3WAAD

The nucleosome containing human h2a.z.2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
94
structure length
94
Chain Sequence
RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 38
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3waaD00
5B0ZC 1P3FA 3REKB 3AZEA 3AYWB 3W96D 4XUJC 3LELC 1N1JB 1S32C 2CV5D 5B31A 1KX3B 3UTBC 3UT9A 2IO5C 2HUEB 5B40A 3MGPB 2PYOD 5B32B 4Z66C 3MNNC 3AZNC 4H9RA 3REJC 5AVBA 4NE6A 1P3GB 1BH8B 3VH5W 3AZLD 4G91C 1ID3D 1TZYA 2FJ7A 5CPJA 5AVCC 4R8PA 5BNVA 1P3KA 5DNMB 5B24D 4ZUXD 3AZKA 4WU8B 2L5AA 3AV2C 4KUDB 5CPKD 5B0YB 3C1CB 4J8WB 1P3BD 3MVDB 3MGRB 5DNNB 5AV5A 2BYKB 5BNXA 2RVQD 1P3AB 4UUZA 5CP6A 3KUYC 5B33C 3KWQA 5FUGB 1ZLAB 3C1BC 5GSUB 3RELD 4X23B 4KGCA 1KU5A 3LJAB 5KDMA 5C3IB 3AV1C 5GT0C 3AFAB 5AV8A 3B6GB 4H9SA 3AZFA 4WNNB 1P3LB 4J8XB 3X1VC 3WTPC 1KX5B 4WU9C 1A7WA 5G49B 3X1UD 4XZQA 1U35C 5B2JD 3WAAB 3REID 3AZJC 3AZGA 1P3MA 5E5AD 5GT3B 1AOIC 5B1LD 1KX4C 3AYWA 4QLCB 3WA9C 3W96A 1M19B 1EQZD 3A6ND 1N1JA 4JJND 4LD9B 3B0CT 3AZEB 3B0DC 3AZJD 1KX3A 1JFIB 5F99B 1P3FC 1AOID 4G92C 5B31B 2PYOA 3AZIC 1HQ3D 1WWIA 3X1SC 3NQUB 3LZ1D 1P3GA 1BH8A 5BS7A 4YS3D 3X1TB 5AY8D 4Z2MH 3MGQB 1F66D 3UT9C 3UTAC 5B40C 5CPIA 4DRBA 3AZHD 3B6FD 1ULYA 4WV4B 5B24A 4H9NB 4Z5TB 5AVBC 3AZMD 1P3IB 4J8WA 5AV9D 3MVDA 3MGRA 3AN2B 5DNNA 1M1AB 2BYKA 1P34D 1TZYC 2F8NH 5CPJC 2FJ7C 4R8PC 4AWLB 1P3KC 2NZDB 3O62D 3TU4C 3REHD 4UUZB 3KXBD 5JRGB 2HIOD 3AZKC 1M18B 4X23A 5JA4B 5AV6B 3LJAA 3W98B 4HGAC 3AFAA 5CP6C 3WKJA 3B6GA 4J8UD 5KDMB 3KWQC 1P3LA 5B1MC 5BT1D 4J8XA 3W97B 4WZSB 1KX5A 2NQBD 5G49A 2AROB 4ZBJB 3WAAA 5B2JA 5GT3A 3REIA 5B1LA 5B2IC 4QLCA 4H9SC 4YM6D 4J8VC 3AZFC 1P3PB 1M19A 3W99D 4KHAB 4LD9A 3A6NA 4JJNA 3W96B 1P3MC 1JFIA 3AZGC 5F99A 3REKC 3MGSD 2CV5B 5GXQC 3AYWC 5B0ZD 3NQUA 3LZ1A 2PYOB 4XUJD 3X1TA 3LELD 3MGQA 1KX3C 1S32D 3MGPC 2HUEC 1F66A 3REKD 5B32C 5GXQD 3AZLB 3AZHA 3UTBD 1ID3B 3B6FA 4H9NA 4Z5TA 5CPIB 1P3GC 3AZMA 4Z66D 1P3IA 3MNND 3AZND 1P3OA 3AN2A 1M1AA 3REJD 5AV9A 5B24B 4ZUXB 5CPKB 2NZDA 1B67A 5DNMC 1P3BB 3O62A 5AVCD 4KUDC 5JRGA 4WU8C 1M18A 5B0YC 3KXBA 3C1CC 4J8WC 4E45A 5JA4A 5AV6A 3MVDC 3LZ0A 5DNNC 3MGRC 3W98A 3AV2D 3RELB 1P3AC 3VH6T 4J8UA 1ZLAC 3W97A 4WU8D 5GSUC 3WKJB 3KUYD 5B0YD 5B33D 4X23C 2AROA 4H9OB 3LJAC 3C1BD 2YFWA 5C3IC 3WTPE 3AFAC 3X1UB 3B6GC 1P3LC 1P3PA 1ZLAD 5B2JB 1BFMA 4J8XC 3REIB 5GT0D 3AV1D 5BO0B 5E5AB 4KHAA 1KX5C 5B1LB 3B0CW 4DRAA 3WAAC 3X1VD 3WTPD 1EQZB 4WU9D 5GT3C 3A6NB 4JJNB 1U35D 2CV5A 2F8ND 1M19C 1KX4D 1AOIB 4LD9C 3AZEC 3WA9D 1HQ3B 4XUJA 3LZ1B 5F99C 1S32A 4YS3B 3AZLA 5B31C 5AY8B 1ID3A 1P3FD 3UTBA 1F66B 3AZID 3AZHB 3MNNA 3B6FB 3X1TC 3X1SD 3AZMB 4NE3A 4ZUXA 1P3OB 5CPKA 5AV9B 5B31D 1P3BA 3UT9D 1BH9A 3UTAD 1P34B 4Z5TC 5B40D 1P3IC 3O62B 3AN2C 1M1AC 5AVBD 4CSRB 3REHB 3KXBB 3RELA 2HIOB 4AWLC 3LZ0B 2NZDC 5AV5C 1TZYD 2FJ7D 5CPJD 4R8PD 5JRGC 1P3KD 1Q9CA 3TU4D 2YFVA 4H9OA 5AV6C 4J8UB 3W98C 4H9PB 3AZKD 1HTAA 4KGCC 2NQBB 3X1UA 5AV5D 2YFWB 4EO5B 3W97C 5CP6D 5BO0A 5E5AA 5AV8C 4H9QA 3KWQD 3V9RB 2AROC 5B1MD 4YM6B 4NFTA 1EQZA 3W99B 4XZQC 4KGCD 1U35A 1P3PC 2F8NA 3AZJA 1AOIA 5AV8D 5B2ID 3AZFD 4J8VD 3MGSB 3W96C 1HQ3A 5B0ZB 4XZQD 4YS3A 1H3OB 2CWEA 2CV5C 4XUJB 1P3MD 5AY8A 3VH6A 3AZGD 3LELB 1S32B 3AYWD 2PYOC 5GXQB 3AZIA 3UTBB 3X1SA 2IO5B 5BS7C 4Z66B 3MNNB 3AZNB 3B0BA 3AZLC 1KX3D 3REJB 1ID3C 1P34A 3MGPD 1TAFB 2F8NK 3UTAA 5CPIC 5B32D 4KUDA 4G91B 1BH9B 5B24C 1P3GD 4CSRA 5AVCB 3REHA 4ZUXC 2BYMA 2HIOA 5CPKC 1P3BC 3VH6W 3AV2B 5CPID 3VH5T 2RVQC 5DNMD 3TU4A 4H9PA 4KUDD 3C1CD 4J8WD 3RELC 3KUYB 3MVDD 2YFVB 3MGRD 5DNND 5B33B 2NQBA 4CAYB 3C1BB 1P3AD 3WKJC 1F1EA 3V9RA 3NQJB 4YM6A 5B1MA 5GSUD 3AV1B 5GT0B 1P3PD 3W99A 4H9QB 4X23D 3LJAD 3X1UC 5B2JC 3X1VB 3REIC 3WTPB 3AFAD 4WU9B 5E5AC 3WKJD 3B6GD 3R45B 5B1LC 4QLCC 3MGSA 5B2IA 1U35B 1P3LD 2F8NB 4J8XD 4J8VA 3AZJB 5B0ZA 2JSSA 1KX5D 1EQZC 1KX4B 5B32G 3A6NC 4JJNC 1H3OA 3WA9B 3WAAD 1WWSA 5GT3D 3LELA 4QLCD 3REKA 3B0DB 5GXQA 1M19D 1HQ3C 1P3FB 4LD9D 3LZ1C 3AZED 4G92B 4Z66A 3AZNA 4YS3C 3AZIB 3MGQC 3REJA 5AY8C 3X1SB 5F99D 1TAFA 1F66C 3MGPA 4M6BA 5B32A 3AZHC 3B6FC 3UT9B 3UTAB 4Z2MG 5AVCA 5B40B 3AZMC 1P3OC 1R4VA 3X1TD 5AV9C 4H9RB 3MGQD 5AVBB 1P34C 3AV2A 2BYMB 5DNMA 3O62C 4Z5TD 1TZYB 3KSYA 2FJ7B 5CPJB 1M18C 4R8PB 3REHC 1P3ID 4WU8A 3KXBC 1P3OD 2HIOC 5BNVB 3KUYA 5B0YA 3C1CA 3AN2D 1P3KB 5B33A 3LZ0C 3TU4B 4CAYA 1M1AD 2F8NG 3C1BA 3AZKB 4E44A 2NZDD 1P3AA 5AV5B 3NQJA 4J8UC 5BNXB 5FUGA 1ZLAA 5JRGD 4HGAB 1B6WA 5BT1C 5GT0A 3AV1A 5CP6B 5GSUA 1M18D 5AV6D 2NQBC 3LZ0D 3KWQB 4ZBJC 3W98D 5B1MB 4EO5C 3X1VA 3WTPA 4WU9A 3R45A 4KGCB 5CHLB 2LY8A 3W97D 4YM6C 4WNNA 3W99C 1KX4A 5AV8B 5B31G 5B2IB 2AROD 3AZFB 4J8VB 3WA9A 3VH5A 4XZQB 3MGSC 4NE5A 1P3MB 3AZGB
chains in the Genus database with same CATH superfamily
2Y2KA 5B0ZC 1P3FA 3REKB 2DF4C 3AZEA 3AYWB 3W96D 4XUJC 3LELC 1N1JB 1S32C 2CV5D 5B31A 1KX3B 3UTBC 3UT9A 2IO5C 2HUEB 5B40A 3MGPB 2PYOD 5B32B 4Z66C 3MNNC 3AZNC 4H9RA 3REJC 5AVBA 4NE6A 1P3GB 1BH8B 3VH5W 3AZLD 3F6TA 4G91C 1ID3D 3KFUG 1TZYA 3FDDA 2FJ7A 5CPJA 5AVCC 4R8PA 5BNVA 1P3KA 1P3OD 5DNMB 5B24D 4ZUXD 3AZKA 4WU8B 2L5AA 3AV2C 4KUDB 5CPKD 5B0YB 3C1CB 4J8WB 1P3BD 3MVDB 3MGRB 5DNNB 5AV5A 2BYKB 5BNXA 2RVQD 1P3AB 4UUZA 5CP6A 3KUYC 5B33C 3KWQA 5FUGB 1ZLAB 3C1BC 5GSUB 3RELD 4X23B 3EPJA 4KGCA 1KU5A 3LJAB 5KDMA 5C3IB 3AV1C 5GT0C 1W2EA 3AFAB 5AV8A 3B6GB 4H9SA 3AZFA 2W8SA 4WNNB 1P3LB 4J8XB 3X1VC 3WTPC 1KX5B 4WU9C 1A7WA 5G49B 3X1UD 4XZQA 1U35C 5B2JD 3WAAB 3REID 3AZJC 3AZGA 1P3MA 3EPKA 5E5AD 5GT3B 1AOIC 5B1LD 1KX4C 2Y2HA 3AYWA 4QLCB 1PZRA 3WA9C 3W96A 1M19B 1EQZD 3A6ND 1N1JA 4JJND 4LD9B 3B0CT 3AZEB 3B0DC 3AZJD 1KX3A 1JFIB 5F99B 1P3FC 1AOID 4G92C 4UPKA 5B31B 2PYOA 3AZIC 1HQ3D 1WWIA 3X1SC 3NQUB 1P3KB 3LZ1D 1P3GA 1BH8A 5BS7A 4YS3D 3X1TB 5AY8D 4Z2MH 3MGQB 1F66D 3UT9C 3UTAC 3EPLA 5B40C 5CPIA 4DRBA 3AZHD 3B6FD 1ULYA 4WV4B 4H9NB 4Z5TB 5B24A 5AVBC 3AZMD 1P3IB 4J8WA 5AV9D 3MVDA 3MGRA 3AN2B 5DNNA 1M1AB 2BYKA 1P34D 1TZYC 2F8NH 5CPJC 2FJ7C 4R8PC 4AWLB 1P3KC 2NZDB 3O62D 3H0LC 3TU4C 2Y2IA 3REHD 4UUZB 3KXBD 5JRGB 2HIOD 3AZKC 1M18B 4X23A 2Y2NA 5JA4B 2Y2PA 5AV6B 3LJAA 3W98B 4HGAC 3AFAA 5CP6C 3WKJA 3B6GA 4J8UD 5KDMB 3KWQC 1P3LA 5B1MC 5BT1D 4J8XA 3W97B 4WZSB 2ZY2A 1KX5A 2NQBD 5G49A 2AROB 4ZBJB 3WAAA 5B2JA 5GT3A 3REIA 5B1LA 5B2IC 4QLCA 4H9SC 4YM6D 4J8VC 3AZFC 1P3PB 1M19A 3W99D 4KHAB 4LD9A 3A6NA 2FFFB 4JJNA 3W96B 1P3MC 1JFIA 3AZGC 2ZY5A 5F99A 2Y2GA 3REKC 3MGSD 2CV5B 5GXQC 2XD5A 3AYWC 5B0ZD 3NQUA 3LZ1A 2PYOB 4XUJD 3X1TA 3LELD 3MGQA 1KX3C 1S32D 3MGPC 2HUEC 1F66A 3REKD 5B32C 5GXQD 3AZLB 3AZHA 3UTBD 1ID3B 3B6FA 4H9NA 4Z5TA 5CPIB 1P3GC 3AZMA 4Z66D 1P3IA 3MNND 3AZND 1P3OA 3AN2A 1M1AA 3REJD 5AV9A 5B24B 3IP4C 4ZUXB 5CPKB 2NZDA 1B67A 5DNMC 1P3BB 3O62A 5AVCD 4KUDC 5JRGA 4WU8C 1M18A 5B0YC 3KXBA 3C1CC 4J8WC 4E45A 5JA4A 5AV6A 3MVDC 3LZ0A 5DNNC 3MGRC 3W98A 3AV2D 2ZY4A 3RELB 1P3AC 3VH6T 4J8UA 1ZLAC 3W97A 4WU8D 5GSUC 2VQRA 3A1KA 3KUYD 5B0YD 3WKJB 5B33D 4X23C 2AROA 4H9OB 3LJAC 3C1BD 2YFWA 5C3IC 3WTPE 3AFAC 3X1UB 3B6GC 1P3LC 1P3PA 1ZLAD 5B2JB 3AL0C 4J8XC 3REIB 5GT0D 3AV1D 2Y2JA 1BFMA 5BO0B 5E5AB 4KHAA 1KX5C 5B1LB 3B0CW 4DRAA 3WAAC 3X1VD 3WTPD 1EQZB 4WU9D 5GT3C 3A6NB 4JJNB 1U35D 2CV5A 2F8ND 1M19C 1KX4D 1AOIB 4LD9C 3AZEC 3WA9D 2XD1A 1HQ3B 4XUJA 3LZ1B 5F99C 1S32A 2Y2OA 4YS3B 3AZLA 5B31C 5AY8B 2F2AC 1ID3A 1P3FD 3UTBA 1F66B 3AZID 3AZHB 3MNNA 3B6FB 3X1TC 3X1SD 3AZMB 4NE3A 4ZUXA 1P3OB 5CPKA 5AV9B 5B31D 1P3BA 3UT9D 1BH9A 3UTAD 1P34B 4Z5TC 5B40D 2Y2MA 1P3IC 3O62B 3AN2C 1M1AC 5AVBD 4CSRB 2G5HC 3REHB 3KXBB 3RELA 2HIOB 4AWLC 2G5IC 3LZ0B 2NZDC 5AV5C 1TZYD 2FJ7D 5CPJD 4R8PD 5JRGC 1P3KD 1Q9CA 3P5JB 3TU4D 2YFVA 4H9OA 5AV6C 4J8UB 3W98C 4H9PB 3AZKD 1T3UA 1HTAA 4KGCC 2NQBB 3X1UA 5AV5D 2YFWB 4EO5B 3W97C 5CP6D 5BO0A 5E5AA 5AV8C 4H9QA 3KWQD 3V9RB 2AROC 5B1MD 4YM6B 4NFTA 1EQZA 3W99B 2JE5A 4XZQC 4KGCD 3EG5B 1U35A 1P3PC 2F8NA 3AZJA 3EPHA 1AOIA 5AV8D 5B2ID 3AZFD 4J8VD 3MGSB 3W96C 1HQ3A 5B0ZB 4XZQD 4YS3A 1H3OB 2CWEA 2CV5C 4XUJB 1P3MD 2JCHA 5AY8A 3VH6A 3AZGD 3LELB 1S32B 3AYWD 2PYOC 5GXQB 3AZIA 3UTBB 3X1SA 2IO5B 5BS7C 4Z66B 3MNNB 3AZNB 3B0BA 3AZLC 1KX3D 3A1IA 3REJB 1ID3C 1P34A 3MGPD 1TAFB 2F8NK 3UTAA 5CPIC 5B32D 4KUDA 4G91B 1BH9B 5B24C 1P3GD 4CSRA 5AVCB 3REHA 4ZUXC 2BYMA 2HIOA 5CPKC 1P3BC 3VH6W 3AV2B 2DQNC 5CPID 3VH5T 2RIQA 2RVQC 5DNMD 3TU4A 4H9PA 4KUDD 3C1CD 4J8WD 3RELC 3KUYB 3MVDD 2YFVB 3MGRD 5DNND 5B33B 2NQBA 4CAYB 3C1BB 1P3AD 1Z2CB 3WKJC 1F1EA 3V9RA 3NQJB 4YM6A 5B1MA 5GSUD 3AV1B 5GT0B 1P3PD 3W99A 4H9QB 4X23D 3LJAD 3X1UC 5B2JC 3X1VB 3REIC 3WTPB 3AFAD 4WU9B 5E5AC 3WKJD 3B6GD 3R45B 5B1LC 4QLCC 3MGSA 5B2IA 1U35B 1P3LD 2F8NB 4J8XD 4J8VA 3AZJB 5B0ZA 2JSSA 1KX5D 1EQZC 1KX4B 5B32G 3A6NC 4JJNC 1H3OA 3WA9B 3WAAD 1WWSA 5GT3D 3LELA 4QLCD 3REKA 3B0DB 2UWXA 5GXQA 1M19D 1HQ3C 1P3FB 4LD9D 3LZ1C 3AZED 4G92B 4Z66A 3AZNA 4YS3C 3AZIB 3MGQC 3REJA 5AY8C 3X1SB 5F99D 1TAFA 1F66C 2Y2QA 3MGPA 4M6BA 5B32A 3AZHC 2ZY3A 3B6FC 3UT9B 3UTAB 4Z2MG 5AVCA 5B40B 3AZMC 2BG1A 1P3OC 2J8PA 1R4VA 3X1TD 5AV9C 4H9RB 3MGQD 5AVBB 1P34C 3AV2A 2BYMB 2Y2LA 5DNMA 3O62C 4Z5TD 1TZYB 3KSYA 2FJ7B 5CPJB 3H0RC 1M18C 4R8PB 3H0MC 3REHC 4WU8A 3KXBC 1P3ID 2HIOC 5BNVB 3KUYA 5B0YA 2ZM5A 3C1CA 3AN2D 5B33A 3LZ0C 3TU4B 4CAYA 1M1AD 2F8NG 3C1BA 3AZKB 4E44A 2NZDD 1P3AA 5AV5B 3NQJA 4J8UC 5BNXB 4WJ3C 5FUGA 1ZLAA 5JRGD 4HGAB 1B6WA 5BT1C 5GT0A 4DQYB 5CP6B 5GSUA 3AV1A 1M18D 5AV6D 2NQBC 3LZ0D 3KWQB 4ZBJC 3W98D 5B1MB 4EO5C 3X1VA 3WTPA 4WU9A 3R45A 4KGCB 5CHLB 2LY8A 3W97D 4YM6C 4WNNA 3W99C 1KX4A 5AV8B 5B31G 5B2IB 2AROD 3AZFB 4J8VB 3WA9A 3VH5A 4XZQB 3MGSC 4NE5A 1P3MB 3AZGB
chains in the Genus database with same CATH topology
2Y2KA 5B0ZC 1P3FA 3REKB 2DF4C 3AZEA 3AYWB 3W96D 4XUJC 3LELC 1N1JB 1S32C 2CV5D 5B31A 1KX3B 3UTBC 3UT9A 2IO5C 2HUEB 5B40A 3MGPB 2PYOD 5B32B 4Z66C 3MNNC 3AZNC 4H9RA 3REJC 5AVBA 4NE6A 1P3GB 1BH8B 3VH5W 3AZLD 3F6TA 4G91C 1ID3D 3KFUG 1TZYA 3FDDA 2FJ7A 5CPJA 5AVCC 4R8PA 5BNVA 1P3KA 1P3OD 5DNMB 5B24D 4ZUXD 3AZKA 4WU8B 2L5AA 3AV2C 4KUDB 5CPKD 5B0YB 3C1CB 4J8WB 1P3BD 3MVDB 3MGRB 5DNNB 5AV5A 2BYKB 5BNXA 2RVQD 1P3AB 4UUZA 5CP6A 3KUYC 5B33C 3KWQA 5FUGB 1ZLAB 3C1BC 5GSUB 3RELD 4X23B 3EPJA 4KGCA 1KU5A 3LJAB 5KDMA 5C3IB 3AV1C 5GT0C 1W2EA 3AFAB 5AV8A 3B6GB 4H9SA 3AZFA 2W8SA 4WNNB 1P3LB 4J8XB 3X1VC 3WTPC 1KX5B 4WU9C 1A7WA 5G49B 3X1UD 4XZQA 1U35C 5B2JD 3WAAB 3REID 3AZJC 3AZGA 1P3MA 3EPKA 5E5AD 5GT3B 1AOIC 5B1LD 1KX4C 2Y2HA 3AYWA 4QLCB 1PZRA 3WA9C 3W96A 1M19B 1EQZD 3A6ND 1N1JA 4JJND 4LD9B 3B0CT 3AZEB 3B0DC 3AZJD 1KX3A 1JFIB 5F99B 1P3FC 1AOID 4G92C 4UPKA 5B31B 2PYOA 3AZIC 1HQ3D 1WWIA 3X1SC 3NQUB 1P3KB 3LZ1D 1P3GA 1BH8A 5BS7A 4YS3D 3X1TB 5AY8D 4Z2MH 3MGQB 1F66D 3UT9C 3UTAC 3EPLA 5B40C 5CPIA 4DRBA 3AZHD 3B6FD 1ULYA 4WV4B 4H9NB 4Z5TB 5B24A 5AVBC 3AZMD 1P3IB 4J8WA 5AV9D 3MVDA 3MGRA 3AN2B 5DNNA 1M1AB 2BYKA 1P34D 1TZYC 2F8NH 5CPJC 2FJ7C 4R8PC 4AWLB 1P3KC 2NZDB 3O62D 3H0LC 3TU4C 2Y2IA 3REHD 4UUZB 3KXBD 5JRGB 2HIOD 3AZKC 1M18B 4X23A 2Y2NA 5JA4B 2Y2PA 5AV6B 3LJAA 3W98B 4HGAC 3AFAA 5CP6C 3WKJA 3B6GA 4J8UD 5KDMB 3KWQC 1P3LA 5B1MC 5BT1D 4J8XA 3W97B 4WZSB 2ZY2A 1KX5A 2NQBD 5G49A 2AROB 4ZBJB 3WAAA 5B2JA 5GT3A 3REIA 5B1LA 5B2IC 4QLCA 4H9SC 4YM6D 4J8VC 3AZFC 1P3PB 1M19A 3W99D 4KHAB 4LD9A 3A6NA 2FFFB 4JJNA 3W96B 1P3MC 1JFIA 3AZGC 2ZY5A 5F99A 2Y2GA 3REKC 3MGSD 2CV5B 5GXQC 2XD5A 3AYWC 5B0ZD 3NQUA 3LZ1A 2PYOB 4XUJD 3X1TA 3LELD 3MGQA 1KX3C 1S32D 3MGPC 2HUEC 1F66A 3REKD 5B32C 5GXQD 3AZLB 3AZHA 3UTBD 1ID3B 3B6FA 4H9NA 4Z5TA 5CPIB 1P3GC 3AZMA 4Z66D 1P3IA 3MNND 3AZND 1P3OA 3AN2A 1M1AA 3REJD 5AV9A 5B24B 3IP4C 4ZUXB 5CPKB 2NZDA 1B67A 5DNMC 1P3BB 3O62A 5AVCD 4KUDC 5JRGA 4WU8C 1M18A 5B0YC 3KXBA 3C1CC 4J8WC 4E45A 5JA4A 5AV6A 3MVDC 3LZ0A 5DNNC 3MGRC 3W98A 3AV2D 2ZY4A 3RELB 1P3AC 3VH6T 4J8UA 1ZLAC 3W97A 4WU8D 5GSUC 2VQRA 3A1KA 3KUYD 5B0YD 3WKJB 5B33D 4X23C 2AROA 4H9OB 3LJAC 3C1BD 2YFWA 5C3IC 3WTPE 3AFAC 3X1UB 3B6GC 1P3LC 1P3PA 1ZLAD 5B2JB 3AL0C 4J8XC 3REIB 5GT0D 3AV1D 2Y2JA 1BFMA 5BO0B 5E5AB 4KHAA 1KX5C 5B1LB 3B0CW 4DRAA 3WAAC 3X1VD 3WTPD 1EQZB 4WU9D 5GT3C 3A6NB 4JJNB 1U35D 2CV5A 2F8ND 1M19C 1KX4D 1AOIB 4LD9C 3AZEC 3WA9D 2XD1A 1HQ3B 4XUJA 3LZ1B 5F99C 1S32A 2Y2OA 4YS3B 3AZLA 5B31C 5AY8B 2F2AC 1ID3A 1P3FD 3UTBA 1F66B 3AZID 3AZHB 3MNNA 3B6FB 3X1TC 3X1SD 3AZMB 4NE3A 4ZUXA 1P3OB 5CPKA 5AV9B 5B31D 1P3BA 3UT9D 1BH9A 3UTAD 1P34B 4Z5TC 5B40D 2Y2MA 1P3IC 3O62B 3AN2C 1M1AC 5AVBD 4CSRB 2G5HC 3REHB 3KXBB 3RELA 2HIOB 4AWLC 2G5IC 3LZ0B 2NZDC 5AV5C 1TZYD 2FJ7D 5CPJD 4R8PD 5JRGC 1P3KD 1Q9CA 3P5JB 3TU4D 2YFVA 4H9OA 5AV6C 4J8UB 3W98C 4H9PB 3AZKD 1T3UA 1HTAA 4KGCC 2NQBB 3X1UA 5AV5D 2YFWB 4EO5B 3W97C 5CP6D 5BO0A 5E5AA 5AV8C 4H9QA 3KWQD 3V9RB 2AROC 5B1MD 4YM6B 4NFTA 1EQZA 3W99B 2JE5A 4XZQC 4KGCD 3EG5B 1U35A 1P3PC 2F8NA 3AZJA 3EPHA 1AOIA 5AV8D 5B2ID 3AZFD 4J8VD 3MGSB 3W96C 1HQ3A 5B0ZB 4XZQD 4YS3A 1H3OB 2CWEA 2CV5C 4XUJB 1P3MD 2JCHA 5AY8A 3VH6A 3AZGD 3LELB 1S32B 3AYWD 2PYOC 5GXQB 3AZIA 3UTBB 3X1SA 2IO5B 5BS7C 4Z66B 3MNNB 3AZNB 3B0BA 3AZLC 1KX3D 3A1IA 3REJB 1ID3C 1P34A 3MGPD 1TAFB 2F8NK 3UTAA 5CPIC 5B32D 4KUDA 4G91B 1BH9B 5B24C 1P3GD 4CSRA 5AVCB 3REHA 4ZUXC 2BYMA 2HIOA 5CPKC 1P3BC 3VH6W 3AV2B 2DQNC 5CPID 3VH5T 2RIQA 2RVQC 5DNMD 3TU4A 4H9PA 4KUDD 3C1CD 4J8WD 3RELC 3KUYB 3MVDD 2YFVB 3MGRD 5DNND 5B33B 2NQBA 4CAYB 3C1BB 1P3AD 1Z2CB 3WKJC 1F1EA 3V9RA 3NQJB 4YM6A 5B1MA 5GSUD 3AV1B 5GT0B 1P3PD 3W99A 4H9QB 4X23D 3LJAD 3X1UC 5B2JC 3X1VB 3REIC 3WTPB 3AFAD 4WU9B 5E5AC 3WKJD 3B6GD 3R45B 5B1LC 4QLCC 3MGSA 5B2IA 1U35B 1P3LD 2F8NB 4J8XD 4J8VA 3AZJB 5B0ZA 2JSSA 1KX5D 1EQZC 1KX4B 5B32G 3A6NC 4JJNC 1H3OA 3WA9B 3WAAD 1WWSA 5GT3D 3LELA 4QLCD 3REKA 3B0DB 2UWXA 5GXQA 1M19D 1HQ3C 1P3FB 4LD9D 3LZ1C 3AZED 4G92B 4Z66A 3AZNA 4YS3C 3AZIB 3MGQC 3REJA 5AY8C 3X1SB 5F99D 1TAFA 1F66C 2Y2QA 3MGPA 4M6BA 5B32A 3AZHC 2ZY3A 3B6FC 3UT9B 3UTAB 4Z2MG 5AVCA 5B40B 3AZMC 2BG1A 1P3OC 2J8PA 1R4VA 3X1TD 5AV9C 4H9RB 3MGQD 5AVBB 1P34C 3AV2A 2BYMB 2Y2LA 5DNMA 3O62C 4Z5TD 1TZYB 3KSYA 2FJ7B 5CPJB 3H0RC 1M18C 4R8PB 3H0MC 3REHC 4WU8A 3KXBC 1P3ID 2HIOC 5BNVB 3KUYA 5B0YA 2ZM5A 3C1CA 3AN2D 5B33A 3LZ0C 3TU4B 4CAYA 1M1AD 2F8NG 3C1BA 3AZKB 4E44A 2NZDD 1P3AA 5AV5B 3NQJA 4J8UC 5BNXB 4WJ3C 5FUGA 1ZLAA 5JRGD 4HGAB 1B6WA 5BT1C 5GT0A 4DQYB 5CP6B 5GSUA 3AV1A 1M18D 5AV6D 2NQBC 3LZ0D 3KWQB 4ZBJC 3W98D 5B1MB 4EO5C 3X1VA 3WTPA 4WU9A 3R45A 4KGCB 5CHLB 2LY8A 3W97D 4YM6C 4WNNA 3W99C 1KX4A 5AV8B 5B31G 5B2IB 2AROD 3AZFB 4J8VB 3WA9A 3VH5A 4XZQB 3MGSC 4NE5A 1P3MB 3AZGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Z C;  1P3F A;  3REK B;  3AZE A;  3AYW B;  3W96 D;  4XUJ C;  3LEL C;  1N1J B;  1S32 C;  2CV5 D;  5B31 A;  1KX3 B;  3UTB C;  3UT9 A;  2IO5 C;  2HUE B;  5B40 A;  3MGP B;  2PYO D;  5B32 B;  4Z66 C;  3MNN C;  3AZN C;  4H9R A;  3REJ C;  5AVB A;  4NE6 A;  1P3G B;  1BH8 B;  3VH5 W;  3AZL D;  4G91 C;  1ID3 D;  1TZY A;  2FJ7 A;  5CPJ A;  5AVC C;  4R8P A;  5BNV A;  1P3K A;  5DNM B;  5B24 D;  4ZUX D;  3AZK A;  4WU8 B;  2L5A A;  3AV2 C;  4KUD B;  5CPK D;  5B0Y B;  3C1C B;  4J8W B;  1P3B D;  3MVD B;  3MGR B;  5DNN B;  5AV5 A;  2BYK B;  5BNX A;  2RVQ D;  1P3A B;  4UUZ A;  5CP6 A;  3KUY C;  5B33 C;  3KWQ A;  5FUG B;  1ZLA B;  3C1B C;  5GSU B;  3REL D;  4X23 B;  4KGC A;  1KU5 A;  3LJA B;  5KDM A;  5C3I B;  3AV1 C;  5GT0 C;  3AFA B;  5AV8 A;  3B6G B;  4H9S A;  3AZF A;  4WNN B;  1P3L B;  4J8X B;  3X1V C;  3WTP C;  1KX5 B;  4WU9 C;  1A7W A;  5G49 B;  3X1U D;  4XZQ A;  1U35 C;  5B2J D;  3WAA B;  3REI D;  3AZJ C;  3AZG A;  1P3M A;  5E5A D;  5GT3 B;  1AOI C;  5B1L D;  1KX4 C;  3AYW A;  4QLC B;  3WA9 C;  3W96 A;  1M19 B;  1EQZ D;  3A6N D;  1N1J A;  4JJN D;  4LD9 B;  3B0C T;  3AZE B;  3B0D C;  3AZJ D;  1KX3 A;  1JFI B;  5F99 B;  1P3F C;  1AOI D;  4G92 C;  5B31 B;  2PYO A;  3AZI C;  1HQ3 D;  1WWI A;  3X1S C;  3NQU B;  3LZ1 D;  1P3G A;  1BH8 A;  5BS7 A;  4YS3 D;  3X1T B;  5AY8 D;  4Z2M H;  3MGQ B;  1F66 D;  3UT9 C;  3UTA C;  5B40 C;  5CPI A;  4DRB A;  3AZH D;  3B6F D;  1ULY A;  4WV4 B;  5B24 A;  4H9N B;  4Z5T B;  5AVB C;  3AZM D;  1P3I B;  4J8W A;  5AV9 D;  3MVD A;  3MGR A;  3AN2 B;  5DNN A;  1M1A B;  2BYK A;  1P34 D;  1TZY C;  2F8N H;  5CPJ C;  2FJ7 C;  4R8P C;  4AWL B;  1P3K C;  2NZD B;  3O62 D;  3TU4 C;  3REH D;  4UUZ B;  3KXB D;  5JRG B;  2HIO D;  3AZK C;  1M18 B;  4X23 A;  5JA4 B;  5AV6 B;  3LJA A;  3W98 B;  4HGA C;  3AFA A;  5CP6 C;  3WKJ A;  3B6G A;  4J8U D;  5KDM B;  3KWQ C;  1P3L A;  5B1M C;  5BT1 D;  4J8X A;  3W97 B;  4WZS B;  1KX5 A;  2NQB D;  5G49 A;  2ARO B;  4ZBJ B;  3WAA A;  5B2J A;  5GT3 A;  3REI A;  5B1L A;  5B2I C;  4QLC A;  4H9S C;  4YM6 D;  4J8V C;  3AZF C;  1P3P B;  1M19 A;  3W99 D;  4KHA B;  4LD9 A;  3A6N A;  4JJN A;  3W96 B;  1P3M C;  1JFI A;  3AZG C;  5F99 A;  3REK C;  3MGS D;  2CV5 B;  5GXQ C;  3AYW C;  5B0Z D;  3NQU A;  3LZ1 A;  2PYO B;  4XUJ D;  3X1T A;  3LEL D;  3MGQ A;  1KX3 C;  1S32 D;  3MGP C;  2HUE C;  1F66 A;  3REK D;  5B32 C;  5GXQ D;  3AZL B;  3AZH A;  3UTB D;  1ID3 B;  3B6F A;  4H9N A;  4Z5T A;  5CPI B;  1P3G C;  3AZM A;  4Z66 D;  1P3I A;  3MNN D;  3AZN D;  1P3O A;  3AN2 A;  1M1A A;  3REJ D;  5AV9 A;  5B24 B;  4ZUX B;  5CPK B;  2NZD A;  1B67 A;  5DNM C;  1P3B B;  3O62 A;  5AVC D;  4KUD C;  5JRG A;  4WU8 C;  1M18 A;  5B0Y C;  3KXB A;  3C1C C;  4J8W C;  4E45 A;  5JA4 A;  5AV6 A;  3MVD C;  3LZ0 A;  5DNN C;  3MGR C;  3W98 A;  3AV2 D;  3REL B;  1P3A C;  3VH6 T;  4J8U A;  1ZLA C;  3W97 A;  4WU8 D;  5GSU C;  3WKJ B;  3KUY D;  5B0Y D;  5B33 D;  4X23 C;  2ARO A;  4H9O B;  3LJA C;  3C1B D;  2YFW A;  5C3I C;  3WTP E;  3AFA C;  3X1U B;  3B6G C;  1P3L C;  1P3P A;  1ZLA D;  5B2J B;  1BFM A;  4J8X C;  3REI B;  5GT0 D;  3AV1 D;  5BO0 B;  5E5A B;  4KHA A;  1KX5 C;  5B1L B;  3B0C W;  4DRA A;  3WAA C;  3X1V D;  3WTP D;  1EQZ B;  4WU9 D;  5GT3 C;  3A6N B;  4JJN B;  1U35 D;  2CV5 A;  2F8N D;  1M19 C;  1KX4 D;  1AOI B;  4LD9 C;  3AZE C;  3WA9 D;  1HQ3 B;  4XUJ A;  3LZ1 B;  5F99 C;  1S32 A;  4YS3 B;  3AZL A;  5B31 C;  5AY8 B;  1ID3 A;  1P3F D;  3UTB A;  1F66 B;  3AZI D;  3AZH B;  3MNN A;  3B6F B;  3X1T C;  3X1S D;  3AZM B;  4NE3 A;  4ZUX A;  1P3O B;  5CPK A;  5AV9 B;  5B31 D;  1P3B A;  3UT9 D;  1BH9 A;  3UTA D;  1P34 B;  4Z5T C;  5B40 D;  1P3I C;  3O62 B;  3AN2 C;  1M1A C;  5AVB D;  4CSR B;  3REH B;  3KXB B;  3REL A;  2HIO B;  4AWL C;  3LZ0 B;  2NZD C;  5AV5 C;  1TZY D;  2FJ7 D;  5CPJ D;  4R8P D;  5JRG C;  1P3K D;  1Q9C A;  3TU4 D;  2YFV A;  4H9O A;  5AV6 C;  4J8U B;  3W98 C;  4H9P B;  3AZK D;  1HTA A;  4KGC C;  2NQB B;  3X1U A;  5AV5 D;  2YFW B;  4EO5 B;  3W97 C;  5CP6 D;  5BO0 A;  5E5A A;  5AV8 C;  4H9Q A;  3KWQ D;  3V9R B;  2ARO C;  5B1M D;  4YM6 B;  4NFT A;  1EQZ A;  3W99 B;  4XZQ C;  4KGC D;  1U35 A;  1P3P C;  2F8N A;  3AZJ A;  1AOI A;  5AV8 D;  5B2I D;  3AZF D;  4J8V D;  3MGS B;  3W96 C;  1HQ3 A;  5B0Z B;  4XZQ D;  4YS3 A;  1H3O B;  2CWE A;  2CV5 C;  4XUJ B;  1P3M D;  5AY8 A;  3VH6 A;  3AZG D;  3LEL B;  1S32 B;  3AYW D;  2PYO C;  5GXQ B;  3AZI A;  3UTB B;  3X1S A;  2IO5 B;  5BS7 C;  4Z66 B;  3MNN B;  3AZN B;  3B0B A;  3AZL C;  1KX3 D;  3REJ B;  1ID3 C;  1P34 A;  3MGP D;  1TAF B;  2F8N K;  3UTA A;  5CPI C;  5B32 D;  4KUD A;  4G91 B;  1BH9 B;  5B24 C;  1P3G D;  4CSR A;  5AVC B;  3REH A;  4ZUX C;  2BYM A;  2HIO A;  5CPK C;  1P3B C;  3VH6 W;  3AV2 B;  5CPI D;  3VH5 T;  2RVQ C;  5DNM D;  3TU4 A;  4H9P A;  4KUD D;  3C1C D;  4J8W D;  3REL C;  3KUY B;  3MVD D;  2YFV B;  3MGR D;  5DNN D;  5B33 B;  2NQB A;  4CAY B;  3C1B B;  1P3A D;  3WKJ C;  1F1E A;  3V9R A;  3NQJ B;  4YM6 A;  5B1M A;  5GSU D;  3AV1 B;  5GT0 B;  1P3P D;  3W99 A;  4H9Q B;  4X23 D;  3LJA D;  3X1U C;  5B2J C;  3X1V B;  3REI C;  3WTP B;  3AFA D;  4WU9 B;  5E5A C;  3WKJ D;  3B6G D;  3R45 B;  5B1L C;  4QLC C;  3MGS A;  5B2I A;  1U35 B;  1P3L D;  2F8N B;  4J8X D;  4J8V A;  3AZJ B;  5B0Z A;  2JSS A;  1KX5 D;  1EQZ C;  1KX4 B;  5B32 G;  3A6N C;  4JJN C;  1H3O A;  3WA9 B;  3WAA D;  1WWS A;  5GT3 D;  3LEL A;  4QLC D;  3REK A;  3B0D B;  5GXQ A;  1M19 D;  1HQ3 C;  1P3F B;  4LD9 D;  3LZ1 C;  3AZE D;  4G92 B;  4Z66 A;  3AZN A;  4YS3 C;  3AZI B;  3MGQ C;  3REJ A;  5AY8 C;  3X1S B;  5F99 D;  1TAF A;  1F66 C;  3MGP A;  4M6B A;  5B32 A;  3AZH C;  3B6F C;  3UT9 B;  3UTA B;  4Z2M G;  5AVC A;  5B40 B;  3AZM C;  1P3O C;  1R4V A;  3X1T D;  5AV9 C;  4H9R B;  3MGQ D;  5AVB B;  1P34 C;  3AV2 A;  2BYM B;  5DNM A;  3O62 C;  4Z5T D;  1TZY B;  3KSY A;  2FJ7 B;  5CPJ B;  1M18 C;  4R8P B;  3REH C;  1P3I D;  4WU8 A;  3KXB C;  1P3O D;  2HIO C;  5BNV B;  3KUY A;  5B0Y A;  3C1C A;  3AN2 D;  1P3K B;  5B33 A;  3LZ0 C;  3TU4 B;  4CAY A;  1M1A D;  2F8N G;  3C1B A;  3AZK B;  4E44 A;  2NZD D;  1P3A A;  5AV5 B;  3NQJ A;  4J8U C;  5BNX B;  5FUG A;  1ZLA A;  5JRG D;  4HGA B;  1B6W A;  5BT1 C;  5GT0 A;  3AV1 A;  5CP6 B;  5GSU A;  1M18 D;  5AV6 D;  2NQB C;  3LZ0 D;  3KWQ B;  4ZBJ C;  3W98 D;  5B1M B;  4EO5 C;  3X1V A;  3WTP A;  4WU9 A;  3R45 A;  4KGC B;  5CHL B;  2LY8 A;  3W97 D;  4YM6 C;  4WNN A;  3W99 C;  1KX4 A;  5AV8 B;  5B31 G;  5B2I B;  2ARO D;  3AZF B;  4J8V B;  3WA9 A;  3VH5 A;  4XZQ B;  3MGS C;  4NE5 A;  1P3M B;  3AZG B; 
#chains in the Genus database with same CATH topology
 2Y2K A;  5B0Z C;  1P3F A;  3REK B;  2DF4 C;  3AZE A;  3AYW B;  3W96 D;  4XUJ C;  3LEL C;  1N1J B;  1S32 C;  2CV5 D;  5B31 A;  1KX3 B;  3UTB C;  3UT9 A;  2IO5 C;  2HUE B;  5B40 A;  3MGP B;  2PYO D;  5B32 B;  4Z66 C;  3MNN C;  3AZN C;  4H9R A;  3REJ C;  5AVB A;  4NE6 A;  1P3G B;  1BH8 B;  3VH5 W;  3AZL D;  3F6T A;  4G91 C;  1ID3 D;  3KFU G;  1TZY A;  3FDD A;  2FJ7 A;  5CPJ A;  5AVC C;  4R8P A;  5BNV A;  1P3K A;  1P3O D;  5DNM B;  5B24 D;  4ZUX D;  3AZK A;  4WU8 B;  2L5A A;  3AV2 C;  4KUD B;  5CPK D;  5B0Y B;  3C1C B;  4J8W B;  1P3B D;  3MVD B;  3MGR B;  5DNN B;  5AV5 A;  2BYK B;  5BNX A;  2RVQ D;  1P3A B;  4UUZ A;  5CP6 A;  3KUY C;  5B33 C;  3KWQ A;  5FUG B;  1ZLA B;  3C1B C;  5GSU B;  3REL D;  4X23 B;  3EPJ A;  4KGC A;  1KU5 A;  3LJA B;  5KDM A;  5C3I B;  3AV1 C;  5GT0 C;  1W2E A;  3AFA B;  5AV8 A;  3B6G B;  4H9S A;  3AZF A;  2W8S A;  4WNN B;  1P3L B;  4J8X B;  3X1V C;  3WTP C;  1KX5 B;  4WU9 C;  1A7W A;  5G49 B;  3X1U D;  4XZQ A;  1U35 C;  5B2J D;  3WAA B;  3REI D;  3AZJ C;  3AZG A;  1P3M A;  3EPK A;  5E5A D;  5GT3 B;  1AOI C;  5B1L D;  1KX4 C;  2Y2H A;  3AYW A;  4QLC B;  1PZR A;  3WA9 C;  3W96 A;  1M19 B;  1EQZ D;  3A6N D;  1N1J A;  4JJN D;  4LD9 B;  3B0C T;  3AZE B;  3B0D C;  3AZJ D;  1KX3 A;  1JFI B;  5F99 B;  1P3F C;  1AOI D;  4G92 C;  4UPK A;  5B31 B;  2PYO A;  3AZI C;  1HQ3 D;  1WWI A;  3X1S C;  3NQU B;  1P3K B;  3LZ1 D;  1P3G A;  1BH8 A;  5BS7 A;  4YS3 D;  3X1T B;  5AY8 D;  4Z2M H;  3MGQ B;  1F66 D;  3UT9 C;  3UTA C;  3EPL A;  5B40 C;  5CPI A;  4DRB A;  3AZH D;  3B6F D;  1ULY A;  4WV4 B;  4H9N B;  4Z5T B;  5B24 A;  5AVB C;  3AZM D;  1P3I B;  4J8W A;  5AV9 D;  3MVD A;  3MGR A;  3AN2 B;  5DNN A;  1M1A B;  2BYK A;  1P34 D;  1TZY C;  2F8N H;  5CPJ C;  2FJ7 C;  4R8P C;  4AWL B;  1P3K C;  2NZD B;  3O62 D;  3H0L C;  3TU4 C;  2Y2I A;  3REH D;  4UUZ B;  3KXB D;  5JRG B;  2HIO D;  3AZK C;  1M18 B;  4X23 A;  2Y2N A;  5JA4 B;  2Y2P A;  5AV6 B;  3LJA A;  3W98 B;  4HGA C;  3AFA A;  5CP6 C;  3WKJ A;  3B6G A;  4J8U D;  5KDM B;  3KWQ C;  1P3L A;  5B1M C;  5BT1 D;  4J8X A;  3W97 B;  4WZS B;  2ZY2 A;  1KX5 A;  2NQB D;  5G49 A;  2ARO B;  4ZBJ B;  3WAA A;  5B2J A;  5GT3 A;  3REI A;  5B1L A;  5B2I C;  4QLC A;  4H9S C;  4YM6 D;  4J8V C;  3AZF C;  1P3P B;  1M19 A;  3W99 D;  4KHA B;  4LD9 A;  3A6N A;  2FFF B;  4JJN A;  3W96 B;  1P3M C;  1JFI A;  3AZG C;  2ZY5 A;  5F99 A;  2Y2G A;  3REK C;  3MGS D;  2CV5 B;  5GXQ C;  2XD5 A;  3AYW C;  5B0Z D;  3NQU A;  3LZ1 A;  2PYO B;  4XUJ D;  3X1T A;  3LEL D;  3MGQ A;  1KX3 C;  1S32 D;  3MGP C;  2HUE C;  1F66 A;  3REK D;  5B32 C;  5GXQ D;  3AZL B;  3AZH A;  3UTB D;  1ID3 B;  3B6F A;  4H9N A;  4Z5T A;  5CPI B;  1P3G C;  3AZM A;  4Z66 D;  1P3I A;  3MNN D;  3AZN D;  1P3O A;  3AN2 A;  1M1A A;  3REJ D;  5AV9 A;  5B24 B;  3IP4 C;  4ZUX B;  5CPK B;  2NZD A;  1B67 A;  5DNM C;  1P3B B;  3O62 A;  5AVC D;  4KUD C;  5JRG A;  4WU8 C;  1M18 A;  5B0Y C;  3KXB A;  3C1C C;  4J8W C;  4E45 A;  5JA4 A;  5AV6 A;  3MVD C;  3LZ0 A;  5DNN C;  3MGR C;  3W98 A;  3AV2 D;  2ZY4 A;  3REL B;  1P3A C;  3VH6 T;  4J8U A;  1ZLA C;  3W97 A;  4WU8 D;  5GSU C;  2VQR A;  3A1K A;  3KUY D;  5B0Y D;  3WKJ B;  5B33 D;  4X23 C;  2ARO A;  4H9O B;  3LJA C;  3C1B D;  2YFW A;  5C3I C;  3WTP E;  3AFA C;  3X1U B;  3B6G C;  1P3L C;  1P3P A;  1ZLA D;  5B2J B;  3AL0 C;  4J8X C;  3REI B;  5GT0 D;  3AV1 D;  2Y2J A;  1BFM A;  5BO0 B;  5E5A B;  4KHA A;  1KX5 C;  5B1L B;  3B0C W;  4DRA A;  3WAA C;  3X1V D;  3WTP D;  1EQZ B;  4WU9 D;  5GT3 C;  3A6N B;  4JJN B;  1U35 D;  2CV5 A;  2F8N D;  1M19 C;  1KX4 D;  1AOI B;  4LD9 C;  3AZE C;  3WA9 D;  2XD1 A;  1HQ3 B;  4XUJ A;  3LZ1 B;  5F99 C;  1S32 A;  2Y2O A;  4YS3 B;  3AZL A;  5B31 C;  5AY8 B;  2F2A C;  1ID3 A;  1P3F D;  3UTB A;  1F66 B;  3AZI D;  3AZH B;  3MNN A;  3B6F B;  3X1T C;  3X1S D;  3AZM B;  4NE3 A;  4ZUX A;  1P3O B;  5CPK A;  5AV9 B;  5B31 D;  1P3B A;  3UT9 D;  1BH9 A;  3UTA D;  1P34 B;  4Z5T C;  5B40 D;  2Y2M A;  1P3I C;  3O62 B;  3AN2 C;  1M1A C;  5AVB D;  4CSR B;  2G5H C;  3REH B;  3KXB B;  3REL A;  2HIO B;  4AWL C;  2G5I C;  3LZ0 B;  2NZD C;  5AV5 C;  1TZY D;  2FJ7 D;  5CPJ D;  4R8P D;  5JRG C;  1P3K D;  1Q9C A;  3P5J B;  3TU4 D;  2YFV A;  4H9O A;  5AV6 C;  4J8U B;  3W98 C;  4H9P B;  3AZK D;  1T3U A;  1HTA A;  4KGC C;  2NQB B;  3X1U A;  5AV5 D;  2YFW B;  4EO5 B;  3W97 C;  5CP6 D;  5BO0 A;  5E5A A;  5AV8 C;  4H9Q A;  3KWQ D;  3V9R B;  2ARO C;  5B1M D;  4YM6 B;  4NFT A;  1EQZ A;  3W99 B;  2JE5 A;  4XZQ C;  4KGC D;  3EG5 B;  1U35 A;  1P3P C;  2F8N A;  3AZJ A;  3EPH A;  1AOI A;  5AV8 D;  5B2I D;  3AZF D;  4J8V D;  3MGS B;  3W96 C;  1HQ3 A;  5B0Z B;  4XZQ D;  4YS3 A;  1H3O B;  2CWE A;  2CV5 C;  4XUJ B;  1P3M D;  2JCH A;  5AY8 A;  3VH6 A;  3AZG D;  3LEL B;  1S32 B;  3AYW D;  2PYO C;  5GXQ B;  3AZI A;  3UTB B;  3X1S A;  2IO5 B;  5BS7 C;  4Z66 B;  3MNN B;  3AZN B;  3B0B A;  3AZL C;  1KX3 D;  3A1I A;  3REJ B;  1ID3 C;  1P34 A;  3MGP D;  1TAF B;  2F8N K;  3UTA A;  5CPI C;  5B32 D;  4KUD A;  4G91 B;  1BH9 B;  5B24 C;  1P3G D;  4CSR A;  5AVC B;  3REH A;  4ZUX C;  2BYM A;  2HIO A;  5CPK C;  1P3B C;  3VH6 W;  3AV2 B;  2DQN C;  5CPI D;  3VH5 T;  2RIQ A;  2RVQ C;  5DNM D;  3TU4 A;  4H9P A;  4KUD D;  3C1C D;  4J8W D;  3REL C;  3KUY B;  3MVD D;  2YFV B;  3MGR D;  5DNN D;  5B33 B;  2NQB A;  4CAY B;  3C1B B;  1P3A D;  1Z2C B;  3WKJ C;  1F1E A;  3V9R A;  3NQJ B;  4YM6 A;  5B1M A;  5GSU D;  3AV1 B;  5GT0 B;  1P3P D;  3W99 A;  4H9Q B;  4X23 D;  3LJA D;  3X1U C;  5B2J C;  3X1V B;  3REI C;  3WTP B;  3AFA D;  4WU9 B;  5E5A C;  3WKJ D;  3B6G D;  3R45 B;  5B1L C;  4QLC C;  3MGS A;  5B2I A;  1U35 B;  1P3L D;  2F8N B;  4J8X D;  4J8V A;  3AZJ B;  5B0Z A;  2JSS A;  1KX5 D;  1EQZ C;  1KX4 B;  5B32 G;  3A6N C;  4JJN C;  1H3O A;  3WA9 B;  3WAA D;  1WWS A;  5GT3 D;  3LEL A;  4QLC D;  3REK A;  3B0D B;  2UWX A;  5GXQ A;  1M19 D;  1HQ3 C;  1P3F B;  4LD9 D;  3LZ1 C;  3AZE D;  4G92 B;  4Z66 A;  3AZN A;  4YS3 C;  3AZI B;  3MGQ C;  3REJ A;  5AY8 C;  3X1S B;  5F99 D;  1TAF A;  1F66 C;  2Y2Q A;  3MGP A;  4M6B A;  5B32 A;  3AZH C;  2ZY3 A;  3B6F C;  3UT9 B;  3UTA B;  4Z2M G;  5AVC A;  5B40 B;  3AZM C;  2BG1 A;  1P3O C;  2J8P A;  1R4V A;  3X1T D;  5AV9 C;  4H9R B;  3MGQ D;  5AVB B;  1P34 C;  3AV2 A;  2BYM B;  2Y2L A;  5DNM A;  3O62 C;  4Z5T D;  1TZY B;  3KSY A;  2FJ7 B;  5CPJ B;  3H0R C;  1M18 C;  4R8P B;  3H0M C;  3REH C;  4WU8 A;  3KXB C;  1P3I D;  2HIO C;  5BNV B;  3KUY A;  5B0Y A;  2ZM5 A;  3C1C A;  3AN2 D;  5B33 A;  3LZ0 C;  3TU4 B;  4CAY A;  1M1A D;  2F8N G;  3C1B A;  3AZK B;  4E44 A;  2NZD D;  1P3A A;  5AV5 B;  3NQJ A;  4J8U C;  5BNX B;  4WJ3 C;  5FUG A;  1ZLA A;  5JRG D;  4HGA B;  1B6W A;  5BT1 C;  5GT0 A;  4DQY B;  5CP6 B;  5GSU A;  3AV1 A;  1M18 D;  5AV6 D;  2NQB C;  3LZ0 D;  3KWQ B;  4ZBJ C;  3W98 D;  5B1M B;  4EO5 C;  3X1V A;  3WTP A;  4WU9 A;  3R45 A;  4KGC B;  5CHL B;  2LY8 A;  3W97 D;  4YM6 C;  4WNN A;  3W99 C;  1KX4 A;  5AV8 B;  5B31 G;  5B2I B;  2ARO D;  3AZF B;  4J8V B;  3WA9 A;  3VH5 A;  4XZQ B;  3MGS C;  4NE5 A;  1P3M B;  3AZG B; 
#chains in the Genus database with same CATH homology
 2Y2K A;  5B0Z C;  1P3F A;  3REK B;  2DF4 C;  3AZE A;  3AYW B;  3W96 D;  4XUJ C;  3LEL C;  1N1J B;  1S32 C;  2CV5 D;  5B31 A;  1KX3 B;  3UTB C;  3UT9 A;  2IO5 C;  2HUE B;  5B40 A;  3MGP B;  2PYO D;  5B32 B;  4Z66 C;  3MNN C;  3AZN C;  4H9R A;  3REJ C;  5AVB A;  4NE6 A;  1P3G B;  1BH8 B;  3VH5 W;  3AZL D;  3F6T A;  4G91 C;  1ID3 D;  3KFU G;  1TZY A;  3FDD A;  2FJ7 A;  5CPJ A;  5AVC C;  4R8P A;  5BNV A;  1P3K A;  1P3O D;  5DNM B;  5B24 D;  4ZUX D;  3AZK A;  4WU8 B;  2L5A A;  3AV2 C;  4KUD B;  5CPK D;  5B0Y B;  3C1C B;  4J8W B;  1P3B D;  3MVD B;  3MGR B;  5DNN B;  5AV5 A;  2BYK B;  5BNX A;  2RVQ D;  1P3A B;  4UUZ A;  5CP6 A;  3KUY C;  5B33 C;  3KWQ A;  5FUG B;  1ZLA B;  3C1B C;  5GSU B;  3REL D;  4X23 B;  3EPJ A;  4KGC A;  1KU5 A;  3LJA B;  5KDM A;  5C3I B;  3AV1 C;  5GT0 C;  1W2E A;  3AFA B;  5AV8 A;  3B6G B;  4H9S A;  3AZF A;  2W8S A;  4WNN B;  1P3L B;  4J8X B;  3X1V C;  3WTP C;  1KX5 B;  4WU9 C;  1A7W A;  5G49 B;  3X1U D;  4XZQ A;  1U35 C;  5B2J D;  3WAA B;  3REI D;  3AZJ C;  3AZG A;  1P3M A;  3EPK A;  5E5A D;  5GT3 B;  1AOI C;  5B1L D;  1KX4 C;  2Y2H A;  3AYW A;  4QLC B;  1PZR A;  3WA9 C;  3W96 A;  1M19 B;  1EQZ D;  3A6N D;  1N1J A;  4JJN D;  4LD9 B;  3B0C T;  3AZE B;  3B0D C;  3AZJ D;  1KX3 A;  1JFI B;  5F99 B;  1P3F C;  1AOI D;  4G92 C;  4UPK A;  5B31 B;  2PYO A;  3AZI C;  1HQ3 D;  1WWI A;  3X1S C;  3NQU B;  1P3K B;  3LZ1 D;  1P3G A;  1BH8 A;  5BS7 A;  4YS3 D;  3X1T B;  5AY8 D;  4Z2M H;  3MGQ B;  1F66 D;  3UT9 C;  3UTA C;  3EPL A;  5B40 C;  5CPI A;  4DRB A;  3AZH D;  3B6F D;  1ULY A;  4WV4 B;  4H9N B;  4Z5T B;  5B24 A;  5AVB C;  3AZM D;  1P3I B;  4J8W A;  5AV9 D;  3MVD A;  3MGR A;  3AN2 B;  5DNN A;  1M1A B;  2BYK A;  1P34 D;  1TZY C;  2F8N H;  5CPJ C;  2FJ7 C;  4R8P C;  4AWL B;  1P3K C;  2NZD B;  3O62 D;  3H0L C;  3TU4 C;  2Y2I A;  3REH D;  4UUZ B;  3KXB D;  5JRG B;  2HIO D;  3AZK C;  1M18 B;  4X23 A;  2Y2N A;  5JA4 B;  2Y2P A;  5AV6 B;  3LJA A;  3W98 B;  4HGA C;  3AFA A;  5CP6 C;  3WKJ A;  3B6G A;  4J8U D;  5KDM B;  3KWQ C;  1P3L A;  5B1M C;  5BT1 D;  4J8X A;  3W97 B;  4WZS B;  2ZY2 A;  1KX5 A;  2NQB D;  5G49 A;  2ARO B;  4ZBJ B;  3WAA A;  5B2J A;  5GT3 A;  3REI A;  5B1L A;  5B2I C;  4QLC A;  4H9S C;  4YM6 D;  4J8V C;  3AZF C;  1P3P B;  1M19 A;  3W99 D;  4KHA B;  4LD9 A;  3A6N A;  2FFF B;  4JJN A;  3W96 B;  1P3M C;  1JFI A;  3AZG C;  2ZY5 A;  5F99 A;  2Y2G A;  3REK C;  3MGS D;  2CV5 B;  5GXQ C;  2XD5 A;  3AYW C;  5B0Z D;  3NQU A;  3LZ1 A;  2PYO B;  4XUJ D;  3X1T A;  3LEL D;  3MGQ A;  1KX3 C;  1S32 D;  3MGP C;  2HUE C;  1F66 A;  3REK D;  5B32 C;  5GXQ D;  3AZL B;  3AZH A;  3UTB D;  1ID3 B;  3B6F A;  4H9N A;  4Z5T A;  5CPI B;  1P3G C;  3AZM A;  4Z66 D;  1P3I A;  3MNN D;  3AZN D;  1P3O A;  3AN2 A;  1M1A A;  3REJ D;  5AV9 A;  5B24 B;  3IP4 C;  4ZUX B;  5CPK B;  2NZD A;  1B67 A;  5DNM C;  1P3B B;  3O62 A;  5AVC D;  4KUD C;  5JRG A;  4WU8 C;  1M18 A;  5B0Y C;  3KXB A;  3C1C C;  4J8W C;  4E45 A;  5JA4 A;  5AV6 A;  3MVD C;  3LZ0 A;  5DNN C;  3MGR C;  3W98 A;  3AV2 D;  2ZY4 A;  3REL B;  1P3A C;  3VH6 T;  4J8U A;  1ZLA C;  3W97 A;  4WU8 D;  5GSU C;  2VQR A;  3A1K A;  3KUY D;  5B0Y D;  3WKJ B;  5B33 D;  4X23 C;  2ARO A;  4H9O B;  3LJA C;  3C1B D;  2YFW A;  5C3I C;  3WTP E;  3AFA C;  3X1U B;  3B6G C;  1P3L C;  1P3P A;  1ZLA D;  5B2J B;  3AL0 C;  4J8X C;  3REI B;  5GT0 D;  3AV1 D;  2Y2J A;  1BFM A;  5BO0 B;  5E5A B;  4KHA A;  1KX5 C;  5B1L B;  3B0C W;  4DRA A;  3WAA C;  3X1V D;  3WTP D;  1EQZ B;  4WU9 D;  5GT3 C;  3A6N B;  4JJN B;  1U35 D;  2CV5 A;  2F8N D;  1M19 C;  1KX4 D;  1AOI B;  4LD9 C;  3AZE C;  3WA9 D;  2XD1 A;  1HQ3 B;  4XUJ A;  3LZ1 B;  5F99 C;  1S32 A;  2Y2O A;  4YS3 B;  3AZL A;  5B31 C;  5AY8 B;  2F2A C;  1ID3 A;  1P3F D;  3UTB A;  1F66 B;  3AZI D;  3AZH B;  3MNN A;  3B6F B;  3X1T C;  3X1S D;  3AZM B;  4NE3 A;  4ZUX A;  1P3O B;  5CPK A;  5AV9 B;  5B31 D;  1P3B A;  3UT9 D;  1BH9 A;  3UTA D;  1P34 B;  4Z5T C;  5B40 D;  2Y2M A;  1P3I C;  3O62 B;  3AN2 C;  1M1A C;  5AVB D;  4CSR B;  2G5H C;  3REH B;  3KXB B;  3REL A;  2HIO B;  4AWL C;  2G5I C;  3LZ0 B;  2NZD C;  5AV5 C;  1TZY D;  2FJ7 D;  5CPJ D;  4R8P D;  5JRG C;  1P3K D;  1Q9C A;  3P5J B;  3TU4 D;  2YFV A;  4H9O A;  5AV6 C;  4J8U B;  3W98 C;  4H9P B;  3AZK D;  1T3U A;  1HTA A;  4KGC C;  2NQB B;  3X1U A;  5AV5 D;  2YFW B;  4EO5 B;  3W97 C;  5CP6 D;  5BO0 A;  5E5A A;  5AV8 C;  4H9Q A;  3KWQ D;  3V9R B;  2ARO C;  5B1M D;  4YM6 B;  4NFT A;  1EQZ A;  3W99 B;  2JE5 A;  4XZQ C;  4KGC D;  3EG5 B;  1U35 A;  1P3P C;  2F8N A;  3AZJ A;  3EPH A;  1AOI A;  5AV8 D;  5B2I D;  3AZF D;  4J8V D;  3MGS B;  3W96 C;  1HQ3 A;  5B0Z B;  4XZQ D;  4YS3 A;  1H3O B;  2CWE A;  2CV5 C;  4XUJ B;  1P3M D;  2JCH A;  5AY8 A;  3VH6 A;  3AZG D;  3LEL B;  1S32 B;  3AYW D;  2PYO C;  5GXQ B;  3AZI A;  3UTB B;  3X1S A;  2IO5 B;  5BS7 C;  4Z66 B;  3MNN B;  3AZN B;  3B0B A;  3AZL C;  1KX3 D;  3A1I A;  3REJ B;  1ID3 C;  1P34 A;  3MGP D;  1TAF B;  2F8N K;  3UTA A;  5CPI C;  5B32 D;  4KUD A;  4G91 B;  1BH9 B;  5B24 C;  1P3G D;  4CSR A;  5AVC B;  3REH A;  4ZUX C;  2BYM A;  2HIO A;  5CPK C;  1P3B C;  3VH6 W;  3AV2 B;  2DQN C;  5CPI D;  3VH5 T;  2RIQ A;  2RVQ C;  5DNM D;  3TU4 A;  4H9P A;  4KUD D;  3C1C D;  4J8W D;  3REL C;  3KUY B;  3MVD D;  2YFV B;  3MGR D;  5DNN D;  5B33 B;  2NQB A;  4CAY B;  3C1B B;  1P3A D;  1Z2C B;  3WKJ C;  1F1E A;  3V9R A;  3NQJ B;  4YM6 A;  5B1M A;  5GSU D;  3AV1 B;  5GT0 B;  1P3P D;  3W99 A;  4H9Q B;  4X23 D;  3LJA D;  3X1U C;  5B2J C;  3X1V B;  3REI C;  3WTP B;  3AFA D;  4WU9 B;  5E5A C;  3WKJ D;  3B6G D;  3R45 B;  5B1L C;  4QLC C;  3MGS A;  5B2I A;  1U35 B;  1P3L D;  2F8N B;  4J8X D;  4J8V A;  3AZJ B;  5B0Z A;  2JSS A;  1KX5 D;  1EQZ C;  1KX4 B;  5B32 G;  3A6N C;  4JJN C;  1H3O A;  3WA9 B;  3WAA D;  1WWS A;  5GT3 D;  3LEL A;  4QLC D;  3REK A;  3B0D B;  2UWX A;  5GXQ A;  1M19 D;  1HQ3 C;  1P3F B;  4LD9 D;  3LZ1 C;  3AZE D;  4G92 B;  4Z66 A;  3AZN A;  4YS3 C;  3AZI B;  3MGQ C;  3REJ A;  5AY8 C;  3X1S B;  5F99 D;  1TAF A;  1F66 C;  2Y2Q A;  3MGP A;  4M6B A;  5B32 A;  3AZH C;  2ZY3 A;  3B6F C;  3UT9 B;  3UTA B;  4Z2M G;  5AVC A;  5B40 B;  3AZM C;  2BG1 A;  1P3O C;  2J8P A;  1R4V A;  3X1T D;  5AV9 C;  4H9R B;  3MGQ D;  5AVB B;  1P34 C;  3AV2 A;  2BYM B;  2Y2L A;  5DNM A;  3O62 C;  4Z5T D;  1TZY B;  3KSY A;  2FJ7 B;  5CPJ B;  3H0R C;  1M18 C;  4R8P B;  3H0M C;  3REH C;  4WU8 A;  3KXB C;  1P3I D;  2HIO C;  5BNV B;  3KUY A;  5B0Y A;  2ZM5 A;  3C1C A;  3AN2 D;  5B33 A;  3LZ0 C;  3TU4 B;  4CAY A;  1M1A D;  2F8N G;  3C1B A;  3AZK B;  4E44 A;  2NZD D;  1P3A A;  5AV5 B;  3NQJ A;  4J8U C;  5BNX B;  4WJ3 C;  5FUG A;  1ZLA A;  5JRG D;  4HGA B;  1B6W A;  5BT1 C;  5GT0 A;  4DQY B;  5CP6 B;  5GSU A;  3AV1 A;  1M18 D;  5AV6 D;  2NQB C;  3LZ0 D;  3KWQ B;  4ZBJ C;  3W98 D;  5B1M B;  4EO5 C;  3X1V A;  3WTP A;  4WU9 A;  3R45 A;  4KGC B;  5CHL B;  2LY8 A;  3W97 D;  4YM6 C;  4WNN A;  3W99 C;  1KX4 A;  5AV8 B;  5B31 G;  5B2I B;  2ARO D;  3AZF B;  4J8V B;  3WA9 A;  3VH5 A;  4XZQ B;  3MGS C;  4NE5 A;  1P3M B;  3AZG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...