C 3LZ0C 5AV8B 1P3LA 5B24D 2CV5A 5GXQA 1P3OD 4WU8B 3REJD 4H9OA 5B0ZD 4J8UB 3MGRA 1S32D 3B6FC 3VH5W 3REKA 3UT9B 1P3BB 4KUDB 2IO5B 3UTAA 1P3IC 2FJ7A 3AZJD 5CPIB 3REKC 5B31A 1H3OB 4J8UC 3NQJB 1M1AD 1P34B 5C3IC 3MNNB 5KDMB 4KUDC 4AWLB 3REIB 5B1MC 1P3GA 2AROC 3A6NB 3AZND 3W98B 5B2IA 5AY8A 3MNNC 4WU9D 2NZDA 3AN2A 4R8PA 5B32D 5F99C 3C1BB 3AZID 1ID3A 5GT3D 4H9RA 4ZUXA 4LD9B 2F8ND 3W99B 3WKJA 3RELD 3O62B 4J8WB 1KX4A 4YM6C 5DNNB 4CSRB 3WA9A 5GSUB 4J8VD 2HIOD 3LZ1B 4LD9C 4H9PA 1BH8B 4XUJA 5B2JC 1JFIA 3TU4D 3AZMA 3KSYA 2BYKA 4Z66D 5BS7A 4KGCB 1EQZA 5CPJB 3MVDA 3X1UB 1AOIC 5AV9D 1HQ3B 3V9RA 2YFVA 3LZ1C 1P3PC 3LZ0A 4NE3A 4YM6D 5E5AB 3AZFD 3UTBB 5GT0D 3WTPE 5CPKD 4KGCC 5DNMD 3B6FA 4H9NB 3X1UC 3AYWD 3W97A 3B6GC 5AV8A 2F8NG 1HTAA 4ZBJC 4QLCB 4WU8A 3C1CD 4G91B 4XZQD 4YS3C 1TZYC 3VH6W 4J8UA 1F66C 4Z5TD 3W96B 4JJNB 3KUYB 1AOID 2NZDB 3B0CW 1P3PD 3UT9A 3R45B 1P3BA 4KUDA 3LJAC 3X1SC 5AVBD 1WWIA 1H3OA 1N1JB 5B0YC 3NQJA 1KX5D 1P34A 1BH9B 3WTPD 3MNNA 3AV2D 2NQBB 4KGCD 3AZKC 3REJB 3REIA 5B0ZB 5BT1C 3AV1C 5F99A 4X23C 3LELD 1U35D 3A6NA 1S32B 5AV6D 3MGQC 5JRGB 2PYOD 1M19B 1P3MD 4XUJB 1TAFB 3B0DC 1P3LD 5GXQD 5B24C 1P3OC 3AZJB 3KXBD 1P3AD 3X1SD 3KWQC 2JSSA 5B40C 3MGRD 1M1AB 3AZHB 3C1BA 1S32C 2RVQC 3X1VB 5B33B 3LZ0B 3UTAD 4LD9A 3W99A 3AZKD 4J8WA 3AZJC 1ZLAC 3WAAC 5B31D 1M1AC 4CSRA 5GSUA 3LZ1A 1BH8A 3AZEC 1P3IB 3REHD 1KX3C 5B32B 3KWQD 5AVCD 3MGPD 3AZNC 5B40D 5C3IB 2RVQD 5AY8D 3X1TD 5CPJA 4KGCA 4H9QB 3X1UA 4WU9C 2F8NK 1HQ3A 5AV5D 4R8PD 5B1MB 1ZLAD 2AROB 3WAAD 5E5AA 5B32C 3UTBA 1ID3D 3AZIC 4Z2MG 5JA4B 1TZYA 5GT3C 1F66A 4H9NA 3WKJD 3RELC 1KX4D 3AZED 1KX3D 5F99B 4QLCA 5B31G 3WA9D 3MGSC 4J8VC 2HIOC 3W96A 4JJNA 3KUYA 1F1EA 3R45A 4YM6B 3TU4C 1P3KC 3AFAC 4Z66C 2LY8A 3MGQA 1N1JA 5AV9C 1BH9A 5B2JB 2NQBA 3AZFC 1BFMA 3REJA 5GT0C 5B0ZA 5CPKC 5DNMC 3MGSD 5BNVB 1S32A 1AOIB 5JRGA 1P3PB 1M19A 3W97D 3AYWC 1TAFA 4WU8D 1WWSA 4DRAA 3AZJA 3C1CC 3AFAD 4J8XD 1P3KD 4CAYB 4XZQC 4WZSB 4NE6A 3VH6A 3AZLD 4Z5TC 1M1AA 3AZHA 3UT9D 3X1VA 3VH5T 5CP6D 5B33A 3B6GB 1A7WA 3AZGD 4ZBJB 1P3FC 5AVBC 4YS3B 5CPID 5BNXB 1U35B 3AZNA 1TZYB 5B1LC 2PYOB 1F66B 1P3MB 1P34D 1KX5C 3WTPC 3AV2C 1Q9CA 4WU9A 3LJAB 3KXBB 1P3IA 1P3AB 3X1SB 3REID 1KU5A 5B32A 3LELC 1U35C 3A6ND 5AV6C 4E45A 5B0YB 2PYOC 1B6WA 3AZIA 1P3MC 3W98D 4WV4B 4NE5A 1P3LC 4H9QA 5GXQC 3AZKB 3KXBC 1M18D 1P3AC 1P3FD 3NQUB 5B1MA 3AV1B 2AROA 4X23B 3MGRC 3MGQB 5B1LD
chains in the Genus database with same CATH superfamily
5JA4A 2HIOA 3B0DB 2DF4C 3UTAC 5B24B 3O62D 1P3OB 3REHB 3KWQB 5AVCB 5B31C 3MGPB 5B40B 5DNND 4G92C 5GSUD 5AV9A 2CV5D 5AV5B 2F2AC 1ZLAB 4YM6A 3REHC 3AZFA 3WAAB 5AVCC 3MGPC 2BYMB 4H9SC 3VH5A 5FUGB 3REKD 5AY8C 5CPJD 4KHAB 3X1TC 1HQ3D 3AZEB 5AV5C 4R8PC 5B2JA 2FJ7D 2G5IC 1KX3B 5E5AD 1PZRA 4HGAC 3UTBD 3AZNB 3B0BA 1ID3C 3FDDA 5BNVA 1AOIA 4WU9B 3WKJC 1P3PA 1KX4C 4WJ3C 1P3GD 4DRBA 4QLCD 2Y2MA 4CAYA 1B67A 3WA9C 3AZIB 5B2ID 5GT3B 3W96D 5BO0B 4JJND 3KUYD 2NZDD 3VH6T 2F8NB 3WTPA 1R4VA 2Y2NA 3RELB 4WNNB 3AN2D 3B0CT 3AZMC 3B6GA 3EPLA 5BS7C 4YS3A 1EQZC 5BNXA 4NFTA 1U35A 3MGSB 5AV6A 4J8VB 2ZY4A 2HIOB 4ZUXD 2PYOA 1P3MA 5G49B 2NQBD 3TU4B 3LJAA 1P3KB 3KXBA 3AFAB 4J8XB 4Z66B 1P3AA 3X1SA 3AZLB 5JRGD 5B0YA 5AV9B 1M19D 4XUJD 5CP6B 3W97C 5AV8C 1ULYA 2F8NH 3AZGB 3AZMD 3AZFB 3AZKA 4WU8C 4J8XC 5GT0B 3NQUA 3AZLC 3AV1A 5CPKB 4EO5B 4X23A 3EPJA 1EQZD 3P5JB 5DNMB 3MVDD 3AZHD 3X1VD 3UT9C 1P3BC 3AYWB 5B33D 5CP6C 3LZ0D 2IO5C 5B24A 3AZGC 1P3OA 3C1CB 3REHA 4E44A 4XZQB 5CPIC 3KWQA 5AVCA 1W2EA 3MGPA 5B40A 4EO5C 4Z5TB 4H9SA 3B6FD 1P34C 3X1TA 2FFFB 5AV8D 4AWLC 1P3ID 1M18B 5AV5A 3AL0C 3REIC 1P3FB 5AVBB 1ZLAA 3WAAA 3A6NC 2ZY3A 2BYMA 5B1LB 4J8UD 1KX5B 3W98C 2YFWA 5FUGA 3WTPB 4KHAA 4UUZB 3AV2B 1P3BD 4KUDD 3AZEA 1M18C 2Y2IA 5B1MD 2AROD 1KX3A 3LELB 5AV6B 3C1BC 3MNND 1P3LB 3W99C 2CV5B 5GXQB 3O62C 4J8WC 4M6BA 4H9OB 5F99D 2ZY5A 5DNNC 3MGRB 3REKB 3H0RC 5GSUC 5GT3A 5BO0A 3UTAB 2F8NA 2CV5C 2FJ7B 3RELA 4WNNA 5B31B 3C1BD 5B32G 4G92B 5CPJC 3MGSA 4J8VA 1HQ3C 4LD9D 3W99D 5G49A 5B2JD 2FJ7C 4J8WD 1P3GB 5E5AC 3TU4A 3UTBC 1P3KA 3AFAA 4J8XA 4Z66A 4Z2MH 5B2IB 3AZLA 2HUEB 2BG1A 5AY8B 3X1TB 2W8SA 3LZ1D 2Y2JA 3AN2B 5CP6A 4R8PB 1P3GC 4HGAB 4QLCC 3AZGA 4G91C 3IP4C 5CPIA 5GT0A 2CWEA 1ID3B 2J8PA 2YFWB 4H9RB 3W96C 2HUEC 5B2IC 4ZUXB 5DNMA 4JJNC 3KUYC 3X1UD 2NZDC 3WKJB 1KX4B 3AN2C 5KDMA 2L5AA 3AYWA 3B6GD 3C1CA 4YS3D 4XZQA 3WA9B 1TZYD 1F66D 4ZUXC 4H9PB 4Z5TA 3W98A 1JFIB 2NQBC 3AZMB 3LJAD 3REJC 2BYKB 1M18A 1P3FA 5AVBA 5B0ZC 1EQZB 3MVDB 5JRGC 5B1LA 3V9RB 5B0YD 2YFVB 1M19C 1KX5A 4XUJC 4UUZA 3AV2A 3O62A 3AV1D 5CHLB 5BT1D 4X23D 3LELA 5DNNA 3MGQD 3MVDC 3AZHC 1Z2CB 3B6FB 3EPKA 3X1VC 3W97B 5B33C 3LZ0C 5AV8B 1P3LA 5B24D 2CV5A 2XD5A 5GXQA 4WU8B 1P3OD 3REJD 4H9OA 5B0ZD 3KFUG 4J8UB 2DQNC 3MGRA 1S32D 3B6FC 3VH5W 3REKA 3UT9B 1P3BB 4KUDB 2IO5B 3UTAA 1P3IC 2FJ7A 2Y2QA 3AZJD 5CPIB 3REKC 5B31A 1H3OB 4J8UC 3NQJB 1M1AD 1P34B 5C3IC 3MNNB 5KDMB 4KUDC 4AWLB 3REIB 5B1MC 3H0LC 2AROC 1P3GA 3A6NB 3AZND 3W98B 5B2IA 5AY8A 3MNNC 4WU9D 2NZDA 3AN2A 4R8PA 3EG5B 5B32D 5F99C 3C1BB 3AZID 2RIQA 1ID3A 5GT3D 4H9RA 4ZUXA 4LD9B 2F8ND 3W99B 3WKJA 3RELD 3O62B 4J8WB 1KX4A 4YM6C 5DNNB 4CSRB 2Y2OA 5GSUB 4J8VD 3WA9A 2HIOD 3LZ1B 4LD9C 4H9PA 1BH8B 4XUJA 5B2JC 1JFIA 3TU4D 3AZMA 2ZM5A 3KSYA 2BYKA 4Z66D 5BS7A 4KGCB 1EQZA 5CPJB 3MVDA 3X1UB 1AOIC 5AV9D 1HQ3B 3V9RA 2YFVA 3LZ1C 1P3PC 3LZ0A 4NE3A 4YM6D 5E5AB 3AZFD 3UTBB 5GT0D 3WTPE 5CPKD 4KGCC 5DNMD 3B6FA 4H9NB 3X1UC 3F6TA 3H0MC 3AYWD 3W97A 3B6GC 5AV8A 2F8NG 1HTAA 4ZBJC 4QLCB 4WU8A 3C1CD 4G91B 4XZQD 4YS3C 1TZYC 3VH6W 4J8UA 1F66C 4Z5TD 3W96B 4JJNB 3KUYB 1AOID 2NZDB 3B0CW 1P3PD 3UT9A 3R45B 1P3BA 4KUDA 2ZY2A 3LJAC 3X1SC 5AVBD 1WWIA 1H3OA 1N1JB 5B0YC 3NQJA 1KX5D 1P34A 1BH9B 3WTPD 3MNNA 3AV2D 2NQBB 4KGCD 3AZKC 2VQRA 3REJB 3REIA 5B0ZB 5BT1C 3AV1C 5F99A 4X23C 3LELD 1U35D 3A6NA 1S32B 5AV6D 3MGQC 5JRGB 2PYOD 1M19B 1P3MD 4XUJB 1TAFB 3B0DC 1P3LD 5GXQD 5B24C 1P3OC 3AZJB 3KXBD 2UWXA 2Y2KA 1P3AD 3X1SD 3KWQC 2JSSA 5B40C 3MGRD 1M1AB 3AZHB 3C1BA 1S32C 2RVQC 3X1VB 5B33B 3LZ0B 3UTAD 4LD9A 3W99A 3AZKD 4J8WA 3AZJC 1ZLAC 3WAAC 5CPKA 5B31D 3A1IA 2Y2GA 1M1AC 4CSRA 5GSUA 3LZ1A 1BH8A 2G5HC 3AZEC 1P3IB 3REHD 1KX3C 5B32B 3KWQD 5AVCD 3MGPD 3AZNC 5B40D 5C3IB 2RVQD 5AY8D 3X1TD 5CPJA 4KGCA 4H9QB 3X1UA 4WU9C 2F8NK 1HQ3A 5AV5D 4R8PD 5B1MB 3A1KA 1ZLAD 2AROB 3WAAD 5E5AA 5B32C 3UTBA 1ID3D 3AZIC 4Z2MG 5JA4B 1TZYA 5GT3C 1F66A 4H9NA 3WKJD 3RELC 1KX4D 3AZED 1KX3D 5F99B 4QLCA 5B31G 3WA9D 3MGSC 4J8VC 2HIOC 3W96A 1T3UA 4JJNA 3KUYA 1F1EA 3R45A 4YM6B 3TU4C 1P3KC 3AFAC 4Z66C 4DQYB 2LY8A 3MGQA 1N1JA 5AV9C 1BH9A 5B2JB 2NQBA 3AZFC 1BFMA 3REJA 5GT0C 2Y2HA 5B0ZA 5CPKC 5DNMC 3MGSD 5BNVB 1S32A 2XD1A 5JRGA 1AOIB 1P3PB 1M19A 3W97D 3AYWC 1TAFA 4WU8D 1WWSA 4DRAA 3AZJA 3C1CC 3AFAD 4J8XD 1P3KD 4CAYB 4XZQC 2JE5A 4WZSB 4NE6A 3VH6A 3AZLD 2Y2LA 4Z5TC 1M1AA 3AZHA 3UT9D 3X1VA 3VH5T 5CP6D 5B33A 3B6GB 1A7WA 2Y2PA 3AZGD 4ZBJB 1P3FC 5AVBC 4YS3B 5CPID 5BNXB 1U35B 3AZNA 1TZYB 5B1LC 2PYOB 1F66B 4UPKA 1P3MB 1P34D 1KX5C 3WTPC 3AV2C 1Q9CA 4WU9A 3LJAB 3KXBB 1P3IA 1P3AB 3X1SB 3REID 3EPHA 1KU5A 5B32A 3LELC 1U35C 3A6ND 5AV6C 4E45A 5B0YB 2PYOC 1B6WA 3AZIA 1P3MC 3W98D 4WV4B 4NE5A 1P3LC 4H9QA 5GXQC 3AZKB 3KXBC 1M18D 1P3AC 1P3FD 3NQUB 5B1MA 3AV1B 2AROA 4X23B 3MGRC 2JCHA 3MGQB 5B1LD
chains in the Genus database with same CATH topology
5JA4A 2HIOA 3B0DB 2DF4C 3UTAC 5B24B 3O62D 1P3OB 3REHB 3KWQB 5AVCB 5B31C 3MGPB 5B40B 5DNND 4G92C 5GSUD 5AV9A 2CV5D 5AV5B 2F2AC 1ZLAB 4YM6A 3REHC 3AZFA 3WAAB 5AVCC 3MGPC 2BYMB 4H9SC 3VH5A 5FUGB 3REKD 5AY8C 5CPJD 4KHAB 3X1TC 1HQ3D 3AZEB 5AV5C 4R8PC 5B2JA 2FJ7D 2G5IC 1KX3B 5E5AD 1PZRA 4HGAC 3UTBD 3AZNB 3B0BA 1ID3C 3FDDA 5BNVA 1AOIA 4WU9B 3WKJC 1P3PA 1KX4C 4WJ3C 1P3GD 4DRBA 4QLCD 2Y2MA 4CAYA 1B67A 3WA9C 3AZIB 5B2ID 5GT3B 3W96D 5BO0B 4JJND 3KUYD 2NZDD 3VH6T 2F8NB 3WTPA 1R4VA 2Y2NA 3RELB 4WNNB 3AN2D 3B0CT 3AZMC 3B6GA 3EPLA 5BS7C 4YS3A 1EQZC 5BNXA 4NFTA 1U35A 3MGSB 5AV6A 4J8VB 2ZY4A 2HIOB 4ZUXD 2PYOA 1P3MA 5G49B 2NQBD 3TU4B 3LJAA 1P3KB 3KXBA 3AFAB 4J8XB 4Z66B 1P3AA 3X1SA 3AZLB 5JRGD 5B0YA 5AV9B 1M19D 4XUJD 5CP6B 3W97C 5AV8C 1ULYA 2F8NH 3AZGB 3AZMD 3AZFB 3AZKA 4WU8C 4J8XC 5GT0B 3NQUA 3AZLC 3AV1A 5CPKB 4EO5B 4X23A 3EPJA 1EQZD 3P5JB 5DNMB 3MVDD 3AZHD 3X1VD 3UT9C 1P3BC 3AYWB 5B33D 5CP6C 3LZ0D 2IO5C 5B24A 3AZGC 1P3OA 3C1CB 3REHA 4E44A 4XZQB 5CPIC 3KWQA 5AVCA 1W2EA 3MGPA 5B40A 4EO5C 4Z5TB 4H9SA 3B6FD 1P34C 3X1TA 2FFFB 5AV8D 4AWLC 1P3ID 1M18B 5AV5A 3AL0C 3REIC 1P3FB 5AVBB 1ZLAA 3WAAA 3A6NC 2ZY3A 2BYMA 5B1LB 4J8UD 1KX5B 3W98C 2YFWA 5FUGA 3WTPB 4KHAA 4UUZB 3AV2B 1P3BD 4KUDD 3AZEA 1M18C 2Y2IA 5B1MD 2AROD 1KX3A 3LELB 5AV6B 3C1BC 3MNND 1P3LB 3W99C 2CV5B 5GXQB 3O62C 4J8WC 4M6BA 4H9OB 5F99D 2ZY5A 5DNNC 3MGRB 3REKB 3H0RC 5GSUC 5GT3A 5BO0A 3UTAB 2F8NA 2CV5C 2FJ7B 3RELA 4WNNA 5B31B 3C1BD 5B32G 4G92B 5CPJC 3MGSA 4J8VA 1HQ3C 4LD9D 3W99D 5G49A 5B2JD 2FJ7C 4J8WD 1P3GB 5E5AC 3TU4A 3UTBC 1P3KA 3AFAA 4J8XA 4Z66A 4Z2MH 5B2IB 3AZLA 2HUEB 2BG1A 5AY8B 3X1TB 2W8SA 3LZ1D 2Y2JA 3AN2B 5CP6A 4R8PB 1P3GC 4HGAB 4QLCC 3AZGA 4G91C 3IP4C 5CPIA 5GT0A 2CWEA 1ID3B 2J8PA 2YFWB 4H9RB 3W96C 2HUEC 5B2IC 4ZUXB 5DNMA 4JJNC 3KUYC 3X1UD 2NZDC 3WKJB 1KX4B 3AN2C 5KDMA 2L5AA 3AYWA 3B6GD 3C1CA 4YS3D 4XZQA 3WA9B 1TZYD 1F66D 4ZUXC 4H9PB 4Z5TA 3W98A 1JFIB 2NQBC 3AZMB 3LJAD 3REJC 2BYKB 1M18A 1P3FA 5AVBA 5B0ZC 1EQZB 3MVDB 5JRGC 5B1LA 3V9RB 5B0YD 2YFVB 1M19C 1KX5A 4XUJC 4UUZA 3AV2A 3O62A 3AV1D 5CHLB 5BT1D 4X23D 3LELA 5DNNA 3MGQD 3MVDC 3AZHC 1Z2CB 3B6FB 3EPKA 3X1VC 3W97B 5B33C 3LZ0C 5AV8B 1P3LA 5B24D 2CV5A 2XD5A 5GXQA 4WU8B 1P3OD 3REJD 4H9OA 5B0ZD 3KFUG 4J8UB 2DQNC 3MGRA 1S32D 3B6FC 3VH5W 3REKA 3UT9B 1P3BB 4KUDB 2IO5B 3UTAA 1P3IC 2FJ7A 2Y2QA 3AZJD 5CPIB 3REKC 5B31A 1H3OB 4J8UC 3NQJB 1M1AD 1P34B 5C3IC 3MNNB 5KDMB 4KUDC 4AWLB 3REIB 5B1MC 3H0LC 2AROC 1P3GA 3A6NB 3AZND 3W98B 5B2IA 5AY8A 3MNNC 4WU9D 2NZDA 3AN2A 4R8PA 3EG5B 5B32D 5F99C 3C1BB 3AZID 2RIQA 1ID3A 5GT3D 4H9RA 4ZUXA 4LD9B 2F8ND 3W99B 3WKJA 3RELD 3O62B 4J8WB 1KX4A 4YM6C 5DNNB 4CSRB 2Y2OA 5GSUB 4J8VD 3WA9A 2HIOD 3LZ1B 4LD9C 4H9PA 1BH8B 4XUJA 5B2JC 1JFIA 3TU4D 3AZMA 2ZM5A 3KSYA 2BYKA 4Z66D 5BS7A 4KGCB 1EQZA 5CPJB 3MVDA 3X1UB 1AOIC 5AV9D 1HQ3B 3V9RA 2YFVA 3LZ1C 1P3PC 3LZ0A 4NE3A 4YM6D 5E5AB 3AZFD 3UTBB 5GT0D 3WTPE 5CPKD 4KGCC 5DNMD 3B6FA 4H9NB 3X1UC 3F6TA 3H0MC 3AYWD 3W97A 3B6GC 5AV8A 2F8NG 1HTAA 4ZBJC 4QLCB 4WU8A 3C1CD 4G91B 4XZQD 4YS3C 1TZYC 3VH6W 4J8UA 1F66C 4Z5TD 3W96B 4JJNB 3KUYB 1AOID 2NZDB 3B0CW 1P3PD 3UT9A 3R45B 1P3BA 4KUDA 2ZY2A 3LJAC 3X1SC 5AVBD 1WWIA 1H3OA 1N1JB 5B0YC 3NQJA 1KX5D 1P34A 1BH9B 3WTPD 3MNNA 3AV2D 2NQBB 4KGCD 3AZKC 2VQRA 3REJB 3REIA 5B0ZB 5BT1C 3AV1C 5F99A 4X23C 3LELD 1U35D 3A6NA 1S32B 5AV6D 3MGQC 5JRGB 2PYOD 1M19B 1P3MD 4XUJB 1TAFB 3B0DC 1P3LD 5GXQD 5B24C 1P3OC 3AZJB 3KXBD 2UWXA 2Y2KA 1P3AD 3X1SD 3KWQC 2JSSA 5B40C 3MGRD 1M1AB 3AZHB 3C1BA 1S32C 2RVQC 3X1VB 5B33B 3LZ0B 3UTAD 4LD9A 3W99A 3AZKD 4J8WA 3AZJC 1ZLAC 3WAAC 5CPKA 5B31D 3A1IA 2Y2GA 1M1AC 4CSRA 5GSUA 3LZ1A 1BH8A 2G5HC 3AZEC 1P3IB 3REHD 1KX3C 5B32B 3KWQD 5AVCD 3MGPD 3AZNC 5B40D 5C3IB 2RVQD 5AY8D 3X1TD 5CPJA 4KGCA 4H9QB 3X1UA 4WU9C 2F8NK 1HQ3A 5AV5D 4R8PD 5B1MB 3A1KA 1ZLAD 2AROB 3WAAD 5E5AA 5B32C 3UTBA 1ID3D 3AZIC 4Z2MG 5JA4B 1TZYA 5GT3C 1F66A 4H9NA 3WKJD 3RELC 1KX4D 3AZED 1KX3D 5F99B 4QLCA 5B31G 3WA9D 3MGSC 4J8VC 2HIOC 3W96A 1T3UA 4JJNA 3KUYA 1F1EA 3R45A 4YM6B 3TU4C 1P3KC 3AFAC 4Z66C 4DQYB 2LY8A 3MGQA 1N1JA 5AV9C 1BH9A 5B2JB 2NQBA 3AZFC 1BFMA 3REJA 5GT0C 2Y2HA 5B0ZA 5CPKC 5DNMC 3MGSD 5BNVB 1S32A 2XD1A 5JRGA 1AOIB 1P3PB 1M19A 3W97D 3AYWC 1TAFA 4WU8D 1WWSA 4DRAA 3AZJA 3C1CC 3AFAD 4J8XD 1P3KD 4CAYB 4XZQC 2JE5A 4WZSB 4NE6A 3VH6A 3AZLD 2Y2LA 4Z5TC 1M1AA 3AZHA 3UT9D 3X1VA 3VH5T 5CP6D 5B33A 3B6GB 1A7WA 2Y2PA 3AZGD 4ZBJB 1P3FC 5AVBC 4YS3B 5CPID 5BNXB 1U35B 3AZNA 1TZYB 5B1LC 2PYOB 1F66B 4UPKA 1P3MB 1P34D 1KX5C 3WTPC 3AV2C 1Q9CA 4WU9A 3LJAB 3KXBB 1P3IA 1P3AB 3X1SB 3REID 3EPHA 1KU5A 5B32A 3LELC 1U35C 3A6ND 5AV6C 4E45A 5B0YB 2PYOC 1B6WA 3AZIA 1P3MC 3W98D 4WV4B 4NE5A 1P3LC 4H9QA 5GXQC 3AZKB 3KXBC 1M18D 1P3AC 1P3FD 3NQUB 5B1MA 3AV1B 2AROA 4X23B 3MGRC 2JCHA 3MGQB 5B1LD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JA4 A;  2HIO A;  3B0D B;  3UTA C;  5B24 B;  3O62 D;  1P3O B;  3REH B;  3KWQ B;  5AVC B;  5B31 C;  3MGP B;  5B40 B;  5DNN D;  4G92 C;  5GSU D;  5AV9 A;  2CV5 D;  5AV5 B;  1ZLA B;  4YM6 A;  3REH C;  3AZF A;  3WAA B;  5AVC C;  3MGP C;  2BYM B;  4H9S C;  3VH5 A;  5FUG B;  3REK D;  5AY8 C;  5CPJ D;  4KHA B;  3X1T C;  1HQ3 D;  3AZE B;  5AV5 C;  4R8P C;  5B2J A;  2FJ7 D;  1KX3 B;  5E5A D;  4HGA C;  3UTB D;  3AZN B;  3B0B A;  1ID3 C;  5BNV A;  1AOI A;  4WU9 B;  3WKJ C;  1P3P A;  1KX4 C;  1P3G D;  4DRB A;  4QLC D;  4CAY A;  1B67 A;  3WA9 C;  3AZI B;  5B2I D;  5GT3 B;  3W96 D;  5BO0 B;  4JJN D;  3KUY D;  2NZD D;  3VH6 T;  2F8N B;  3WTP A;  1R4V A;  3REL B;  4WNN B;  3AN2 D;  3B0C T;  3AZM C;  3B6G A;  5BS7 C;  4YS3 A;  1EQZ C;  5BNX A;  4NFT A;  1U35 A;  3MGS B;  5AV6 A;  4J8V B;  2HIO B;  4ZUX D;  2PYO A;  1P3M A;  5G49 B;  2NQB D;  3TU4 B;  3LJA A;  1P3K B;  3KXB A;  3AFA B;  4J8X B;  4Z66 B;  1P3A A;  3X1S A;  3AZL B;  5JRG D;  5B0Y A;  5AV9 B;  1M19 D;  4XUJ D;  5CP6 B;  3W97 C;  5AV8 C;  1ULY A;  2F8N H;  3AZG B;  3AZM D;  3AZF B;  3AZK A;  4WU8 C;  4J8X C;  5GT0 B;  3NQU A;  3AZL C;  3AV1 A;  5CPK B;  4EO5 B;  4X23 A;  1EQZ D;  5DNM B;  3MVD D;  3AZH D;  3X1V D;  3UT9 C;  1P3B C;  3AYW B;  5B33 D;  5CP6 C;  3LZ0 D;  2IO5 C;  5B24 A;  3AZG C;  1P3O A;  3C1C B;  3REH A;  4E44 A;  4XZQ B;  5CPI C;  3KWQ A;  5AVC A;  3MGP A;  5B40 A;  4EO5 C;  4Z5T B;  4H9S A;  3B6F D;  1P34 C;  3X1T A;  5AV8 D;  4AWL C;  1P3I D;  1M18 B;  5AV5 A;  3REI C;  1P3F B;  5AVB B;  1ZLA A;  3WAA A;  3A6N C;  2BYM A;  5B1L B;  4J8U D;  1KX5 B;  3W98 C;  2YFW A;  5FUG A;  3WTP B;  4KHA A;  4UUZ B;  3AV2 B;  1P3B D;  4KUD D;  3AZE A;  1M18 C;  5B1M D;  2ARO D;  1KX3 A;  3LEL B;  5AV6 B;  3C1B C;  3MNN D;  1P3L B;  3W99 C;  2CV5 B;  5GXQ B;  3O62 C;  4J8W C;  4M6B A;  4H9O B;  5F99 D;  5DNN C;  3MGR B;  3REK B;  5GSU C;  5GT3 A;  5BO0 A;  3UTA B;  2F8N A;  2CV5 C;  2FJ7 B;  3REL A;  4WNN A;  5B31 B;  3C1B D;  5B32 G;  4G92 B;  5CPJ C;  3MGS A;  4J8V A;  1HQ3 C;  4LD9 D;  3W99 D;  5G49 A;  5B2J D;  2FJ7 C;  4J8W D;  1P3G B;  5E5A C;  3TU4 A;  3UTB C;  1P3K A;  3AFA A;  4J8X A;  4Z66 A;  4Z2M H;  5B2I B;  3AZL A;  2HUE B;  5AY8 B;  3X1T B;  3LZ1 D;  3AN2 B;  5CP6 A;  4R8P B;  1P3G C;  4HGA B;  4QLC C;  3AZG A;  4G91 C;  5CPI A;  5GT0 A;  2CWE A;  1ID3 B;  2YFW B;  4H9R B;  3W96 C;  5B2I C;  2HUE C;  4ZUX B;  5CPK A;  5DNM A;  4JJN C;  3KUY C;  3X1U D;  2NZD C;  3WKJ B;  1KX4 B;  3AN2 C;  5KDM A;  2L5A A;  3AYW A;  3B6G D;  3C1C A;  4YS3 D;  4XZQ A;  3WA9 B;  1TZY D;  1F66 D;  4ZUX C;  4H9P B;  4Z5T A;  3W98 A;  1JFI B;  2NQB C;  3AZM B;  3LJA D;  3REJ C;  2BYK B;  1M18 A;  1P3F A;  5AVB A;  5B0Z C;  1EQZ B;  3MVD B;  5JRG C;  5B1L A;  3V9R B;  5B0Y D;  2YFV B;  1M19 C;  1KX5 A;  4XUJ C;  4UUZ A;  3AV2 A;  3O62 A;  3AV1 D;  5CHL B;  5BT1 D;  4X23 D;  3LEL A;  5DNN A;  3MGQ D;  3MVD C;  3AZH C;  3B6F B;  3X1V C;  3W97 B;  5B33 C;  3LZ0 C;  5AV8 B;  1P3L A;  5B24 D;  2CV5 A;  5GXQ A;  1P3O D;  4WU8 B;  3REJ D;  4H9O A;  5B0Z D;  4J8U B;  3MGR A;  1S32 D;  3B6F C;  3VH5 W;  3REK A;  3UT9 B;  1P3B B;  4KUD B;  2IO5 B;  3UTA A;  1P3I C;  2FJ7 A;  3AZJ D;  5CPI B;  3REK C;  5B31 A;  1H3O B;  4J8U C;  3NQJ B;  1M1A D;  1P34 B;  5C3I C;  3MNN B;  5KDM B;  4KUD C;  4AWL B;  3REI B;  5B1M C;  1P3G A;  2ARO C;  3A6N B;  3AZN D;  3W98 B;  5B2I A;  5AY8 A;  3MNN C;  4WU9 D;  2NZD A;  3AN2 A;  4R8P A;  5B32 D;  5F99 C;  3C1B B;  3AZI D;  1ID3 A;  5GT3 D;  4H9R A;  4ZUX A;  4LD9 B;  2F8N D;  3W99 B;  3WKJ A;  3REL D;  3O62 B;  4J8W B;  1KX4 A;  4YM6 C;  5DNN B;  4CSR B;  3WA9 A;  5GSU B;  4J8V D;  2HIO D;  3LZ1 B;  4LD9 C;  4H9P A;  1BH8 B;  4XUJ A;  5B2J C;  1JFI A;  3TU4 D;  3AZM A;  3KSY A;  2BYK A;  4Z66 D;  5BS7 A;  4KGC B;  1EQZ A;  5CPJ B;  3MVD A;  3X1U B;  1AOI C;  5AV9 D;  1HQ3 B;  3V9R A;  2YFV A;  3LZ1 C;  1P3P C;  3LZ0 A;  4NE3 A;  4YM6 D;  5E5A B;  3AZF D;  3UTB B;  5GT0 D;  3WTP E;  5CPK D;  4KGC C;  5DNM D;  3B6F A;  4H9N B;  3X1U C;  3AYW D;  3W97 A;  3B6G C;  5AV8 A;  2F8N G;  1HTA A;  4ZBJ C;  4QLC B;  4WU8 A;  3C1C D;  4G91 B;  4XZQ D;  4YS3 C;  1TZY C;  3VH6 W;  4J8U A;  1F66 C;  4Z5T D;  3W96 B;  4JJN B;  3KUY B;  1AOI D;  2NZD B;  3B0C W;  1P3P D;  3UT9 A;  3R45 B;  1P3B A;  4KUD A;  3LJA C;  3X1S C;  5AVB D;  1WWI A;  1H3O A;  1N1J B;  5B0Y C;  3NQJ A;  1KX5 D;  1P34 A;  1BH9 B;  3WTP D;  3MNN A;  3AV2 D;  2NQB B;  4KGC D;  3AZK C;  3REJ B;  3REI A;  5B0Z B;  5BT1 C;  3AV1 C;  5F99 A;  4X23 C;  3LEL D;  1U35 D;  3A6N A;  1S32 B;  5AV6 D;  3MGQ C;  5JRG B;  2PYO D;  1M19 B;  1P3M D;  4XUJ B;  1TAF B;  3B0D C;  1P3L D;  5GXQ D;  5B24 C;  1P3O C;  3AZJ B;  3KXB D;  1P3A D;  3X1S D;  3KWQ C;  2JSS A;  5B40 C;  3MGR D;  1M1A B;  3AZH B;  3C1B A;  1S32 C;  2RVQ C;  3X1V B;  5B33 B;  3LZ0 B;  3UTA D;  4LD9 A;  3W99 A;  3AZK D;  4J8W A;  3AZJ C;  1ZLA C;  3WAA C;  5B31 D;  1M1A C;  4CSR A;  5GSU A;  3LZ1 A;  1BH8 A;  3AZE C;  1P3I B;  3REH D;  1KX3 C;  5B32 B;  3KWQ D;  5AVC D;  3MGP D;  3AZN C;  5B40 D;  5C3I B;  2RVQ D;  5AY8 D;  3X1T D;  5CPJ A;  4KGC A;  4H9Q B;  3X1U A;  4WU9 C;  2F8N K;  1HQ3 A;  5AV5 D;  4R8P D;  5B1M B;  1ZLA D;  2ARO B;  3WAA D;  5E5A A;  5B32 C;  3UTB A;  1ID3 D;  3AZI C;  4Z2M G;  5JA4 B;  1TZY A;  5GT3 C;  1F66 A;  4H9N A;  3WKJ D;  3REL C;  1KX4 D;  3AZE D;  1KX3 D;  5F99 B;  4QLC A;  5B31 G;  3WA9 D;  3MGS C;  4J8V C;  2HIO C;  3W96 A;  4JJN A;  3KUY A;  1F1E A;  3R45 A;  4YM6 B;  3TU4 C;  1P3K C;  3AFA C;  4Z66 C;  2LY8 A;  3MGQ A;  1N1J A;  5AV9 C;  1BH9 A;  5B2J B;  2NQB A;  3AZF C;  1BFM A;  3REJ A;  5GT0 C;  5B0Z A;  5CPK C;  5DNM C;  3MGS D;  5BNV B;  1S32 A;  1AOI B;  5JRG A;  1P3P B;  1M19 A;  3W97 D;  3AYW C;  1TAF A;  4WU8 D;  1WWS A;  4DRA A;  3AZJ A;  3C1C C;  3AFA D;  4J8X D;  1P3K D;  4CAY B;  4XZQ C;  4WZS B;  4NE6 A;  3VH6 A;  3AZL D;  4Z5T C;  1M1A A;  3AZH A;  3UT9 D;  3X1V A;  3VH5 T;  5CP6 D;  5B33 A;  3B6G B;  1A7W A;  3AZG D;  4ZBJ B;  1P3F C;  5AVB C;  4YS3 B;  5CPI D;  5BNX B;  1U35 B;  3AZN A;  1TZY B;  5B1L C;  2PYO B;  1F66 B;  1P3M B;  1P34 D;  1KX5 C;  3WTP C;  3AV2 C;  1Q9C A;  4WU9 A;  3LJA B;  3KXB B;  1P3I A;  1P3A B;  3X1S B;  3REI D;  1KU5 A;  5B32 A;  3LEL C;  1U35 C;  3A6N D;  5AV6 C;  4E45 A;  5B0Y B;  2PYO C;  1B6W A;  3AZI A;  1P3M C;  3W98 D;  4WV4 B;  4NE5 A;  1P3L C;  4H9Q A;  5GXQ C;  3AZK B;  3KXB C;  1M18 D;  1P3A C;  1P3F D;  3NQU B;  5B1M A;  3AV1 B;  2ARO A;  4X23 B;  3MGR C;  3MGQ B;  5B1L D; 
#chains in the Genus database with same CATH topology
 5JA4 A;  2HIO A;  3B0D B;  2DF4 C;  3UTA C;  5B24 B;  3O62 D;  1P3O B;  3REH B;  3KWQ B;  5AVC B;  5B31 C;  3MGP B;  5B40 B;  5DNN D;  4G92 C;  5GSU D;  5AV9 A;  2CV5 D;  5AV5 B;  2F2A C;  1ZLA B;  4YM6 A;  3REH C;  3AZF A;  3WAA B;  5AVC C;  3MGP C;  2BYM B;  4H9S C;  3VH5 A;  5FUG B;  3REK D;  5AY8 C;  5CPJ D;  4KHA B;  3X1T C;  1HQ3 D;  3AZE B;  5AV5 C;  4R8P C;  5B2J A;  2FJ7 D;  2G5I C;  1KX3 B;  5E5A D;  1PZR A;  4HGA C;  3UTB D;  3AZN B;  3B0B A;  1ID3 C;  3FDD A;  5BNV A;  1AOI A;  4WU9 B;  3WKJ C;  1P3P A;  1KX4 C;  4WJ3 C;  1P3G D;  4DRB A;  4QLC D;  2Y2M A;  4CAY A;  1B67 A;  3WA9 C;  3AZI B;  5B2I D;  5GT3 B;  3W96 D;  5BO0 B;  4JJN D;  3KUY D;  2NZD D;  3VH6 T;  2F8N B;  3WTP A;  1R4V A;  2Y2N A;  3REL B;  4WNN B;  3AN2 D;  3B0C T;  3AZM C;  3B6G A;  3EPL A;  5BS7 C;  4YS3 A;  1EQZ C;  5BNX A;  4NFT A;  1U35 A;  3MGS B;  5AV6 A;  4J8V B;  2ZY4 A;  2HIO B;  4ZUX D;  2PYO A;  1P3M A;  5G49 B;  2NQB D;  3TU4 B;  3LJA A;  1P3K B;  3KXB A;  3AFA B;  4J8X B;  4Z66 B;  1P3A A;  3X1S A;  3AZL B;  5JRG D;  5B0Y A;  5AV9 B;  1M19 D;  4XUJ D;  5CP6 B;  3W97 C;  5AV8 C;  1ULY A;  2F8N H;  3AZG B;  3AZM D;  3AZF B;  3AZK A;  4WU8 C;  4J8X C;  5GT0 B;  3NQU A;  3AZL C;  3AV1 A;  5CPK B;  4EO5 B;  4X23 A;  3EPJ A;  1EQZ D;  3P5J B;  5DNM B;  3MVD D;  3AZH D;  3X1V D;  3UT9 C;  1P3B C;  3AYW B;  5B33 D;  5CP6 C;  3LZ0 D;  2IO5 C;  5B24 A;  3AZG C;  1P3O A;  3C1C B;  3REH A;  4E44 A;  4XZQ B;  5CPI C;  3KWQ A;  5AVC A;  1W2E A;  3MGP A;  5B40 A;  4EO5 C;  4Z5T B;  4H9S A;  3B6F D;  1P34 C;  3X1T A;  2FFF B;  5AV8 D;  4AWL C;  1P3I D;  1M18 B;  5AV5 A;  3AL0 C;  3REI C;  1P3F B;  5AVB B;  1ZLA A;  3WAA A;  3A6N C;  2ZY3 A;  2BYM A;  5B1L B;  4J8U D;  1KX5 B;  3W98 C;  2YFW A;  5FUG A;  3WTP B;  4KHA A;  4UUZ B;  3AV2 B;  1P3B D;  4KUD D;  3AZE A;  1M18 C;  2Y2I A;  5B1M D;  2ARO D;  1KX3 A;  3LEL B;  5AV6 B;  3C1B C;  3MNN D;  1P3L B;  3W99 C;  2CV5 B;  5GXQ B;  3O62 C;  4J8W C;  4M6B A;  4H9O B;  5F99 D;  2ZY5 A;  5DNN C;  3MGR B;  3REK B;  3H0R C;  5GSU C;  5GT3 A;  5BO0 A;  3UTA B;  2F8N A;  2CV5 C;  2FJ7 B;  3REL A;  4WNN A;  5B31 B;  3C1B D;  5B32 G;  4G92 B;  5CPJ C;  3MGS A;  4J8V A;  1HQ3 C;  4LD9 D;  3W99 D;  5G49 A;  5B2J D;  2FJ7 C;  4J8W D;  1P3G B;  5E5A C;  3TU4 A;  3UTB C;  1P3K A;  3AFA A;  4J8X A;  4Z66 A;  4Z2M H;  5B2I B;  3AZL A;  2HUE B;  2BG1 A;  5AY8 B;  3X1T B;  2W8S A;  3LZ1 D;  2Y2J A;  3AN2 B;  5CP6 A;  4R8P B;  1P3G C;  4HGA B;  4QLC C;  3AZG A;  4G91 C;  3IP4 C;  5CPI A;  5GT0 A;  2CWE A;  1ID3 B;  2J8P A;  2YFW B;  4H9R B;  3W96 C;  2HUE C;  5B2I C;  4ZUX B;  5DNM A;  4JJN C;  3KUY C;  3X1U D;  2NZD C;  3WKJ B;  1KX4 B;  3AN2 C;  5KDM A;  2L5A A;  3AYW A;  3B6G D;  3C1C A;  4YS3 D;  4XZQ A;  3WA9 B;  1TZY D;  1F66 D;  4ZUX C;  4H9P B;  4Z5T A;  3W98 A;  1JFI B;  2NQB C;  3AZM B;  3LJA D;  3REJ C;  2BYK B;  1M18 A;  1P3F A;  5AVB A;  5B0Z C;  1EQZ B;  3MVD B;  5JRG C;  5B1L A;  3V9R B;  5B0Y D;  2YFV B;  1M19 C;  1KX5 A;  4XUJ C;  4UUZ A;  3AV2 A;  3O62 A;  3AV1 D;  5CHL B;  5BT1 D;  4X23 D;  3LEL A;  5DNN A;  3MGQ D;  3MVD C;  3AZH C;  1Z2C B;  3B6F B;  3EPK A;  3X1V C;  3W97 B;  5B33 C;  3LZ0 C;  5AV8 B;  1P3L A;  5B24 D;  2CV5 A;  2XD5 A;  5GXQ A;  4WU8 B;  1P3O D;  3REJ D;  4H9O A;  5B0Z D;  3KFU G;  4J8U B;  2DQN C;  3MGR A;  1S32 D;  3B6F C;  3VH5 W;  3REK A;  3UT9 B;  1P3B B;  4KUD B;  2IO5 B;  3UTA A;  1P3I C;  2FJ7 A;  2Y2Q A;  3AZJ D;  5CPI B;  3REK C;  5B31 A;  1H3O B;  4J8U C;  3NQJ B;  1M1A D;  1P34 B;  5C3I C;  3MNN B;  5KDM B;  4KUD C;  4AWL B;  3REI B;  5B1M C;  3H0L C;  2ARO C;  1P3G A;  3A6N B;  3AZN D;  3W98 B;  5B2I A;  5AY8 A;  3MNN C;  4WU9 D;  2NZD A;  3AN2 A;  4R8P A;  3EG5 B;  5B32 D;  5F99 C;  3C1B B;  3AZI D;  2RIQ A;  1ID3 A;  5GT3 D;  4H9R A;  4ZUX A;  4LD9 B;  2F8N D;  3W99 B;  3WKJ A;  3REL D;  3O62 B;  4J8W B;  1KX4 A;  4YM6 C;  5DNN B;  4CSR B;  2Y2O A;  5GSU B;  4J8V D;  3WA9 A;  2HIO D;  3LZ1 B;  4LD9 C;  4H9P A;  1BH8 B;  4XUJ A;  5B2J C;  1JFI A;  3TU4 D;  3AZM A;  2ZM5 A;  3KSY A;  2BYK A;  4Z66 D;  5BS7 A;  4KGC B;  1EQZ A;  5CPJ B;  3MVD A;  3X1U B;  1AOI C;  5AV9 D;  1HQ3 B;  3V9R A;  2YFV A;  3LZ1 C;  1P3P C;  3LZ0 A;  4NE3 A;  4YM6 D;  5E5A B;  3AZF D;  3UTB B;  5GT0 D;  3WTP E;  5CPK D;  4KGC C;  5DNM D;  3B6F A;  4H9N B;  3X1U C;  3F6T A;  3H0M C;  3AYW D;  3W97 A;  3B6G C;  5AV8 A;  2F8N G;  1HTA A;  4ZBJ C;  4QLC B;  4WU8 A;  3C1C D;  4G91 B;  4XZQ D;  4YS3 C;  1TZY C;  3VH6 W;  4J8U A;  1F66 C;  4Z5T D;  3W96 B;  4JJN B;  3KUY B;  1AOI D;  2NZD B;  3B0C W;  1P3P D;  3UT9 A;  3R45 B;  1P3B A;  4KUD A;  2ZY2 A;  3LJA C;  3X1S C;  5AVB D;  1WWI A;  1H3O A;  1N1J B;  5B0Y C;  3NQJ A;  1KX5 D;  1P34 A;  1BH9 B;  3WTP D;  3MNN A;  3AV2 D;  2NQB B;  4KGC D;  3AZK C;  2VQR A;  3REJ B;  3REI A;  5B0Z B;  5BT1 C;  3AV1 C;  5F99 A;  4X23 C;  3LEL D;  1U35 D;  3A6N A;  1S32 B;  5AV6 D;  3MGQ C;  5JRG B;  2PYO D;  1M19 B;  1P3M D;  4XUJ B;  1TAF B;  3B0D C;  1P3L D;  5GXQ D;  5B24 C;  1P3O C;  3AZJ B;  3KXB D;  2UWX A;  2Y2K A;  1P3A D;  3X1S D;  3KWQ C;  2JSS A;  5B40 C;  3MGR D;  1M1A B;  3AZH B;  3C1B A;  1S32 C;  2RVQ C;  3X1V B;  5B33 B;  3LZ0 B;  3UTA D;  4LD9 A;  3W99 A;  3AZK D;  4J8W A;  3AZJ C;  1ZLA C;  3WAA C;  5CPK A;  5B31 D;  3A1I A;  2Y2G A;  1M1A C;  4CSR A;  5GSU A;  3LZ1 A;  1BH8 A;  2G5H C;  3AZE C;  1P3I B;  3REH D;  1KX3 C;  5B32 B;  3KWQ D;  5AVC D;  3MGP D;  3AZN C;  5B40 D;  5C3I B;  2RVQ D;  5AY8 D;  3X1T D;  5CPJ A;  4KGC A;  4H9Q B;  3X1U A;  4WU9 C;  2F8N K;  1HQ3 A;  5AV5 D;  4R8P D;  5B1M B;  3A1K A;  1ZLA D;  2ARO B;  3WAA D;  5E5A A;  5B32 C;  3UTB A;  1ID3 D;  3AZI C;  4Z2M G;  5JA4 B;  1TZY A;  5GT3 C;  1F66 A;  4H9N A;  3WKJ D;  3REL C;  1KX4 D;  3AZE D;  1KX3 D;  5F99 B;  4QLC A;  5B31 G;  3WA9 D;  3MGS C;  4J8V C;  2HIO C;  3W96 A;  1T3U A;  4JJN A;  3KUY A;  1F1E A;  3R45 A;  4YM6 B;  3TU4 C;  1P3K C;  3AFA C;  4Z66 C;  4DQY B;  2LY8 A;  3MGQ A;  1N1J A;  5AV9 C;  1BH9 A;  5B2J B;  2NQB A;  3AZF C;  1BFM A;  3REJ A;  5GT0 C;  2Y2H A;  5B0Z A;  5CPK C;  5DNM C;  3MGS D;  5BNV B;  1S32 A;  2XD1 A;  5JRG A;  1AOI B;  1P3P B;  1M19 A;  3W97 D;  3AYW C;  1TAF A;  4WU8 D;  1WWS A;  4DRA A;  3AZJ A;  3C1C C;  3AFA D;  4J8X D;  1P3K D;  4CAY B;  4XZQ C;  2JE5 A;  4WZS B;  4NE6 A;  3VH6 A;  3AZL D;  2Y2L A;  4Z5T C;  1M1A A;  3AZH A;  3UT9 D;  3X1V A;  3VH5 T;  5CP6 D;  5B33 A;  3B6G B;  1A7W A;  2Y2P A;  3AZG D;  4ZBJ B;  1P3F C;  5AVB C;  4YS3 B;  5CPI D;  5BNX B;  1U35 B;  3AZN A;  1TZY B;  5B1L C;  2PYO B;  1F66 B;  4UPK A;  1P3M B;  1P34 D;  1KX5 C;  3WTP C;  3AV2 C;  1Q9C A;  4WU9 A;  3LJA B;  3KXB B;  1P3I A;  1P3A B;  3X1S B;  3REI D;  3EPH A;  1KU5 A;  5B32 A;  3LEL C;  1U35 C;  3A6N D;  5AV6 C;  4E45 A;  5B0Y B;  2PYO C;  1B6W A;  3AZI A;  1P3M C;  3W98 D;  4WV4 B;  4NE5 A;  1P3L C;  4H9Q A;  5GXQ C;  3AZK B;  3KXB C;  1M18 D;  1P3A C;  1P3F D;  3NQU B;  5B1M A;  3AV1 B;  2ARO A;  4X23 B;  3MGR C;  2JCH A;  3MGQ B;  5B1L D; 
#chains in the Genus database with same CATH homology
 5JA4 A;  2HIO A;  3B0D B;  2DF4 C;  3UTA C;  5B24 B;  3O62 D;  1P3O B;  3REH B;  3KWQ B;  5AVC B;  5B31 C;  3MGP B;  5B40 B;  5DNN D;  4G92 C;  5GSU D;  5AV9 A;  2CV5 D;  5AV5 B;  2F2A C;  1ZLA B;  4YM6 A;  3REH C;  3AZF A;  3WAA B;  5AVC C;  3MGP C;  2BYM B;  4H9S C;  3VH5 A;  5FUG B;  3REK D;  5AY8 C;  5CPJ D;  4KHA B;  3X1T C;  1HQ3 D;  3AZE B;  5AV5 C;  4R8P C;  5B2J A;  2FJ7 D;  2G5I C;  1KX3 B;  5E5A D;  1PZR A;  4HGA C;  3UTB D;  3AZN B;  3B0B A;  1ID3 C;  3FDD A;  5BNV A;  1AOI A;  4WU9 B;  3WKJ C;  1P3P A;  1KX4 C;  4WJ3 C;  1P3G D;  4DRB A;  4QLC D;  2Y2M A;  4CAY A;  1B67 A;  3WA9 C;  3AZI B;  5B2I D;  5GT3 B;  3W96 D;  5BO0 B;  4JJN D;  3KUY D;  2NZD D;  3VH6 T;  2F8N B;  3WTP A;  1R4V A;  2Y2N A;  3REL B;  4WNN B;  3AN2 D;  3B0C T;  3AZM C;  3B6G A;  3EPL A;  5BS7 C;  4YS3 A;  1EQZ C;  5BNX A;  4NFT A;  1U35 A;  3MGS B;  5AV6 A;  4J8V B;  2ZY4 A;  2HIO B;  4ZUX D;  2PYO A;  1P3M A;  5G49 B;  2NQB D;  3TU4 B;  3LJA A;  1P3K B;  3KXB A;  3AFA B;  4J8X B;  4Z66 B;  1P3A A;  3X1S A;  3AZL B;  5JRG D;  5B0Y A;  5AV9 B;  1M19 D;  4XUJ D;  5CP6 B;  3W97 C;  5AV8 C;  1ULY A;  2F8N H;  3AZG B;  3AZM D;  3AZF B;  3AZK A;  4WU8 C;  4J8X C;  5GT0 B;  3NQU A;  3AZL C;  3AV1 A;  5CPK B;  4EO5 B;  4X23 A;  3EPJ A;  1EQZ D;  3P5J B;  5DNM B;  3MVD D;  3AZH D;  3X1V D;  3UT9 C;  1P3B C;  3AYW B;  5B33 D;  5CP6 C;  3LZ0 D;  2IO5 C;  5B24 A;  3AZG C;  1P3O A;  3C1C B;  3REH A;  4E44 A;  4XZQ B;  5CPI C;  3KWQ A;  5AVC A;  1W2E A;  3MGP A;  5B40 A;  4EO5 C;  4Z5T B;  4H9S A;  3B6F D;  1P34 C;  3X1T A;  2FFF B;  5AV8 D;  4AWL C;  1P3I D;  1M18 B;  5AV5 A;  3AL0 C;  3REI C;  1P3F B;  5AVB B;  1ZLA A;  3WAA A;  3A6N C;  2ZY3 A;  2BYM A;  5B1L B;  4J8U D;  1KX5 B;  3W98 C;  2YFW A;  5FUG A;  3WTP B;  4KHA A;  4UUZ B;  3AV2 B;  1P3B D;  4KUD D;  3AZE A;  1M18 C;  2Y2I A;  5B1M D;  2ARO D;  1KX3 A;  3LEL B;  5AV6 B;  3C1B C;  3MNN D;  1P3L B;  3W99 C;  2CV5 B;  5GXQ B;  3O62 C;  4J8W C;  4M6B A;  4H9O B;  5F99 D;  2ZY5 A;  5DNN C;  3MGR B;  3REK B;  3H0R C;  5GSU C;  5GT3 A;  5BO0 A;  3UTA B;  2F8N A;  2CV5 C;  2FJ7 B;  3REL A;  4WNN A;  5B31 B;  3C1B D;  5B32 G;  4G92 B;  5CPJ C;  3MGS A;  4J8V A;  1HQ3 C;  4LD9 D;  3W99 D;  5G49 A;  5B2J D;  2FJ7 C;  4J8W D;  1P3G B;  5E5A C;  3TU4 A;  3UTB C;  1P3K A;  3AFA A;  4J8X A;  4Z66 A;  4Z2M H;  5B2I B;  3AZL A;  2HUE B;  2BG1 A;  5AY8 B;  3X1T B;  2W8S A;  3LZ1 D;  2Y2J A;  3AN2 B;  5CP6 A;  4R8P B;  1P3G C;  4HGA B;  4QLC C;  3AZG A;  4G91 C;  3IP4 C;  5CPI A;  5GT0 A;  2CWE A;  1ID3 B;  2J8P A;  2YFW B;  4H9R B;  3W96 C;  2HUE C;  5B2I C;  4ZUX B;  5DNM A;  4JJN C;  3KUY C;  3X1U D;  2NZD C;  3WKJ B;  1KX4 B;  3AN2 C;  5KDM A;  2L5A A;  3AYW A;  3B6G D;  3C1C A;  4YS3 D;  4XZQ A;  3WA9 B;  1TZY D;  1F66 D;  4ZUX C;  4H9P B;  4Z5T A;  3W98 A;  1JFI B;  2NQB C;  3AZM B;  3LJA D;  3REJ C;  2BYK B;  1M18 A;  1P3F A;  5AVB A;  5B0Z C;  1EQZ B;  3MVD B;  5JRG C;  5B1L A;  3V9R B;  5B0Y D;  2YFV B;  1M19 C;  1KX5 A;  4XUJ C;  4UUZ A;  3AV2 A;  3O62 A;  3AV1 D;  5CHL B;  5BT1 D;  4X23 D;  3LEL A;  5DNN A;  3MGQ D;  3MVD C;  3AZH C;  1Z2C B;  3B6F B;  3EPK A;  3X1V C;  3W97 B;  5B33 C;  3LZ0 C;  5AV8 B;  1P3L A;  5B24 D;  2CV5 A;  2XD5 A;  5GXQ A;  4WU8 B;  1P3O D;  3REJ D;  4H9O A;  5B0Z D;  3KFU G;  4J8U B;  2DQN C;  3MGR A;  1S32 D;  3B6F C;  3VH5 W;  3REK A;  3UT9 B;  1P3B B;  4KUD B;  2IO5 B;  3UTA A;  1P3I C;  2FJ7 A;  2Y2Q A;  3AZJ D;  5CPI B;  3REK C;  5B31 A;  1H3O B;  4J8U C;  3NQJ B;  1M1A D;  1P34 B;  5C3I C;  3MNN B;  5KDM B;  4KUD C;  4AWL B;  3REI B;  5B1M C;  3H0L C;  2ARO C;  1P3G A;  3A6N B;  3AZN D;  3W98 B;  5B2I A;  5AY8 A;  3MNN C;  4WU9 D;  2NZD A;  3AN2 A;  4R8P A;  3EG5 B;  5B32 D;  5F99 C;  3C1B B;  3AZI D;  2RIQ A;  1ID3 A;  5GT3 D;  4H9R A;  4ZUX A;  4LD9 B;  2F8N D;  3W99 B;  3WKJ A;  3REL D;  3O62 B;  4J8W B;  1KX4 A;  4YM6 C;  5DNN B;  4CSR B;  2Y2O A;  5GSU B;  4J8V D;  3WA9 A;  2HIO D;  3LZ1 B;  4LD9 C;  4H9P A;  1BH8 B;  4XUJ A;  5B2J C;  1JFI A;  3TU4 D;  3AZM A;  2ZM5 A;  3KSY A;  2BYK A;  4Z66 D;  5BS7 A;  4KGC B;  1EQZ A;  5CPJ B;  3MVD A;  3X1U B;  1AOI C;  5AV9 D;  1HQ3 B;  3V9R A;  2YFV A;  3LZ1 C;  1P3P C;  3LZ0 A;  4NE3 A;  4YM6 D;  5E5A B;  3AZF D;  3UTB B;  5GT0 D;  3WTP E;  5CPK D;  4KGC C;  5DNM D;  3B6F A;  4H9N B;  3X1U C;  3F6T A;  3H0M C;  3AYW D;  3W97 A;  3B6G C;  5AV8 A;  2F8N G;  1HTA A;  4ZBJ C;  4QLC B;  4WU8 A;  3C1C D;  4G91 B;  4XZQ D;  4YS3 C;  1TZY C;  3VH6 W;  4J8U A;  1F66 C;  4Z5T D;  3W96 B;  4JJN B;  3KUY B;  1AOI D;  2NZD B;  3B0C W;  1P3P D;  3UT9 A;  3R45 B;  1P3B A;  4KUD A;  2ZY2 A;  3LJA C;  3X1S C;  5AVB D;  1WWI A;  1H3O A;  1N1J B;  5B0Y C;  3NQJ A;  1KX5 D;  1P34 A;  1BH9 B;  3WTP D;  3MNN A;  3AV2 D;  2NQB B;  4KGC D;  3AZK C;  2VQR A;  3REJ B;  3REI A;  5B0Z B;  5BT1 C;  3AV1 C;  5F99 A;  4X23 C;  3LEL D;  1U35 D;  3A6N A;  1S32 B;  5AV6 D;  3MGQ C;  5JRG B;  2PYO D;  1M19 B;  1P3M D;  4XUJ B;  1TAF B;  3B0D C;  1P3L D;  5GXQ D;  5B24 C;  1P3O C;  3AZJ B;  3KXB D;  2UWX A;  2Y2K A;  1P3A D;  3X1S D;  3KWQ C;  2JSS A;  5B40 C;  3MGR D;  1M1A B;  3AZH B;  3C1B A;  1S32 C;  2RVQ C;  3X1V B;  5B33 B;  3LZ0 B;  3UTA D;  4LD9 A;  3W99 A;  3AZK D;  4J8W A;  3AZJ C;  1ZLA C;  3WAA C;  5CPK A;  5B31 D;  3A1I A;  2Y2G A;  1M1A C;  4CSR A;  5GSU A;  3LZ1 A;  1BH8 A;  2G5H C;  3AZE C;  1P3I B;  3REH D;  1KX3 C;  5B32 B;  3KWQ D;  5AVC D;  3MGP D;  3AZN C;  5B40 D;  5C3I B;  2RVQ D;  5AY8 D;  3X1T D;  5CPJ A;  4KGC A;  4H9Q B;  3X1U A;  4WU9 C;  2F8N K;  1HQ3 A;  5AV5 D;  4R8P D;  5B1M B;  3A1K A;  1ZLA D;  2ARO B;  3WAA D;  5E5A A;  5B32 C;  3UTB A;  1ID3 D;  3AZI C;  4Z2M G;  5JA4 B;  1TZY A;  5GT3 C;  1F66 A;  4H9N A;  3WKJ D;  3REL C;  1KX4 D;  3AZE D;  1KX3 D;  5F99 B;  4QLC A;  5B31 G;  3WA9 D;  3MGS C;  4J8V C;  2HIO C;  3W96 A;  1T3U A;  4JJN A;  3KUY A;  1F1E A;  3R45 A;  4YM6 B;  3TU4 C;  1P3K C;  3AFA C;  4Z66 C;  4DQY B;  2LY8 A;  3MGQ A;  1N1J A;  5AV9 C;  1BH9 A;  5B2J B;  2NQB A;  3AZF C;  1BFM A;  3REJ A;  5GT0 C;  2Y2H A;  5B0Z A;  5CPK C;  5DNM C;  3MGS D;  5BNV B;  1S32 A;  2XD1 A;  5JRG A;  1AOI B;  1P3P B;  1M19 A;  3W97 D;  3AYW C;  1TAF A;  4WU8 D;  1WWS A;  4DRA A;  3AZJ A;  3C1C C;  3AFA D;  4J8X D;  1P3K D;  4CAY B;  4XZQ C;  2JE5 A;  4WZS B;  4NE6 A;  3VH6 A;  3AZL D;  2Y2L A;  4Z5T C;  1M1A A;  3AZH A;  3UT9 D;  3X1V A;  3VH5 T;  5CP6 D;  5B33 A;  3B6G B;  1A7W A;  2Y2P A;  3AZG D;  4ZBJ B;  1P3F C;  5AVB C;  4YS3 B;  5CPI D;  5BNX B;  1U35 B;  3AZN A;  1TZY B;  5B1L C;  2PYO B;  1F66 B;  4UPK A;  1P3M B;  1P34 D;  1KX5 C;  3WTP C;  3AV2 C;  1Q9C A;  4WU9 A;  3LJA B;  3KXB B;  1P3I A;  1P3A B;  3X1S B;  3REI D;  3EPH A;  1KU5 A;  5B32 A;  3LEL C;  1U35 C;  3A6N D;  5AV6 C;  4E45 A;  5B0Y B;  2PYO C;  1B6W A;  3AZI A;  1P3M C;  3W98 D;  4WV4 B;  4NE5 A;  1P3L C;  4H9Q A;  5GXQ C;  3AZK B;  3KXB C;  1M18 D;  1P3A C;  1P3F D;  3NQU B;  5B1M A;  3AV1 B;  2ARO A;  4X23 B;  3MGR C;  2JCH A;  3MGQ B;  5B1L D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...