3WB2A

Hcgb from methanocaldococcus jannaschii in complex with the guanylyl-pyridinol product in a model reaction of [fe]-hydrogenase cofactor biosynthesis
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
160
structure length
160
Chain Sequence
b'VVMEEIIKKAFIESINNIRRGDKEEELKKIQEKIVNAKKIVVATNNQKKFKVIRDIMLRVCNAEIKMLDIDTRFADLTRMPALTKGLIALDIEKADLYIARGRLGAPGSGSMLVILDEKGRVLTASLSPSSVIHKEDIEERIKKELIEALSRIGISILEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0488
publication title Identification of the HcgB enzyme in [Fe]-hydrogenase-cofactor biosynthesis.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 55
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3wb2A01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 3wb2A02
1UC5B 1IWBB 4DK0A 2F1MA 5D5PA 1EGMB 3BRCA 1RSOA 1H2SB 1IWPB 1EGVB 2D0OB 1MMFB 1UC4B 5JJNB 4GYCB 1VF7A 5JJJB 4L8JA 1NBWB 1T5EA 4DK1A 2D0PB 1DIOB 3WB0A 3WB2A 5JJEB 2F93B 2F95B 1EEXB 3WB1A 3AUJB 2V4DA 5D5QA 3LNNA
chains in the Genus database with same CATH superfamily
2Q8NA 1E5DA 1G66A 3SYRA 1J0BA 3EZXA 2VF8A 1SCDA 3EMDA 2NUTB 4WGFA 4ECAA 3MTEA 4DXAA 4D0SA 2ERXA 3AL0C 2HVJC 2DPXA 3OE7D 1WA5A 5B3AA 3SF8A 2POCA 5KHKA 3GQBA 2EYQA 2R7KA 4DCNA 1TGYA 1RYYA 1F4LA 3I01A 3WL3A 3IMKA 2O7QA 4X63A 1U3VA 2D1TA 4MQMA 5J40A 1ECPA 3O92A 1VSUA 3PNOA 3KG2A 4KLCA 4JI2B 3N0RA 2Z1MA 1KJ8A 2I4TA 1JLSA 5CFMA 2O2YA 2NN3C 1AUVA 4E1BA 2NV0A 4RH3A 4U5QA 5CA0F 2W83A 1A4UA 5TPZA 1WXQA 1J0AA 2OZEA 3B89A 3IIIA 2I2XB 2WFZA 2NIPA 4PRZA 2A2ZA 5HUJA 4US2R 2V97A 4XLTA 4DZTA 3A27A 1TKCA 4WCFA 3T54A 4PG4A 4G27B 1NG1A 3PHHA 4YRSA 4QE9A 4JI7O 1X19A 3UAZA 1JEJA 5KSZA 1MO2A 5JJBA 1DXYA 2JFHA 3NJ4A 5AI5A 4MO2A 5G2OA 3APOA 1U2GA 4DQUA 5FTLA 1SC3A 1SR8A 3MMNA 2P0YA 2CW5A 3QLUA 2A7XA 2V55B 1HC7A 2AZXA 3RS5A 5CB4F 3HWRA 4MVWA 3CVUA 4LHXA 1WJZA 4ESHA 1Z82A 5EGNA 1VL5A 5DW0A 5CN0A 2P6OA 4PC1A 5B6PA 4MRRA 2CBZA 4G9BA 4G1FA 3RR2A 3IAHA 3SXUA 3TTTA 1ZWIC 3DAYA 2ZRQA 1Q1AA 3IQHX 3BMQA 1SPBS 3CX6A 3C3KA 5C31A 3JQFC 3DGEC 3PVZA 4XBFA 4IFIA 3LPMA 2Q2QA 4L7VA 2ONYA 3UEOA 1YQUA 3EIQA 1XZAA 2V9PA 3QNMA 5HF6A 4BGVA 1X1DA 3ABQB 2WTBA 5IT9N 4QVIA 3MAAC 3MINA 4PLVA 4RK1A 2R8EA 1XVAA 5KSYA 4OHBA 2K2WA 1K2VN 3WGOA 5HBRA 2BFDB 1WLYA 2IPMA 4J1TC 2VJKA 4RXUA 2CBGA 1W9MA 2EQAA 5EESA 1XMJA 2PTHA 1YITV 4RTOA 4XM1A 4Z3DA 2VTVA 4CIWA 3E4DA 3HRHA 4ZPXA 2E4WA 1JAZA 5K7SA 3AY6A 4M9XA 3GFRA 4EL0A 1BA3A 2R8PA 2F6RA 4BWVA 4KIUA 1ZC4A 2QL7A 1KP3A 4EQ6B 3WLHA 2NGRA 4MYHA 4XB2A 4R9SA 2IS2A 4M3NA 4PHTA 3WWDA 1JG7A 3JTMA 4ZDJA 3K6RA 1ZXBA 3HZRA 1VP7A 1QUEA 1XT6A 2DBZA 2IZ6A 4JMPA 3JARB 5HDQA 1QE3A 3M1LA 2OY0A 1JHMA 5HQ3B 4HXEB 4P3XA 5KVQA 5LYJB 2DPHA 4S1TA 3WKAA 1ETHA 1NBWB 1RQ2A 3ER9A 4CUKA 2IC5A 1CE8A 2KWIA 1ABEA 2O5EA 3GXOA 4RE5A 3VBCA 3GN1A 2G1PA 3OSZA 4L8YA 1EQUA 4D97A 4MV6A 1IQUA 2PX0A 3UJ9A 3K8OE 4W8OA 4B31A 1U99A 4GC9A 1JT2A 2PUJA 4PN3A 2Q1YA 4O8ZA 4Q9DA 1MXHA 1R27A 2QTBA 4CEIA 1GYRA 3IELA 1L8AA 3LU1A 5JBQA 5BMOA 4DV3O 1BKDR 4WJLA 1X92A 4ZT4A 1QQAA 3ZHSA 1BXKA 5GV8A 2N1MA 4PG5A 1Y3HA 2PZMA 2WBLC 1ZD2P 4H1VA 3TTXA 1EJBA 4XSGA 4JODA 3RH0A 3WC4A 3T3OA 4MW6A 4UMDA 1IN8A 5ALJA 2IV7A 5FXMA 3SC2A 3WZMA 2EFJA 4A8JB 1FFWA 1GUZA 4ZYVA 4J29A 4Z9BA 4QPZA 2P68A 1KERA 4AY2A 2ZDHA 2OD7A 2GXSA 4L6CA 4D41A 1QGAA 2FJPA 3Q8KA 5IDXA 2ZJ8A 5AVWA 4EKEA 3UHJA 3L0OA 3CX5F 3T38A 5B30A 2WD7A 4RLHA 1NY5A 3GJYA 1JBQA 4F2GA 2V74B 3QIVA 1XNRB 4F5WA 1SAYA 4BV3A 4N8DA 4JJ6A 1E1YA 3QE2A 4M8KA 6REQA 4MGZR 3E6AA 1XDBA 1SESA 1RAIA 4JJZA 4IFBA 1N4DA 4YMGA 1LXCA 3LDEA 2C00A 1TUBB 1JKJB 3WQQA 5EKDA 2H48A 3EBPA 4FP9A 1OWLA 4FCVA 4E03A 5KNDH 3EH2A 1KL7A 1ULHA 1QONA 1JMVA 2CLDX 5AKHA 4P32A 2Z09A 2OZLB 1YGPA 3WOHA 2QLBA 4LXHA 4CV0A 4WWHA 2CNLA 2OIEA 3LY9A 4U5XA 1GGNA 2C7PA 5SICE 1QG4A 3STHA 4R2IA 1FRNA 5AIAA 4FOPA 2M9MA 3LQFA 1RBMA 1T3LA 4V1CA 1BEZA 2NVUB 1L5FA 5L53A 3AVYA 1T8RA 1NX6A 3T1CA 1FIUA 3VR4H 2JLWA 4R0NA 1E2LA 2CCKA 1FLAA 2EL9A 2EW8A 3H3JA 4YACA 3IAYA 4HVLA 1I7SB 2HHHB 4EVSA 2OD9A 5JZMA 1X38A 3C3MA 1O77A 4AZTA 2BGTA 1SXHA 2VBFA 2CJFA 3PDIB 3VR5H 1PW7A 5DP2A 3D0KA 3IQFA 3UT0A 3ZWMA 2IBZH 4J0EA 2A9RA 4KN5A 4LSZA 3NTUA 3U80A 5K1XA 3OZEA 1ENOA 4Q39A 7ADHA 5HZMA 3N7UA 4YJGA 3FOFC 1UPTA 1VA5A 4U7WA 3ZS8C 4YP0A 4FFBB 3DTVB 1YSCA 4PSVA 4B4OA 1XD2B 4J2OA 2HIGA 3T1QA 4JV5B 1UK7A 1OWOA 4CTOA 4I50F 1RLTA 4WXHA 1HF3A 5AKEA 1LDMA 4EFKA 2C8JA 3DXRB 3D4OA 1ZMTA 3OPQA 3DZJA 5F98A 1T0HB 1PFVA 2F7SA 2J5RA 3ABZA 4FX2A 1SBNE 1IEVA 5CJPA 3OUZA 3GLUA 4WFBV 5LQSA 3RJMA 2PCLA 2CL5A 3G85A 2G5CA 5FQNA 3ZJ4A 2Y93A 1XQ1A 1G18A 2ZVQX 1YZUA 1UKAA 5F1OA 4COKA 3UHAA 2ATKC 1Y5IA 4Y0AA 1MRZA 3GP3A 1SO8A 1KY3A 1FTYA 3TQFA 1LLQA 2BT4A 5FORA 1I3OA 3KS9A 3Q40A 5TPWA 3KHUA 4O2BA 4XX0B 1RZVA 2R5WA 5ALRA 1EBOA 4YJ3A 2NU6B 1LW6E 4N40A 3LFUA 1A7UA 5IARA 3VDRA 1BW9A 3LKVA 4H13B 1J09A 3IBTA 2H92A 5AW5A 1KO4A 4IQFA 1Z7EA 3ZHBA 3LXMA 3QXGA 2WRZA 2C84A 4HFRA 1L0NH 3LQKA 1Y8QA 3WLAA 2GBIA 3F47A 1S89A 3LT1A 1KH1A 2FJUA 1VE5A 4OHKA 1P0PA 2R00C 3A9VA 4ROTA 1XDGA 4OLHA 1AMOA 2I2BA 1MC8A 4TXHA 2ZYAA 4LHSA 4IKOA 1SCNE 1P75A 3STYA 1U5AA 2OO7A 1D9ZA 5FWYA 1N8TA 2SKCA 3MERA 3RVDA 2A7WA 3WLJA 1H93A 5IBRA 1BVYF 1BS1A 4K9RA 5DRTA 4IJ5A 1A7KA 1W88A 4IRUB 4E5KA 4BX9A 2AQHA 3K94A 5CDUA 5ALLA 1WBBA 1EUCB 4QFBA 1II8A 3BXEA 3CCBA 2QG9A 4R3NA 4KPUA 4JYZA 5C7OO 3LPDA 1YDGA 1HM5A 3MJVA 3IOEA 5ALXA 2ZNJA 1YCIA 1A4IA 3MGKA 1TB4A 4MWGA 2CLIB 1FFBA 3RVJA 2FWAA 2ZT6A 4KHPB 4QTXA 3B77A 1LKZA 3B1FA 4XTRA 3RAJA 3ZD6A 1QH8A 3PF9A 4Q4LA 3T35A 3UPTA 1Y7LA 4AO6A 1LY1A 3IAUA 4H7PA 1D6JA 3HB9A 5D6NA 5K0ZA 1V11A 3OC6A 4AI8A 4R1MA 3RU9A 3RSGA 3U56A 2WY2D 8AT1A 1P4GA 3ZE1B 3T95A 4N5LA 1N8RW 2YBDA 1I5YA 3I45A 3F7YC 5KLVH 1T9KA 3D6MA 1USWA 3IDQA 5B3KA 1HETA 2C5FA 3ESAA 5G0TA 1QNFA 3B9BA 2VA9A 4Y6RA 3ZWDA 5HKAA 3I5UA 3THYB 2H31A 2ZE6A 2E7ZA 2P4KA 5DYGA 3CLUD 3TLAA 3IJ4A 2C7GA 1PM9A 5IAGA 1QH1A 3E7PA 1LWOA 3S81A 3WG9A 1FA9A 4BMSA 4MTLA 1ORVA 1PD1A 1B0PA 4JLAA 1W49A 3GRYA 1YHZA 3N6XA 4WFAV 3HKBB 3HWWA 4GGOA 3D7NA 2GEBA 4RDXA 3GPDG 5C3MA 3AR2A 3VU0A 1CQXA 4LI0A 4F2PA 3L6OO 2YTZA 3A2KA 5JS1A 4LC0A 1FUEA 3NT4A 3P0HA 2VJDA 4M0UA 2ZSHA 3CMCO 1QGUA 2HA3A 1NW8A 4QQRA 3Q0IA 2RAFA 3U4IA 4M1QA 1VKZA 4LJLA 3OR6C 1FPMA 4DLWA 3MOGA 4I5DA 3D43A 4AKEA 2ZSKA 3R75A 4I19A 4NU8X 2B2CA 1M1UA 3VGPA 3BK7A 4JI0O 4NENA 1HUQA 1CNMA 1HZJA 4Q6WA 1IH8A 1Q82W 2LR0A 3OTFA 4B83A 1XF1A 4AJOA 5M3BA 4I3FA 1MX9A 1ORIA 1XJQA 1R0KA 4NG5A 1A9QA 1M1NA 3GLIB 4BN0A 5CURA 3W77A 3GOHA 1M2FA 1BWRA 3OOHA 3CS5A 4YP6A 4G3XA 4ZRMA 3T61A 5LQNA 2RGYA 3RLFA 4EI7A 1L4BA 4FYIA 1E1KA 2QX6A 4GSLA 4N12A 1AU9A 1FRVA 4OB6A 4RZ3A 1BS2A 1YD7A 4H0CA 4M21A 1DIAA 4B3JA 3QEKA 3QG5A 1OZHA 2Y69C 1ZR2A 2PZBA 2FF7A 4KXNA 5ELXA 2Y1LA 4RWUA 1H38A 1X1RA 4IGFA 1JEQB 3OBIA 2AC7A 2IEGA 3FF4A 1FBNA 4ALMA 4Z8XA 1EAMA 3HUTA 1PYDA 1XKXA 1M2HA 2EYUA 3C1TA 3BIOA 4IH9A 1CHDA 3O7MA 1I4LD 4HQ0A 1SXQA 4HY3A 3T0IA 2COUA 3G2JA 2OCXA 5LQAA 5HMMA 1JLHA 4R69A 1AVTA 3AJEA 1E3EA 3HDYA 3C7DB 5H9CA 4NVPA 4ENSA 1PVDA 2AR7A 3DBRA 2WABA 1KI8A 2EEPA 4DYVA 1GZHB 1MEJA 1TD9A 3JQFA 3MMSA 3HN2A 1K8QA 1P72A 5BSWA 5A71A 4BFYA 4QPCA 3ZMZA 4UU8A 4OMFG 1SY7A 3CNHA 3HPQA 2OQIA 3T5BA 4TWIA 1B0AA 4RAQA 5B1SA 3QEOA 3WYCA 3GWZA 4XB6B 4BEBA 3F1KA 5H68A 13PKA 3EYWA 2YEVB 3UOGA 2VYND 3OJWA 4G0VA 5JAZA 1XU9A 2WYVA 3WYFA 4CKEB 1WA8A 3D6FA 5IVKA 3HL0A 1EN5A 3VSEA 1U2ZA 4G86A 2I8LA 3DR3A 4ZAVA 2GZHA 3L4BC 3IQDB 1NXQA 1E5TA 3UZUA 2PJUA 2KW5A 1QBKC 3A3PA 1H8HG 5FUMA 1CB0A 2QG4A 1P9WA 2QLFA 3EGDB 3U62A 4JBYA 2YCBA 2WJIA 2QTTA 3A6HA 3TMKA 1HLFA 4MH0R 4RH1A 4XX1A 2Z8XA 2HO5A 2ID8A 4G85A 3VR6H 1NU6A 3ICPA 2CY0A 3VNSA 1M93A 1KEVA 3GG9A 3PUVA 2XAHA 4PIMA 2A9FA 2DUMA 1QKKA 2R6DA 1AR5A 4YVFA 5I7HA 5UKDA 2I67A 1MFZA 1HG0A 3BJIC 1RKUA 3ANTA 3IUEA 5B1HA 3MILA 3ZY6A 3T4DA 3JQGB 4HH4A 1T8SA 4WX2B 3PUHA 2OCDA 3WRYA 4LK3A 3VHXA 5IM5A 1BE6A 3RK1A 1KO8A 3OA0A 3O4GA 5FI5A 2A1TS 1QE0A 4H1HA 5HR5A 1W0JD 1WVGA 1QCEA 3ND5A 2B4QA 3TTWA 4GZRB 3IO5A 4TTPA 3FHJA 4MS4B 4IMIB 2QTOA 2QTFA 3F67A 1PR0A 2WM9B 4G2NA 2Z8YM 2NO1A 1X59A 4FM9A 4HWTA 2B5VA 4YMLA 1JEEA 1FKAO 4Y1GA 4JOCA 1LNSA 2JLXA 4BCBA 2DYKA 1YJ9V 3I9MA 4MUIA 1NS1A 1L7BA 5ENVA 4H17A 2Z4TA 4GQAA 2HZ7A 3LOPA 1RS0A 5AR1A 3RSSA 1XIVA 2JFXA 4JLMA 3GCGA 3W6ZA 3BTVA 4MW2A 5AW2A 3G2LA 3L6UA 3I62A 4UUMA 1YJQA 3T9AA 1N9KA 4O4JB 1JI0A 4ICGA 3QRWA 4I5GA 4IXTA 4IWXA 4AYTA 1YVWA 1R3JC 4M1WA 1X1EA 4TXMA 4X65O 1T26A 1GA1A 4YRLA 1W59A 3GGSA 1N77A 4CKCA 1CRLA 3WTCA 3NZEA 3INNA 3V6LA 4P3OA 1SQQH 3S1SA 3TS1A 4GGPA 1E9CA 2X40A 2BF4A 4YMVA 4HDNA 3A4TA 4MJLA 1NLUA 3U17A 1UQRA 4HDRB 4GCZA 4PLGA 3FNGA 2XF8A 3OOSA 3BN3A 1W1IA 4DIDA 4LF8B 1Z5ZA 2C99A 2WKQA 4FGLA 1YR6A 3P0JA 2JH9A 4IIXA 4ZQGA 1UDBA 4BC1A 3KB8A 1KYIA 4YFVA 5FR1A 3LP5A 2FUNB 4K26A 2J6IA 4JFAA 2PUSA 2J7KA 3IR5A 1U0GA 4HX2A 3AK1A 2H4XA 4TMZA 3OICA 4ZVUA 2AFHA 4FDVA 1JT9A 1R2QA 1BJRE 3OQNA 4H7DA 2PMKA 5ALPA 1JPUA 4LE2A 1UKEA 2PSDA 1WHSB 4LFBB 4Z3KA 1RMQA 2PBFA 4NXNO 1RBQA 4C6TB 4C5AA 1F7VA 2JEYA 5KX5A 3BT7A 2QV0A 1O0CA 3LDHA 1SIOA 2HM7A 1QORA 2X0LA 3GVIA 5LP6C 4HXYA 3ZY3A 3RU3A 1ZXXA 1U8EA 3U09A 4DT1A 4E32A 4N8EA 4AZ3B 4DTIA 3DZCA 5DNEA 4WECA 5J4KA 1IXZA 1X7HA 4JBGA 4C0KA 4BYGA 2GA9A 3ZS8A 2OCCB 1RJWA 4IUBS 2PRKA 4NCNA 4FYJA 1XG5A 4ZEWA 4B17A 4M1OA 4R01A 4X1OA 1C7JA 3GQBB 1S96A 4P83A 4MRMA 2YWRA 1YI2V 4YGYA 4JL5A 5IJZA 1FNMA 3WSVA 4U02A 2YZMA 1Z4JA 3AHIA 1JKFA 4JXXA 2OT5A 1FFSA 4UFOA 3QFRA 3A1VA 4EHAA 1I6MA 3V46A 4EX7A 1W2WB 4URFA 2VQFO 3U40A 4WEOA 2PMBA 2BFFA 5F73A 4QLAA 5JJLA 3TLCA 3OM3B 2B7CA 2HXYA 5DHSA 4WCFB 3BE6A 1L5HB 3KR9A 3MCTA 4PIVA 1TD1A 4GP9A 2DFPA 4DBVO 5JSFA 2ZZKA 4R8SA 3I04A 3GRCA 1GM8A 3QWBA 2Z2KA 4A0GA 3BWEA 2I3ZA 4W1QA 2WB4A 5F2NA 1FFXA 1PJZA 1WW8A 1Z08A 3R7AA 3QKIA 1FMTA 2JJ2A 4GXRA 4URWR 2XA1A 2JLYA 2AXNA 1UJMA 4JI4O 3ZV4A 4A7PA 1P1KA 1EK2A 2R1TB 3QG1A 3ORFA 4Q9JA 2ZXUA 2R00A 3EOAI 2X0IA 3AONB 3NAMA 4FYHA 1N4AA 1O6GA 3HCWA 2QEQA 1UJ6A 3FTEA 2C77A 2F3QA 5J5VA 1KQOA 4GI1A 4GUNA 1YAJA 2ZTUA 4ARZA 1DIGA 1QU7A 3TSZA 1J0DA 1VIYA 4MJ7A 1Y1PA 3BMQB 3R5TA 4QO7A 3FHLA 5HXAA 3AVUA 4GECA 4EPRA 1NE2A 4R2LA 2AW3A 1ZW6A 1T4MA 1NOIA 5A5VA 3NETA 3BSFA 3P9CA 4CLEA 3MINB 5LLSA 2O0MA 4Q7LA 3UCFA 4OFZA 3PEVA 4C2UA 4JC8A 1U0HC 4ZHQA 1DC3A 4HNRA 4DUYB 1YZVA 4QJ3A 4IS3A 2FKXA 1XPJA 1J99A 2PU7A 4I3HA 4KAJA 3H84A 2XZTA 4YRIA 2MJLA 3NNNA 1SPXA 1DARA 3W7BA 4DSOA 2P6PA 3QBTA 1WWKA 3NXSA 1CJUC 2VPQA 3GEHA 4U7JA 3RWRD 3KKPA 2EJTA 2MSDB 1V39A 3F3KA 4DSAA 2REOA 3H5AA 3H7AA 5E7IA 3Q1KA 4RYLA 2AXTZ 3PTLA 1MJGA 2FN4A 3PIDA 1TKRA 3ZTWA 3NTOA 3ZY5A 2BFOA 4CNQA 4WKBA 5EERA 1NW7A 1W85A 2QTRA 3DOCA 1DCMA 1THTA 2Z0AA 4PYNA 5JPCA 3CLTD 2WLSA 4G5HA 1TVEA 4N6GA 3ZI0A 3WWPA 2DWQA 4WINA 2PX8A 2AQIA 4TQDA 3JY6A 2A1UA 2OPHA 5KQGA 1M9NA 4GSKA 3K70C 4CW7A 3FHCB 3LPAA 2ZSJA 1CE8B 1KYTA 3FR7A 3FTCA 1YVDA 2Y1EA 4UCQA 1QTRA 2AA3A 3KQYA 3L4KA 4W63A 3R7LA 5IULC 3M33A 1UL1X 1XFDA 4RTPA 2ZBRA 4OLJA 2WWXA 2C7BA 1Q1QA 3A4MA 3IVAA 2ZYTX 1P5HA 1X6VA 3IB6A 1N5OX 2BSKA 4H44B 1FX0A 4BGDA 4NY1A 5FRDA 4BQPA 4CEIB 4JUBA 3SQWA 3QXXA 1U0JA 3B8HA 4WLUA 2Q7EA 1UEXC 1ZHOA 3NUQA 3P2OA 3UAOA 2WYOA 1YJXA 4OGWA 1UBMS 3CLVA 5JC8A 5CBFA 3M4ZA 4B5LA 1SRQA 2G9VA 1NZDA 2D2CB 4BRUA 4NTZA 3LT2A 1B3BA 3C8ZA 4HFMA 3HPRA 2F1OA 1CYEA 1V5FA 1YQ9A 3VDMA 3NGMA 5E95A 4YR7A 1XILA 1O94D 3ZK8A 3SC2B 1JQ3A 2OSVA 1A77A 2GHRA 1Y80A 2DH5A 4D80A 4UCRA 1ONOA 4RJJA 2E4AA 1N8SA 3I8SA 4UDYX 1P80A 3IVGA 1OPRA 3UWPA 2AFIE 3BXOA 2WD7B 1R6VA 1HKUA 4DNXA 2L6LA 3J81A 2IYZA 3RUAA 5IH3A 2H7CA 2JAQA 4O0LA 1K89A 5KSPA 3PS9A 1F0NA 3NHBA 4N6OA 3IEPA 3GK3A 1VHQA 4PWYA 1YB1A 1OJLA 4GWLA 5LCXA 3DTTA 2Z3ZA 5M5BA 5JOQA 2BKLA 4TWKA 1E9BA 3F2IA 4ZQEA 1JXQA 3T5PA 4DQ0A 3G59A 2EHDA 4EZEA 2UUPA 3AMVA 2VJCA 5CNMA 3WWYA 3CNOA 2NM0A 4LZPA 2BFNA 3GGCA 4Q15A 2PUEA 2X6TA 2QZPA 2ZDQA 3JR7A 2DUWA 5JQGA 1YMUA 3CPEA 3M6XA 4V1CB 1TJYA 4TTAA 2VWKA 3O84A 2AW5A 3N2IA 3QA3E 3WGMA 4UC0A 2AUMA 2VTKA 2QD3A 4XVQA 5DHQA 5CG1A 4GQIA 1H94A 2WUDA 3PWSA 4J3NA 2GT1A 1V2HE 3PRKE 3HGMA 2IEBA 2G80A 1QG0A 5HEKA 2IPNA 3DB1A 2W2VA 3FJOA 4CU5A 5B3SB 3EYAA 3G6WA 2JAPA 1X80A 2VHCA 3OIGA 1NMQA 1IZ0A 2GERA 4YK7A 4K6OA 2VPWA 2WR8A 1C81A 2YOGA 2VJMA 3L4BA 3GB7C 2IUSA 1P8AA 4ER3A 3W05A 4KGVA 4HUQA 1EFRG 1ZXLA 4W8GA 1WW3A 2HR3A 2LWIA 2QVXX 1LH0A 3MM4A 3BDIA 1VL1A 3EVDA 3PFCA 5K0BA 1NUAA 3BHNA 3PEUA 4AVYA 1KI2A 5IKXA 2A6PA 2UYYA 3L6RA 2IYTA 1HY3A 4A9AA 3HEAA 3NHUA 1P6XA 4JASA 2BZ1A 1N75A 2R85A 2VUHB 3M3HA 3SQNA 4G1VA 1D3AA 1TA4A 1DJQA 1CVLA 1DTOA 1URFA 1H9BA 2GN1A 4MV1A 1JIUA 1GGFA 4IRMA 3JWHA 3W4KA 5B1EA 1RAHA 2GDSA 1JKXA 4WY5A 3KTOA 1RLJA 1QZZA 4ZOQI 2HMWA 2P4UA 4ARUA 4QDTA 1VF7A 2LKDA 2O20A 1CR4A 2CN1A 1OLSA 1PJSA 4HBNA 1CLUA 1DRWA 4AKSA 4E51A 3SMQA 3ST7A 5L6LB 3BILA 3INRA 3AG4C 3CWBH 1U0EA 3QKUA 3KCQA 4EFMA 3K5MA 3WYBA 5JAUA 3FRJA 2VH2A 4O2BB 3FJYA 4XWKA 3N86A 4WDRA 2FEPA 3L8YA 2ZSIA 3JPWA 1VYUA 1Q15A 2QT0A 2YKGA 2ZIVB 2B21A 1EWYA 1Z5PA 5IDWA 5CUQA 4PSKA 3M4YA 2BHTA 1J8DA 1AKMA 2DFDA 3PTAA 2RGAA 1Y8QB 1COWG 4YO7A 2PAFA 3FYDA 5CK5A 5EIWA 3SOZA 1RQNA 3TXXA 2YH2A 4FQ5A 4DIUA 3T1YB 3ADPA 2HJVA 1ISRA 1UJBA 3CP1A 3CWQA 5IYCO 4KRXA 5EJ7A 5K9ZA 1P0QA 4KQHA 5ICFA 3F4LA 2Z56A 4PRLA 1R9JA 4BVFA 1XTPA 2MWMA 5FWYB 2ZS9A 4EKGA 4EY3A 1US6A 1E3TA 2QRVA 5IHPA 4XDZA 4ZQIA 5E2AA 3SLRA 5C7YA 1L8XA 5IDVA 1W88B 2PSEA 4RSMA 3SNKA 2O7NA 3AG2C 1JB9A 4KFRA 3IAAA 4Z2YA 4O4LB 4QOIA 3DZFA 4NBLA 4KPUB 5AW4A 4BKPA 5HFMA 1KD1W 3PNSA 1KZHA 1KFEB 1KVRA 5I7VA 3L6BA 4PICA 1HDGO 4NNJA 2J0VA 2HX1A 1WP7A 3S8MA 2HDHA 5HOQA 1RHMA 2IE0A 2GJ8A 2V7UA 2DTXA 4JP1A 4WKCA 2VHEA 1ZLXA 2WW8A 3R2JA 2O1EA 3UPUA 2AG0A 3W5VA 1GKIA 1G42A 2Q5LA 4U8GA 4FSXA 1Z28A 1MQ9A 1NI3A 1TZJA 1VL0A 4R3UC 1V11B 4Q24A 5GTDA 3RHSA 1VJ0A 2ECOA 2C58A 4ZO9A 4PC2A 1IXRC 4CCSA 1MU0A 1Q86W 3AUYA 3BMCA 3GFPA 2JCVA 4Z0HO 1H2YA 3COVA 3K35A 1NVBA 4XQEA 2EINB 3CKMA 3PU6A 4YT2A 1NL3A 1PHPA 2PJDA 4B3XA 2C9ZA 2FTKE 3RFUA 3RYHA 5KYXA 5B1NA 4CEJB 2C92A 5AWFC 5L95A 2OWDA 5LXTF 3FNHA 2GK4A 4GM0A 4H3HB 1ECFA 3LRXA 4K7JA 2J5KA 4EWLA 4JI1B 1I10A 5KDLA 4R0VA 4DJEC 2JGUA 1I08A 1KYYA 2W2XA 3HP4A 4R8RA 1N0VC 2FSUA 3MYYA 5JARA 1L5GB 4JL8A 5LP6A 2PLRA 1PS8A 2ZYDA 1PNTA 5E3JA 2WFMA 4DUPA 5FP0A 2VF7A 4PNPA 2B0CA 2IU3A 4LGCA 4V2UA 4CIXA 3BTUA 1QGUB 1E9FA 1EJ2A 1N9GA 4I9HA 4HT3B 1U1DA 4LQCA 1BMQA 2P6NA 2AXPA 3GUUA 1H0SA 3L7KA 2AN4A 3R44A 4DF3A 3FUCA 3IP8A 4FB5A 3F6PA 1TPYA 4PDVA 3H9GA 3QOWA 5NULA 2O8BB 4BBJA 1N36B 4JR1A 4NENB 3ZLJA 4W99A 1YI0A 2C5AA 2PT5A 2DPLA 4J0IA 5T64A 3K0AB 4LYGA 3KHKA 3ED5A 4KSCA 2CUTA 4QDUA 5JMOA 2B30A 3K53A 2AN5A 1KZ4A 4XQCA 3E3AA 4LJ6A 4TWBA 5DX1A 3P7MA 5A0FA 4A4DA 1EVLA 3WJ7A 2FMFA 3G17A 4NU6A 1FUYB 1XEXA 4PHGA 3ZXUB 4Q3EA 1EDEA 3RVLA 1MMFB 4MVRA 3V2HA 4UUBA 2C3MA 2VAVA 3WICA 1IBMB 3AP2A 5LZ4A 2D1YA 2I78A 3E7XA 4MQFA 3F7VC 1ADJA 3K92A 1JMKC 3KIPA 3EC7A 3JWEA 3CJTA 3EOZA 3QTLA 1XN4A 1PT8A 2C78A 2WQZA 1UFIA 1AY0A 2M98A 3MRVA 5CIYA 4X45A 2OHFA 2BTOA 1E3DA 1WSBA 3N0WA 1Z0JA 4ZCPA 1ETUA 2FKAA 1QAQA 3LZ6A 3VYRB 2JI9A 1TE2A 4ZAGA 5J2TA 2YV4A 2GUZA 3TSYA 1F2UA 1ORHA 2ZSFA 4ZRNA 1TO1E 1A9YA 1AKQA 2PZJA 3O83A 4BQRA 2NU9A 4K8RB 1OWNA 3N7TA 1MAVA 3ZKWA 3TKYA 3CRW1 4LJ9A 5HOEA 3B1YA 2J32A 4WIAA 1VLJA 4M9UA 4IL5A 2YBEA 4QYXA 4MUKA 2VFAA 1XTTA 2PMEA 3ZJYA 1PNLA 2DW4A 3ZHYA 1RXVA 4PNZA 3HGTA 2QMUA 1IHOA 3L0BA 1I7PA 4C08A 2CXNA 3LRPA 2OFWA 3OW2U 4YCMA 3TZ6A 2HCTA 3EGVA 1Z25A 1YZHA 3FKQA 2SKDA 1QYXA 1NI8A 4WW0A 4M83A 5M7EA 1OXUA 4O5AA 4MVXA 3P5SA 4DANA 2FK8A 2IYRA 2PT6A 1NTMH 1GQFA 3T3EA 1X8JA 3TMYA 3WWEA 3OUFA 1SU6A 3N07A 1VPDA 2GZDA 1UJ4A 4ZU6X 3R7WA 3OZUA 1ZJ6A 3E9YA 2QTGA 1B6QA 4F5EA 5TEVA 4AS2A 2GCGA 4D02A 3VM6A 3BTSA 2O2ZA 4JB8A 3LUDA 3D6UA 3TX2A 2EF0A 1ORQC 1DEXA 3G3EA 2CUNA 2X4GA 5CLIA 4XUGB 4W1RA 3MGAA 3FYHA 2LW7A 5U9CA 4L8JA 2D00A 3SZMA 1O9HA 3FAKA 3R0ZA 4AXXA 4QARA 3RNLA 3UUGA 5LDDC 4BKOA 3SZUA 3RUEA 3ELDA 1L9KA 1KJIA 3IOYA 1D0SA 2AG6A 4A91A 4HJRA 4Z7JA 3AM1A 2FZGA 3FCCA 2XB8A 2YXDA 2DJ5A 3Q4GA 3QUBA 2WF8A 4X0EA 1KAMA 2JBWA 2I1WA 2YS8A 3VHXB 1UDRA 1ABBA 1WJGA 2B36A 4X3OA 2IHZA 1U7OA 4R1OA 5AW8A 3PPVA 3JQ8A 1G6UA 1E2IA 2CCJA 2OGTA 2DRIA 2YHUA 5MGNA 4EW6A 5DXJA 2VS0A 5GQSA 4NFSA 2VAWA 2VO1A 1PL0A 1WBDA 1WAZA 3ZZTA 2XTZA 3GCWA 3BB3A 3KKKA 1NRIA 5GP1A 2BHRA 2OHHA 3BGWA 3CIOA 5H6RA 2WQ6A 4DR7O 1M75A 3D4IA 3X2QC 1Z6PA 2CDCA 1BS9A 1DRUA 1H8HA 3ZHUA 4DV6B 4MTXA 1JYFA 4OHRA 1RADA 2Y27A 4IYRA 3V1YA 5EK0A 1E2FA 2JVKA 1B0UA 4B7AA 1YKGA 3TKLA 3ND8A 2HI0A 3KTFA 3ESCA 1WQ1R 3EHEA 1RWPA 4U2KA 1C0EA 1WPBA 4JUAA 1U3FA 4GWKA 5BV0A 2G1AA 2MYNA 1NVMB 2A59A 3IBSA 1J00A 1E7WA 4ENWA 2ZR8A 2IH5A 1U31A 3RGWS 1P73A 3CHXA 3SK0A 4QUEA 4CKCB 2WICA 1CT9A 4AYXA 2GR9A 3CONA 3AK3A 4O25A 1Z56C 4H08A 1CQJA 1V37A 2ZB7A 3VH3A 1LQ2A 3DE3X 4BN4A 3WRYC 1Z7WA 3Q85A 5LJLA 2XGMA 3U60B 3MUEA 3LC2O 1CEQA 1BGWA 3CE6A 3V2GA 2P30A 4EGAA 5FO0A 1NNLA 1AP6A 1KBOA 2ZAOA 4NMMA 4I9GA 4NAUA 3L49A 3VC2A 4RJ2A 1JECA 2FUEA 2EEZA 5I01A 1E9EA 3WFIA 2FB9A 1N1GA 1ZD3A 2HHAA 1N6LA 2OCYC 4RSGA 4L6AA 4FHZA 3IUMA 1Z17A 1HNWB 2R7LA 3QVSA 4GX5A 1UAGA 2I76A 4ALKA 3E81A 3K2EA 5KB3A 4NDZA 4C0XA 1TIKA 5JR3A 4AWXA 2P9BA 3PNLA 3FPSA 3MTQA 3CT4A 4M54A 2CHFA 4UNQA 3Q6IA 1C9EA 1ADGA 2IVFA 3RTBA 3LLUA 4KFUA 1HYGA 4GZ3A 4P1ZA 3IKTA 3A6GA 2JEOA 3KZVA 1ZGJA 1PUIA 3KJIA 3OZDA 2PX5A 1M3SA 3DDHA 2EJCA 4X1IA 3T8YA 3UMBA 1YIDA 4M0CA 1F3LA 4DSTA 5EJIA 2H8PC 5CXXA 2D0PB 5K8VA 3SFTA 2ACWA 4JDUA 3RM3A 1B93A 3AKEA 2QLLA 4LQ4A 4CC6A 4C89A 1P60A 1XKLA 4F04A 1N3BA 2DR3A 4WKPA 1K0UA 5BORA 2XNSA 2XWJI 5D01A 2WF5A 4W5HA 5F78A 1JZQA 4K9QA 1N34O 3DC6A 4HX9A 4L5IA 4QUAA 2IYOA 4H0FA 3TQRA 5ECYA 1ZUQA 1RWWA 1JILA 3U19A 1JBKA 4PNEA 3U4MA 1Z4MA 5G4KA 5CB0A 3N0TA 4ZOLB 5ICMA 1WP9A 5LFAA 1BTOA 3NAZA 2G7MC 4JYAB 1GA4A 3EBOA 3EQ8A 4X97A 3SYMA 3RTGA 3MPOA 1KDRA 1YS1X 4OMCA 1NF9A 3IE0A 1J23A 4LEIA 4RS4A 3FNRA 2CFRA 3TLXA 2IZ0A 3KSAC 1PYGA 1DG9A 4B71A 3W3ZB 4YJFA 1GZ6A 2XRZA 1E8NA 4PI2A 1FLVA 1CRQA 2WIFA 4IDBA 3BMOA 2OGWA 2R48A 1OSNA 2W6PA 4IX9A 3L6EA 4HNGA 1T10A 4FNMA 4F3NA 3L1IA 5A6VA 3QBJA 2OFOA 1A9RA 3O2SB 4FEEA 3HJGA 5T8KC 3WLSA 1J8VA 1C29B 3ZDCA 3COWA 3WBJA 2AQ8A 5IT4A 1PJAA 2ZB4A 4R54A 1X0VA 3C3XA 1II0A 5JH7A 2XCLA 1NPYA 4FWBA 5BO5A 4URYR 2OECA 2KLBA 5AXBA 3KKZA 5IT0A 1OILA 4BV8A 2ZWOA 3D31A 4HLCA 1XHLA 2ORED 4JUFA 1T13A 1XXHE 4PFQA 4ZHSA 3LUGA 3WLIA 4EOGA 1PE0A 4TYPA 3AF0A 1DC8A 3ADOA 2ECQA 2P9CA 2JFYA 2ODMA 3ZV3A 4QGAA 1I4DD 4LMRA 5ICGA 1ZTEA 5DHTA 2MMGA 1EKXA 3ZDZB 4Q20A 4RVFA 1LFDB 5ED4A 3DF9A 1YR9A 3Q98A 1R64A 5AK4A 4NYIR 5ILOA 3QPUA 1E6KA 4DXDA 4CG3A 4OU5A 4OK3A 4ZHQB 4LJKA 2D3WA 1MH9A 1CERA 1MT3A 1AO3A 4D3DA 1MSWD 3OY2A 3SYTA 1P7YA 3CPSA 4ER0A 4OREX 5EIBD 4UPDA 1M6EX 2UXXA 3H5TA 4DCOA 3TDMA 2HHLA 2NX2A 2XY4A 2YWDA 3AG5A 3WXBA 2GF2A 3T2MA 4JYPA 3NCTA 1F6WA 1SG0A 3MMZA 4UZFA 4CIBA 4Q12A 4XFDA 2ZRMA 2ZE8A 3O8QB 1PZGA 3PYXA 5LGUA 1WCXA 4BE9A 4MAAA 1S0UA 4Q1CA 1W85B 5AVXA 3IUPA 4RL4A 4KZKA 3Q8LA 3J80N 4M8IA 3O8CA 1PR5A 1X87A 2O2IA 5JFGA 4BQFA 4B73A 3H1IH 3U4DA 4C14A 4KXLA 1SEPA 3DQPA 4KE6A 2BCEA 3AF3A 4GPTA 2CLEB 3VVLA 4CH4A 2ZRGA 3K9NA 1RQGA 2J59A 1VZ2A 5EMKA 4BW5A 2ZI6A 4IQ8A 2XZLA 4JT9A 2JIPA 5T4BA 1KYZA 2JKZA 1UMDA 4J9VA 1G20E 2NVOA 1L1EA 2AF3C 3ZD7A 2OG1A 2J5XA 1THMA 4PHCA 3O74A 4EB6A 4KNVA 3GI1A 3C48A 2GFHA 3GDHA 2D54A 4DQKA 1P4SA 1DDOA 4I1SA 1UBCA 3N05A 4GMHA 4OSEA 5C8XA 1KIFA 1BMFD 1HYBA 1RRFA 1JTFA 3ASNC 3WFVA 4P7JA 1QHFA 1Z4PX 3BGSA 4S0ZA 1NF8A 3HO6A 3GUHA 4HN4B 5BUZA 3TFOA 4MW0A 3Q7PA 3U3RA 1NVFA 4L0QA 2DSTA 2EW2A 3TTVA 3GD5A 1ZJWA 4Q4AA 4WUVA 4CM4B 1EHCA 1EUYA 5B1OA 3DL4A 4O0MA 1IM2A 2D5BA 2DWUA 3EQZA 2E3JA 3LP8A 4MUAA 3U1VA 1S1CA 5D3ZA 3HCAA 3I4LA 2O8CA 5FOUA 5B4TA 9ATCA 4LVUA 2EARA 4WASA 1W0KD 3EUAA 3ZDAA 3A04A 4OAOA 5G1OA 3KZKA 3LZCA 1RIIA 2CMHA 1NASA 2UU9B 4LF5B 2JIDA 5F7XA 2X41A 2E2WA 5DMHA 2Z9DA 4MTGA 2Y69B 1BKSB 4MKHA 1GXSA 3E5NA 1N2SA 4BTVA 3F9RA 3Q11A 3LCUA 1K5HA 3HUUA 4JVSB 4O4IA 3W78A 1JP7A 4DR3B 1DAIA 2Z2IA 1J42A 2NU7A 1LC0A 3QYAA 2OD2A 3E27A 4LJAA 3VVBA 5ILGA 2CL0X 1NUQA 1GT6A 2YWGA 4FLUA 4IH4A 3V8EA 2W6OA 5JCJD 5CFRA 4YCSA 4OOEA 3KCNA 1SVKA 5THQA 1KKDA 4P4GA 1R0WA 5JQGB 4ZICA 2FGKA 4HRXA 1IBRA 1OH8A 5K6TA 3U4QA 3WL7A 3T7CA 1CQIA 4P7GA 3WZ2A 3NRBA 1NP3A 5CM9C 1RACA 3SJ7A 1DRKA 3RJ9A 3F6SA 2B34A 4R51A 1UKZA 2HFEC 3O31A 1HR0B 5BNIA 3UYKA 3H1EA 4IHQA 1KJYA 3W5DA 1PG2A 5CFNA 4M46A 1SZCA 1RDFA 4HPWA 5HKKA 3JWJA 4YQEA 5I3CA 3NFYA 3BIJA 2HSGA 1D1SA 4GOXA 4NONA 1Q19A 5JAHA 4RJKA 3ZMUA 3CCEV 3A4YA 3CC2V 1X80B 2OT3B 1KI3A 4AMGA 2PXXA 2OPBA 5DWVA 4PA7A 3RVYA 3VO1A 2G72A 4QQFA 2Z6AA 2C04A 1XNJA 3S7ZA 2J0QA 1HEYA 2VJMB 3KVYA 1ZFNA 1UP6A 4DZZA 2G7ZA 5A3RA 1YDEA 4Q6GA 3FCXA 5L3VA 3OAAA 2EFCB 1WXHA 2P3LA 4FHDA 1NXVA 5B4UA 3CLKA 3TR0A 1UKYA 4E15A 1GZ7A 1G5HA 4FQ7A 3SYNA 4JASB 4MUXA 4B45A 1AQNA 4F06A 4DOMA 3AUTA 4GZLA 1WPXA 4OXSA 1JDNA 1XD8A 1JJVA 1F20A 1J5EO 4IOJA 1I94O 4BNLA 2Z8ZA 5H82A 2Y48A 1YZBA 4KQ2A 1SXJD 1JNXX 4KR6A 3VQXA 4YX9A 4GM4A 4HL6A 1KFBB 3TD9A 1YBHA 2QA4V 1SC5B 1U3WA 1OLSB 1PGOA 1QXSA 2ZJOA 5TMBA 1KDVA 1U98A 1VIMA 4L74A 4BNNA 5I5EA 3PHCA 1CUBA 1Q92A 3QVUA 4PXYA 2P2DA 4ZFNA 4IZHA 3BKWA 4ERXA 3MVEA 2RBKA 4R3WA 4TLLB 1W4RA 3EG9A 4BNVA 3RC2A 5T3UA 4N7BA 1NVPB 5TSDA 4YRFA 4MVJM 3W7SA 2ANCA 4IWYA 2WMYA 4YRQA 1SC1A 1XQVA 3OUUA 4FBMA 3NM5A 4GO1A 1SHUX 1SKYB 5IYZB 4Y9RA 4EGQA 1Q17A 3KJXA 1EFRA 4PG7A 2JFNA 3W7AA 2OA0A 1E9RA 4RTNA 2FW8A 2QRVB 1E0JA 3P26A 5JO9A 4TUYF 4PPNA 3BICA 4LWSA 3RB8A 3GPCA 4QWMA 1U2DA 2Q3BA 5JZSA 5AJXA 1QZXA 3Q7IA 1XZBA 1OPXA 3D6JA 1KOFA 3ICOA 2CNBA 2I3AA 4ASUD 2XDQA 3VJRA 4XQ0A 2BM0A 2AZ0A 4ZI2A 3W2TA 2IXTA 2J7PD 3QUCA 2VUIB 4WLVA 1PUJA 3N59A 2IXGA 2W0SA 1PEDA 4HN9A 3CUEF 3NM4A 2VATA 2BGGA 4KU4A 3TZLA 5L4NA 3A26A 3VTAA 2ZUDA 2R68A 3INGA 5BSGA 2XNHA 2J9XB 2EKDA 3N74A 5DLEA 2WLIA 4F4IA 1M1YA 3QA9A 3L8HA 4HGYA 4FE3A 4C6HA 3K9GA 2YHIA 1ULSA 4DXHA 1R3DA 2QP9X 1NBIA 4NOLA 2XKKA 1LV8A 721PA 4IP0A 3BCSA 3TR5A 1ZL2A 3O94A 1I13A 3BMCB 1VHLA 1D8TA 1R3LC 4OJNA 2MYTA 1PP4A 2BGJA 2OMKA 1COWA 4MW1A 5EG5A 4V0MA 2FG5A 3H5WA 2MR6A 5EZYF 3OGCC 4C3ZA 2RKBA 1AXRA 3GMIA 1RWQA 1SBTA 3RYHB 3MHPA 1QIGA 5KYXB 1GNVA 5C1OA 1S3GA 4KCGA 3IJRA 1HQDA 1QGOA 2ZWMA 2CE2X 1AUPA 3ZWYA 2ACEA 1V35A 1JG2A 1NTZH 4ZWNA 4BVAA 1V7QA 3NKFA 3V42A 3OESA 5B1DA 4LXQA 3KSMA 3DC5A 3KXDA 5LP6B 3FE2A 2E6UX 1B3QA 3O1JC 5SY9A 5SYNA 1JR3A 2JGIA 3KEFA 2RBEA 2ZYHA 4BQQA 1W2GA 3FSRA 3L8FA 4ZQFA 3KLOA 1U7WA 3A37A 1CUWA 1EVQA 2WJHA 5K4GA 2YIVX 5JZBA 2ZSDA 3NEYA 1N9GB 2Z30A 4QNMA 2W4QA 1T6BY 1HLPA 1I2CA 1Z2EA 3HE3A 3C5EA 1QMPA 4XCQA 1DQYA 5EGSA 1Q11A 2WWFA 1OFUX 4UATA 4Z4FA 3V7FA 2FPPA 2IXAA 1HE2A 2HTFA 5BYAA 1W52X 1JOYA 3BWBA 3OVMA 3D0OA 2NVBA 4YGXB 3HNOA 1CDEA 3LO8A 4LP8A 4IIEA 1P19A 2FSGA 3CJRA 1XEXB 4PJ0Z 3E22A 3DE4X 1SXJE 2Y92A 3CEAA 3IAM6 1JJIA 1U8FO 2ZREA 4R7CA 1VJ1A 4O2LA 4V2IA 4R8CA 4MQFB 1PO7A 3CC4V 2Q7HA 1C30A 2ECKA 2J87A 1OFVA 1G4AE 5EHIA 1WD7A 4IMJB 3UC9A 5T8KA 4PS1A 1Z6TA 3ILYA 4K9KA 1NBMD 5J2TB 2GUZB 5I8ZA 1J95A 1F2UB 2CTRA 1VI5A 1QR6A 4RF5A 1G5IA 3B3FA 1WNTA 2NU9B 2BN4A 3QOFA 4BUCA 2CNDA 3CX7A 4HXGA 3ZKWB 3HYCA 2L69A 1C9MA 1YF3A 2VVTA 1Z47A 5JWRA 1XL4A 4YO8A 3F74A 3NVMB 2ZCUA 1QGZA 1QIHA 1XLUA 4IVNA 1DHTA 2HIAA 5K05A 2NXNA 4M9ZA 3SF8B 3A3KA 3LJKA 3MHTA 2I54A 5HP4A 1WEHA 2YYZA 1D09A 4PAMA 4MKZA 2K5UA 2VR1A 4M8NE 5IHXA 1NRXA 4LOLA 1NULA 1KORA 1X2BA 2FZ5A 2O7SA 3D5EA 3DLPX 1W73A 2G6TA 2N42A 4E5DA 5F3WB 3VPAA 3R7WB 3CSUA 4R98A 4V03A 2P9HA 4NE2A 1ADFA 3K4HA 1V4BA 1DJMA 5AVKA 3I32A 5BR1A 3F71A 3BB1A 3AR7A 4ZBMA 1IN6A 1EFUA 2I03A 1I5XA 1L5NA 1USKA 1HTBA 2EKLA 3JQDA 4J0QA 4TN5A 2G63A 3M70A 2ZE7A 3FXAA 4EKYA 4KLAA 2CE4A 3P4YA 3IT1A 2HOQA 4JBWA 4NESA 4QG3A 1G8AA 1G4HA 4G5FA 1LK0A 3PC3A 1TEVA 3CPWU 2QD1A 1D8AA 1KAEA 5K8UA 5D86A 3WV4A 2I2CA 3LCVB 5CRIA 4YY3O 1B14A 4KR2A 4DDMA 3OZAA 4PE5B 2XMPA 3I53A 3SYCA 4EJ6A 2JANA 1UPXA 3PQCA 1U3UA 4AKTA 4XIGS 3ABTA 3K70B 1A76A 4H18A 1U8AA 3SXUB 4ZO8A 2FDXA 3P94A 2VBGA 4JA2A 1E3LA 3PC8C 1M74A 1ZVKA 5DGDA 1S1MA 3I5MA 3JQ8B 4GFDA 3A36A 4TRJA 1XTIA 5H16A 2V7BA 3B9PA 1W96A 4JXZA 2YASA 1RKVA 3M83A 5C9ZA 3VMMA 3ROFA 1MGPA 2JGMA 5C5DA 2YNMC 4EX6A 2O9JA 3LHIA 1ND5A 2ADQB 1SBCA 4IRXA 3TLKA 4PPQA 3BEDA 2XGGA 3U0ZA 3TZKA 2XAJA 1F8YA 2ON6A 1ZOIA 1U9IA 3GLGA 2VDMB 2FXVA 5DM6V 4TM7A 2X1VA 4DR2O 3SHFA 2ZJZA 5EXDA 3LV8A 4X1KA 2Y0BA 3DXYA 4JJAA 5U4QA 1YBMA 1P6UA 4ARBA 4BXOA 4D3ZA 5E4YA 1VI6A 4L4UA 1WU8A 5TF4A 4KWIA 3OQOA 4RPLA 2NYVA 1DF5A 1KP2A 1ZEMA 3GJ8A 1WLEA 3BD8A 4MLCA 1IJKA 3RRNA 3DTVD 2IEAA 3U1TA 3CZ9A 2QVYX 3IKLA 3G5AA 4MQEA 4LE0A 2KQXA 2AOTA 1GPJA 3WDLA 2Z5GA 1CQJB 3CLRC 1IXYA 3YASA 2Y0PA 5CT5A 3ANMA 5BSRA 4NG4A 5B7PA 1YHYA 2ZYWX 3EHBB 1TAQA 1IY1A 4TS3A 1F51A 1JLLA 4CE6A 3IB3A 3GUYA 1W581 4JQSA 3QU7A 4XEHA 3AR5A 1GLVA 4AILC 2HV9A 3B8MA 4N49A 3BPZA 1NBME 1Y9EA 1ZNWA 5CNKA 3H5LA 4WFQA 2EAUA 1IIBA 3T3MB 5KNCA 3NB0A 3DT6A 5KMGA 2R1UA 4PA9A 5AXDA 1CDOA 4BFSA 4P4SA 4CODB 2YXNA 4EHFA 1I0IA 1E3MA 4RIIA 1SKMA 3UAWA 4JBHA 2O2JA 2VJLA 5EE1A 3WLFA 1LUVA 3O26A 4KQ9A 4A15A 1RFGE 1P0CA 5K20A 3J7AU 1YEWA 4CS3A 5DN6A 1DUIA 2AR0A 1FYJA 5JAQA 2D5LA 4Y7DA 4ZYLA 3I9JA 1E2BA 4R7TA 1QP4A 1NNUA 1FUKA 1PK7A 3RK0A 1VKRA 4X1IB 3LUHA 4PY2A 3TIXB 5KTMA 4E2LA 3QKWA 5E1MA 4BQNA 1V4NA 4HRVA 4B32A 1CEEA 4IS2A 3O1IC 5I4KA 3HLTA 2O2CA 1ENPA 2IS1A 1J2JA 4TT8A 1H66A 1TQ6A 3ZC3A 1CP3A 1NZFA 4LY9A 4AMVA 1FXWF 3USZA 3OEHG 1TNDA 3C7TA 5CCXA 1VCHA 2OP1A 4KAXA 1VHWA 1X15A 1UPGA 1PQ4A 6REQB 3I76A 3OAAG 1VYVA 3WISA 1SETA 1PTJA 1XALA 4B0PA 1EBBA 3L8DA 4FLZA 2V5AA 5G4KB 5KQRA 3ZHXA 4H7FA 3WJAA 4D7TA 4EGCB 5G40A 2MT9A 4URHA 4ZT5A 1V25A 4OYLA 2C3YA 3FX7A 4N54A 1SQVH 2QRHA 2DTEA 4BWGA 3SXPA 3COZA 1S77D 3LSUA 2VHTA 1Z06A 1Y37A 4GMXA 3AG4B 2WTMA 1C9DB 4H4EA 4FOTA 4GXTA 5IMBA 1EFVA 4TM8A 1U90A 2QSYA 3UM9A 1XNQO 3IAS1 3KYIB 3T5AA 4NBNA 1AS2A 3BMOB 1P31A 4IYJA 3MRXA 1XMSA 4MTFA 1E1MA 1Q6ZA 1EZ1A 1QR9A 3HSSA 4R9RA 3TOSA 1UBLS 2UZ1A 1P81A 3ETGA 1K5DA 3UC5A 4CUJA 1NAHA 4DLSA 5DLYA 4YI3A 3ESQA 3H9VA 1C2YA 5D5PA 2C8LA 5DCLA 1DK1A 5KDDA 2QW8A 4WOJA 3LO5A 2C59A 3OT5A 5LOVA 4YJGB 2C5BA 2D74A 2BFAA 3IHLA 2QAGC 2BH2A 2KS6A 4D0NA 2IYQA 3FPHA 3CNEA 1F8FA 3MWKA 1NVKA 2I3GA 4IG9A 3AKCA 1Z15A 5K3FA 4RELA 2HEPA 2PSHA 1W5TA 3GLTA 4W7IA 2W2OA 3AG2B 4ZZ3A 3V8NA 4QUBA 3NR2A 2R6HA 4P5DA 2GZ2A 2P1ZA 4EUHA 4PA6A 1ZJJA 3ZWQA 3LG2A 3V9AA 5LIRA 2JFFA 1NH2D 1N5MA 2IXDA 4OO3A 1I6LA 2BE3A 2V6JA 1Z34A 3IOCA 4V38A 3W3AD 1CKEA 5FOVA 2WJWA 4LE1A 5ELMA 5CB8A 3GA7A 1QE5A 3TM5A 1UAAA 4AAYA 2AWOA 3SZGA 3I42A 4RAIA 4ALJA 2QDOA 1O0BA 3IMFA 3OTIA 4KE8A 2UYHA 5GOZA 2ZUVA 2CC2A 3R9WA 2IDKA 5TPWB 1GU1A 2IHUA 4LOHA 4YJ3B 2P2ZA 4Z6KA 2UXDB 2FZWA 3BGVA 3TM4A 2JLCA 4MV7A 4H1UA 2GPJA 3GY0A 1BW9B 2ZSUA 1XZQA 2FWIA 2GN6A 2CMDA 1XAJA 5AKIA 3OCCA 5A9SA 3IS3A 3FR8A 3H9QA 3RSHA 1H3NA 1K6XA 1A27A 1Z36A 3RQIA 4KH0A 3W6NA 3KR1A 3P3NA 1LQUA 5DSZA 4KUMA 4HH1A 3QEMA 2GNAA 2HPVA 5B2EA 3SEZA 2AGVA 4RDIA 3QX7A 1Z9BA 4BR6A 4GI2A 3ZCVA 1UMDB 2G5GX 1YJNV 5BWOA 1R0BA 1TM4E 2RNBA 1GP2A 3LE8A 4EB6B 2OBYA 2NZJA 1KUQA 3TQOA 1IBKB 1N9ZA 3KXKA 3B1ZA 1N0UA 2UXBB 1PQYA 2HLNA 4U0JA 4MI9A 2IPXA 1GU0A 1SVOA 2M1ZA 1FW6A 3B8EA 2ATIA 2BW0A 1K8XB 1XTKA 2XZPA 3WBKA 3VHRA 3UW3A 1II8B 4CCAA 2XJ4A 3W04A 2HK7A 1QHXA 4TV8F 2VK1A 1JA9A 5A03A 2B6NA 2AI2A 2Y0CA 1NW6A 2PVPA 3TW8A 3DDSA 3GMSA 2R2GA 1CIJA 4DMKA 1XZ8A 4L08A 1LRLA 3KZMA 1I4WA 2OTLV 2Z2JA 2VAXA 1QH8B 3LWZA 4FYXA 2V6BA 4DCMA 3AF2A 1W46A 2O8CB 3A2FA 3G5UA 2PFKA 3R5FA 4LH6A 4QE3A 5A6SA 1V5GA 1W8IA 3T3HA 3LYLA 1EHIA 2APJA 4QFDA 3KLMX 3KZCA 4ALLA 3HVIA 1HE3A 3BBLA 2G0TA 4FOLA 3EVZA 4CS2A 2NMVA 4GU5A 2QN3A 3KXIA 1EPUA 4ZVQA 3ESYA 1PLKA 1WXWA 4R5HA 1NJ1A 1R10A 1YZYA 4BZXA 1YS4A 4BKMA 3ZXXA 5JYCA 3U10A 2YVAA 4BLVA 3EWAA 2VZ9A 4ND5A 4H4DA 1BYUA 4U7OA 3A1DA 1WLSA 4MVJD 4O4IB 3E61A 2A79B 2CVZA 2I8AA 2NU7B 3I58A 4TZTA 3BA9A 1QH1B 4R68A 2JJQA 2WPNA 4MVZA 1UODA 2W70A 5LR6A 1QAMA 4LAFA 1UBFA 3LZDA 3KLBA 3O8LA 4YV7A 3H1GA 3MQ4A 1RCUA 3E9EA 2YRXA 4U2FA 5AVVA 2PYLA 4BS9A 1GPBA 4MVUA 5IAEA 2P2SA 3V4SA 4QBKA 1WUIS 3L0ZA 3IUBA 4WFKA 5GAJA 1JG6A 3U4QB 2A5JA 1CQIB 1KDPA 2VSNA 1J56A 2D62A 2RG7A 1P7PA 5J4VA 5IKOA 4UHJA 4EGJA 3VH4A 2I9KA 1LTQA 4B4UA 3EIUA 5EKSA 1TW3A 4GPAA 1G4UR 4M8SA 1RI1A 3NBMA 1EB8A 3U3DA 4KO4S 3DMNA 4RHEA 1R6DA 5EMLA 2EGGA 3E1GA 2C9OA 5DNVA 4TQ9A 1YF2A 1XCBA 5D5QA 5JRJA 3DE0X 2FZ4A 3GFTA 3AHHA 4BOYA 1H2FA 3LRTA 3LXRA 1M1NB 4EFNA 1XMQO 5HPYB 1TXGA 4GKJB 3TJTA 1MO5A 2J5BA 1SU8A 3UGJA 4LV6A 2ZUBA 2MTBA 1HG1A 5BN1A 3KLNA 2JVIA 3PBKA 4RM3A 3IRUA 1EDZA 2G8NA 4A03A 5I9IA 3IQGX 4LQLA 1EM8A 4UAJA 1XMOO 4YP5A 5TS3A 4HDKA 2KI5A 2P2LA 2CLFB 1Z8DA 4U6SA 3VGJA 2DKFA 3DPSA 1YO6A 1AQIA 3WLMA 4PNHA 4RU1A 4Z99A 4MTOA 4P54A 1URPA 3AGPA 5C8DA 4I2VA 1YDWA 5CH3A 2O1XA 4PGHA 1ULUA 4W5RA 2DULA 1E79D 4GOLD 3VA7A 5ALVA 2NT4A 2LCQA 4ZT3A 3V1LA 2ZT5A 2JIZG 3DBRB 2J3MA 2DERA 1QVAA 2GN8A 2VRCA 5AHWA 1WB9A 3ZDYB 1M1ZA 1FTNA 3LECA 1Z39A 3PC8A 4H6XA 1P44A 1VCMA 3JXEA 2BE7A 2BGIA 4H7EA 3K32A 3SIRA 3S3XA 2Q6AA 3D36A 4ZRDA 1I0ZA 1IIRA 5FJJA 4GE0A 1T3GA 2P1DA 1GZUA 1G4YB 3STLC 2D4HA 3AJAA 1YNOA 3VPBA 3AEZA 4JBXA 1X7YA 3N87A 3THOA 4IIJA 2YNMA 3AEXA 2UYGA 2R6FA 1WA8B 1N5IA 2NR5A 4RZ2A 4YUAA 3M6LA 5EPEA 4ZXFA 1HFKA 1I1QB 2D0IA 1DT5A 4UNIA 3X2QB 1CVRA 5ERXA 5G53C 3O8DA 2MINA 2EG5A 3OQHA 4GPIB 1W6UA 2IYUA 4KDFA 5ICCA 1N6PA 1SCIA 4HNSA 3KQOA 4D9FA 2A57A 2YFHA 2CV0A 4C0JA 1YS7A 3RUCA 3G7UA 4LWSB 4QTTB 2I6XA 1KFCB 3WB0A 4ZMSA 1U0TA 2P0AA 1TA9A 3IDZA 1ZH8A 1GTG1 3PC7A 1VG9B 2LUOA 2P9EA 3WNVA 1B6GA 1K7SN 2HU2A 1WMDA 1VJTA 2I4LA 1AA9A 4UMFA 1ILEA 2QI9F 2GM3A 2H2HA 1NBAA 3BRSA 2O0HA 5BWCA 3TNLA 3I6BA 3OTOB 3NUGA 3UWMA 5JATA 3JSNA 2PRIA 1HO3A 5J2UF 1H8EG 2QIPA 2PRYA 3MS2A 2E1RA 3BFKA 2WLIB 3A8TA 3KV3O 1MW8X 1L5MA 2YHIB 3HJCA 4MA5A 5K8JB 2HO4A 5TPZD 4Q3BA 4DB4A 3CVXA 4MVJE 2DWEC 3AIOA 2XEDA 1J8MF 5CDFE 5CT9A 3ORRA 4AY3A 1W2BU 1XOIA 1NM5C 1JE1A 5H81A 2ORWA 3OQ6A 1I14A 5M34A 4NLLA 3W2IA 1P2DA 3OH8A 1NF3A 2XUQA 2BSAA 1FYXA 2WYUA 3KYDA 3NYWA 4ARIA 2HBZA 4J16C 4A6DA 3ROMA 1F38A 3SQMA 3LGXA 2KJQA 1IHYA 1AZWA 1JQLB 1G7RA 3H86A 2G40A 5LBIA 3QYFA 2BBTA 2K9PA 1TF7A 5E6UA 1FNSA 1CUZA 4NHOA 4O33A 3NNSA 3RNOA 2W2KA 4BMVA 2EZTA 1YJ5A 3PGJA 1N1DA 5HCIA 5DN6G 2H4FA 4EPXA 4NOMA 1SH7A 4R05A 5E1DA 2HEIA 5HIKA 2F66C 2V9CA 2E48A 1U2DC 2VYVA 1H2AS 5K99A 1JDUA 2ARKA 3B6MA 4R2KA 2X6AA 2ZJYA 1RPAA 3MN1A 2Q8QA 1JH8A 2O5VA 3HJFA 4EEQA 3QM1A 4R31A 1HQKA 1P5FA 4YROA 3NR7A 2CLCX 5C37A 3CX3A 1GRJA 2OCLA 1NXTA 3FWKA 1T35A 2Q1WA 3PL1A 4B9AA 3RIEA 3FMPB 3HYLA 4BDSA 1LCIA 2FPPB 4BNTA 1MAWA 2VQEO 2D8AA 2GCPA 4HDNB 4V3CA 4BVBA 2ZRIA 4PGAA 3GLFE 3QW2A 1FFGA 4P30A 1RAAA 3DE7X 4XRRA 4DC1A 1OFUA 3E22B 3L70H 1W1WA 3NS7A 3AF1A 5EVCA 3PZRA 1J22A 1JLRA 2WJAA 3NDIA 1Z73A 2AFHB 1RWOA 2XGSA 1QWOA 4LV8B 1ZIDA 3QENA 1K6MA 3QE3A 2JCGA 4PZCA 1R6UA 1CJKC 1NJ8A 1QV9A 2CLHB 3L7IA 2FW0A 1SQBH 3V33A 2IBSA 3ZGOA 3C7AA 2Z6QA 4GZ6A 3GRUA 5KX5B 2H51A 2CXTA 1J2EA 5ERGB 1JS1X 3VR2A 4I55F 4AMUA 2WUVA 3AFOA 4K1XA 3UENA 1PKXA 4DT1B 1IN7A 4HN2A 2FZEA 3RUIA 2HK8A 2Q5IA 3LOQA 2C5SA 1SZJG 4K2AA 2I2DA 3RS4A 3G2MA 4H2DA 1T1IA 1DGQA 2RJ3A 1E89A 4IO1A 2PS0A 1QDEA 2QAGA 4LBYA 4ENRA 4ILEA 2EJWA 2R66A 4X44A 1VIAA 4OH7A 3VJMA 1H2XA 1FX1A 3IVCA 2NSLA 1OROA 1E9VA 1AT1A 4K9LA 4MRMB 4YPVA 1U0SY 1VARA 2VSOA 1CIVA 4NJOA 1J9ZA 4ZT2A 3VDNB 2VUSA 1YBAA 4J94A 5IAOA 3WQHA 3OZRA 2LP7A 1X8KA 2D0DA 2WIKA 4GVPA 3RG2A 4DMCA 3PHIA 3UJDA 1GG8A 3RI3A 2XD4A 1STOA 2GCIA 3ITNA 3UQZA 3PDHA 3ZXSA 2B5OA 4IEEA 2BFFB 5DM0A 4HWRA 1AUXA 1UBOS 1ZN9A 4X5OA 1RWKA 5H4HA 1NVXQ 1B15A 3NM6B 4A0FA 4FE4A 1XAHA 1YTLA 1E0KA 4BW9A 3H99A 2AKAB 1QVRA 5JCZA 3KBOA 3KUKA 2C5EA 1KFKB 3EY9A 4JQZA 3OZFA 2R751 4R1QA 3RBVA 1QCYA 2X1HA 1FFXB 4ND7A 3I09A 2IUFA 3PPIA 1OTXA 1AVMA 3M5WA 4DG9A 3WGQA 4DCPA 1QU2A 1W87A 3USCS 3H0EA 4A1OA 4EYSA 1Y66A 4Z1VA 2ATCA 1K7EB 2KYRA 5GJBA 4G4SO 1XI1A 4KI0A 1IPHA 1QNLA 2ZXWC 3CRMA 1N1MA 4XIYA 5EJFA 1S5HC 2GUGA 3HMKA 2JGAA 4MQ6A 3VZDA 4ARZB 2XUAA 4OBXA 4BLPA 5H7XA 2WA3A 2H18A 6YASA 3EA4A 2IIVA 2PGJA 4GR5A 2PL9A 1I2ZA 1MOFA 4H33A 1XC7A 1CS4C 4PF1A 4GBED 4CR7A 1U04A 4X24A 1UOQA 4P5EA 2E49A 1ZQ1A 5LSAA 1Z12A 5DI3A 2QSZA 1S5LZ 1DVRA 3ME5A 4JGIA 3H4VA 4Z4GA 1FFHA 4BNDA 3D1VA 5IBQA 3X1JA 1PQPA 5H59A 3ASNB 3BMXA 1YDMA 2F2TA 4RVGA 4IGEA 2IU6A 4LOIA 1SELA 4L78A 2VC2B 3SC4A 3GLGB 5A0TA 3D0RA 5CXSA 1PJLA 3B40A 1MVOA 1FTQA 4RYDA 2BGRA 4X1KB 3GRVA 2WLNA 2WKRA 3ZLUA 1E66A 1CNEA 2WD9A 1AQ6A 3CW9A 5M29A 3F96A 2H2AA 1G7SA 4BXOB 1CUSA 1W48A 3C74A 4ZTBA 1L7XA 1JU4A 2QRGA 3IBFA 4DDVA 2F3TA 3RRBA 1X9HA 1GDDA 2ENUA 3G71V 4GAEA 3Q2IA 4J03A 1VPEA 4UHFA 1X7GA 1D4FA 3NBKA 3IEUA 1B3RA 3OCZA 2ILVA 2A9KA 4B6GA 3L4JA 1J21A 3ZVLA 3AHJA 1P4HA 1QBZA 2UXCB 1LX6A 2NVWA 4AJKA 1T9CA 1QHNA 3QMWA 5G1PA 2AOTB 5CJ2A 5BWMA 5EIFA 5IAJA 1DFIA 2A1UB 3BJZA 3DBVO 3QX8A 3EFFK 1M0SA 4FEGA 3IGAC 1ID1A 3HU3A 4PBRA 1PN3A 3T0GA 3R3ZA 2L35A 3S5UA 1XU4A 4M99A 1JLLB 4WFGA 3F7NA 1TYAE 2FPOA 3SE7A 3SN6A 3FFWA 1ISMA 5C93A 4HDMA 3G0BA 4WMLA 3EGIA 4KR0A 2BSKB 3EMKA 1FX0B 2OCPA 2C4KA 2VRWA 1QQCA 1XR3A 2B8NA 4HMPA 3A9CA 5KMGB 1Y3DE 4P4SB 3RQSA 1FPOA 5LBQA 1IBLO 3NANA 1UF9A 4DV5O 1U7ZA 5HNKA 3H16A 2WLLA 3S8EA 4WXPA 1T15A 1EG7A 1U9IC 5LQJA 2EV9A 5AKKA 5KQLA 3B6JA 1HQCA 4UXJA 5AHRA 3F5FA 2FZLA 3GGPA 1U9JA 5AJYA 1CF2O 1J8QA 3BH6A 1KQFA 1ENZA 1SXIA 1I3KA 3ZJ5A 4J41A 4RCVA 1KC1A 5DDIP 2XOKG 2J6BA 1MG5A 2V7VA 4RZIA 3GG2A 1U81A 5DSXA 2W93A 1F7YA 3P32A 3BIFA 1EVEA 4F8JA 1BN7A 3H8WA 3UV3A 1OU4A 2V8OA 4MVMA 5A2QA 2UZ0A 4DMUB 4UV8A 2RJZA 2XE8A 3I2YX 3NDBB 3PICA 1E7YA 2ONJA 1YDHA 3QVKA 1O3YA 1DO8A 3PKIA 4RGBA 4NEHB 2O2XA 3G1WA 4EUFA 4ZI7A 1J7KA 3PWTA 1AQLA 2R47A 2IJKA 2DFTA 5BPHA 1TC1A 4H3KB 1IHUA 3BY6A 4P38A 4ZMBA 2DECA 1XBTA 4D9MA 4Y2UA 1EFVB 3DAPA 4J11A 2XGOA 4LHEA 1NQVA 4EMSA 5F33A 3ODPA 5F64A 3NOOA 2P90A 1SD2A 1W19A 2Q6LA 2R9RB 4NS4A 4YJHA 2GX6A 3T34A 4EG3A 1UK9A 4M1MA 1FK8A 1MC5A 2UZ1B 4GEGA 3U0VA 5IUNC 4F5ZA 2AIRA 1Y4ZA 2CNWA 5ADHA 3I92A 4JLDA 1NUSA 1EAYA 2G07A 3HBFA 4EO4A 1LNQA 3JD0A 3V8VA 4Y9UA 4BMCA 5JCPA 4GYYA 1OZFA 5AM0A 3RJTA 4NNPA 3GFOA 1FMLA 1HNNA 3AOEC 2Y1GA 1M1XB 5FHQA 2H2WA 1E6WA 3D54D 4IXNA 5KYGA 2ZUTA 4M2LA 4OPMA 4LC9A 4IJ6A 1OGIA 3ISJA 5LOVB 3OEHA 3GLKA 4O59O 3SR0A 2G17A 5KUMA 4HUQB 1NW4A 3H6KA 1U8CB 1V0JA 2CLOB 1PS9A 4OH1A 2P5OA 4II2A 4BP8A 2GKGA 1G1MA 3I5AA 5K3FB 3UTDA 1VF5B 4JC0A 2HPAA 1AK2A 2YY6A 3AIIA 3T4ZA 4X93A 1U7XA 1PTJC 2AL7A 4DBZA 3FSJX 4GYCB 2RKWA 2EU8A 3D8CA 3U7RA 2JI7A 3ZE7A 4J7ZA 4D0RA 4RGYA 3ZK9A 2ZU0C 2JS7A 2CNNA 2Q3CA 1Y5LA 1LPSA 4D98A 1DKQA 2VEDA 1Y4AE 4I8IA 3NYRA 1RJDA 2XB2A 2M6LA 2NZUG 3I5DA 2H5IA 4BVGA 4OXKA 4RZSA 3IAFA 1H22A 2W6MA 3ZZ0A 1DKNA 3K04A 3THSA 2W2QA 4LISA 1R6XA 1H6DA 1X94A 1MF7A 2J3IA 3WAJA 3QHQA 3PJGA 3PQFA 1DOHA 1KYXA 3TPZA 1VRCA 4BY9E 1C7RA 1KSGA 1GL9B 1YV9A 3L4SO 2NO6A 4YUYA 2SBTA 4LCJA 4KXQA 1HDZA 1IATA 2AKYA 1NM5A 821PA 3QU4A 4E46A 2AOVA 1N0NA 3MAGA 4EPVA 4OXYA 4ZKEA 3O4JA 1BG6A 3LSTA 2G36A 2O3SA 1RR6A 2WC1A 5A9SB 3CZ5A 4HHEA 1YK0A 4J16A 2JFBA 1U80A 4OCZA 4FYKA 3ANLA 1TKAA 3PC6A 3L71H 5CBPA 2QUIA 1PWZA 3ZCXA 5I8PA 4WOBA 4BFZA 3QEMB 2FY8A 1Z0ZA 2IF0A 4JUCA 3AETA 2D2IA 2RB4A 4FD3A 4NZPA 2IGBA 4LYFA 4KBYA 1MVLA 2E4XA 2CXSA 3EUEA 4QUGA 3UN1A 1XPOA 1FNCA 1Q0UA 2GBLC 3FPBA 3SC6A 2GAJA 2NO0A 4EB3A 3MJSA 4F56A 5JCOC 3KQWA 3N39C 1SUCA 1GRCA 5LDGA 4MIEA 4G63A 3C8DA 3SGLA 1W0CA 3L79A 1EA7A 3RSOA 2HDNB 3V8QA 4D74A 3LPLA 3TJZA 1XTBA 3HLYA 1CY8A 3IA2A 5AP9A 5D7NA 1J5XA 3UUEA 1CJMA 1DPGA 1MXFA 4OQLA 3TW8B 1BL8A 4C76A 2J85A 3C6ZA 3ASUA 3LX6A 1JG3A 1SGWA 3DQZA 3VKUA 3FOEC 4LYYA 3EOBI 3ON5A 1POXA 3PKZA 5FUXA 3ML0A 2BMEA 3GEPA 3TJRA 2FLVA 1I5OA 1ZHFA 1RRCA 3DFFA 2XF2A 2RK6A 2AMFA 3JYHA 3Q9SA 3AQIA 2ZIWB 1OBFO 5IXYA 4DLNA 1EBFA 3NAQA 1CY2A 4TT3D 2FMXA 3IDOA 3EQ6A 3G79A 4TMYA 2BEWA 2CGEA 4ZJYA 1DWOA 1IC6A 1XTRA 5B7NA 3CB2A 3HDVA 1MKYA 4NP6A 4CPDA 1RJGA 4NQZA 2J3EA 1NQ5A 3FTFA 2P2NA 3IDSA 3L74H 2OV8A 1KEEA 4QTYA 3AYZB 5DN9A 3OF2A 1ST3A 1WVMA 1KI1A 1AQUA 2QTVA 5EUCA 3IOMA 1DJPA 1YOVA 3W5JA 3TEFA 1YJCA 2YV3A 4PVDA 1YB6A 3EZLA 3B9QA 2NV6A 2CVFA 4YONB 2J41A 5A7FA 4BEJA 3CRZA 4BMOB 3PFIA 4UXNA 1GNQA 3UMGA 3RSQA 5GOTA 1LRKA 2V1DA 5DM2A 1KEZA 2IPAB 3IL2A 3Q88A 3TUJC 2Z4SA 5KYNA 3HNRA 2J0SA 4MYDA 3LTEA 3OLXA 3RREA 1N3IA 3C6BA 2NYAA 2NQ2C 1OGYA 4CG2A 3RRXA 1W5BA 3RS2A 4LNAA 3AFIA 4J07A 1HLDA 4I4LA 2YI8A 1ZH4A 4BBPA 1KJQA 4H3VA 1Y9AA 4LA4A 1R5BA 3G0IA 3M1IA 1YJBA 1HDEA 4TTIA 3V7NA 2POQX 4MEAA 1GAWA 1YE8A 3N8HA 1WSWA 2D2XA 3LY7A 3ILHA 1JV2B 3CGWA 1Z0SA 5KNBA 4JSTA 4I1YA 3CR3C 3D6VA 1JQAA 1SC6A 4KG7A 1Q0RA 4OHXA 3TNYA 4E21A 4FM0A 3ZK7A 5DHAA 3GFGA 3QLTA 4HDKB 4F12A 1T34A 4YBZA 2JDID 2W6JG 3IE1A 3VSAA 1HFJA 3ESZA 1ML3A 4NECA 4NZYA 2JLRA 1H85A 4M0EA 2C57A 3KWLA 2JD1A 4YN3A 2OWOA 3I01M 1MQ8B 4WBNF 3GLRA 4ND8A 5ESDA 3BD9A 2YC2C 4JZGA 4GLLA 1JALA 2JATA 3AEQA 2IYXA 5H4GA 2WV7A 2YQ4A 2HD4A 2WJVA 3ABSB 1NVEA 3LW7A 2PD6A 2F4VO 4CQJA 2LD4A 3WYAA 4OQXA 1DC6A 1Q2UA 3ZE2B 4L5BA 4C4XA 1GM9A 3WIEA 3FLMA 2QMEA 3GJ0A 5LHHA 1VLMA 2PZKA 2W7TA 4GOND 1T5TA 2M7WA 1KQNA 4Q48A 4AUMA 2QN1A 5AKGA 4BEVA 4H6PA 5KJ1A 2QWNB 2FDCA 3QU5A 1A5TA 3D4NA 2YS7A 3CA8A 2G8LA 1O87A 2W0XA 2W6ID 3NORA 3DCNA 3V9PA 3WL4A 2QL9A 4IIJB 3PNYA 1PU2A 3ONWA 2WT9A 3P5BA 3FB5C 2OK8A 2Y6UA 4PO8A 5IK2A 3I9FA 1OLOA 4KFCA 3R3SA 3OT4A 3O47A 4QJ4A 2RB5A 3T7DA 1FJGB 3EQ9A 3VV2A 3VNQA 4HTAA 1HDCA 3G2PA 4K46A 4LOJA 3F73A 3QJYA 4PA4A 4PINA 4CF3A 1N25A 2GA8A 3M49A 1SHZA 3UT5A 2J3LA 1L7EA 1B8NA 2AEFA 4JQOA 2P4EA 3DEJA 3WL6A 3DE5X 2PGNA 4YTEA 2XRMA 5IYDO 1AA6A 4OX9Y 1E3SA 3APQA 3JPYA 2Y0EA 1IQ0A 3F8TA 3W1VA 4JQCA 1SCAA 2GPYA 5HA5A 3GO4A 2OV1A 4AQYO 3ONEA 1H1LA 1AB3A 2W8BA 2BMWA 2QUJA 3I23A 1V8DA 621PA 2HIHA 1YUBA 2COEA 2I4MA 4EITA 4OX9O 2Z9BA 2VJBA 3H11A 5KSWB 3U4AA 1O4VA 3T5GA 3TL6A 2YZ7A 2XNDG 3F2VA 5E9QA 4KWTA 4LY6A 2JIZA 2CYAA 5J1SB 2ZM6B 3SKVA 4CRWB 3TB4A 5DBOA 1UH5A 3F3MA 1R6BX 3I2KA 5FNVF 5K8LA 2RGRA 2F00A 3GNQA 3ZYZA 3RFRA 3DMFA 1XKTA 5F9MA 2VJYA 2VWGA 3I4FA 4DRXA 4IX1A 5HF5A 1GGJA 5D51S 1KMCA 2PT9A 2FP3A 2QMQA 2OO5A 2AZ4A 4ETNA 1TRKA 1G6OA 3D36C 5JXIA 2HWKA 3JW8A 4XYEA 1RM4A 4XFKA 2FPLA 5U4XA 2JJMA 1C0PA 3KYDB 1S2LA 4C0SA 1FRQA 2IY9A 3GRFA 2VXCA 3T52A 1TECE 4A2PA 3NHRA 3RTAA 4JD5A 5J9FA 2G0AA 3DEHA 3CCJV 3BSSA 4D9JA 4C7OA 3UK7A 4C9BA 2DHCA 5E6UB 1OB2A 1AI6A 4ZZ1A 5JVDA 5KC8A 2BE9A 4H7KA 2W2KB 4ENQA 4B4VA 2EDAA 4P9OA 3HWSA 1SQFA 4RQUA 3PJSK 4BX0A 3DLTA 1J1UA 3LX4A 5KJ6A 3CQ9A 3L01A 3KZOA 4C4PA 2GSDA 2OGSA 5BW4A 4WJZA 4N01A 3LNTA 3WL5A 3GVMA 2V0NA 1E3WA 4HVAA 4YB8A 4PIPA 4I5IA 1V48A 3ZWCA 4FEYA 1L6IA 4H27A 1QC5A 4GDFA 1FRZA 2FZKA 3PNQA 2A3RA 5E0KB 3DP7A 1H8EA 2EP8A 1CR6A 4KXYA 1G3QA 2D1FA 4F6EA 4WZZA 1FVFA 3P2EA 2OP0A 2QY6A 1JU3A 2LQTA 5JS2A 3KXLA 3K73O 4Z53A 2ORYA 1V3TA 3GYGA 1ZGGA 1H2GA 2PSFA 1AK1A 1ACLA 4AJEA 4DY4A 2KHZA 4LXGA 1T3SA 1K7DA 1J9GA 2C2XA 4BIZA 2B6HA 2IF2A 4R84A 1EP1B 3QUQA 4YEDA 4H31A 2BSXA 4EKIA 4PELA 3C3YA 1IPEA 4TKZA 5BV7A 1WMFA 2ZQYA 2GM5A 4IR7A 4WK2B 3H1TA 4NVRA 3GMTA 2BSQA 4IQGA 3WA6A 1HSZA 4IBOA 4ZGWA 3C5VA 5K4AA 3CUKA 4S2UA 2RHWA 4E70A 2FWJA 5FHRA 4GLOA 1TYCA 3G23A 1P4JA 2IKQA 4DR4B 1E6LA 1T2UA 4ZU1X 1Y5NA 1LEHA 4JTCB 5FPPA 1N2IA 3OLWA 5HIIA 5DT9A 1X13A 2QLJA 3GEDA 2EBWA 1I8TA 1J2TA 3AOEA 4G8DA 3BORA 3UAXA 3ONVA 2IUEA 3MBOA 3FNIA 4XDHA 1M8FA 5AIBA 3ROKA 1Q81W 4MGHA 3INTA 4D3XA 2QAGB 1E7QA 2QGZA 3FB1A 3PQ2A 4EVQA 4LSWA 3LLMA 4IDOA 4JVLA 3MMPA 3TVYA 2Q5ZA 3IP3A 3FVTA 1A32A 2XYRA 5A4DA 2HK9A 3QYJA 4PZDA 1MJ5A 4DV0B 3K5NA 1TO6A 3WA7A 1Y6XA 1Z3CA 1Q0PA 1NWCA 2IP4A 2H6EA 3WKDA 2CFOA 4XR4A 1BDIA 3SVLA 2M6RA 4MVJI 5B66Z 4QUHA 4CUZA 1M2GA 2QYHA 3QW4B 1IY2A 4RL6A 2WWGA 4BIIA 1ZGAA 1XEWY 4YJFB 1PI3A 1QJ4A 3F6YA 4E5MA 1AS3A 4M9RA 2KKWA 5AYVA 1P1RA 1IZYA 3THRA 1FQOA 1KZGB 1TLFA 3KKQA 2O5CA 2FMUA 2IHBA 3PGMA 1H6BA 3DFKA 3AUSA 4R41A 2FP4A 3GWGA 4RACA 5CLHA 2DFVA 1E1NA 2RAUA 3PUIA 1CP9A 4J6EA 4R40A 4GMFA 1B4DA 2H1WA 4P36A 3AQ4A 3E05A 5JH7B 5K0EA 1F6DA 4F1WA 4H1WA 2OC9A 2XCUA 3KKYA 4M0FA 1I7QB 5DK6A 4B6FA 4XIJA 1GPLA 4AJPA 2ZRKA 3LC0A 5EJAA 3P2IA 5BYKA 2J07A 4YAEA 2AJ8A 2XUGA 4F72A 1US8A 4JF3A 1KR5A 1Z5NA 2D5AA 4WAUA 2XPCA 2LFRA 3AR3A 5MHTA 4DRZA 1DC4A 3MOSA 3WLNA 2GBLA 4X6LA 4C06A 3JWPA 3H01A 2PUWA 4LFCO 2Q4TA 4MMZB 4OV6B 3BD6A 3ECSA 2OCKA 2ZQ5A 5JCOA 4OXRA 2ZT7A 5DGCA 2C3OA 2CDAA 1B06A 4ZKDA 1M2VA 1DQRA 1UR5A 1EESA 5IJXA 1CZRA 1FDSA 2W58A 4C7JA 4YMWA 1E96A 2WE8A 3WRXC 3KVNA 5JAMA 5AXCA 2GCNA 4M49A 1LDNA 2J5QA 1KYQA 3X1DA 3TEMA 3ZCUA 4CM5A 4QX6A 4OTZA 4ZZ2A 1DZ3A 4AY6A 3UWOA 1Y3CE 3ZDFA 3GT7A 1NN3A 3MWJA 4JJ8A 4N6NA 3FDXA 3I1YA 5CD9A 4BUZA 2R79A 4RF4A 1MDBA 4J1SA 3M4NA 1PF7E 4RKEA 3DZ8A 3OD4A 5AVJA 1QKIA 2K6GA 3WMWA 1W7AA 5A9RA 4JKYA 4W9RA 4MI3A 2VYCA 3BSWA 3C4QA 3QP9A 3BKXA 1AV6A 1T43A 4ITRC 3RVSA 5I4IA 5CA0A 3QVGA 4X92A 1Q1ZA 3LYHA 5AUQA 3S2SA 1A69A 2D7JA 2GKSA 4E5SA 4CL8A 1C8VB 3QHAA 4C29A 3EGOA 5DYWA 2NOAA 1C7ZA 3WJ1A 3K06A 1A7JA 2Y3IA 1QYVA 2Z3VA 3AKYA 4N3BA 3A0HZ 3SS7X 1JQBA 3VDQA 3IPAA 3CLSC 3BQ9A 4RF2A 4LHVA 5LJIA 4HZUA 5AW6A 4CDGA 5H5JA 5AI0A 2IV2X 5ITVA 2GBCA 3CXUA 3WL8A 1U5BA 1XAIA 3ZGNA 1W4AA 2QTLA 3ICQB 2IS6A 1YB5A 4R6ZA 4IDFA 1EUDA 3HJUA 4U7HA 3LDFA 2YRFA 4C0AC 4QYMA 5CB4A 4HDMB 3P2KA 1Q91A 4ND3A 4PYRA 3K9AA 2B99A 1C8KA 3CVJA 2A1TR 4NV0A 3W9UA 3AV3A 3H3XA 2HDOA 4GBJA 3K1AA 4GD3Q 4LI3X 1KU0A 4IQ4A 4LJ4A 4GDMA 3GVCA 1T0BA 4U2GA 4CLOA 1XCMA 4LYEA 2AXQA 4Q5IA 1NFRA 4ESEA 3B1XA 2X2FA 2WLLB 4M1EA 2GN4A 1KNQA 4G2TA 2DQ4A 2HU5A 2N04A