3WA9B

The nucleosome containing human h2a.z.1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wa9B00
2RVQC 5B33D 1P3MB 4WU9A 3VH5T 2AROB 4J8XB 5DNMA 3MGSC 3UTBB 4WNNB 3UTAB 4J8VB 1KX5C 2NZDD 3X1VD 1P3FC 1P3OD 3WKJD 5B2JC 5B2ID 3B0BA 3MGRD 3AZHB 3AZIB 4YS3D 2PYOB 5B24D 5B24C 3B0DB 3AZJC 1P3AA 1F66D 4NE5A 1ID3A 4R8PD 1KX5D 4WV4B 4J8WA 1P3GC 3W99B 3NQJB 5AV9D 5B0ZC 5CPIB 4H9PB 3WAAC 5AY8C 4H9RA 3LZ0B 4WU9D 3AZIC 3MVDD 4E45A 1KX4C 4H9NA 3TU4D 3AZFC 3X1VA 1P3OA 3WKJA 2IO5C 1F66B 5BT1D 4G91C 3B0CW 4G92B 1M19C 3NQJA 5JA4A 4YS3A 1P34A 3C1BD 5B31B 2HUEB 2LY8A 1F66A 3REHC 4J8WC 1P3KD 3AFAB 1P3AB 4XUJD 1P34C 1KX5A 3C1CC 3UTBD 4Z66C 3REJC 4KUDC 3MGPC 3AYWD 1BH8B 3W96C 5B33B 3AZJA 4H9RB 4ZUXB 3AZEB 4QLCB 5B1LC 3TU4A 3X1SA 5GT0C 5AV5C 1HQ3C 4LD9B 1ZLAD 5G49A 1M1AA 5E5AB 5CP6D 3MNNC 5AV9B 3X1TD 3AZND 1P34D 5GT3D 1P3BA 4NFTA 3O62D 4H9QB 3MNNB 1KX3A 5AVCD 1P3BB 3UTBA 5C3IB 3KWQD 3AV2C 5DNMB 2YFWA 3AYWA 1M1AB 1S32D 1P3FA 4YM6A 3LZ0C 2BYKA 5AY8B 5AV8B 5DNND 3W98B 1F1EA 1TAFA 3AV2A 3O62C 3X1SB 3B6GB 3UT9D 1P3PD 4HGAB 3VH6A 3WA9B 5AY8D 1P3MD 5B0ZD 3AN2B 5C3IC 3WTPE 3AZMB 1P3GD 1KX4D 5KDMB 3KWQB 3AZNA 5BNXB 1P3BD 5GT0D 5G49B 3UTAC 1TZYC 4JJNB 3WTPD 1Q9CA 4X23D 4KGCA 3AYWC 3MGPD 1TZYB 4JJNC 5AV6D 3AZKD 1HQ3B 3MGRC 4LD9C 5B0YC 4QLCA 4ZUXA 5B2IC 5B2JD 5GSUB 3AZEA 1S32A 3X1VC 1P3OC 1P3FD 3WKJC 3LELC 5DNNA 3REHD 3AZLA 3UT9A 1P3PA 2CV5C 5AVBD 5F99D 5B33C 4ZBJB 3V9RB 5CPKC 3REJB 1M19D 3X1SC 1AOIC 5B0ZA 4KUDB 3AZLC 5AV6C 4H9PA 1P34B 3W99A 3X1TB 4J8WB 1AOIB 5B40D 1ID3C 3NQUB 3REJA 4KUDA 4KHAB 3WTPA 4KGCC 1P3BC 4Z5TB 1WWIA 5BO0A 4AWLB 3AZKA 3W97B 3AZHA 5B2JA 4ZUXD 3AZED 4AWLC 3UT9C 1P3PC 1TZYA 2IO5B 3REHA 4Z5TD 3RELC 3VH5A 4WNNA 3UTAA 1HTAA 5AVBA 1P3KB 1R4VA 3RELB 4J8XA 4WU9B 1M19A 1B67A 3RELA 3KWQC 5BNVA 2HIOD 5JRGC 1AOID 5BNXA 3W99D 3AZMC 3WAAB 5KDMA 5AVBC 2F8NH 5B40A 3REKA 3WA9C 5CPKB 2F8NA 4XZQB 3R45B 5B1MD 3AZKC 5AV8A 2HIOB 1ZLAC 2AROA 5CPJD 3AZHD 1P3IC 1P3FB 2NQBA 5B2IB 1ULYA 5FUGA 5B0YA 1TZYD 3MGSB 3UTAD 3W96D 4H9QA 3MNNA 3AZFB 3KUYB 3RELD 2HIOA 1P3MC 2NQBB 1EQZB 3LZ1A 3KXBA 4LD9A 3MGQA 5B40B 1M18B 5BS7A 1P3IA 5B1MA 2AROD 5CPJA 2F8NK 1KX4A 3B0DC 5B40C 3AZJB 5B33A 4YM6C 5B32B 4Z66B 5DNMD 2BYMB 4H9SA 5B1MC 4CSRB 3REHB 2FJ7A 5F99C 2NZDA 4J8VC 3AV1B 2CV5D 5B32D 3MNND 2NQBC 3MGRA 4UUZA 1HQ3D 4G91B 4J8XC 4G92C 3VH5W 4WU8C 1M18D 3KXBD 5B31G 4J8UB 4LD9D 5GXQA 5AV5B 4JJND 4EO5B 1JFIB 3TU4C 5CHLB 4R8PA 3REKC 5GT0B 3X1UA 4Z66D 5B0ZB 4H9OA 3AN2D 3W96B 3V9RA 4XUJC 3VH6W 3C1CB 3X1UB 2BYMA 3MGSD 4XUJB 2FJ7D 3REIC 3W98D 5B32A 1S32B 3AZGC 5DNMC 3C1BB 2JSSA 1EQZD 4WU8A 3A6NC 3LJAC 4UUZB 3AZFD 5GXQD 5CPKD 4J8VA 4DRBA 2FJ7C 5AVCC 4M6BA 3WAAD 5AV9C 4CAYB 5CP6B 3MVDB 4Z66A 3KUYA 3AZGB 1ZLAB 1H3OA 5CPJB 3AN2C 5B1MB 1TAFB 3W98A 2YFVA 3WTPC 1H3OB 5AV8C 1ZLAA 4NE3A 3LZ1B 5CP6A 5B24B 4ZBJC 4WU8D 5GT3A 2F8NB 3AZHC 1P3AD 3O62A 3VH6T 1KX3D 1N1JA 5AVCA 4J8VD 3REKB 4J8WD 4WU8B 1P3KC 3KUYC 3WAAA 5B0YB 5AV9A 4J8UC 5BNVB 5DNNC 4YM6D 1BFMA 4CAYA 1B6WA 5F99B 3MVDA 3W97D 3R45A 3AV2D 3W97C 3C1CA 1P3LB 3B6FB 4J8UD 1U35A 1P3GA 5CPID 5AV6B 3LELA 3MGPB 3C1BA 5GT0A 5JRGA 3WTPB 3AV1D 2CV5B 1P3AC 5AVBB 1P3KA 3A6NA 3LJAA 4XUJA 3B0CT 4KGCD 3LELB 3MGPA 5AV6A 3KSYA 3MGRB 4H9OB 3AZJD 3REIA 5B2JB 4YS3C 4WZSB 3X1VB 1P3OB 3W97A 5BO0B 3WKJB 3AZLD 3UT9B 1P3PB 3X1SD 3B6GD 3C1CD 3UTBC 3A6NB 3LJAB 5F99A 2NZDC 3NQUA 4J8UA 1KX4B 1U35D 1M1AD 5CPIA 3X1TA 3LELD 3C1BC 4KGCB 2RVQD 3W99C 3AZMD 1P3GB 1U35B 4Z2MH 2F8NG 2HIOC 5JRGD 3B6FA 5GXQC 1ID3B 3AV1A 3MGQB 3O62B 3A6ND 3LJAD 4CSRA 4X23C 3KXBB 3AZLB 3AZNB 3MGQC 3KWQA 1BH9B 5E5AD 2CWEA 3REID 4WU9C 2YFVB 3W98C 3AV2B 3B6GA 1N1JB 5AVCB 2BYKB 5AY8A 1P3MA 3AZGA 3AYWB 1F66C 2L5AA 4XZQA 3REKD 3AZMA 1A7WA 3B6FD 1KX3B 4X23A 2F8ND 5B31D 4QLCC 5FUGB 2NQBD 4QLCD 5E5AA 5B32C 4YM6B 5GT3C 3AZNC 3X1TC 1BH9A 3B6GC 5B0YD 3B6FC 3AFAD 3W96A 2HUEC 1BH8A 3AZGD 5GSUC 4XZQD 3LZ1D 1KX5B 4H9SC 4R8PB 4Z2MG 3REJD 1M19B 1JFIA 4KHAA 4KUDD 5AV5A 5B31A 5E5AC 4YS3B 3TU4B 5JA4B 3REIB 4XZQC 5GSUD 3LZ0D 1S32C 3AZKB 4Z5TA 3KXBC 3AFAA 3X1UC 1M18C 4HGAC 4J8XD 2CV5A 5GXQB 5JRGB 1M1AC 1U35C 1AOIA 1HQ3A 5BS7C 2PYOD 3AZID 1M18A 2PYOC 5CP6C 1KX3C 4JJNA 3WA9D 5AV5D 2NZDB 5B31C 2FJ7B 4EO5C 1P3LA 3X1UD 4R8PC 2AROC 4H9NB 5DNNB 5AV8D 5B1LD 3AN2A 5GSUA 4DRAA 3LZ0A 3AV1C 1P3IB 4Z5TC 4NE6A 4E44A 3MGSA 5B2IA 4ZUXC 5CPIC 3AZEC 5B1LB 5GT3B 2YFWB 2PYOA 3LZ1C 3AZIA 1EQZA 5B24A 5B32G 4X23B 1KU5A 1WWSA 3AZFA 5BT1C 3MGQD 3WA9A 1ID3D 5CPKA 1P3LD 1P3LC 1EQZC 3AFAC 1P3ID 5CPJC 5B1LA 3KUYD 3MVDC
chains in the Genus database with same CATH superfamily
2RVQC 5B33D 1P3MB 4WU9A 3VH5T 2AROB 4J8XB 5DNMA 3MGSC 3UTBB 3F6TA 4WNNB 3UTAB 4J8VB 1T3UA 1KX5C 2NZDD 3X1VD 1P3FC 1P3OD 3WKJD 5B2JC 5B2ID 3B0BA 3MGRD 3AZHB 3AZIB 4YS3D 2PYOB 2UWXA 5B24C 5B24D 3B0DB 2DF4C 3AZJC 1P3AA 1F66D 4NE5A 1ID3A 3A1KA 4R8PD 1KX5D 4WV4B 4J8WA 1P3GC 3W99B 3NQJB 5AV9D 5B0ZC 5CPIB 4H9PB 3WAAC 5AY8C 4H9RA 3LZ0B 4WU9D 3AZIC 3MVDD 4E45A 3EPJA 1KX4C 4H9NA 3TU4D 3AZFC 3H0RC 1W2EA 2Y2QA 3X1VA 1P3OA 3WKJA 2IO5C 1F66B 5BT1D 4G91C 3B0CW 4G92B 1M19C 3NQJA 5JA4A 4YS3A 1P34A 3C1BD 5B31B 2HUEB 2LY8A 1F66A 3REHC 4J8WC 1P3KD 3AFAB 1P3AB 4XUJD 1P34C 1KX5A 3C1CC 3UTBD 4Z66C 3REJC 4KUDC 3MGPC 3AYWD 2Y2IA 1BH8B 3W96C 5B33B 3AZJA 4H9RB 4ZUXB 3AZEB 4QLCB 5B1LC 3TU4A 3X1SA 5GT0C 3KFUG 5AV5C 1HQ3C 4LD9B 1ZLAD 5G49A 1M1AA 5E5AB 5CP6D 3MNNC 5AV9B 3X1TD 3AZND 1P34D 5GT3D 2ZY2A 1P3BA 4NFTA 3O62D 4H9QB 3MNNB 1KX3A 5AVCD 3EPLA 1P3BB 3UTBA 5C3IB 3KWQD 3AV2C 5DNMB 2YFWA 3AYWA 2W8SA 1M1AB 1S32D 2Y2NA 1P3FA 4YM6A 5AY8B 2BYKA 3LZ0C 5AV8B 5DNND 3W98B 1F1EA 1TAFA 3AV2A 3O62C 3X1SB 3B6GB 3UT9D 1P3PD 4HGAB 3VH6A 2ZY5A 3WA9B 3IP4C 5AY8D 1P3MD 5B0ZD 3AN2B 5C3IC 3WTPE 3AZMB 1P3GD 1KX4D 5KDMB 3KWQB 3AZNA 5BNXB 1P3BD 5GT0D 5G49B 3UTAC 1TZYC 4JJNB 3WTPD 1Q9CA 2F2AC 4X23D 4KGCA 3AYWC 3MGPD 1TZYB 4JJNC 5AV6D 4DQYB 3AZKD 1HQ3B 3MGRC 4LD9C 5B0YC 4QLCA 5B2IC 4ZUXA 5B2JD 5GSUB 3AZEA 1S32A 3X1VC 1P3OC 1P3FD 3WKJC 3LELC 5DNNA 3REHD 1Z2CB 3AZLA 2Y2JA 3UT9A 1P3PA 2CV5C 5AVBD 5F99D 5B33C 4ZBJB 3P5JB 3V9RB 5CPKC 3REJB 1M19D 3X1SC 1AOIC 5B0ZA 4KUDB 3AZLC 5AV6C 4H9PA 1P34B 3W99A 3X1TB 4J8WB 1AOIB 5B40D 1ID3C 3NQUB 3REJA 4KUDA 4KHAB 2Y2KA 3WTPA 4KGCC 1P3BC 4Z5TB 1WWIA 5BO0A 4AWLB 3AZKA 3W97B 3AZHA 5B2JA 4ZUXD 3AZED 4AWLC 3UT9C 1P3PC 1TZYA 2IO5B 3REHA 4Z5TD 3RELC 3VH5A 4WNNA 3UTAA 1HTAA 2Y2HA 5AVBA 1P3KB 1R4VA 3RELB 4J8XA 4WU9B 1M19A 1B67A 3RELA 3KWQC 5BNVA 2HIOD 5JRGC 1AOID 5BNXA 3W99D 3AZMC 3WAAB 5KDMA 5AVBC 2F8NH 5B40A 3REKA 3WA9C 2J8PA 5CPKB 2F8NA 4XZQB 2Y2MA 3R45B 5B1MD 3AZKC 5AV8A 2HIOB 1ZLAC 2AROA 5CPJD 3AZHD 1P3IC 1P3FB 2NQBA 2FFFB 5B2IB 1ULYA 5FUGA 5B0YA 1TZYD 3MGSB 3UTAD 3W96D 4H9QA 3MNNA 3AZFB 3KUYB 3RELD 2HIOA 1P3MC 2NQBB 1EQZB 3LZ1A 4UPKA 3KXBA 4LD9A 3MGQA 5B40B 1M18B 5BS7A 1P3IA 5B1MA 2AROD 5CPJA 2F8NK 2Y2PA 1KX4A 3B0DC 5B40C 3AZJB 5B33A 4YM6C 5B32B 4Z66B 5DNMD 2BYMB 4H9SA 5B1MC 4CSRB 2ZY3A 3REHB 2FJ7A 5F99C 2NZDA 4J8VC 3AV1B 2CV5D 5B32D 3MNND 2NQBC 3MGRA 4UUZA 1HQ3D 4G91B 4J8XC 4G92C 3VH5W 4WU8C 1M18D 3KXBD 5B31G 4J8UB 4LD9D 5GXQA 2Y2LA 5AV5B 4JJND 4EO5B 3FDDA 1JFIB 3TU4C 5CHLB 4R8PA 3REKC 2RIQA 5GT0B 3X1UA 2VQRA 4Z66D 5B0ZB 4H9OA 3AN2D 3W96B 3V9RA 4XUJC 3VH6W 3C1CB 3X1UB 2BYMA 3MGSD 4XUJB 2FJ7D 3REIC 3W98D 5B32A 1S32B 3AZGC 5DNMC 3C1BB 2JSSA 1EQZD 3EG5B 4WU8A 3A6NC 3LJAC 4UUZB 3AZFD 5GXQD 5CPKD 4J8VA 4DRBA 2FJ7C 5AVCC 4M6BA 3WAAD 5AV9C 4CAYB 5CP6B 3MVDB 4Z66A 3KUYA 3AZGB 1ZLAB 1H3OA 5CPJB 3AN2C 5B1MB 1TAFB 3W98A 2YFVA 3WTPC 1H3OB 5AV8C 1ZLAA 4NE3A 3LZ1B 5CP6A 5B24B 1PZRA 4ZBJC 4WJ3C 4WU8D 5GT3A 2F8NB 3AZHC 1P3AD 3O62A 3VH6T 1KX3D 3AL0C 1N1JA 5AVCA 4J8VD 3REKB 4J8WD 4WU8B 1P3KC 3KUYC 3WAAA 5B0YB 5AV9A 4J8UC 5BNVB 2JCHA 5DNNC 4YM6D 1BFMA 4CAYA 1B6WA 5F99B 3MVDA 3W97D 3R45A 3AV2D 2XD5A 3C1CA 1P3LB 3W97C 3B6FB 4J8UD 1U35A 1P3GA 5CPID 5AV6B 3LELA 3MGPB 3C1BA 2XD1A 5GT0A 5JRGA 2DQNC 3WTPB 3AV1D 2CV5B 1P3AC 5AVBB 1P3KA 3A6NA 3LJAA 4XUJA 3B0CT 4KGCD 3LELB 3MGPA 5AV6A 3KSYA 3MGRB 2ZY4A 4H9OB 3REIA 5B2JB 3AZJD 4YS3C 4WZSB 3X1VB 1P3OB 3W97A 5BO0B 3WKJB 3AZLD 3UT9B 1P3PB 3X1SD 3B6GD 3C1CD 3UTBC 3A6NB 3LJAB 5F99A 2NZDC 3NQUA 4J8UA 1KX4B 1U35D 1M1AD 5CPIA 3X1TA 3LELD 3C1BC 4KGCB 2RVQD 3W99C 3AZMD 1P3GB 1U35B 4Z2MH 2F8NG 2HIOC 5JRGD 3B6FA 5GXQC 1ID3B 3AV1A 3MGQB 3O62B 3A6ND 3LJAD 4CSRA 4X23C 3KXBB 3AZLB 3AZNB 3MGQC 3KWQA 1BH9B 5E5AD 2CWEA 3REID 4WU9C 2YFVB 3W98C 3AV2B 3B6GA 1N1JB 5AVCB 2BYKB 5AY8A 1P3MA 3AZGA 3AYWB 1F66C 2L5AA 4XZQA 3REKD 3AZMA 1A7WA 3B6FD 1KX3B 4X23A 2F8ND 5B31D 4QLCC 5FUGB 2NQBD 4QLCD 5E5AA 5B32C 4YM6B 3EPHA 5GT3C 3AZNC 3X1TC 1BH9A 3B6GC 5B0YD 3B6FC 3AFAD 3W96A 2HUEC 1BH8A 3AZGD 2JE5A 5GSUC 4XZQD 3LZ1D 1KX5B 4H9SC 4R8PB 4Z2MG 3REJD 1M19B 1JFIA 4KHAA 4KUDD 5AV5A 5B31A 5E5AC 4YS3B 3TU4B 5JA4B 3REIB 4XZQC 5GSUD 3LZ0D 1S32C 3AZKB 3EPKA 4Z5TA 3KXBC 3AFAA 3X1UC 1M18C 4HGAC 2Y2OA 3A1IA 4J8XD 2CV5A 5GXQB 5JRGB 1M1AC 1U35C 1AOIA 1HQ3A 5BS7C 2PYOD 3AZID 1M18A 2PYOC 5CP6C 3H0MC 1KX3C 4JJNA 3WA9D 5AV5D 2NZDB 5B31C 2FJ7B 4EO5C 1P3LA 3X1UD 4R8PC 3H0LC 2AROC 4H9NB 5DNNB 5AV8D 5B1LD 3AN2A 5GSUA 4DRAA 3LZ0A 2BG1A 2G5IC 3AV1C 1P3IB 4Z5TC 4NE6A 2G5HC 4E44A 3MGSA 5B2IA 4ZUXC 5CPIC 3AZEC 2ZM5A 5B1LB 5GT3B 2YFWB 2PYOA 3LZ1C 3AZIA 1EQZA 5B24A 5B32G 4X23B 1KU5A 1WWSA 3AZFA 5BT1C 3MGQD 2Y2GA 1ID3D 5CPKA 3WA9A 1P3LD 1P3LC 1EQZC 3AFAC 1P3ID 5CPJC 5B1LA 3KUYD 3MVDC
chains in the Genus database with same CATH topology
2RVQC 5B33D 1P3MB 4WU9A 3VH5T 2AROB 4J8XB 5DNMA 3MGSC 3UTBB 3F6TA 4WNNB 3UTAB 4J8VB 1T3UA 1KX5C 2NZDD 3X1VD 1P3FC 1P3OD 3WKJD 5B2JC 5B2ID 3B0BA 3MGRD 3AZHB 3AZIB 4YS3D 2PYOB 2UWXA 5B24C 5B24D 3B0DB 2DF4C 3AZJC 1P3AA 1F66D 4NE5A 1ID3A 3A1KA 4R8PD 1KX5D 4WV4B 4J8WA 1P3GC 3W99B 3NQJB 5AV9D 5B0ZC 5CPIB 4H9PB 3WAAC 5AY8C 4H9RA 3LZ0B 4WU9D 3AZIC 3MVDD 4E45A 3EPJA 1KX4C 4H9NA 3TU4D 3AZFC 3H0RC 1W2EA 2Y2QA 3X1VA 1P3OA 3WKJA 2IO5C 1F66B 5BT1D 4G91C 3B0CW 4G92B 1M19C 3NQJA 5JA4A 4YS3A 1P34A 3C1BD 5B31B 2HUEB 2LY8A 1F66A 3REHC 4J8WC 1P3KD 3AFAB 1P3AB 4XUJD 1P34C 1KX5A 3C1CC 3UTBD 4Z66C 3REJC 4KUDC 3MGPC 3AYWD 2Y2IA 1BH8B 3W96C 5B33B 3AZJA 4H9RB 4ZUXB 3AZEB 4QLCB 5B1LC 3TU4A 3X1SA 5GT0C 3KFUG 5AV5C 1HQ3C 4LD9B 1ZLAD 5G49A 1M1AA 5E5AB 5CP6D 3MNNC 5AV9B 3X1TD 3AZND 1P34D 5GT3D 2ZY2A 1P3BA 4NFTA 3O62D 4H9QB 3MNNB 1KX3A 5AVCD 3EPLA 1P3BB 3UTBA 5C3IB 3KWQD 3AV2C 5DNMB 2YFWA 3AYWA 2W8SA 1M1AB 1S32D 2Y2NA 1P3FA 4YM6A 5AY8B 2BYKA 3LZ0C 5AV8B 5DNND 3W98B 1F1EA 1TAFA 3AV2A 3O62C 3X1SB 3B6GB 3UT9D 1P3PD 4HGAB 3VH6A 2ZY5A 3WA9B 3IP4C 5AY8D 1P3MD 5B0ZD 3AN2B 5C3IC 3WTPE 3AZMB 1P3GD 1KX4D 5KDMB 3KWQB 3AZNA 5BNXB 1P3BD 5GT0D 5G49B 3UTAC 1TZYC 4JJNB 3WTPD 1Q9CA 2F2AC 4X23D 4KGCA 3AYWC 3MGPD 1TZYB 4JJNC 5AV6D 4DQYB 3AZKD 1HQ3B 3MGRC 4LD9C 5B0YC 4QLCA 5B2IC 4ZUXA 5B2JD 5GSUB 3AZEA 1S32A 3X1VC 1P3OC 1P3FD 3WKJC 3LELC 5DNNA 3REHD 1Z2CB 3AZLA 2Y2JA 3UT9A 1P3PA 2CV5C 5AVBD 5F99D 5B33C 4ZBJB 3P5JB 3V9RB 5CPKC 3REJB 1M19D 3X1SC 1AOIC 5B0ZA 4KUDB 3AZLC 5AV6C 4H9PA 1P34B 3W99A 3X1TB 4J8WB 1AOIB 5B40D 1ID3C 3NQUB 3REJA 4KUDA 4KHAB 2Y2KA 3WTPA 4KGCC 1P3BC 4Z5TB 1WWIA 5BO0A 4AWLB 3AZKA 3W97B 3AZHA 5B2JA 4ZUXD 3AZED 4AWLC 3UT9C 1P3PC 1TZYA 2IO5B 3REHA 4Z5TD 3RELC 3VH5A 4WNNA 3UTAA 1HTAA 2Y2HA 5AVBA 1P3KB 1R4VA 3RELB 4J8XA 4WU9B 1M19A 1B67A 3RELA 3KWQC 5BNVA 2HIOD 5JRGC 1AOID 5BNXA 3W99D 3AZMC 3WAAB 5KDMA 5AVBC 2F8NH 5B40A 3REKA 3WA9C 2J8PA 5CPKB 2F8NA 4XZQB 2Y2MA 3R45B 5B1MD 3AZKC 5AV8A 2HIOB 1ZLAC 2AROA 5CPJD 3AZHD 1P3IC 1P3FB 2NQBA 2FFFB 5B2IB 1ULYA 5FUGA 5B0YA 1TZYD 3MGSB 3UTAD 3W96D 4H9QA 3MNNA 3AZFB 3KUYB 3RELD 2HIOA 1P3MC 2NQBB 1EQZB 3LZ1A 4UPKA 3KXBA 4LD9A 3MGQA 5B40B 1M18B 5BS7A 1P3IA 5B1MA 2AROD 5CPJA 2F8NK 2Y2PA 1KX4A 3B0DC 5B40C 3AZJB 5B33A 4YM6C 5B32B 4Z66B 5DNMD 2BYMB 4H9SA 5B1MC 4CSRB 2ZY3A 3REHB 2FJ7A 5F99C 2NZDA 4J8VC 3AV1B 2CV5D 5B32D 3MNND 2NQBC 3MGRA 4UUZA 1HQ3D 4G91B 4J8XC 4G92C 3VH5W 4WU8C 1M18D 3KXBD 5B31G 4J8UB 4LD9D 5GXQA 2Y2LA 5AV5B 4JJND 4EO5B 3FDDA 1JFIB 3TU4C 5CHLB 4R8PA 3REKC 2RIQA 5GT0B 3X1UA 2VQRA 4Z66D 5B0ZB 4H9OA 3AN2D 3W96B 3V9RA 4XUJC 3VH6W 3C1CB 3X1UB 2BYMA 3MGSD 4XUJB 2FJ7D 3REIC 3W98D 5B32A 1S32B 3AZGC 5DNMC 3C1BB 2JSSA 1EQZD 3EG5B 4WU8A 3A6NC 3LJAC 4UUZB 3AZFD 5GXQD 5CPKD 4J8VA 4DRBA 2FJ7C 5AVCC 4M6BA 3WAAD 5AV9C 4CAYB 5CP6B 3MVDB 4Z66A 3KUYA 3AZGB 1ZLAB 1H3OA 5CPJB 3AN2C 5B1MB 1TAFB 3W98A 2YFVA 3WTPC 1H3OB 5AV8C 1ZLAA 4NE3A 3LZ1B 5CP6A 5B24B 1PZRA 4ZBJC 4WJ3C 4WU8D 5GT3A 2F8NB 3AZHC 1P3AD 3O62A 3VH6T 1KX3D 3AL0C 1N1JA 5AVCA 4J8VD 3REKB 4J8WD 4WU8B 1P3KC 3KUYC 3WAAA 5B0YB 5AV9A 4J8UC 5BNVB 2JCHA 5DNNC 4YM6D 1BFMA 4CAYA 1B6WA 5F99B 3MVDA 3W97D 3R45A 3AV2D 2XD5A 3C1CA 1P3LB 3W97C 3B6FB 4J8UD 1U35A 1P3GA 5CPID 5AV6B 3LELA 3MGPB 3C1BA 2XD1A 5GT0A 5JRGA 2DQNC 3WTPB 3AV1D 2CV5B 1P3AC 5AVBB 1P3KA 3A6NA 3LJAA 4XUJA 3B0CT 4KGCD 3LELB 3MGPA 5AV6A 3KSYA 3MGRB 2ZY4A 4H9OB 3REIA 5B2JB 3AZJD 4YS3C 4WZSB 3X1VB 1P3OB 3W97A 5BO0B 3WKJB 3AZLD 3UT9B 1P3PB 3X1SD 3B6GD 3C1CD 3UTBC 3A6NB 3LJAB 5F99A 2NZDC 3NQUA 4J8UA 1KX4B 1U35D 1M1AD 5CPIA 3X1TA 3LELD 3C1BC 4KGCB 2RVQD 3W99C 3AZMD 1P3GB 1U35B 4Z2MH 2F8NG 2HIOC 5JRGD 3B6FA 5GXQC 1ID3B 3AV1A 3MGQB 3O62B 3A6ND 3LJAD 4CSRA 4X23C 3KXBB 3AZLB 3AZNB 3MGQC 3KWQA 1BH9B 5E5AD 2CWEA 3REID 4WU9C 2YFVB 3W98C 3AV2B 3B6GA 1N1JB 5AVCB 2BYKB 5AY8A 1P3MA 3AZGA 3AYWB 1F66C 2L5AA 4XZQA 3REKD 3AZMA 1A7WA 3B6FD 1KX3B 4X23A 2F8ND 5B31D 4QLCC 5FUGB 2NQBD 4QLCD 5E5AA 5B32C 4YM6B 3EPHA 5GT3C 3AZNC 3X1TC 1BH9A 3B6GC 5B0YD 3B6FC 3AFAD 3W96A 2HUEC 1BH8A 3AZGD 2JE5A 5GSUC 4XZQD 3LZ1D 1KX5B 4H9SC 4R8PB 4Z2MG 3REJD 1M19B 1JFIA 4KHAA 4KUDD 5AV5A 5B31A 5E5AC 4YS3B 3TU4B 5JA4B 3REIB 4XZQC 5GSUD 3LZ0D 1S32C 3AZKB 3EPKA 4Z5TA 3KXBC 3AFAA 3X1UC 1M18C 4HGAC 2Y2OA 3A1IA 4J8XD 2CV5A 5GXQB 5JRGB 1M1AC 1U35C 1AOIA 1HQ3A 5BS7C 2PYOD 3AZID 1M18A 2PYOC 5CP6C 3H0MC 1KX3C 4JJNA 3WA9D 5AV5D 2NZDB 5B31C 2FJ7B 4EO5C 1P3LA 3X1UD 4R8PC 3H0LC 2AROC 4H9NB 5DNNB 5AV8D 5B1LD 3AN2A 5GSUA 4DRAA 3LZ0A 2BG1A 2G5IC 3AV1C 1P3IB 4Z5TC 4NE6A 2G5HC 4E44A 3MGSA 5B2IA 4ZUXC 5CPIC 3AZEC 2ZM5A 5B1LB 5GT3B 2YFWB 2PYOA 3LZ1C 3AZIA 1EQZA 5B24A 5B32G 4X23B 1KU5A 1WWSA 3AZFA 5BT1C 3MGQD 2Y2GA 1ID3D 5CPKA 3WA9A 1P3LD 1P3LC 1EQZC 3AFAC 1P3ID 5CPJC 5B1LA 3KUYD 3MVDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RVQ C;  5B33 D;  1P3M B;  4WU9 A;  3VH5 T;  2ARO B;  4J8X B;  5DNM A;  3MGS C;  3UTB B;  4WNN B;  3UTA B;  4J8V B;  1KX5 C;  2NZD D;  3X1V D;  1P3F C;  1P3O D;  3WKJ D;  5B2J C;  5B2I D;  3B0B A;  3MGR D;  3AZH B;  3AZI B;  4YS3 D;  2PYO B;  5B24 D;  5B24 C;  3B0D B;  3AZJ C;  1P3A A;  1F66 D;  4NE5 A;  1ID3 A;  4R8P D;  1KX5 D;  4WV4 B;  4J8W A;  1P3G C;  3W99 B;  3NQJ B;  5AV9 D;  5B0Z C;  5CPI B;  4H9P B;  3WAA C;  5AY8 C;  4H9R A;  3LZ0 B;  4WU9 D;  3AZI C;  3MVD D;  4E45 A;  1KX4 C;  4H9N A;  3TU4 D;  3AZF C;  3X1V A;  1P3O A;  3WKJ A;  2IO5 C;  1F66 B;  5BT1 D;  4G91 C;  3B0C W;  4G92 B;  1M19 C;  3NQJ A;  5JA4 A;  4YS3 A;  1P34 A;  3C1B D;  5B31 B;  2HUE B;  2LY8 A;  1F66 A;  3REH C;  4J8W C;  1P3K D;  3AFA B;  1P3A B;  4XUJ D;  1P34 C;  1KX5 A;  3C1C C;  3UTB D;  4Z66 C;  3REJ C;  4KUD C;  3MGP C;  3AYW D;  1BH8 B;  3W96 C;  5B33 B;  3AZJ A;  4H9R B;  4ZUX B;  3AZE B;  4QLC B;  5B1L C;  3TU4 A;  3X1S A;  5GT0 C;  5AV5 C;  1HQ3 C;  4LD9 B;  1ZLA D;  5G49 A;  1M1A A;  5E5A B;  5CP6 D;  3MNN C;  5AV9 B;  3X1T D;  3AZN D;  1P34 D;  5GT3 D;  1P3B A;  4NFT A;  3O62 D;  4H9Q B;  3MNN B;  1KX3 A;  5AVC D;  1P3B B;  3UTB A;  5C3I B;  3KWQ D;  3AV2 C;  5DNM B;  2YFW A;  3AYW A;  1M1A B;  1S32 D;  1P3F A;  4YM6 A;  3LZ0 C;  2BYK A;  5AY8 B;  5AV8 B;  5DNN D;  3W98 B;  1F1E A;  1TAF A;  3AV2 A;  3O62 C;  3X1S B;  3B6G B;  3UT9 D;  1P3P D;  4HGA B;  3VH6 A;  3WA9 B;  5AY8 D;  1P3M D;  5B0Z D;  3AN2 B;  5C3I C;  3WTP E;  3AZM B;  1P3G D;  1KX4 D;  5KDM B;  3KWQ B;  3AZN A;  5BNX B;  1P3B D;  5GT0 D;  5G49 B;  3UTA C;  1TZY C;  4JJN B;  3WTP D;  1Q9C A;  4X23 D;  4KGC A;  3AYW C;  3MGP D;  1TZY B;  4JJN C;  5AV6 D;  3AZK D;  1HQ3 B;  3MGR C;  4LD9 C;  5B0Y C;  4QLC A;  4ZUX A;  5B2I C;  5B2J D;  5GSU B;  3AZE A;  1S32 A;  3X1V C;  1P3O C;  1P3F D;  3WKJ C;  3LEL C;  5DNN A;  3REH D;  3AZL A;  3UT9 A;  1P3P A;  2CV5 C;  5AVB D;  5F99 D;  5B33 C;  4ZBJ B;  3V9R B;  5CPK C;  3REJ B;  1M19 D;  3X1S C;  1AOI C;  5B0Z A;  4KUD B;  3AZL C;  5AV6 C;  4H9P A;  1P34 B;  3W99 A;  3X1T B;  4J8W B;  1AOI B;  5B40 D;  1ID3 C;  3NQU B;  3REJ A;  4KUD A;  4KHA B;  3WTP A;  4KGC C;  1P3B C;  4Z5T B;  1WWI A;  5BO0 A;  4AWL B;  3AZK A;  3W97 B;  3AZH A;  5B2J A;  4ZUX D;  3AZE D;  4AWL C;  3UT9 C;  1P3P C;  1TZY A;  2IO5 B;  3REH A;  4Z5T D;  3REL C;  3VH5 A;  4WNN A;  3UTA A;  1HTA A;  5AVB A;  1P3K B;  1R4V A;  3REL B;  4J8X A;  4WU9 B;  1M19 A;  1B67 A;  3REL A;  3KWQ C;  5BNV A;  2HIO D;  5JRG C;  1AOI D;  5BNX A;  3W99 D;  3AZM C;  3WAA B;  5KDM A;  5AVB C;  2F8N H;  5B40 A;  3REK A;  3WA9 C;  5CPK B;  2F8N A;  4XZQ B;  3R45 B;  5B1M D;  3AZK C;  5AV8 A;  2HIO B;  1ZLA C;  2ARO A;  5CPJ D;  3AZH D;  1P3I C;  1P3F B;  2NQB A;  5B2I B;  1ULY A;  5FUG A;  5B0Y A;  1TZY D;  3MGS B;  3UTA D;  3W96 D;  4H9Q A;  3MNN A;  3AZF B;  3KUY B;  3REL D;  2HIO A;  1P3M C;  2NQB B;  1EQZ B;  3LZ1 A;  3KXB A;  4LD9 A;  3MGQ A;  5B40 B;  1M18 B;  5BS7 A;  1P3I A;  5B1M A;  2ARO D;  5CPJ A;  2F8N K;  1KX4 A;  3B0D C;  5B40 C;  3AZJ B;  5B33 A;  4YM6 C;  5B32 B;  4Z66 B;  5DNM D;  2BYM B;  4H9S A;  5B1M C;  4CSR B;  3REH B;  2FJ7 A;  5F99 C;  2NZD A;  4J8V C;  3AV1 B;  2CV5 D;  5B32 D;  3MNN D;  2NQB C;  3MGR A;  4UUZ A;  1HQ3 D;  4G91 B;  4J8X C;  4G92 C;  3VH5 W;  4WU8 C;  1M18 D;  3KXB D;  5B31 G;  4J8U B;  4LD9 D;  5GXQ A;  5AV5 B;  4JJN D;  4EO5 B;  1JFI B;  3TU4 C;  5CHL B;  4R8P A;  3REK C;  5GT0 B;  3X1U A;  4Z66 D;  5B0Z B;  4H9O A;  3AN2 D;  3W96 B;  3V9R A;  4XUJ C;  3VH6 W;  3C1C B;  3X1U B;  2BYM A;  3MGS D;  4XUJ B;  2FJ7 D;  3REI C;  3W98 D;  5B32 A;  1S32 B;  3AZG C;  5DNM C;  3C1B B;  2JSS A;  1EQZ D;  4WU8 A;  3A6N C;  3LJA C;  4UUZ B;  3AZF D;  5GXQ D;  5CPK D;  4J8V A;  4DRB A;  2FJ7 C;  5AVC C;  4M6B A;  3WAA D;  5AV9 C;  4CAY B;  5CP6 B;  3MVD B;  4Z66 A;  3KUY A;  3AZG B;  1ZLA B;  1H3O A;  5CPJ B;  3AN2 C;  5B1M B;  1TAF B;  3W98 A;  2YFV A;  3WTP C;  1H3O B;  5AV8 C;  1ZLA A;  4NE3 A;  3LZ1 B;  5CP6 A;  5B24 B;  4ZBJ C;  4WU8 D;  5GT3 A;  2F8N B;  3AZH C;  1P3A D;  3O62 A;  3VH6 T;  1KX3 D;  1N1J A;  5AVC A;  4J8V D;  3REK B;  4J8W D;  4WU8 B;  1P3K C;  3KUY C;  3WAA A;  5B0Y B;  5AV9 A;  4J8U C;  5BNV B;  5DNN C;  4YM6 D;  1BFM A;  4CAY A;  1B6W A;  5F99 B;  3MVD A;  3W97 D;  3R45 A;  3AV2 D;  3W97 C;  3C1C A;  1P3L B;  3B6F B;  4J8U D;  1U35 A;  1P3G A;  5CPI D;  5AV6 B;  3LEL A;  3MGP B;  3C1B A;  5GT0 A;  5JRG A;  3WTP B;  3AV1 D;  2CV5 B;  1P3A C;  5AVB B;  1P3K A;  3A6N A;  3LJA A;  4XUJ A;  3B0C T;  4KGC D;  3LEL B;  3MGP A;  5AV6 A;  3KSY A;  3MGR B;  4H9O B;  3AZJ D;  3REI A;  5B2J B;  4YS3 C;  4WZS B;  3X1V B;  1P3O B;  3W97 A;  5BO0 B;  3WKJ B;  3AZL D;  3UT9 B;  1P3P B;  3X1S D;  3B6G D;  3C1C D;  3UTB C;  3A6N B;  3LJA B;  5F99 A;  2NZD C;  3NQU A;  4J8U A;  1KX4 B;  1U35 D;  1M1A D;  5CPI A;  3X1T A;  3LEL D;  3C1B C;  4KGC B;  2RVQ D;  3W99 C;  3AZM D;  1P3G B;  1U35 B;  4Z2M H;  2F8N G;  2HIO C;  5JRG D;  3B6F A;  5GXQ C;  1ID3 B;  3AV1 A;  3MGQ B;  3O62 B;  3A6N D;  3LJA D;  4CSR A;  4X23 C;  3KXB B;  3AZL B;  3AZN B;  3MGQ C;  3KWQ A;  1BH9 B;  5E5A D;  2CWE A;  3REI D;  4WU9 C;  2YFV B;  3W98 C;  3AV2 B;  3B6G A;  1N1J B;  5AVC B;  2BYK B;  5AY8 A;  1P3M A;  3AZG A;  3AYW B;  1F66 C;  2L5A A;  4XZQ A;  3REK D;  3AZM A;  1A7W A;  3B6F D;  1KX3 B;  4X23 A;  2F8N D;  5B31 D;  4QLC C;  5FUG B;  2NQB D;  4QLC D;  5E5A A;  5B32 C;  4YM6 B;  5GT3 C;  3AZN C;  3X1T C;  1BH9 A;  3B6G C;  5B0Y D;  3B6F C;  3AFA D;  3W96 A;  2HUE C;  1BH8 A;  3AZG D;  5GSU C;  4XZQ D;  3LZ1 D;  1KX5 B;  4H9S C;  4R8P B;  4Z2M G;  3REJ D;  1M19 B;  1JFI A;  4KHA A;  4KUD D;  5AV5 A;  5B31 A;  5E5A C;  4YS3 B;  3TU4 B;  5JA4 B;  3REI B;  4XZQ C;  5GSU D;  3LZ0 D;  1S32 C;  3AZK B;  4Z5T A;  3KXB C;  3AFA A;  3X1U C;  1M18 C;  4HGA C;  4J8X D;  2CV5 A;  5GXQ B;  5JRG B;  1M1A C;  1U35 C;  1AOI A;  1HQ3 A;  5BS7 C;  2PYO D;  3AZI D;  1M18 A;  2PYO C;  5CP6 C;  1KX3 C;  4JJN A;  3WA9 D;  5AV5 D;  2NZD B;  5B31 C;  2FJ7 B;  4EO5 C;  1P3L A;  3X1U D;  4R8P C;  2ARO C;  4H9N B;  5DNN B;  5AV8 D;  5B1L D;  3AN2 A;  5GSU A;  4DRA A;  3LZ0 A;  3AV1 C;  1P3I B;  4Z5T C;  4NE6 A;  4E44 A;  3MGS A;  5B2I A;  4ZUX C;  5CPI C;  3AZE C;  5B1L B;  5GT3 B;  2YFW B;  2PYO A;  3LZ1 C;  3AZI A;  1EQZ A;  5B24 A;  5B32 G;  4X23 B;  1KU5 A;  1WWS A;  3AZF A;  5BT1 C;  3MGQ D;  3WA9 A;  1ID3 D;  5CPK A;  1P3L D;  1P3L C;  1EQZ C;  3AFA C;  1P3I D;  5CPJ C;  5B1L A;  3KUY D;  3MVD C; 
#chains in the Genus database with same CATH topology
 2RVQ C;  5B33 D;  1P3M B;  4WU9 A;  3VH5 T;  2ARO B;  4J8X B;  5DNM A;  3MGS C;  3UTB B;  3F6T A;  4WNN B;  3UTA B;  4J8V B;  1T3U A;  1KX5 C;  2NZD D;  3X1V D;  1P3F C;  1P3O D;  3WKJ D;  5B2J C;  5B2I D;  3B0B A;  3MGR D;  3AZH B;  3AZI B;  4YS3 D;  2PYO B;  2UWX A;  5B24 C;  5B24 D;  3B0D B;  2DF4 C;  3AZJ C;  1P3A A;  1F66 D;  4NE5 A;  1ID3 A;  3A1K A;  4R8P D;  1KX5 D;  4WV4 B;  4J8W A;  1P3G C;  3W99 B;  3NQJ B;  5AV9 D;  5B0Z C;  5CPI B;  4H9P B;  3WAA C;  5AY8 C;  4H9R A;  3LZ0 B;  4WU9 D;  3AZI C;  3MVD D;  4E45 A;  3EPJ A;  1KX4 C;  4H9N A;  3TU4 D;  3AZF C;  3H0R C;  1W2E A;  2Y2Q A;  3X1V A;  1P3O A;  3WKJ A;  2IO5 C;  1F66 B;  5BT1 D;  4G91 C;  3B0C W;  4G92 B;  1M19 C;  3NQJ A;  5JA4 A;  4YS3 A;  1P34 A;  3C1B D;  5B31 B;  2HUE B;  2LY8 A;  1F66 A;  3REH C;  4J8W C;  1P3K D;  3AFA B;  1P3A B;  4XUJ D;  1P34 C;  1KX5 A;  3C1C C;  3UTB D;  4Z66 C;  3REJ C;  4KUD C;  3MGP C;  3AYW D;  2Y2I A;  1BH8 B;  3W96 C;  5B33 B;  3AZJ A;  4H9R B;  4ZUX B;  3AZE B;  4QLC B;  5B1L C;  3TU4 A;  3X1S A;  5GT0 C;  3KFU G;  5AV5 C;  1HQ3 C;  4LD9 B;  1ZLA D;  5G49 A;  1M1A A;  5E5A B;  5CP6 D;  3MNN C;  5AV9 B;  3X1T D;  3AZN D;  1P34 D;  5GT3 D;  2ZY2 A;  1P3B A;  4NFT A;  3O62 D;  4H9Q B;  3MNN B;  1KX3 A;  5AVC D;  3EPL A;  1P3B B;  3UTB A;  5C3I B;  3KWQ D;  3AV2 C;  5DNM B;  2YFW A;  3AYW A;  2W8S A;  1M1A B;  1S32 D;  2Y2N A;  1P3F A;  4YM6 A;  5AY8 B;  2BYK A;  3LZ0 C;  5AV8 B;  5DNN D;  3W98 B;  1F1E A;  1TAF A;  3AV2 A;  3O62 C;  3X1S B;  3B6G B;  3UT9 D;  1P3P D;  4HGA B;  3VH6 A;  2ZY5 A;  3WA9 B;  3IP4 C;  5AY8 D;  1P3M D;  5B0Z D;  3AN2 B;  5C3I C;  3WTP E;  3AZM B;  1P3G D;  1KX4 D;  5KDM B;  3KWQ B;  3AZN A;  5BNX B;  1P3B D;  5GT0 D;  5G49 B;  3UTA C;  1TZY C;  4JJN B;  3WTP D;  1Q9C A;  2F2A C;  4X23 D;  4KGC A;  3AYW C;  3MGP D;  1TZY B;  4JJN C;  5AV6 D;  4DQY B;  3AZK D;  1HQ3 B;  3MGR C;  4LD9 C;  5B0Y C;  4QLC A;  5B2I C;  4ZUX A;  5B2J D;  5GSU B;  3AZE A;  1S32 A;  3X1V C;  1P3O C;  1P3F D;  3WKJ C;  3LEL C;  5DNN A;  3REH D;  1Z2C B;  3AZL A;  2Y2J A;  3UT9 A;  1P3P A;  2CV5 C;  5AVB D;  5F99 D;  5B33 C;  4ZBJ B;  3P5J B;  3V9R B;  5CPK C;  3REJ B;  1M19 D;  3X1S C;  1AOI C;  5B0Z A;  4KUD B;  3AZL C;  5AV6 C;  4H9P A;  1P34 B;  3W99 A;  3X1T B;  4J8W B;  1AOI B;  5B40 D;  1ID3 C;  3NQU B;  3REJ A;  4KUD A;  4KHA B;  2Y2K A;  3WTP A;  4KGC C;  1P3B C;  4Z5T B;  1WWI A;  5BO0 A;  4AWL B;  3AZK A;  3W97 B;  3AZH A;  5B2J A;  4ZUX D;  3AZE D;  4AWL C;  3UT9 C;  1P3P C;  1TZY A;  2IO5 B;  3REH A;  4Z5T D;  3REL C;  3VH5 A;  4WNN A;  3UTA A;  1HTA A;  2Y2H A;  5AVB A;  1P3K B;  1R4V A;  3REL B;  4J8X A;  4WU9 B;  1M19 A;  1B67 A;  3REL A;  3KWQ C;  5BNV A;  2HIO D;  5JRG C;  1AOI D;  5BNX A;  3W99 D;  3AZM C;  3WAA B;  5KDM A;  5AVB C;  2F8N H;  5B40 A;  3REK A;  3WA9 C;  2J8P A;  5CPK B;  2F8N A;  4XZQ B;  2Y2M A;  3R45 B;  5B1M D;  3AZK C;  5AV8 A;  2HIO B;  1ZLA C;  2ARO A;  5CPJ D;  3AZH D;  1P3I C;  1P3F B;  2NQB A;  2FFF B;  5B2I B;  1ULY A;  5FUG A;  5B0Y A;  1TZY D;  3MGS B;  3UTA D;  3W96 D;  4H9Q A;  3MNN A;  3AZF B;  3KUY B;  3REL D;  2HIO A;  1P3M C;  2NQB B;  1EQZ B;  3LZ1 A;  4UPK A;  3KXB A;  4LD9 A;  3MGQ A;  5B40 B;  1M18 B;  5BS7 A;  1P3I A;  5B1M A;  2ARO D;  5CPJ A;  2F8N K;  2Y2P A;  1KX4 A;  3B0D C;  5B40 C;  3AZJ B;  5B33 A;  4YM6 C;  5B32 B;  4Z66 B;  5DNM D;  2BYM B;  4H9S A;  5B1M C;  4CSR B;  2ZY3 A;  3REH B;  2FJ7 A;  5F99 C;  2NZD A;  4J8V C;  3AV1 B;  2CV5 D;  5B32 D;  3MNN D;  2NQB C;  3MGR A;  4UUZ A;  1HQ3 D;  4G91 B;  4J8X C;  4G92 C;  3VH5 W;  4WU8 C;  1M18 D;  3KXB D;  5B31 G;  4J8U B;  4LD9 D;  5GXQ A;  2Y2L A;  5AV5 B;  4JJN D;  4EO5 B;  3FDD A;  1JFI B;  3TU4 C;  5CHL B;  4R8P A;  3REK C;  2RIQ A;  5GT0 B;  3X1U A;  2VQR A;  4Z66 D;  5B0Z B;  4H9O A;  3AN2 D;  3W96 B;  3V9R A;  4XUJ C;  3VH6 W;  3C1C B;  3X1U B;  2BYM A;  3MGS D;  4XUJ B;  2FJ7 D;  3REI C;  3W98 D;  5B32 A;  1S32 B;  3AZG C;  5DNM C;  3C1B B;  2JSS A;  1EQZ D;  3EG5 B;  4WU8 A;  3A6N C;  3LJA C;  4UUZ B;  3AZF D;  5GXQ D;  5CPK D;  4J8V A;  4DRB A;  2FJ7 C;  5AVC C;  4M6B A;  3WAA D;  5AV9 C;  4CAY B;  5CP6 B;  3MVD B;  4Z66 A;  3KUY A;  3AZG B;  1ZLA B;  1H3O A;  5CPJ B;  3AN2 C;  5B1M B;  1TAF B;  3W98 A;  2YFV A;  3WTP C;  1H3O B;  5AV8 C;  1ZLA A;  4NE3 A;  3LZ1 B;  5CP6 A;  5B24 B;  1PZR A;  4ZBJ C;  4WJ3 C;  4WU8 D;  5GT3 A;  2F8N B;  3AZH C;  1P3A D;  3O62 A;  3VH6 T;  1KX3 D;  3AL0 C;  1N1J A;  5AVC A;  4J8V D;  3REK B;  4J8W D;  4WU8 B;  1P3K C;  3KUY C;  3WAA A;  5B0Y B;  5AV9 A;  4J8U C;  5BNV B;  2JCH A;  5DNN C;  4YM6 D;  1BFM A;  4CAY A;  1B6W A;  5F99 B;  3MVD A;  3W97 D;  3R45 A;  3AV2 D;  2XD5 A;  3C1C A;  1P3L B;  3W97 C;  3B6F B;  4J8U D;  1U35 A;  1P3G A;  5CPI D;  5AV6 B;  3LEL A;  3MGP B;  3C1B A;  2XD1 A;  5GT0 A;  5JRG A;  2DQN C;  3WTP B;  3AV1 D;  2CV5 B;  1P3A C;  5AVB B;  1P3K A;  3A6N A;  3LJA A;  4XUJ A;  3B0C T;  4KGC D;  3LEL B;  3MGP A;  5AV6 A;  3KSY A;  3MGR B;  2ZY4 A;  4H9O B;  3REI A;  5B2J B;  3AZJ D;  4YS3 C;  4WZS B;  3X1V B;  1P3O B;  3W97 A;  5BO0 B;  3WKJ B;  3AZL D;  3UT9 B;  1P3P B;  3X1S D;  3B6G D;  3C1C D;  3UTB C;  3A6N B;  3LJA B;  5F99 A;  2NZD C;  3NQU A;  4J8U A;  1KX4 B;  1U35 D;  1M1A D;  5CPI A;  3X1T A;  3LEL D;  3C1B C;  4KGC B;  2RVQ D;  3W99 C;  3AZM D;  1P3G B;  1U35 B;  4Z2M H;  2F8N G;  2HIO C;  5JRG D;  3B6F A;  5GXQ C;  1ID3 B;  3AV1 A;  3MGQ B;  3O62 B;  3A6N D;  3LJA D;  4CSR A;  4X23 C;  3KXB B;  3AZL B;  3AZN B;  3MGQ C;  3KWQ A;  1BH9 B;  5E5A D;  2CWE A;  3REI D;  4WU9 C;  2YFV B;  3W98 C;  3AV2 B;  3B6G A;  1N1J B;  5AVC B;  2BYK B;  5AY8 A;  1P3M A;  3AZG A;  3AYW B;  1F66 C;  2L5A A;  4XZQ A;  3REK D;  3AZM A;  1A7W A;  3B6F D;  1KX3 B;  4X23 A;  2F8N D;  5B31 D;  4QLC C;  5FUG B;  2NQB D;  4QLC D;  5E5A A;  5B32 C;  4YM6 B;  3EPH A;  5GT3 C;  3AZN C;  3X1T C;  1BH9 A;  3B6G C;  5B0Y D;  3B6F C;  3AFA D;  3W96 A;  2HUE C;  1BH8 A;  3AZG D;  2JE5 A;  5GSU C;  4XZQ D;  3LZ1 D;  1KX5 B;  4H9S C;  4R8P B;  4Z2M G;  3REJ D;  1M19 B;  1JFI A;  4KHA A;  4KUD D;  5AV5 A;  5B31 A;  5E5A C;  4YS3 B;  3TU4 B;  5JA4 B;  3REI B;  4XZQ C;  5GSU D;  3LZ0 D;  1S32 C;  3AZK B;  3EPK A;  4Z5T A;  3KXB C;  3AFA A;  3X1U C;  1M18 C;  4HGA C;  2Y2O A;  3A1I A;  4J8X D;  2CV5 A;  5GXQ B;  5JRG B;  1M1A C;  1U35 C;  1AOI A;  1HQ3 A;  5BS7 C;  2PYO D;  3AZI D;  1M18 A;  2PYO C;  5CP6 C;  3H0M C;  1KX3 C;  4JJN A;  3WA9 D;  5AV5 D;  2NZD B;  5B31 C;  2FJ7 B;  4EO5 C;  1P3L A;  3X1U D;  4R8P C;  3H0L C;  2ARO C;  4H9N B;  5DNN B;  5AV8 D;  5B1L D;  3AN2 A;  5GSU A;  4DRA A;  3LZ0 A;  2BG1 A;  2G5I C;  3AV1 C;  1P3I B;  4Z5T C;  4NE6 A;  2G5H C;  4E44 A;  3MGS A;  5B2I A;  4ZUX C;  5CPI C;  3AZE C;  2ZM5 A;  5B1L B;  5GT3 B;  2YFW B;  2PYO A;  3LZ1 C;  3AZI A;  1EQZ A;  5B24 A;  5B32 G;  4X23 B;  1KU5 A;  1WWS A;  3AZF A;  5BT1 C;  3MGQ D;  2Y2G A;  1ID3 D;  5CPK A;  3WA9 A;  1P3L D;  1P3L C;  1EQZ C;  3AFA C;  1P3I D;  5CPJ C;  5B1L A;  3KUY D;  3MVD C; 
#chains in the Genus database with same CATH homology
 2RVQ C;  5B33 D;  1P3M B;  4WU9 A;  3VH5 T;  2ARO B;  4J8X B;  5DNM A;  3MGS C;  3UTB B;  3F6T A;  4WNN B;  3UTA B;  4J8V B;  1T3U A;  1KX5 C;  2NZD D;  3X1V D;  1P3F C;  1P3O D;  3WKJ D;  5B2J C;  5B2I D;  3B0B A;  3MGR D;  3AZH B;  3AZI B;  4YS3 D;  2PYO B;  2UWX A;  5B24 C;  5B24 D;  3B0D B;  2DF4 C;  3AZJ C;  1P3A A;  1F66 D;  4NE5 A;  1ID3 A;  3A1K A;  4R8P D;  1KX5 D;  4WV4 B;  4J8W A;  1P3G C;  3W99 B;  3NQJ B;  5AV9 D;  5B0Z C;  5CPI B;  4H9P B;  3WAA C;  5AY8 C;  4H9R A;  3LZ0 B;  4WU9 D;  3AZI C;  3MVD D;  4E45 A;  3EPJ A;  1KX4 C;  4H9N A;  3TU4 D;  3AZF C;  3H0R C;  1W2E A;  2Y2Q A;  3X1V A;  1P3O A;  3WKJ A;  2IO5 C;  1F66 B;  5BT1 D;  4G91 C;  3B0C W;  4G92 B;  1M19 C;  3NQJ A;  5JA4 A;  4YS3 A;  1P34 A;  3C1B D;  5B31 B;  2HUE B;  2LY8 A;  1F66 A;  3REH C;  4J8W C;  1P3K D;  3AFA B;  1P3A B;  4XUJ D;  1P34 C;  1KX5 A;  3C1C C;  3UTB D;  4Z66 C;  3REJ C;  4KUD C;  3MGP C;  3AYW D;  2Y2I A;  1BH8 B;  3W96 C;  5B33 B;  3AZJ A;  4H9R B;  4ZUX B;  3AZE B;  4QLC B;  5B1L C;  3TU4 A;  3X1S A;  5GT0 C;  3KFU G;  5AV5 C;  1HQ3 C;  4LD9 B;  1ZLA D;  5G49 A;  1M1A A;  5E5A B;  5CP6 D;  3MNN C;  5AV9 B;  3X1T D;  3AZN D;  1P34 D;  5GT3 D;  2ZY2 A;  1P3B A;  4NFT A;  3O62 D;  4H9Q B;  3MNN B;  1KX3 A;  5AVC D;  3EPL A;  1P3B B;  3UTB A;  5C3I B;  3KWQ D;  3AV2 C;  5DNM B;  2YFW A;  3AYW A;  2W8S A;  1M1A B;  1S32 D;  2Y2N A;  1P3F A;  4YM6 A;  5AY8 B;  2BYK A;  3LZ0 C;  5AV8 B;  5DNN D;  3W98 B;  1F1E A;  1TAF A;  3AV2 A;  3O62 C;  3X1S B;  3B6G B;  3UT9 D;  1P3P D;  4HGA B;  3VH6 A;  2ZY5 A;  3WA9 B;  3IP4 C;  5AY8 D;  1P3M D;  5B0Z D;  3AN2 B;  5C3I C;  3WTP E;  3AZM B;  1P3G D;  1KX4 D;  5KDM B;  3KWQ B;  3AZN A;  5BNX B;  1P3B D;  5GT0 D;  5G49 B;  3UTA C;  1TZY C;  4JJN B;  3WTP D;  1Q9C A;  2F2A C;  4X23 D;  4KGC A;  3AYW C;  3MGP D;  1TZY B;  4JJN C;  5AV6 D;  4DQY B;  3AZK D;  1HQ3 B;  3MGR C;  4LD9 C;  5B0Y C;  4QLC A;  5B2I C;  4ZUX A;  5B2J D;  5GSU B;  3AZE A;  1S32 A;  3X1V C;  1P3O C;  1P3F D;  3WKJ C;  3LEL C;  5DNN A;  3REH D;  1Z2C B;  3AZL A;  2Y2J A;  3UT9 A;  1P3P A;  2CV5 C;  5AVB D;  5F99 D;  5B33 C;  4ZBJ B;  3P5J B;  3V9R B;  5CPK C;  3REJ B;  1M19 D;  3X1S C;  1AOI C;  5B0Z A;  4KUD B;  3AZL C;  5AV6 C;  4H9P A;  1P34 B;  3W99 A;  3X1T B;  4J8W B;  1AOI B;  5B40 D;  1ID3 C;  3NQU B;  3REJ A;  4KUD A;  4KHA B;  2Y2K A;  3WTP A;  4KGC C;  1P3B C;  4Z5T B;  1WWI A;  5BO0 A;  4AWL B;  3AZK A;  3W97 B;  3AZH A;  5B2J A;  4ZUX D;  3AZE D;  4AWL C;  3UT9 C;  1P3P C;  1TZY A;  2IO5 B;  3REH A;  4Z5T D;  3REL C;  3VH5 A;  4WNN A;  3UTA A;  1HTA A;  2Y2H A;  5AVB A;  1P3K B;  1R4V A;  3REL B;  4J8X A;  4WU9 B;  1M19 A;  1B67 A;  3REL A;  3KWQ C;  5BNV A;  2HIO D;  5JRG C;  1AOI D;  5BNX A;  3W99 D;  3AZM C;  3WAA B;  5KDM A;  5AVB C;  2F8N H;  5B40 A;  3REK A;  3WA9 C;  2J8P A;  5CPK B;  2F8N A;  4XZQ B;  2Y2M A;  3R45 B;  5B1M D;  3AZK C;  5AV8 A;  2HIO B;  1ZLA C;  2ARO A;  5CPJ D;  3AZH D;  1P3I C;  1P3F B;  2NQB A;  2FFF B;  5B2I B;  1ULY A;  5FUG A;  5B0Y A;  1TZY D;  3MGS B;  3UTA D;  3W96 D;  4H9Q A;  3MNN A;  3AZF B;  3KUY B;  3REL D;  2HIO A;  1P3M C;  2NQB B;  1EQZ B;  3LZ1 A;  4UPK A;  3KXB A;  4LD9 A;  3MGQ A;  5B40 B;  1M18 B;  5BS7 A;  1P3I A;  5B1M A;  2ARO D;  5CPJ A;  2F8N K;  2Y2P A;  1KX4 A;  3B0D C;  5B40 C;  3AZJ B;  5B33 A;  4YM6 C;  5B32 B;  4Z66 B;  5DNM D;  2BYM B;  4H9S A;  5B1M C;  4CSR B;  2ZY3 A;  3REH B;  2FJ7 A;  5F99 C;  2NZD A;  4J8V C;  3AV1 B;  2CV5 D;  5B32 D;  3MNN D;  2NQB C;  3MGR A;  4UUZ A;  1HQ3 D;  4G91 B;  4J8X C;  4G92 C;  3VH5 W;  4WU8 C;  1M18 D;  3KXB D;  5B31 G;  4J8U B;  4LD9 D;  5GXQ A;  2Y2L A;  5AV5 B;  4JJN D;  4EO5 B;  3FDD A;  1JFI B;  3TU4 C;  5CHL B;  4R8P A;  3REK C;  2RIQ A;  5GT0 B;  3X1U A;  2VQR A;  4Z66 D;  5B0Z B;  4H9O A;  3AN2 D;  3W96 B;  3V9R A;  4XUJ C;  3VH6 W;  3C1C B;  3X1U B;  2BYM A;  3MGS D;  4XUJ B;  2FJ7 D;  3REI C;  3W98 D;  5B32 A;  1S32 B;  3AZG C;  5DNM C;  3C1B B;  2JSS A;  1EQZ D;  3EG5 B;  4WU8 A;  3A6N C;  3LJA C;  4UUZ B;  3AZF D;  5GXQ D;  5CPK D;  4J8V A;  4DRB A;  2FJ7 C;  5AVC C;  4M6B A;  3WAA D;  5AV9 C;  4CAY B;  5CP6 B;  3MVD B;  4Z66 A;  3KUY A;  3AZG B;  1ZLA B;  1H3O A;  5CPJ B;  3AN2 C;  5B1M B;  1TAF B;  3W98 A;  2YFV A;  3WTP C;  1H3O B;  5AV8 C;  1ZLA A;  4NE3 A;  3LZ1 B;  5CP6 A;  5B24 B;  1PZR A;  4ZBJ C;  4WJ3 C;  4WU8 D;  5GT3 A;  2F8N B;  3AZH C;  1P3A D;  3O62 A;  3VH6 T;  1KX3 D;  3AL0 C;  1N1J A;  5AVC A;  4J8V D;  3REK B;  4J8W D;  4WU8 B;  1P3K C;  3KUY C;  3WAA A;  5B0Y B;  5AV9 A;  4J8U C;  5BNV B;  2JCH A;  5DNN C;  4YM6 D;  1BFM A;  4CAY A;  1B6W A;  5F99 B;  3MVD A;  3W97 D;  3R45 A;  3AV2 D;  2XD5 A;  3C1C A;  1P3L B;  3W97 C;  3B6F B;  4J8U D;  1U35 A;  1P3G A;  5CPI D;  5AV6 B;  3LEL A;  3MGP B;  3C1B A;  2XD1 A;  5GT0 A;  5JRG A;  2DQN C;  3WTP B;  3AV1 D;  2CV5 B;  1P3A C;  5AVB B;  1P3K A;  3A6N A;  3LJA A;  4XUJ A;  3B0C T;  4KGC D;  3LEL B;  3MGP A;  5AV6 A;  3KSY A;  3MGR B;  2ZY4 A;  4H9O B;  3REI A;  5B2J B;  3AZJ D;  4YS3 C;  4WZS B;  3X1V B;  1P3O B;  3W97 A;  5BO0 B;  3WKJ B;  3AZL D;  3UT9 B;  1P3P B;  3X1S D;  3B6G D;  3C1C D;  3UTB C;  3A6N B;  3LJA B;  5F99 A;  2NZD C;  3NQU A;  4J8U A;  1KX4 B;  1U35 D;  1M1A D;  5CPI A;  3X1T A;  3LEL D;  3C1B C;  4KGC B;  2RVQ D;  3W99 C;  3AZM D;  1P3G B;  1U35 B;  4Z2M H;  2F8N G;  2HIO C;  5JRG D;  3B6F A;  5GXQ C;  1ID3 B;  3AV1 A;  3MGQ B;  3O62 B;  3A6N D;  3LJA D;  4CSR A;  4X23 C;  3KXB B;  3AZL B;  3AZN B;  3MGQ C;  3KWQ A;  1BH9 B;  5E5A D;  2CWE A;  3REI D;  4WU9 C;  2YFV B;  3W98 C;  3AV2 B;  3B6G A;  1N1J B;  5AVC B;  2BYK B;  5AY8 A;  1P3M A;  3AZG A;  3AYW B;  1F66 C;  2L5A A;  4XZQ A;  3REK D;  3AZM A;  1A7W A;  3B6F D;  1KX3 B;  4X23 A;  2F8N D;  5B31 D;  4QLC C;  5FUG B;  2NQB D;  4QLC D;  5E5A A;  5B32 C;  4YM6 B;  3EPH A;  5GT3 C;  3AZN C;  3X1T C;  1BH9 A;  3B6G C;  5B0Y D;  3B6F C;  3AFA D;  3W96 A;  2HUE C;  1BH8 A;  3AZG D;  2JE5 A;  5GSU C;  4XZQ D;  3LZ1 D;  1KX5 B;  4H9S C;  4R8P B;  4Z2M G;  3REJ D;  1M19 B;  1JFI A;  4KHA A;  4KUD D;  5AV5 A;  5B31 A;  5E5A C;  4YS3 B;  3TU4 B;  5JA4 B;  3REI B;  4XZQ C;  5GSU D;  3LZ0 D;  1S32 C;  3AZK B;  3EPK A;  4Z5T A;  3KXB C;  3AFA A;  3X1U C;  1M18 C;  4HGA C;  2Y2O A;  3A1I A;  4J8X D;  2CV5 A;  5GXQ B;  5JRG B;  1M1A C;  1U35 C;  1AOI A;  1HQ3 A;  5BS7 C;  2PYO D;  3AZI D;  1M18 A;  2PYO C;  5CP6 C;  3H0M C;  1KX3 C;  4JJN A;  3WA9 D;  5AV5 D;  2NZD B;  5B31 C;  2FJ7 B;  4EO5 C;  1P3L A;  3X1U D;  4R8P C;  3H0L C;  2ARO C;  4H9N B;  5DNN B;  5AV8 D;  5B1L D;  3AN2 A;  5GSU A;  4DRA A;  3LZ0 A;  2BG1 A;  2G5I C;  3AV1 C;  1P3I B;  4Z5T C;  4NE6 A;  2G5H C;  4E44 A;  3MGS A;  5B2I A;  4ZUX C;  5CPI C;  3AZE C;  2ZM5 A;  5B1L B;  5GT3 B;  2YFW B;  2PYO A;  3LZ1 C;  3AZI A;  1EQZ A;  5B24 A;  5B32 G;  4X23 B;  1KU5 A;  1WWS A;  3AZF A;  5BT1 C;  3MGQ D;  2Y2G A;  1ID3 D;  5CPK A;  3WA9 A;  1P3L D;  1P3L C;  1EQZ C;  3AFA C;  1P3I D;  5CPJ C;  5B1L A;  3KUY D;  3MVD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...