3WB2A

Hcgb from methanocaldococcus jannaschii in complex with the guanylyl-pyridinol product in a model reaction of [fe]-hydrogenase cofactor biosynthesis
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
160
structure length
160
Chain Sequence
VVMEEIIKKAFIESINNIRRGDKEEELKKIQEKIVNAKKIVVATNNQKKFKVIRDIMLRVCNAEIKMLDIDTRFADLTRMPALTKGLIALDIEKADLYIARGRLGAPGSGSMLVILDEKGRVLTASLSPSSVIHKEDIEERIKKELIEALSRIGISILEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the HcgB enzyme in [Fe]-hydrogenase-cofactor biosynthesis.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Uncharacterized protein MJ0488
total genus 55
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3wb2A01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 3wb2A02
1IWBB 3WB0A 2F1MA 1DIOB 5D5PA 3BRCA 4L8JA 1UC4B 1EGVB 2D0PB 4DK0A 2D0OB 1RSOA 1T5EA 5JJEB 2F95B 5JJJB 2F93B 5JJNB 3AUJB 4GYCB 1IWPB 1EGMB 3WB2A 3WB1A 3LNNA 1EEXB 1NBWB 5D5QA 1MMFB 1H2SB 4DK1A 1UC5B 2V4DA 1VF7A
chains in the Genus database with same CATH superfamily
2ZPAA 4QXOA 1SXJE 2AUNA 4QUIA 3T5CA 3AH8A 4I1VA 3VNRA 3KQKA 3HG7A 1J99A 1QBKC 3MT9A 5F1OA 3F7OA 4ZREA 1D2HA 1KBOA 2XJ9A 3JQ8A 4RD0A 3VPBA 4RLSA 5DVZA 3LYUA 4LMBA 4ZHSA 2D1TA 1JQDA 2X58A 3GRAA 1E7WA 2JGIA 1W581 2WT9A 3JQAD 4QYWA 1BE1A 2PMFA 4XVRA 3DZFA 1JWBB 2P3SA 1T0BA 3PNYA 5FUVA 3WQBA 2ZRHA 3ZJYA 4DC1A 3JQFA 2P22C 1R0KA 4QUJA 4E11A 4MS3A 1I5XA 2UXDB 1BX0A 1A27A 1YRQA 2OEPA 2PRSA 4HDSA 1G2QA 3KJXA 4IMJB 4L3WA 5G0SA 4L07A 3RRMA 3S7ZA 3WG9A 1ORVA 4AW9A 2GZ2A 2P0YA 4E21A 1C9YA 4MW4A 3B70A 2UUAB 2ZRLA 3MLEA 2XTJA 3FSGA 3P45A 1YK1A 3E7PA 1WY5A 4JLWA 3ZHCA 4GF5A 4IO1A 1YJ9V 1LRJA 1PR5A 2CJPA 3C7DB 1H2GA 4N9QA 5ECYA 2HJRA 3UV6A 3KJEA 3VBCA 4DM3A 3GELA 3ZMSA 4ND5A 2O8VA 3FOAA 2A9QA 3QY9A 2DBYA 4L74A 5AESA 3GOQA 1JMKC 3N0WA 3PGLA 2AZDA 2RG1A 1C7EA 1JVSA 2HHLA 2XGGA 4FKBA 3E9RA 1XJQA 4UPDA 1KO5A 2VUHB 3M4ZA 1C80A 1NT4A 4KV7A 2WQ7A 3EW9A 4G5XA 1H5QA 2FB5A 4H7HA 2GT1A 3OMIB 5CEJA 3H99A 3LPCA 3OAAD 4Y1EA 3DFIA 3WGQA 2C9DA 2EGUA 1KHTA 2ID9A 2R84A 4WBXC 4Z6KA 9ATCA 3EAGA 4PZ0A 5FWYA 5KTSA 4X97A 2YVUA 1A5ZA 4OYRA 4CF6A 1JECA 2FN8A 2VT2A 4NEHB 3SQOA 1K8YB 5SV2A 1TRHA 3WI7A 4KFRA 3GRUA 3C6MA 1LVGA 2GUWA 5EESA 3HB3B 5BSGA 1SQ0A 3WGIA 4YUVA 4DA6A 3CR7A 4MB2A 4PLYA 1BGYH 1FD9A 4GIBA 2C04A 4HEHA 2PRYA 3TZQA 4EPTA 3UMVA 5B7NA 5KOIA 1UM9B 2IVFA 3AHIA 1DRWA 3BD7A 2A88A 5D86A 1WS6A 2OZEA 4YQEA 2JGDB 3Q6IA 5LWQA 4G1VA 4DDTA 2Q6TA 2QJRA 1ZMTA 2OXTA 1IOWA 2NZJA 1YR3A 3M6WA 1FNCA 3R76A 4KK4A 1ZD8A 3OP4A 3C24A 5KUKA 1CZKA 4KBGA 1OBFO 1JIIA 1NLUA 1QK4A 2DQKA 3Q6NA 1Z29A 4QXQA 4ZHQF 2O8EA 2JL1A 2QDKA 2ONJA 3DXRB 1AGNA 5FL7D 4L3OA 1GFWA 2O14A 4N7JA 1OPRA 1RI3A 3ZLVA 3W7SA 2R3SA 1JJ7A 1L5QA 1NJ1A 1KJ8A 2HF7A 2C4HA 5L3CA 1YZFA 3F8SA 3I2HA 3EBLA 3M5WA 3A32A 4P54A 3D4LA 4RTNA 4V0ME 3JQBC 4Z4EA 3HUFA 1JE1A 2W6JA 4BQQA 1YH3A 2QGFA 5EHQA 3SOPA 5JANA 4QXPA 1SU6A 1ZXXA 1JFVA 3DCJA 3H8SA 4Q1CA 3ZE6A 1KEEA 1DUVG 2C2OA 2VQDA 3EEYA 4HQOA 3VBEA 4DCCA 1KZ1A 4J1TA 3O3CA 3QTCA 4CMGA 1Q82W 1OX4A 1CQJB 3VSCA 4DBZA 3OR6C 1ZDMA 2JK0A 1ECBA 2PS9A 1PQWA 3V8EA 4CQLB 2AW5A 1GFZA 2NU7B 4HUTA 1TZCA 4FD3A 3RASA 5DT2A 3X1JA 3E22A 3SICE 1CHDA 2R00C 4ARUA 1HOTA 2HA0A 1EXNA 3NFYA 4XTRA 1NI8A 2XUQA 1NF9A 1H0KA 2HQOA 2WJHA 5KWIA 1P5JA 3NBYC 3OZIA 5F3RA 3D8CA 2TYSB 4CTKA 1E3TA 1QCEA 1ADYA 4GKJO 4H77A 3LJKA 4INAA 5KOHA 4AUNA 1B2RA 2H1LA 4DR6B 5ADVA 2GX6A 3P2OA 2YWDA 4I6JA 4QJ5A 2W6ZA 5DLPA 1SQFA 2OBXA 4QODA 2ZIUB 1YZTA 2ZS9A 1ZVVA 1J07A 3KZNA 1A2KC 2VDUE 2XA9A 1YQGA 2ARHA 5IFKA 3NB0A 1QF7A 4RKEA 1H8EA 3O8QA 1THMA 1O8CA 2GHIA 2EJ7A 2NAFA 2VH1A 4QDJA 3A3YA 4IWXA 4ZXPA 4A8TA 2Y69B 2ZE5A 4WDQA 1F0KA 1TU3A 3K5PA 5J2UB 4YT2A 4O08A 1E3SA 5KAIZ 3DDUA 1N0HA 1AF4A 2W6MA 4RZQA 1ZN9A 4PS0A 3CU5A 1DPGA 4LYDA 4RK0A 2PBRA 1JW9B 4O2AB 3LNCA 3V97A 1U3UA 3RVQA 2O19A 5IJ0B 2AUTA 2DUMA 3NUZA 1TD1A 4KITB 3W5BA 2IHJA 3KKNA 3NHRA 4DQKA 2X13A 3FPLA 1WUHS 3PC3A 4J0CA 4XWYA 3SQNA 3NUGA 3QFRA 2QT1A 1M8GA 4DUYO 2BC9A 2JJMA 2Y1DA 3GJ7A 4EJ6A 1DO8A 5I3ZA 5EBWC 1SHTX 4DW8A 1GR1A 2OECA 2HPVA 2WSYB 1I3KA 1PJLA 3IQGX 4DR5O 5LDGA 4WNAB 3PICA 4WF9V 5JISA 1DQPA 1LDMA 2HC9A 1YI0A 1RRFA 3T1CA 4CR8A 4OI0A 3RF7A 1UC5B 4JCCA 4X62B 2ZI3A 1P0MA 5HBRA 3DEZA 1E32A 4P22A 4CWAA 2PR2A 5DGTA 4S1TA 1A4UA 1IDOA 3AU9A 4BYGA 4YV2A 4RHEA 2OV8A 1ICEA 1XA3A 1YV9A 1F06A 2MSDB 2VBGA 2FW6A 4LWOA 4NENB 2P67A 1Q3HA 4RZXA 1XPRA 1QV9A 4A73A 1P62B 2B20A 3AB8A 2MJLA 4AWXA 4KU4A 5KNCA 3PFKA 4FEEA 3LP6A 4F5EA 3ZQ4A 1KVUA 2FEMA 4NH0A 4L8YA 4RPKA 2ZFUA 2RHTA 3THXA 1K3FA 4N0PA 4B3DA 3QFHA 3HYTA 1Q17A 3LX6A 3CPWU 4WA8A 1XAJA 4QULA 4XGQA 3E8FA 5JQGA 3CD6V 3BEDA 4Z0NA 1JFFA 1X15A 5JSZA 1Z3IX 4D3YA 1REQB 4JBLA 3TLGA 3MMXA 4R1PA 4BC1A 4HGPA 3WLTA 1HFWA 1PEYA 4ZQHA 2WILA 1EHYA 4LR3A 1HLFA 4HYQA 4YECA 3VVBA 5LQSA 4DB4A 4XYLA 3AF6A 1T5LA 1K34A 3GBSA 3IXLA 2G8NA 3N7UA 5BPFA 3NKLA 1HE5A 3OQBA 3FPKA 2KLHA 1YA8A 2EZ4A 1J8DA 1AI4A 4J7XA 5IG2A 3F8WA 3C3EA 4FIZA 3L0DA 5KC8A 3DGEA 3UOWA 1Y6GA 1UXHA 3IA2A 3ADDA 3PYMA 2GAIA 5BN3A 3B1FA 3GAMA 1R0LA 5FPKA 3R41A 4K26A 1QQCA 4MV1A 5L3ZA 2VK1A 2JK1A 1E96A 4KV9A 2RB4A 1U3VA 3H4MA 4P58A 3DB1A 4GOJA 3R7WB 2JVKA 3K2EA 3QSYA 4M0KA 1FFGA 4YCLA 5CP8A 4YJ2A 1ZGBA 1KKMA 3R75A 5BR8O 1DHTA 3S2FA 1N1MA 1CR6A 1O94C 1SHLA 4Z51A 4XIFA 4E03A 5B58C 1K75A 1O6FA 4C7OB 1EBBA 1EP3B 4MVQA 2YX1A 4FMDF 2W2LD 2WLTA 3MWGA 4RETA 4LNHA 5KREA 1YIJV 2RGXA 5KNBA 1QP4A 4Y6OA 4BBAA 5C8DA 1I0HA 4I9QA 2QZJA 1ODIA 1O95D 3DEYX 4M83A 4O4IF 1KOLA 2VH5R 4PIMA 3ASOB 4KXYA 4JYMA 5JH7F 1E94E 4IRUB 1LK0A 2VNJA 3HFJA 4TSRA 2FW0A 1W19A 3WC4A 3DPIA 5COAA 5CX1B 3H5NA 1EJ2A 2C4WA 4LOIA 3ZCSA 3PWTA 4BP1A 1K8QA 2VWKA 3IE0A 4M21A 4PHTA 3RSFA 5HR5A 1K8AW 4R51A 2HK8A 4ZO7A 2OCGA 4MVCA 2ON6A 1DI0A 2FQXA 4MZXA 4NDZA 4Z53A 3WNCA 4OSPA 4A6PA 1AV6A 4GDMA 3ETNA 3DW3X 2ISSD 4KQEA 4OI4A 3O5AA 3CS3A 5DW3A 5LB4A 1SPBS 4M46A 4RQBA 3VR3D 3WDSA 4N0EA 4XQEA 5FP0A 2R6R1 1DJQA 1TQ2A 1M74A 1U3GA 4AG6A 4FLYA 4BNXA 1WVIA 4PSVA 3BVPA 1GGEA 2CVQA 3IAXA 5JPCA 3MWDA 3R2JA 1CR1A 1K88A 1HZJA 3LKZA 4BPBA 2VQEO 5K3AA 1OR8A 1E2BA 2HHHO 1XEXB 2R86A 1N6RA 4PW0A 3H5RA 4RQUA 4C6HA 1ABFA 1SXIA 3CGWA 4FYKA 4H1TA 5ALEA 4C7MA 1IATA 3KQMA 4FLZA 1J5EO 4QTTB 3EXHB 2A9VA 1R74A 2J8ZA 3KEQA 3EF1A 3OZRA 4MV4A 1MFZA 1P4SA 3JQAA 1GPAA 3BA1A 3WK6A 1JSZA 1WNSA 4MRVA 5EINA 1IBKB 3HK2A 5KTKA 1OI7A 3V2GA 1GQSA 3SFZA 2CUGA 4RTQA 1K73W 1ZRMA 4OK3A 2XRZA 1UIMA 3CE9A 5CDFA 2EJBA 2ZXUA 1CQWA 5DT9A 4POAA 4BCCA 4KRFA 1DC8A 1ZG3A 1L4YA 2WA2A 3ABQB 1WLEA 1A2QA 3ZXSA 1QRSA 1Q3TA 3DHYA 2IUSA 3MTDA 4FILA 5TS3A 4A6XA 3I55V 3E8XA 1TJPB 1NX9A 2FUNB 1P8AA 3D6FA 3NOOA 1CP9A 4QNRA 4BO7A 2YUAA 1SC3A 1L6RA 1NXOA 3CCFA 4AO7A 4DW0A 1AO3A 2Q5IA 3PDWA 2CFCA 4IVQA 4R98A 3DBLA 2MYPA 3FNRA 3OA2A 4HUQA 3RQIA 3VSEA 4J2HA 5F1YA 4HHEA 9ABPA 4GPD1 4FOTA 4AJKA 3AVVA 1M76A 4FCCA 2E5LO 4KXLA 4EYOA 3DAHA 2FUEA 3FB1A 4WCFA 4FFPA 5ED4A 1GWNA 3C3DA 1SIUA 1XCGB 2WYHA 2XRFA 1YCDA 3EOBI 3GLKA 2R7AA 3W34A 3FSGD 5LKRA 1WW3A 2EKLA 3V6LA 1DEOA 4M54A 2X9GA 1A7UA 4QJBA 2I1WA 1LLDA 3UJBA 1QCDA 4ER5A 4IDEA 3TAXA 2LP7A 2GAFA 2YINC 3K5LA 1LD3A 4GYCB 2ONYA 2WAAA 1FK8A 5KJFA 5H6RA 2V97A 2P40A 4YCDA 1LU9A 4J10A 1OWOA 1BJRE 2G1UA 1VMGA 3NHKA 4MAAA 4PO3X 5AVOA 1N32O 2V7WA 2WHXA 4K2HA 4YI5A 4DK1A 4FWTA 3K09A 1SD2A 1SVSA 3HI4A 4RIGA 2YI9A 1DJPA 1OZFA 2Q3HA 1WNFA 4KO4S 1LX6A 3KLPX 4NZ9A 1KYOF 1MJHA 3EXFB 3SEAA 3RC9A 1O5TA 5C7IO 1NI4A 2B1GA 1E7YA 3G9XA 3ZWNA 4TKUB 1GUYA 1N9GB 4JTDB 3SPGA 3N76A 4NK5A 4DQLA 3KZOA 4GSLA 3X2QC 1LLUA 4R2JA 4JX8A 5C9ZA 3U1BA 1M9NA 2XWPA 3ZIAD 3INNA 3UO8B 3QV2A 2DW4A 3K5OA 3WGYA 1N36B 1ISJA 1SIWA 3WX0A 4DCJA 2RGWA 3WB1A 2CNKA 1KO4A 4N8DA 3SNHA 4JI8O 3EPPA 3ZHZA 1KAMA 1KI3A 1SZCA 2FZEA 2ET6A 2G67A 3EXHC 2QD2A 1UBSB 4LBWA 4QXAA 3SJUA 2Q8NA 1D9XA 5GVRA 4OH1A 5JCPA 4LXTA 5LGUA 3QG5A 2UV8A 3MN1A 1RTKA 4NE7A 3L6BA 1GFIA 2R6FA 4M0EA 2ZJ5A 2JLSA 1SY7A 4E09A 2VSFA 3I5YA 1G6UA 2HH9A 2RN9A 3IIJA 2BEKA 2MSCB 2QQ0A 3QU4A 4LQDA 3DE5X 4BLUA 2WWRA 1T2AA 4EEKA 4N9WA 4BCDA 4E46A 3SDLA 2QEXV 3D2LA 3Q41A 3B2EE 1PG2A 4LUCA 4KPFC 2QRJA 1YCHA 2YV4A 3GUVA 1YVPA 5JBQA 1KDTA 1U98A 2YYYA 2AC4A 2AFHE 4YUYA 4MTXA 5IAOA 3N70A 4DREA 4UVBA 1UK6A 2X14A 3LCCA 4IZOA 1WW8A 3I6IA 2VZ8A 1NW9B 1OFTA 3CVVA 1FUEA 3G2JA 3U7RA 4EA9A 1VQ5V 2CKDA 1GLGA 1XRPA 2OAQ1 3IEIA 2OCCB 1KZ7B 1FSGA 1JR9A 1NBMA 4YMHA 1P33A 4WK6A 4IZHA 2WYWA 2VXBA 3PPVA 5ICMA 5FJIA 1M56C 2I7DA 3WYBA 2R11A 4O33A 4I55F 2JH3A 1ENZA 2I6UA 3R9IA 4AROA 1M34B 3ST7A 2HSZA 3LUKA 3UWKA 1XOIA 2XA1A 4KO8A 3IUPA 3ND8A 1LPNA 2Q3DA 4O0LA 4PZPA 1NJFA 5T8KC 3K4HA 1OWLA 2LV8A 1U8XX 1XJWA 1QYRA 4GMHA 1NU8A 4PFKA 2QSYA 4TSFG 2O5EA 1QQ7A 2DM6A 1JAZA 3F5SA 5SY6A 2HWWA 1G5FA 5EE5B 1VF5B 3ZN1A 3F46A 4N54A 1A9XA 1WPRA 2PT6A 3U0ZA 3HN2A 4BIIA 3D0KA 3KJHA 4F11A 2JZCA 5EUCA 5K6AA 2DR2A 3LFUA 3W7UA 4ZAGA 2IIPA 3D5TA 3LA8A 4EI9A 1V2HE 1PGPA 2N42A 4UM7A 4OBXA 4UU8A 3U5ZB 1LBHA 5E9QA 3U0VA 3VYRB 5IVIA 4QGSA 4QJFB 3LP8A 4D4HA 2XVAA 2EX3A 5H9WA 4EBBA 2GKGA 3AM1A 3AF2A 1KB9F 4MP3A 2O52A 1F5SA 5G41A 3I0ZA 2XNCA 1JDNA 4HGQA 2HLDG 2VZEA 1BSMA 4QFDA 5D6OA 1JIXA 4ZV7A 1JDUA 4A0RA 5TX7A 3ZGXA 5B3JC 2P6RA 1SOUA 2X6QA 2PJRA 2QEQA 2NM0A 3T8YA 4KC0A 4YRCA 2V1UA 3M7MX 1JFFB 1QIGA 4G8JA 4H3HB 2LXNA 3D6TB 1UJBA 2VP3A 4QQRA 3VVLA 4YT4A 1K5SA 1YQQA 3HCAA 3TPCA 1CZNA 4JJIA 2EATA 2VAMA 1DEHA 3GO4A 1YQTA 4PPQA 1I0LA 1CVRA 2C2MA 2CYCA 3HUEA 1ZK3A 2VP6A 2YRFA 4GR9A 4Z1MA 1BE8A 2Z2KA 1I4DD 1KI6A 4CFYA 1N36O 2PGXA 2PL3A 4YGYA 5M34A 3VPDA 4CC6A 3EF3A 1AF7A 1PSDA 2WJAA 5D2CA 4DQVA 4WECA 5JXGA 1FRFS 2E76B 1N34O 3M7IA 3IA7A 2B2CA 4LYGA 1YS9A 1UAYA 1JZTA 2ZEJA 2Q2VA 3G7NA 4KR9A 3ZLBA 1SUCA 1OH8A 3ZWQA 1POWA 1YGPA 2WFLB 4WCEV 2WWVD 4C0BA 4GYKA 4AQYB 5IWAB 2KG7A 1J7KA 5DK4A 2Y77A 3TXYA 4DUGA 1AI5A 3HRHA 3NALA 1SBZA 2BKLA 1ODJA 2XKAA 4UMVA 3AY3A 4BO2A 1JKFA 4IF6A 1Z0FA 3FGOA 2SNIE 4ROSA 1DJOA 5BUCA 2I91A 3KEMA 2MSNA 2XAUA 5CVVA 2OL4A 4HJRA 1TC1A 5DN6G 1YQUA 1YB7A 3GB9A 3KT0A 3D2BA 4P9NA 5DWVA 2H07A 2H3OA 3TI7A 4KCGA 3MCZA 3O1JC 2J3IA 1BQ3A 1MDBA 3PUJA 4P08A 3I42A 2PQ6A 2B0CA 4IS2A 2J9XB 3SYKA 2ZR0A 1PW7A 2AYZA 3KYDB 1E2IA 3MOIA 3PEVA 4LRXA 4ZMSA 1KERA 2VDRB 3QELA 4YP5A 4DLPA 4Y0VA 3UAGA 4I5EA 2G6TA 1EK6A 1TUGA 2NO9A 3V8QA 4JV5B 2GHYA 1KH2A 2G83A 3K5IA 1T25A 2CUZA 2QG6A 2XR1A 2ZIGA 3CEIA 4HB0A 5KAMA 1BIFA 4R01A 3IAHA 1XMVA 2GRAA 3L0YA 2WWFA 1U0RA 5G0WA 4ZZ1A 4JJ6A 4RKWA 3IHLA 3ORSA 2WZQA 4RBNA 4BMVA 4A36A 4EO4A 4FONA 3GBPA 2Z3YA 1DKQA 2PZJA 2HIGA 3KQSA 3OFJA 4Y2QA 2H1FA 1TL7C 2IOFK 1J6UA 3ZCTA 4MQEB 3CCCA 1D07A 1U4NA 1UZAA 3ETJA 1IMOA 3THOA 1OU0A 3TTTA 5JNSA 4K5QA 5MDHA 4OXIA 4NBWA 4ZEOA 4KKXB 1T2NA 2AN1A 5IYCO 3DT8A 4MPDA 1MJ5A 3NI2A 4WASA 4LZZA 5ECDA 5HP4A 5FWXB 5F7OA 4BWYA 5LU9A 4JQCA 2YFHA 5KBYA 2IYPA 4C7XA 4P7JA 3TDNA 4EUNA 5D8DA 1TUEA 5AXCA 5CW2A 3VC2A 2Y0IA 1UBNA 5IY5C 4BUCA 1ZJZA 3D6NB 3PQCA 4DUZO 3N39C 1YJBA 3EZYA 5FH9A 3ONFA 5AJTA 2NSLA 2BJVA 1Z8FA 2XVZA 4UBJA 1ESZA 3PFCA 4U0JA 1DWOA 4EFKA 1D9ZA 2G3YA 3MTEA 3BAFA 3SPCA 1F0NA 1SG6A 1T4GA 2ZREA 3OC0A 3T1HB 2V7VA 4L78A 1NVEA 1E89A 2LP4Y 5KYUB 1VXRA 3DYVA 2GLXA 2H1WA 4FX2A 3EB9A 1QRUA 3AYZB 3NEPX 1LQTA 4MVJA 5TSDA 3TB6A 3WO0A 2YEVB 4FEGA 2QR5A 3VOSA 2HFKA 1MJGA 2H4WA 2BUAA 2BF7A 1YJNV 3KKMA 2FWRA 2GNOA 1MQ8B 3MUEA 1YZKA 1C9JA 4G65A 1JU4A 1VDZA 1Y42X 4K0RA 3WL3A 1K3TA 3SYTA 5LOVB 5DMXA 3CWBH 1RM5A 1BGXT 1KY3A 2A9OA 5BOSB 2CNBA 2JJ1A 3H4VA 4RVOA 2ZIMA 3RIMA 1K4MA 2XUPA 4IJ6A 4INJA 5AO9A 5KVVA 3LBAA 3BXFA 3CLVA 1CY6A 2YWBA 3QX8A 2AZTA 5BR8B 1HT0A 1Z0JA 4QGHA 1ZNZA 2J3KA 1FVFA 3I34X 3OMNB 5IDJA 2P5TB 1YIDA 2TMGA 3NJ4A 4PHCA 1E5QA 4Q9IA 2EIMB 4ZOLB 1KIAA 3C41J 3TW4A 1SQVH 5MN6A 3VDRA 3I92A 4KNYA 3A2KA 2W5UA 3OQOA 1YB5A 1CS0A 2RHOA 3QNUA 4AZSA 4D0GA 4Z9FA 4NI5A 1TU0A 2AEEA 2FEPA 1YVUA 5G4LA 3AHFA 1YZ3A 1NUHA 1UJ2A 1WZCA 3G1WA 3K9NA 4L1KA 1NTKH 4WKNA 3AT1A 1YHQV 3UQZA 4BFCA 3UMYA 1ETHA 1QV6A 3OLCX 1J1UA 5LQJA 2KG7B 4GRAA 4MB6A 2EIMC 1PQUA 2QHXA 5LD2B 2X9NA 3OD1A 1X9IA 2OCAA 1YE8A 2C92A 1KDVA 4HAIA 1V8FA 4RKRA 1C9NA 2WINI 3LC2O 4KVAA 5C4GB 5CLFA 5F7XA 3E23A 3WKEA 4M0MA 3ESQA 4ZOBA 4IXDA 1SKYE 1WSWA 2P2CA 4JQSA 3LQQA 5ADHA 1PBTA 4KE8A 4II7A 2UYHA 2YSUB 1DB3A 2JLZA 2ZUFA 2ZSIA 1VECA 1GN9A 3G9UA 3LF2A 3UUEA 4MV9A 4WXMA 4LH6A 1U6IA 2YYZA 3FR8A 2NVOA 1O89A 4NRDA 1OX5A 2UDPA 2VPYA 4PYQA 4TMXA 4BX8A 1J0AA 4EGJA 3IP5A 4Z7OB 1QH1B 3DTTA 1A5AB 3B6ZA 1JZSA 1PS8A 3G8CA 3L6UA 4XJSA 4RAIA 5DYWA 4PHZA 3GVCA 3FUWA 1GRQA 1DE0A 4ZFNA 1U8TA 3HTXA 1S2LA 4Z1MG 2C4UA 3QX7A 3VKHA 3AG6A 3WGVA 1A5TA 2XMRA 5C3MA 1A7KA 1MQSA 3X3HA 4FM1A 3PWSA 4NXNB 2FPXA 2O2JA 2XYVA 3IFSA 2E7ZA 3OWOA 2WHQA 2VDMB 3HJHA 2WG0A 3GLGA 2PX5A 2BHLA 4OCZA 1MO4A 5HEKA 4EFLA 4ZCMA 2IK8A 2XY4A 4OFWA 4UU1A 6NULA 1Z28A 5JCZA 5B12A 2X0DA 3PXBA 1WXFA 4CT0A 2Q6VA 2IBTA 2PUHA 1I0IA 2AE1A 4KQ9A 1TRKA 5AVKA 4II3A 1GH6A 3Q8WA 1PZXA 1DMSA 2HSEA 4W9MC 4OTZA 4AAYA 1E20A 2K7ZA 3KFVA 3EK2A 4TL6A 1KJ9A 2R4UA 4J0HA 2CF6A 5CDUA 2B37A 1IJBA 1RAHA 3IOMA 4N6OA 1QXSA 1X74A 3GLFE 3EC7A 1W4AA 4HQ0A 1ONBA 3H2GA 2DT5A 2RJOA 1QH9A 3IPCA 1OXUA 1U11A 3KJFA 2Z2JA 4KNVA 2ACWA 5EJIA 1WJZA 2IZ6A 5LP6B 2P77A 3GR6A 1M0TA 4PBRA 5EXPA 4F7DA 2OCHA 3CQ9A 1RQGA 3GJXC 3W6PA 3G1UA 4OX9O 5K6AC 1NPDA 4PG7A 2DQZA 2V6MA 4LCUC 1HM5A 1PR1A 1NVXQ 3FYUB 4JLDA 3O0DA 2R4QA 2QR4A 3MAGA 4KIUA 4TX1A 4FT4A 2G1KA 4DK0A 2YN2A 4LYEA 2JFGA 4C14A 5IHXA 1Y8ZA 1EUYA 1B2LA 2WPNA 1R4NA 2PGLA 3I5XA 5JZSA 1WAMA 2DHDA 3WIOA 5A1TA 2QP4A 3QVLA 3ADBA 1NBMD 3MCVA 1ZSNA 4X63A 4C4SA 1CY4A 4MR7B 4Z8XA 2IHYA 3C87A 3GP5A 3QLUA 5A4JA 1DCTA 3M3DA 3DXFA 5AOCA 3VR5H 2QZPA 1FZQA 2JJ2A 2EJWA 5L3GA 1VGQA 1X19A 1QLWA 3U1TA 2F55A 4PAGA 1XNHA 2QLMA 3FDIA 2F1MA 1LW7A 1N0WA 4QGGA 5HCUA 4Q18A 4EJ0A 4Q3OA 2H0AA 2X5XA 1DV2A 4HZUA 2OE2A 3HCFA 4YS6A 2NO4A 3W6ZA 2CFTA 2X4LA 5T6MA 1WO8A 1S0VA 2GCIA 3R3ZA 4TQUS 4OP2A 3DDWA 3TE6A 4B87A 4ENVA 5LNK6 1ZL0A 2EX0A 5G1PA 1YEWA 4EB0A 1QKKA 3CYFA 4TSFD 4CS3A 1IBLB 1VYTA 3GJQA 3RVBA 4BWGA 1QIIA 2I6TA 3BD8A 4U2CA 1ZCFA 4JOQA 3WA7A 3GZJA 4D98A 4BKMA 3BILA 1FDRA 3HEBA 5JT1A 1KI6B 3Q5EA 5BO5A 3MZ0A 1H3EA 4TXJA 4BNIA 4FOOA 1BE6A 1FE8A 1RHJA 2EBUA 1KMIZ 1CEQA 4YJFA 4D5EA 1G8GA 2PT5A 3NEJA 3VZSA 3NBQA 4DJDC 4CTMA 4FEAA 1KI4A 3MJCA 3QNWA 2QN7A 1HDYA 5ESWA 2R9RB 3NUQA 1VIVA 1K8XB 3ZVMA 1O77A 3NTLA 3FHLA 1UEXC 5EK0A 1ZH2A 3KJZA 2ETXA 2ZYAA 3JQEA 1R0YA 3TGWA 4BVHA 4QUBA 3BGDA 5A6SB 4TV8A 1JEEA 3CCBA 1EBOA 2ACKA 3INTA 1NW5A 3QE3A 1W7AA 2PKCA 3C70A 3OU7A 3HKBA 2G9UA 1R6XA 3CC7V 4UDXX 2QTMA 3EPJA 1U28C 4MV5A 3L1IA 1DKPA 4PXSA 1EJ6A 3LHKA 4JJAA 4JROA 1R10A 1FJ2A 1BMDA 1CQIA 3K9SA 3HCRA 3VAZA 3QXHA 1L7PA 4C89A 5BQ5A 1KFJB 4EW2A 2J87A 3ROQA 4WXYB 1VBKA 4BGIA 4R8SA 2HWKA 2MINA 3L02A 1U63A 2QL7A 3G7SA 3HV2A 4TTPA 4QGAA 4RK1A 5E4TA 4E5DA 1PVDA 1U7PA 1QTQA 1DAGA 3GRCA 3LXUX 5ELXA 3K58A 1JWAB 2E4AA 2XYRA 2VP5A 3E4DA 3FPGA 5BRJA 1JHXA 1NUQA 4OKSA 4OREX 1RLTA 3BSYA 3MINA 3LLSA 5BN1A 2Y4TA 1X38A 3MXTA 3TD2A 3PHBE 1C1YA 1SO8A 4OKIA 3OMXA 4E5NA 4PC3A 2D13A 5DLQC 5B64A 1EGMB 4WK0B 3JATB 4Y9SA 1E7SA 2ZBGA 2JDIG 4JP5A 4RGBA 3WR5A 2JAXA 3QGMA 3C4JA 4MQEA 2LR0A 3U0BA 2EFDB 1OU4A 1A97A 3ZCRA 4HD8A 2IU3A 1F6WA 4OLBA 1CUSA 2Z0MA 3O6VA 2PWPA 3TD9A 4CN9A 1VE3A 4IJQA 3CIOA 4WZZA 5B57C 2P9HA 3H8WA 3KZVA 4AYWA 1SVNA 2WSIA 1TFUA 2I8CA 2YHUA 1CW2B 5BVGB 4QOHA 3DWIA 3LHSA 3LUHA 3A36A 5A05A 4WQMA 1RRVA 1SKBA 3LOUA 3L9DA 5FADA 4RMIA 3H11A 1H42A 2CJWB 2QVYX 1EX7A 2X1VA 1TTHA 4IJUA 2C5BA 4CMCA 4CRWB 4N3AA 3H5WA 3W8FA 4B3RO 1A8IA 3WRVA 5HGJA 1WZEA 4MRRA 6PFKA 4IAOA 1W6RA 4Z86A 1FQOA 3H4IA 4MR8B 4CL8A 2D00A 1KYTA 5AMXA 4BNNA 3WJ2A 3WWYA 2OTLV 3BXPA 3W1EA 3B82A 3MJTA 3O7WA 1CY2A 1KIMA 2D62A 4X61A 1JLRA 1A8PA 2C7OA 4ZVOA 1GVNB 2ZI5A 3Q0TA 1CE8A 1R64A 2FHPA 1A7AA 3UT6A 1J8YF 4NBSA 3OCZA 4FT2A 1VOTA 1YBMA 3S0JA 4Y6PA 1E6CA 1U0SY 2F4NA 2GBFA 1TJNA 3F96A 4QZVA 4LHYA 1Z36A 1NVPD 4MUYA 3WQQA 3LV8A 5LOVA 2H7VA 4TWRA 3E9DA 3K20A 4HLDA 4J9VA 4URFA 1S02A 4DVGA 4POOA 2CE2X 3AZQA 1IN4A 1HPLA 4PQYA 3HYLA 5F2VO 4R8VA 4M6WA 4J0DA 1QGZA 2IYQA 4BCBA 4EHLA 4K9DA 1NXQA 3AI7A 3KQVA 3V4PB 1RPNA 1K7FB 4GI7A 1ULTA 1W4ZA 4DR2O 4LF4B 4RJTA 1X8KA 4YHHB 1IJKA 3WWPA 3OPYI 4D5GA 5H4GA 3MTGA 3B7WA 4TRRA 4O3MA 2LD4A 4V0SA 2ODWA 1EM8B 2PUWA 1EWTA 1U4SA 3O82A 4FQ5A 1RHQA 2PRJA 3KSUA 4MJ3A 4ER3A 3VSBA 1CUHA 3QPBA 1V3UA 2VZLA 5DTRA 1P4RA 2NIPA 4AP6A 3SNKA 3HCEA 3NTQA 2C5SA 4JWTA 1SKQA 1THTA 2HX1A 2H5EA 4M0LA 4QT0A 3TK1A 2VSNA 1L5SA 1GQQA 2FX2A 3ZV5A 1Q5OA 1LRKA 3LCRA 4OX9B 3EBOA 1CYEA 4O4LB 5E9AA 2AWNA 4NR1A 1BG6A 1G8YA 3CJTA 3F6SA 1V41E 5J5VA 3G6BA 2GEDA 2WOOA 1G7CA 1KYYA 2PJUA 4U2BA 3U60B 5JJLA 1WOYA 5J40A 2ZQZA 4X8HA 4HAXA 1XQWA 2G7MC 4A0SA 1TK2A 1X2EA 3EGEA 3APOA 4E2FA 3DLBA 3GGJA 4EHDA 1GUDA 1AJPA 1QVGU 3DMTC 3UCFA 3CZ4A 3OAAG 3I3OA 5LJLA 2M6SA 1K7DA 3QVKA 5T5QA 3X43A 4RU1A 1QYXA 5JAQA 1T0PA 4ZEXA 1R16A 3CLSC 4QAQA 3T1YO 1EE2A 3R6GA 4MJXA 4O2AF 4CTNA 2A1UB 3RS0A 3D0OA 2WWTA 4FN4A 1E8NA 1AVTA 1P72A 5F3DA 2YFYA 1P61B 4MW5A 4BGEA 3IDQA 2AN4A 3I2YX 2N9UA 5C8YA 3T5BA 3ZD8A 1QIHA 4NWIA 4BHTA 1K33A 5I4CA 1PK7A 2Z9CA 1KC1A 2V0NA 3AFIA 3MLAA 4JXKA 4OQFA 4RDXA 1TDJA 3KTAB 3R24A 4GI3A 4GECA 4OMDA 4XD7A 3VU0A 1TZJA 5DGHA 3VM6A 1C9DB 1YBFA 4NH4A 4ZDWA 3DR3A 5EPOA 5SZJA 3TDMA 3OZXA 1MXHA 2CGNA 3K9FC 5CVJA 2EIJB 3K9AA 3CRZA 1RC0A 4OA5A 2ZJ8A 4XDLA 4R1QA 1VSUA 2KM1A 3HZOA 4C0LA 3UBMA 4HFJA 4DIKA 3Q7SA 2IKSA 1JWLA 5CCBA 4YV7A 3L73H 2BTQA 3K0KA 1L5VA 1U8YA 1ELOA 3RDPA 1NWCA 1NSTA 3E2IA 3I58A 5CB4A 5CU7A 1OFIA 3PI6A 1RWKA 3PNSA 4ZAVA 4O2BF 4EW6A 1I3OA 1A71A 1QGOA 2JAPA 2QE7A 1OJHA 2BEVB 1WNTA 1N57A 4C0SA 1PIWA 5A9SB 5CBKA 5F7ZA 1AV7A 1G4YB 1T3SA 4OUKX 3JS5A 3QXGA 4XLTA 2CHGA 3LDAA 4N01A 5ED0A 1I2AA 4BBPA 3PG5A 4K0KO 3HMKA 1YHYA 1CIJA 4FUTA 5LC1A 4MYTA 3IQHX 3NWJA 3E3LA 1N6IA 4DSNA 2ZIAA 1FX0A 1QU2A 1Z5WA 1KJZA 1LSOA 1UBCA 2IDJA 3U40A 1KGDA 1UPFA 3LY9A 4AJ9A 5H82A 1QR8A 1DU4A 2X6AA 5KA5A 1IM8A 1FTSA 4UCSA 1VLQA 4C5CA 1N2JA 2F1IA 4PCLA 4KB5A 2RFLA 1CE8B 2PWBA 5EQJB 4UB6Z 2R8RA 1GN3A 4J7KA 2ZTLA 3IIIA 4X93A 1P1BA 3HI6A 4LECA 3PN1A 3S2IA 3S2EA 1Z6AA 2E89A 4M88A 3EPLA 4UCWA 5AUPB 1IRIA 1YAJA 1LVUA 3U16A 2O2GA 4HLCA 2QK4A 1SUWA 3B5IA 4MXDA 1BEZA 2N75A 2B2XA 4P33A 4XR4A 3EYAA 1XGKA 2IXFA 5DXAA 4DDWA 3OFKA 2IUFA 3PRHA 3ML1A 4P5DA 4RLFA 5BVHB 821PA 1XZJA 1U8ZA 3I4CA 1Y7TA 3Q2IA 1L6IA 3BEHA 1OT3A 1UXGA 2F67A 2WJYA 3Q2KA 4LXQA 1Y6ZA 2ZJZA 4AT1A 2F43A 5EY5B 4OQNA 3GVHA 2Y1XA 3FAKA 1RM1C 4RKYA 4D9EA 2W0FC 1J49A 1H69A 1U5BB 1SCBA 4Q4AA 1EK1A 1FDWA 2GK6A 3E9EA 3O4IA 1CDZA 4ZVQA 2P1DA 3PENA 4OP1A 5JV5A 2PLAA 4HI0E 3AJ9A 4YV1A 2D3OW 2D0OB 1VP9A 3EOZA 3PA8A 4YAKA 1I13A 3CF4G 3MBKA 3EIOA 1LF0A 1NMEA 3WWDA 4MVMA 1ZYUA 1BDMA 2Y0BA 4MOWA 2Q0QA 4EJSB 2OPHA 3UUWA 2QTNA 1ADBA 4PICA 4RY0A 5KYTA 4WFEA 2J0VA 3A37A 4HAOA 4FI3C 2FPGA 2QXTA 1C7FA 2YUTA 5DGDA 1RYMA 3RIEA 3JX9A 2XUJA 1R27A 3E05A 1YXMA 4K6FA 1MMFB 4EDHA 1MAWA 1ACMA 1CB0A 1ZGJA 4IY1A 3LA6A 2OIGA 1CUYA 3PUWA 4MGHA 3GEIA 2EP7A 4IHQA 3UFXB 4UNPA 3BJMA 4ABYA 1EHIA 2EJVA 5LDDC 2WIBA 2HLPA 3OTGA 5CBGA 1SKUA 3P9KA 3FTQA 2ZRPA 4BUZA 5KKNB 2P6UA 4GE0A 4ZT7A 4MLPA 2XAQA 1Q1AA 2CTRA 3TMKA 3DT9A 5IJXA 1UDAA 4XWKA 1YTFD 3L40A 3ML0A 2VCYA 2YBEA 3QXJA 3U7FB 3FLEA 3ONVA 1Z13A 3B9RA 5HILA 1B74A 4R8CA 2PZLA 5LHHA 1QCYA 1UFVA 3NYIA 1KAOA 1EZ4A 3DGEC 4KI0A 4Y2JA 1OH7A 2D8MA 4EK9A 4JAAA 1A95A 3BB1A 3DBOB 4RUEA 1YVRA 2B1QA 4WNYA 5KPDA 5TPWA 4CU2A 2ZVJA 4E33A 2X0EA 2VF5X 4KDEA 4RJKA 1XV5A 2JDID 4KE9A 4QAJA 3VU3A 1GGMA 3OD5A 5CXQA 1T5IA 3C15C 4RPHA 4JLBA 3TZCA 2IXEA 1OV6A 3IVAA 5AK0A 3IXQA 2AUMA 4MA5A 1QNLA 4OQDA 3CNHA 4CS4A 4PCUA 3CW2A 4OY3A 5B1DA 4F2DA 1K5DA 4L08A 3ZMTA 2RH9B 3QHPA 3U3JA 4FGWA 4MYRA 4N82A 3NONA 5EVCA 3RUCA 4EZBA 4HR7A 1YTLA 1Y34E 3ROZA 1EFVA 1SOVA 1Y5IA 2W6NA 3PR1A 4FFLA 5C0OE 2XXAB 1AJEA 3I9MA 1MEEA 2K1EA 2PJDA 5BSUA 3M34A 1ZITA 1RWPA 2FZ4A 2Q2OA 4FB5A 4K6MA 1Z4OA 2RHHA 4O5OA 1UAGA 3WP0A 1JZQA 2WSLA 4KWHA 4V3CA 3DAOA 2AC2A 2WNSA 2E9SA 1ADFA 4QRHA 221PA 3VHRA 2VOJA 5HM8A 3TH5A 3JWHA 1IBRA 2A94A 1QG4A 2PEYA 1ZHOA 4H4EA 1MH1A 1NRJB 1VQ1A 4B3BA 4X20A 2AZ0A 1LB1B 1VB3A 4PV1B 4RSGA 6GPBA 5HKKD 3EZFA 1NTZH 2X7HA 2VZ9A 1T8YA 4YIPA 1PR9A 2GAAA 2OAEA 2VYND 3LG2A 3TRKA 4LN1A 5AI0A 5ARBA 4XWTA 2R8ZA 3FCSB 4OLHA 2W70A 3V1NA 4F92B 5L40A 5DM0A 2ZCEA 4JT2A 1RLUA 4EW1A 5GJVC 3GUYA 2CJYA 2P30A 5JSQA 2Q6IA 3FFWA 3R0ZA 4N39A 3D8TA 5FKJA 5AW3A 2X7RB 1KJQA 1CR2A 5J3JA 4UE2A 1W59A 1XVVA 2QRUA 3CJHA 4FFBB 1M6WA 4M1KA 5F51A 5THQA 5BSKA 3ZRXA 5KNDH 2UYYA 1T3HA 1E58A 2O3TA 1DAHA 4HWGA 4NPCA 5KNBH 1YMVA 2PWZA 2PX6A 1KDZA 5L3SB 3HM9A 3IQFA 4OHKA 4C0XA 1H93A 3A1NA 1U7ZA 5AFSA 1G1AA 2XV1A 3W3ZB 1MAHA 5LA6B 5HZMA 5FFNA 2DUNA 2ASEA 1U0GA 5IC5A 2ZJBA 2GFHA 2NO7A 4PZYA 2MIIA 4XVHA 3DKVA 2HLHA 4R9UC 1FS0G 5DLEA 3W5UA 1SZDA 5HK9A 8GPBA 3AFHA 5DIFA 2VTDA 3UA3A 4F9EA 3B2NA 1J23A 2ZVQX 4FN5A 1KZYC 4BO9A 3GUCA 4Y2PA 5FLKA 5KWEA 2BKXA 4CKBA 2WI8A 3MWDB 4KN9S 1XL4A 4QSMA 3M81A 4LY9A 2B99A 4JUAA 4JI2O 3DLHA 5CGQB 3NWOA 5JS1A 3II6X 3PC7A 2C8KA 4G2TA 5FT9A 1RBQA 4QBIA 3CV3A 4QU0A 3HB7A 2B1JA 4B3TO 4L4ZA 4CE6A 2BUBA 2ZVPX 1XZAA 3EYWA 5BQPA 1WBDA 5TVKA 3T61A 3HB5X 4G0QA 4W99A 5M04A 2BOCC 4FOLA 1KC8W 4I0WB 1ENYA 4RZ3A 3ZC3A 2GPBA 4C4PA 1NA5A 2QUAA 5D5PA 3WO1A 4H6PA 1OTHA 1HFEL 1OT5A 2XUGA 3T9CA 3B6MA 3CNOA 3H7AA 4MPRA 3FVVA 2QTLA 1L7QA 1LV7A 2VHZA 3SXPA 3K32A 1ZN8A 4IM7A 3EVCA 1QG2A 1Z16A 2AQIA 2EERA 5IZCA 2P6NA 1YF2A 5JJNB 1E4VA 2A7QA 2LWIA 4WRRA 2BFMA 3ZE2B 4BNUA 5A4KA 2ZCJA 4CQMA 1WP8A 4JBHA 1XL6A 1TMKA 2A5DA 3SYQA 3M6VA 2Y67A 1UMCA 2EU8A 2RAUA 1NBWB 3MSXA 1P5FA 4ZRNA 5K0NA 4RTRA 1CS4C 1GPKA 2ZRBA 2IEAA 1YS4A 3OJEA 1YDMA 4FYMA 1CSEE 4EEXA 3CN9A 5CH8A 2JGJA 4DLYA 1COWD 4X71A 2A5FA 3DV9A 1FDIA 1JXAA 4ZOQI 5FHRA 3SPHA 1JU9A 4J42A 1G18A 1ZK1A 2YJ3A 4JB2A 1KAGA 2B30A 1JE0A 2C9ZA 2P9BA 4RHTA 2HU7A 1FZTA 2QTGA 4IVRA 4JT8A 1RU3A 2ZAIA 3R6WA 3D9QX 2WR8A 4AF7A 1JKJB 1E6MA 2MTBA 3G0DA 1R6UA 4ARBA 4ZYUA 3LE8A 4FGLA 3F73A 4DLXA 2OB2A 1ZRHA 2F9MA 5HJ5A 3AEKA 3G82C 5ENDA 2QSUA 3EULA 1GZSA 1VTKA 2AOVA 3PUHA 2RC6A 3W7WA 3ZZNA 3ZS8C 2ZS8A 1XO1A 2DYRB 4LGYA 3CCJV 1UOPA 1VA5A 2OFWA 1P73A 4FX5A 4GMFA 4PU0A 4EF5A 4WBNB 2AKYA 2AX3A 2V6GA 5CT9A 4PZ9A 4BO5A 4CEHB 1OXVA 2PL1A 2V5UA 4ZCQA 1KOGA 3TW6A 4FEYA 1QIFA 3KAPA 1SKVA 5KHIA 2WKWA 3FDJA 2PV7A 4JNCA 2P5UA 3IT1A 3QO7A 4P3NA 4UBOA 4BVJA 3WMEA 3INYA 1ZS9A 2E1PA 2J9YB 2RGDA 4RK7A 1V0JA 2QM4A 4FHDA 1PV0A 3TIXB 1A1SA 1XL1A 2AD5A 3USES 4I9UA 1S3GA 3LK6A 4LK2A 4DCPA 2WVJA 3EGDA 5CIWA 1LS6A 3CTPA 1Q8IA 3QPWA 3EW7A 4CT4B 1GQFA 2WU0A 2PS3A 1PK9A 4J0EA 1EEXB 3KQYA 1OBVA 1ZZEA 4UFOA 2IZZA 3FMGA 5G02A 4BE9A 3WWOA 1R6BX 2ALJA 1U7UA 1FTGA 1VQKV 2FA9A 5J5AA 3I0NA 3SYRA 3EPHA 4AKHA 1GR0A 1IJEA 4K6OA 1KMQA 4GUAA 4RS4A 3W90A 1B42A 4EEZA 1VRWA 1XNJA 4PTYA 2HA6A 2YC0A 2QOEA 4E08A 3ABSB 2ZSHA 3PK0A 4V39A 1EFCA 4Y1GA 5CVTA 1MIHA 2CLSA 2ZBFA 4JGGA 3CX5F 5B7PA 3O74A 4J1QA 1TTPB 3RK1A 3H9GA 1ZC3A 3MWYW 2P0AA 4UJ3A 3OEEA 2XSZD 4PTLA 4FBLA 5DEOA 4BBJA 4BQPA 1SCJA 4EPVA 4C0WA 3I5UA 5MN5A 4XDYA 1EVYA 1P0PA 2C8JA 4MUAA 2WABA 2VPZA 2B34A 3TAHA 4JJ7A 4U2FA 1SQ6A 3GQVA 2ODTX 1Q0UA 1V71A 2CJXA 3FUCA 4LC9A 2FN4A 4YP6A 2ODBA 1O97D 4NBUA 2K9PA 1KYXA 4BLVA 5JNTA 1MTOA 1YO6A 3IB6A 2QD4A 4UDOA 1YR9A 2XGMA 3ABIA 2FP4A 4HYOA 2X4DA 4LSZA 5DKFA 2XAAA 1JEAA 1E66A 4I9FA 4X8AA 3EFBA 3IJ4A 4GQAA 4GRIA 4L2IA 2XZTA 3FUTA 4MQFA 5KTNA 4EY5A 1NDUA 1RWVA 3KP1A 5EJ7A 2B9EA 5KNLA 1V9PA 5FUMA 2PFKA 4G5GA 4YDHB 5AHRA 2VDPB 3D4IA 4CQLA 3A1FA 3A0RB 4WPGA 1L2TA 2LGJA 4RIHA 1Z33A 2H3EA 1JEYB 1Z7BA 2FPPA 5JFOA 1Y9AA 2B5OA 4I5DA 4IICA 4JYZA 2J0UA 1O4WA 2YIDA 4C4TA 4BQFA 1GEGA 2HCJB 4ZTZB 4Y30A 4TT3A 4BFUA 4CN8A 4HGRA 3ZV6A 2Q68A 2BI7A 3I9KA 1XX6A 1QQ5A 3RROA 1TZKA 1C1HA 1NN5A 2DUJA 4JT9A 1CNEA 3NU1A 1S9HA 5M29A 1TK3A 1LTHR 1B43A 3KCXA 3JY6A 3H9CA 3YASA 4FFSA 1E0KA 2IODA 2D2CB 3LX5A 2JFOA 2VJYA 1AQIA 4QE9A 1FDVA 1XZDA 2YWXA 4L7VA 4C21A 1YE5A 4KXXA 1LCIA 5EHZA 3WLHA 3I4FA 5FCDA 3WL8A 3IUJA 5F77A 3ZY2A 3CGGA 1BQ4A 2H4JA 3B5JA 3I2KA 4ML3A 5ITSA 2JCBA 5CRIA 2GJSA 4CNBA 1DSSG 1ZAUA 1PK8A 3RQSA 1TNDA 1JLHA 4RMJA 1S8OA 4H6WA 2GVDC 2VDQB 4WI1A 1NZJA 2C3PA 4B82A 5K6RA 3I9V6 2YJNA 3NR7A 1DUIA 2V7UA 4ILKA 1AUXA 1CTQA 3W0LB 2RGNC 3PNLA 1BEUB 3R23A 4E5MA 3RFVA 4MRMA 1E2NA 4JZKA 4CKCA 4CTJA 5HKOA 5L3EA 1D4AA 1OV9A 4LI0A 4AG5A 4M9XA 3HGTA 2Z4SA 3O8CA 2C2GA 3RE1A 2MYUA 1G6KA 1E7MA 3H9BA 5F5NA 3LLMA 3NQ41 3PNPA 5DNEA 2IXGA 2DHRA 3TR5A 4E1AA 1CLEA 4RTJA 2IYAA 2GEJA 1KWKA 4Z9AA 4H0CA 1KRXA 2RBEA 2YCLA 3FIJA 3NW9A 2YN0A 2HRBA 3QVTA 4BGDA 1BWQA 1TD9A 1BAPA 1TAQA 1ZLYA 3K2BA 5AKEA 5ARDA 1N0NA 1XK7A 3MAAC 3P5SA 1M2EA 2JFUA 4D92A 1Y7IA 3DL2A 3MD9A 3PQ5A 1FEZA 4PPYA 3X2FA 1XG5A 1NVFA 3EVGA 1AROP 3RARA 1AMOA 3U4QB 4DV6B 1RAAA 1BJKA 1SZJG 4HPXB 4TTSA 3AI3A 4E32A 2VP4A 1XA4A 1QWOA 2WZDA 3HR4A 2M6RA 1YCIA 2OT3B 3C6BA 4MVZA 3GROA 2HO4A 2Y9MB 4AJIA 3DDSA 5KTPA 5JAMA 1AGRA 5MGBA 3AM4A 1PKXA 3H1LH 3D02A 2GFQA 1ODTC 1UPTA 4DS3A 2M1XA 3IAS1 3QELB 2I4MA 5FPQA 3FHOA 2GDZA 4BIOA 3KCQA 4NX2A 1VMKA 3A7EA 4QBKA 2ZJFA 1FUKA 4ESHA 3PR3A 4QKQA 4BX9A 3N8NA 3EVDA 1F6BA 1ILEA 3C6YA 1U2TA 3HGMA 2OTJV 3QVSA 4H15A 2A5LA 3I5MA 4H6XA 5KJCA 1NQXA 5KVAA 1II0A 4LWZA 4GWGA 2J33A 4R1LA 1X0XA 1EP1B 2ZTUA 3EUEA 1NNUA 5LXTF 4ZYLA 4BZWA 4Z49A 1L4EA 1O2DA 1ZEMA 3QA9A 4WZBA 1H2RS 2ZAGA 5HS6A 5LLSA 1DGSA 1Z62A 3AR9A 3HDTA 2Q9LA 3KOZA 4M8IA 3TCNA 5A4FS 3ZDEA 3DT6A 1W85B 4L76A 2X76A 3DE3X 4IOMA 2NWQA 3F6YA 3USZA 1RP1A 4ETNA 4CKBB 4BU1A 1U2EA 3IQWA 2FSSA 5KTRA 4Q3EA 4KAJA 1M72A 2JBHA 3IMKA 2H51A 4MGZR 1T5HX 3IAM6 3W79A 1AY0A 4WLNA 1AU9A 2Q0XA 5DTQA 4MNTA 1CF2O 3NAGA 2XHZA 1ODSA 2CGEA 2V5VA 3O1IC 1YL6A 4G5QA 5U4QA 3ZDZB 4C2AA 4UCVA 1THZA 2VJMA 1EQ2A 2GI4A 3G68A 1AR5A 1Q84A 1YJCA 2A0XA 2CMKA 2HAEA 2PA3A 2X6RA 4MWEA 1U1GA 1UBGA 2X9LA 2KB1A 3OECA 2VLBA 3H2KA 4UVHA 2X9QA 2IU0A 5DEIA 3MELA 2MOKA 1Y89A 4ZJUA 5DNUA 4O0MA 2NO5A 1LH0A 3DCYA 5DASA 1GTSA 4XB1A 4RADA 3F1KA 4MCJA 2C2AA 1COWG 2B6NA 2YQ5A 3AUKA 2HJWA 4ZVRA 2ABWA 2REBA 2OHXA 4S1WA 3ANLA 2RONA 3SHVA 1ZPDA 3VSDA 2GTIA 5B1NA 1FRZA 3A28A 4P4LA 3LSYA 2WLNA 1EJ0A 1F60A 1S4QA 1LPAB 2OHOA 1BSVA 4LYYA 1WZ2A 2WICA 3EARA 5TEWA 5EIBD 5J2TB 3AONB 2QRLA 3IV7A 4GPBA 4B6PA 2C95A 5JSUA 3S3TA 4N3GA 5T64A 3W2GA 2FRVA 3L8GA 2C83A 4LG1A 3V9PA 4MW3A 1H4TA 1W73A 3NRJA 5GZ1A 4AKGA 4PEVA 1ECPA 2VRNA 4N5IX 3L1UA 3ZRWB 4U2KA 4M9CA 4DBLE 1QYIA 3A1WA 4NYIR 1DWPA 5C80A 3IFXA 4P4GA 5ALJA 4MYCA 2CHUA 3DPUA 4LA4A 4A2WA 3GLGB 1DO2A 4MLCA 4Q6GA 2IW1A 2OP1A 3S2ZA 5E79Z 1ZOLA 2HOQA 5KOJB 1RYHA 4Q15A 4D26A 2OCXA 4JI7O 3ORYA 1Q6ZA 4R3UC 2B3DA 1ADJA 2P9EA 4MKRA 2O2XA 2BEWA 3FBWA 2VRZA 4D8XA 2BH9A 2XIQA 4KYUA 2GBOA 4M86A 4TLBA 5KYWB 5CK4A 1W35A 3MGKA 4QUAA 4LRSB 4ZDJA 1GO2A 1PJ3A 1Q0HA 5H1YA 2IYEA 2IHNA 1H8HA 4KPYA 1JX9A 1S7CA 2QPTA 5E95A 1TCVA 3TOXA 2CUKA 2NZ8A 1KK3A 2XI4A 3ZR4B 4D02A 5IH7A 10MHA 2GTSA 3E7XA 2H29A 3FWNA 3L7BA 4IP0A 3HLKA 1DBWA 3AY0A 3QXCA 2AMLA 3IUQA 4Q6WA 3QF4A 2NU6B 1B8PA 2OOSA 3EFEA 3QSGA 5KNBD 2H54A 2QNBA 5ALVA 3DF9A 3K0GA 1PX2A 2J9RA 4ZARA 3EAQA 4US2R 4TLDA 1QYVA 5IXSA 3HMQA 4A6EA 5D1HA 1L5HB 5FAKA 1RPJA 2YQ4A 2ZDGA 1RXSA 2HK6A 4IR7A 1L4NA 4I08A 1YXBA 5CK5A 3TGPA 3BDAA 1MZPA 1SGWA 1EVEA 3A4MA 1B0UA 3R0IA 5AHOA 3OPQA 4AKSA 4PQFA 2GPYA 3U49A 1IONA 1Z5ZA 4WBSA 2GEVA 4TKVA 1L8QA 3AL0C 2AW9A 3JAKB 1DVRA 1GPYA 4E2LA 2FNAA 3G0CA 4G81A 4IHJF 5DX0A 3T0GA 1OCZC 3TVYA 1R8YA 2EYQA 1DJMA 5IT9N 1XMJA 3A4VA 4LRQA 3B48A 4QVIA 5EP1A 4L9RA 4XQ9A 1ZESA 2DF8A 1AS0A 5EXDA 3NM6B 1G9SA 3ZI7A 3ONDA 1E9AA 4K6CA 4E4TA 5LIRA 3CCVV 3FG9A 4DIBA 4DPLA 3A2FA 3V1TC 4FR5A 3F90A 4PG8A 1Q20A 1U90A 3AKEA 3FSRA 2LQTA 2BVNA 1TGOA 3KYIB 2W00A 3UJDA 3AUUA 2IYNA 1FYFA 1BC5A 3BL5A 2JH9A 3R0QA 4MH0R 1N33O 4TLCA 1UXIA 1WZUA 4G4SP 1FTWA 3C5EA 1C41A 4XDZA 5JJ5A 4D80A 2YCBA 5I8WA 3L6RA 3GCDA 2BFCB 2DHEA 3QJ5A 1WM1A 2VG8A 4KH0A 1OHHD 1I32A 1ZM9A 3D1VA 4YMLA 2V4DA 4K8ZA 2OWEA 3I9OA 5CD9A 1NVTA 2XZOA 1MC4A 2CVZA 5KWJA 2Q9BA 2RDMA 4F4IA 2I1QA 3R0XA 1MIOA 4WACA 3RU7A 1PQ4A 3C7CB 4TVKA 5ALQA 3S4YA 3ND5A 1J25A 1J22A 3VI3B 3ZHRA 3HDYA 2DOSA 5JS2A 4ZHQB 1XXLA 4DG5A 3N58A 1H6DA 5CM2Z 5AM5A 2YS6A 5JEEA 3QWIA 4DV3B 5KCZA 4PYRA 4QUGA 3BX1A 2HJFC 4MUIA 1O9HA 1UBFA 4RY8A 2R6JA 1WHSB 1K5PA 3M49A 2BM8A 3ZW8A 3UB3A 3KKOA 5FWAA 1P84F 1T36B 1VJ0A 2WU8A 3UPTA 1FP6A 1Y1QA 2QLLA 4PC2A 3OG9A 3FYEB 5G0TA 5KYXB 4O2BB 2I78A 3NCHA 3NRBA 2Z3ZA 5REQA 2XUZA 4RZ2A 1JDTA 2IPXA 4MUGA 1NU6A 3ANSA 1HC7A 1Z4JA 1GD1O 4D8WA 4OQXA 1HDOA 4QUEA 3L01A 1R0SA 1X7YB 2EX1A 1BEEA 1RFLA 4BJHB 1YZVA 3BFJA 3TZLA 3VJLA 1B41A 3WSTA 1UJMA 2CUNA 1I80A 2FPIB 2G5PA 3LY8A 1PNLA 1TCAA 4HZUB 4AICA 2IS6A 1XZBA 1N2OA 2I7TA 2JGFA 3CWCA 3JVEA 3JZMA 4MQMA 1I1OA 3EQ9A 3RGGA 1L7VC 1W88B 1AIPA 4OGWA 3C7TA 4DLVA 1ISRA 4OI1A 1JN0A 2XUKA 4PG4A 1TI7A 4F5ZA 1XTTA 1CIVA 1QVRA 3IR6A 1LPMA 4YQZA 5DTMA 2BEWB 1Y80A 4CFSA 8LDHA 3TLBA 1PNVA 3DD1A 3F9IA 1BX3A 3IKLA 4C01A 2QAGA 3RC7A 4BZZA 1GCUA 3UK7A 3K0DA 2FG7C 4CUJA 2QG9A 4PJ0Z 3TS1A 1DCMA 2FG5A 3ROXA 3K9WA 2H6EA 1YOVA 5JD6A 1BN6A 2OC9A 5FPRA 1FW6A 1E9RA 5JJKA 2C42A 1DHRA 1Z9BA 1XJ5A 5C8VA 1NLMA 3HH8A 1CDOA 4P9OA 3GJ8A 1K4YA 2CAZC 4QDUA 3MJSA 1IUOA 5DBFA 1EP2B 2H1IA 1A9ZA 3S1LA 4E2ZA 3BWCA 2GTAA 1Y3CE 3PWKA 3QKRA 2JATA 1RYZA 3WAKA 2JD1A 3TLXA 3IOEA 1V39A 2R8EA 1JIKA 2AFIA 2XGOA 2YTZA 4FLTA 2P5YA 1KEEB 1IB6A 4RHYA 5IK2A 4V3BA 1JQ3A 2NV2B 1MF7A 4LDQA 4N5LA 2YDXA 1F4NA 1JFSA 1C30B 3KQHA 3OIUA 4UNQA 1UBMS 1YUNA 3PYLA 3UAXA 3MJDA 5JXHA 2QTWB 3BULA 1PYOA 4KODA 3SZOA 3T3EA 2Q7EA 3UW1A 4B4VA 2IS2A 3SOZA 3T7DA 1EDBA 4URHA 4Q3AA 5GVSA 4AI8A 1PJTA 2BSKB 5FPOA 3VPCA 3BAZA 4HNQA 4KHZA 1RMTA 4V0KA 5TQVA 4D4KA 2HPZA 3MC1A 4DVJA 3WK7A 5ICEA 1CJCA 4QU8A 1Y98A 3NBUA 5IDVA 2FOIA 4PA3A 1JG4A 2HBRA 5HFJA 3U9TA 3V2HA 4S04A 1TVKB 1ZLZA 3CG4A 1EVIA 4RXUA 5AM4A 3BMNB 4Q20A 4HTFA 1Y4SA 3P19A 1GIAA 2HR3A 1RP7A 1J7JA 3DP9A 2WHPB 2YHAA 1BH2A 1G20E 2YIJA 3CSDA 4EJMA 4OLJA 5B1BB 1OROA 4OV6B 1FVHA 2PGDA 2OV4A 1CJBA 4AB1A 3I64A 4OUDB 1Y3FE 1ZD4A 2QM3A 2XCQA 5CLIA 3UGQA 3WGKA 2G5TA 2IJGX 3I30X 3BTUA 4B5LA 1MX5A 5EBLC 1EHCA 1V7PC 5KQMA 3BAAA 4JLOA 3NDJA 4EEQA 1NY6A 3OF5A 5GPBA 1P7WA 1XROA 3DMNA 4AZ0A 1SG9A 1GTOA 1X1DA 1YJQA 5JC8A 2OFPA 2FW7A 4EY4A 1AB6A 1XZGA 1WY7A 1O6CA 1TKRA 2VF7A 2R9AA 4HXEB 4IO0A 2R6ZA 4DDVA 1ZM4A 3UWOA 3PDIA 3UJNA 2RHBA 2PX0A 2XUAA 2XF8A 1R4MA 2QUJA 4EVQA 3RTDA 4GX5A 2V7PA 1E1RD 2QKCA 3W8EA 5HRUA 4YP9A 1FYWA 4FZ5A 3REGA 1EVQA 2PMWB 3JQAB 1WMEA 5FA6A 5IU6A 3TM4A 3BXOA 1W5AA 1K6IA 4XW2A 1D5WA 2WDPA 3WIVA 4A0HA 1OCZB 4Y2UA 5NULA 3T3HA 2R2AA 3M89A 5E3HA 2AYXA 3KV3O 4MWZA 1Q2XA 5G0UA 3TUZC 4OQ4A 3IOBA 3NP7A 2ZBVA 1U8FO 3U3MA 3TSWA 1K68A 2IKQA 3BIFA 5L53A 3N2IA 1QK5A 1GM7A 3OPYB 3ZTYA 3EIWA 2CD9A 1NVDA 2WVAA 1NXVA 1KJWA 2XB9A 5IT9A 3HNOA 1WETA 2XYHA 1WA8B 3D6UA 3E82A 1JALA 1WEHA 3RC1A 9GPBA 1XDWA 4M98A 1O94D 1QX3A 2TMYA 4YJ2F 5IBRA 2NN3C 1OSNA 4NIMA 5B4UA 4X90A 1XNRB 2GJ4A 4ZQEA 2ZSUA 5K0EA 4QDKA 3HU1A 4F9TA 2ICAA 1ENVA 2H0QA 2H1CA 4FJ2A 4Q7QA 2FPUA 4ZQIA 5DRYA 3ZS8A 5JADA 4LVOA 3ETEA 1L3CA 4A5SA 4YT8A 4NEGA 5FI5A 1GZHB 2O2YA 1A8HA 4UTRA 3UC9A 1KYVA 4CL0A 4XIYA 3L6OO 3E1KA 1DPFA 4R0MA 3ASNB 2XDAA 4OSEA 1J56A 3R9KA 1J2TA 4RA9A 5I7FA 4NKRA 3EPRA 4FBMA 4H7JA 1G7SA 2EEPA 2HUPA 2HEGA 2ZRGA 2BFFA 1OCRC 3KNZA 1G6HA 2H94A 5GW7A 3AM5A 2GSDA 3GCWA 2ZDQA 3KZMA 3QPAA 2W8BB 4LYAA 5I45A 4HGOA 4ENRA 1G42A 5DHPA 4PNEA 4LJKA 3RVJA 3OEEG 3GYGA 5I7EA 1XTIA 4PYIA 3IBYA 3RHSA 1GYQA 1WLSA 2WYIA 4L16A 2WJ6A 4PHFA 5BSVA 1IXZA 1LBEA 3KUUA 4MVRA 4NJOA 2N47A 1OCRB 5KTMA 5KAFZ 2HVKC 2E3CA 1FDSA 2H5IA 1ROPA 1JGTA 3CTMA 4TS1A 3PQ7A 4PZLA 3N2KA 2QRVB 4FBGA 2GWHA 4I9GA 1Q21A 4KIGA 1CBUA 3TE7A 1QRAA 4CDNA 4F2PA 1DOZA 4N65A 1F8YA 2HVJC 1JFRA 3QIAA 2WJ4A 4FYVA 4F9FA 1YF3A 2A1UA 4TV9A 2COKA 2HNBA 3ANNA 2ZJ1A 1H6CA 3JD4A 4GI1A 4I1RA 4ZKIA 1AKNA 2GGSA 3HWRA 3P2IA 4OMFG 5F78A 4C08A 5CA1A 4C7OA 3HE3A 2OC4A 4QC2A 1VGVA 1GAXA 3TJTA 3HB9A 3EZ6A 3S1SA 2DBZA 3MIZA 4R1UA 4RF4A 5DHAA 3UAOA 3WRXC 2CK3A 2XKJE 4DR1O 5H6QA 2NZVG 5HDBB 2Q5HA 1ZUWA 2X3UA 2QTRA 2Z83A 3L9WA 3IMFA 2AMVA 5FTKA 4D6PA 2PQ2A 2XKBA 1QFYA 3AQIA 3J7TA 2AV6A 2AOTA 3OU2A 5B55A 3EQ6A 4RDIA 5JMOA 4R40A 2NUTB 4BKQA 4R7CA 3W2FA 1U96A 4FVMA 1L5LA 3ZIAG 4WT7A 5ELMA 3WHIA 3OJCA 3TQSA 3VNBA 5EKDA 3E3OA 3CRW1 4BP9A 4M7PA 3CF2A 4BKUA 3Q72A 2HQBA 4GFDA 4UEKA 5CCXA 3HHPA 1V8BA 4EI2A 1H2KA 4DDUA 4JY7A 4R7ZA 4AJLA 1YZYA 3GPLA 3AFMA 3BWDD 3GFSA 4JR2A 1QIDA 5HA5A 3WK5A 1NRIA 4HWOA 3F47A 3QIVA 4KVFA 5GV8A 1GNVA 4FFVA 4TL8A 1NH2B 3KUCA 4L0MA 3BY6A 4IQ4A 3BRQA 4WUVA 3GDHA 3TPFA 4E5KA 3OUFA 4HNAB 3BC1A 1EX1A 2TMDA 3Q4HA 3DVQX 3JQGB 3OOSA 3GAZA 2IIBA 3EG9B 2IT1A 1IWOA 2ONZA 3ABRB 4LHSA 4Y2HA 1UC4B 2Z8ZA 1MNGA 4TS3A 1DIBA 2ZT9B 5IMBA 9LDTA 1KDPA 1BS9A 1Z2CA 1YVEI 1T6XA 1ZAYA 1M2VB 3LT2A 2FZ5A 2Q29A 4X6XA 2HU5A 3AVPA 5A0TA 3GLUA 3Q1LA 3QMWA 4JP8A 3ZUGA 1ARZA 2IGTA 3KZ1E 1I2BA 1DAOA 3PGXA 3VHLB 5AKGA 2BJWA 4KGVA 4TLAA 4EGCB 4LNUB 4Y2YA 5IKOA 2GK3A 5JS7A 2YWRA 4FOPA 4C6RA 1PSWA 4RDCA 2YS8A 3PF8A 3BHIA 1FFXB 1BKDR 1DOAA 4NMMA 4Q6BA 1OAOA 3LDCA 1COZA 3KM0A 3ODGA 3HLTA 1RWXA 4NJEB 2BE7A 3I04A 3DO6A 3PL1A 3MWJA 4H35A 2CV1A 2M2IA 4BMOB 2H2HA 2AF3C 2PYIA 4I1UA 1FJGO 5KQSA 2HSWA 1NXWA 2WWGA 4MUHA 5FI3A 1EYZA 2DPXA 4MSUA 1XZFA 3B36A 5AVRA 1P2TA 2ATXA 3PLNA 4I2NA 1VL2A 4P6VF 1X1SA 1QB7A 1JJAA 3KB2A 2ZR8A 3QWFA 4LWSA 4JI6B 1FYJA 1M6YA 2DPHA 1RSZA 2VUIB 3HNPA 2GEKA 4PN3A 4PLTA 2RCNA 2QAGB 1HYGA 1VE1A 2F6RA 6ABPA 4ZCSA 1WOMA 3SDZA 2NTJA 3VRHA 3B9PA 2VP2A 2Q2NA 4TPKA 2J07A 4GXQA 5IM5A 4F2HA 5A1JA 1AQ6A 1RLMA 1BD4A 3CRVA 3HJTA 4LJAA 3MOSA 4KZPA 2Q9UA 3OHMA 3NHZA 1ZQ1A 3GLRA 5K0SA 3PYXA 1TLTA 4WBNF 3QKSB 4AJHA 4OGFA 3N1UA 2W8ZA 2FMLA 2NVBA 3E03A 1DC6A 4G0NA 3VMFA 1L7BA 1AUPA 1FBTA 5CJJA 4OFZA 4B6OA 5KZMB 3P0IA 1M5IA 1WMAA 4TS9A 2YV1A 3AYXB 3IO5A 1PE0A 2FMXA 1NMSA 3C8DA 2FZCA 3MHSC 2Y1LA 3KB1A 4EYSA 4KPEC 1YRYE 3ET4A 3ZBUA 1AOXA 3MK31 4LXYA 1T4DA 1M7GA 1AQLA 3MXOA 5EE0A 3LYLA 4M9QA 5M5BA 3FOEC 4X9XA 2XRMA 1W0JA 4KN5A 1QBGA 3GMDA 3ZHUA 1QQBA 3SLGA 4B8YA 2ECKA 3ZY5A 2R96A 4TS4A 5BNZA 1JX6A 2OHJA 2ATEA 2R751 4FZVA 3WS7A 1QLNA 3PJRA 2EGGA 1OGIA 4IMRA 1XD9A 4KLZA 4DBLC 2AOTB 2Y05A 3VX3A 2AJCA 4IUCS 1RZUA 2VQ3A 3DMHA 3Q8LA 4YJDA 4PY2A 3T4EA 1AILA 4MVXA 4JVLA 2VTVA 2YZKA 4M2LA 3DOIA 1XELA 4X9QA 5WRFA 1US8A 2W42A 1M2NA 1C3VA 4LOAA 3UJ6A 2PZ8A 5KYYB 2G1PA 4EKGA 1MMMA 2QX8A 1LBQA 2WKQA 4GSYA 4PO1A 1AS2A 3WTCA 4XE5A 1MU0A 2GFIA 4XAQA 7YASA 2HB6A 1VL8A 4EG6A 5F7JA 1W4CA 2G71A 3B6EA 3P4XA 5B3KA 5C4MA 1RM1B 2OESA 5IDXA 3QBVA 2M98A 1ZNQO 5B6PA 3J7AC 4EY7A 3AG4C 1TPYA 4ER6A 1TUEB 5K3FB 1XTQA 4F56A 1B6GA 4S0ZA 1OBHA 5DN9A 3WYEA 3CRRA 3FN4A 2QUHA 5J1SB 3JWEA 3TTSA 3F3KA 2CV2A 2VDJA 5CPFA 3KSDO 3PTLA 4CJXA 1K6EA 4QJ4A 3WL5A 1M6VB 2I2BA 3AXTA 3KWFA 1A5SB 3EXG1 3OZFA 4K9KA 4UNSA 3S5UA 4DZRA 2OUIA 5HNKA 3ETQA 3BB3A 1EINA 4NCIA 3FPBA 1TMOA 1FNMA 3UJ3X 4B3SO 4H60A 3W5JA 3HXQA 2I9KA 4NYMQ 4P1ZA 1T8TA 4RE6A 1TW2A 3CJHB 5KYUA 3WOVA 4B80A 4D43A 3A1VA 5L3QB 2CB9A 2R7NA 4FFMA 2P9CA 6CHYA 3ABOB 3RHZA 3OPYA 3ZE7A 1QB8A 1YRLA 3SC2B 2IYRA 2E75B 2KW5A 4P3OA 2Q0OC 4Q21A 4WTOA 5ALDA 3STWA 3X1WA 4DWWA 4EL0A 1IIBA 3SX2A 3SVTA 3LMKA 1A9XB 2OUKA 1YITV 1NIPA 3IO3A 1EESA 3HSKA 5LZ2A 2UXBO 2Y66A 3NANA 4KQXA 4X91A 4CKZA 4UQLA 2QQ5A 2QJWA 1UKBA 1Z4QA 1GV1A 2AGVA 3CT4A 3UXHA 1KFEB 1Q5PA 2HNAA 2Q41A 3VISA 1XOUA 1YZLA 1ZW1A 3DXZA 4EF6A 1U2DA 1ZUD1 1NFFA 4ZT5A 2ZYRA 1AR4A 1SUDA 2OHFA 3B3FA 3HJGA 1QHYA 4J1NA 3DLTA 3R09A 4XRRA 4ZN6A 1OCOB 4H0LB 2R1ZA 4NXMO 3R6TA 1NP3A 2HPAA 4RLQA 1T0UA 1YJ5A 1KL7A 4HWRA 3SQMA 1TJYA 2HBZA 3JQ7A 3EA5A 2O0KA 1TUBB 1BW9B 1G98A 1M6EX 1P44A 3CLRD 3F5FA 1G5TA 2G4VA 4DMRA 3G6WA 3DE1X 2DWCA 4M0UA 1Z6QA 4QU5A 5D6NA 3QEJA 2VHQA 5HCIA 5KCMA 1FS5A 4XDGA 2AGAA 1N25A 1RM4A 2FI1A 2G72A 4J90A 3OJOA 3TZBA 1RFYA 1RQPA 2SCUB 2DFNA 2YJGA 3VOAA 4JTAB 2F1OA 1KECA 1GRVA 2BR3A 1NVAA 2BV3A 3CNBA 2BT4A 4CKEA 1OUMA 4LE1A 4QJIA 1OFVA 2FL4A 4DCSA 2NZ2A 1TEVA 1Y67A 1JDSA 1NUTA 3ASUA 4LHWA 1V54C 1PFYA 1Z75A 2DECA 3WLKX 5J4LA 3VHXB 1QZ3A 4PYNA 4TN5A 3OUZA 5AM0A 3RS9A 1C9MA 3A0HZ 1O8BA 3EDRA 3B8HA 4GOMD 5E9WA 2X22A 2WAXA 3DDCA 3ZE9A 5ALOA 2I67A 5AUOB 1JIVA 3A6GA 3M6MD 4OQMA 3DUWA 3E70C 2EZOA 3E7FA 2BMDA 3H7IA 1GTJ1 3K16A 3OMWA 4L95C 3OIGA 1YE3A 4OB6A 4ISBA 4Q37A 1U1CA 4QYIA 4NCHA 1RXIA 3SXUA 3QQ5A 1XRLA 3QXXA 4OI2A 1WXEA 1R73A 2PS0A 5J43A 4N23A 4MCIA 2D0PB 5ALTA 3BIOA 2YMMA 5G40A 5AXDA 4P0QB 4IFEA 5G1OA 4HY3A 1JDJA 2UZ0A 2PV0A 4HDKA 1RLIA 2Q6KA 2R60A 2P2GA 3FBGA 4MW9A 5C5DA 3ABUA 3DA8A 1WUYA 5TPWB 1DAMA 4U5QA 2WP0A 2PVCA 3QV1A 4IQFA 1RACA 4I3GA 3FLAA 1S6YA 4JT4A 4N47A 5LPNA 2NU8B 5F76A 4IG4A 1GZUA 1IRXA 4A1FA 3D3JA 4K9SA 3HWX1 3V7WA 4AZTA 3FZYA 2IU4A 1RKBA 1Z4KA 4HL6A 4KG7A 2IX3A 2JCSA 2PY6A 4RGVA 2NUTA 2VKQA 1JQEA 1FFCA 5HZGA 3RW9A 1U2QA 2O1WA 4PO9A 5F9HA 3TZEA 3OBBA 2JJ1D 1UJ5A 3IDSA 3QFTA 3UENA 5BR4A 1GILA 3SDSA 4N76A 3TL3A 3ZMVA 4F46A 4KKVA 2FMFA 2O8FA 1H0SA 2XYQA 4OHCA 1XQ1A 3U7HB 4GL2A 1YR2A 3DUFB 3G88A 1G5QA 3B7PA 3B78A 1M6VA 3OP1A 4Q3DA 3RSGA 1O1YA 1Q7GA 3UKJA 4B0PA 1YBAA 1HQCA 1Z6XA 2FX3A 3UGJA 3P9NA 2AN9A 3RYIA 4LCEA 1YB2A 4NESA 2CXQA 2FZGA 3MB5A 1I94O 2IXAA 2NO0A 4Q24A 1AHPA 4G9EA 3JRXA 1E0JA 5HFMA 3RVMA 2GVZC 4EF4A 2UZ1B 2F1HA 2BFPA 4RMHA 1Q22A 1AK2A 1DXQA 2HK9A 4UHKA 2YWGA 3TWOA 2AL7A 3TGLA 1PFKA 2GEFA 2DFTA 2QL9A 5BSRA 2ID8A 3TAUA 3U17A 5KMGB 1BMFA 2QD3A 4J7CA 4AS2A 2SHKA 4L72A 1QHHA 4L4RA 3BFPA 5JMWA 1DGQA 1V37A 3CXUA 2VPQA 1B04A 3OFNA 4P4TA 5DB4A 3TNFA 4TYWA 1MZEA 4D2IA 3EC1A 1RWBA 2Z5GA 1MFPA 4NTYA 2PX4A 2XMZA 3A9SA 3JVVA 3L7OA 4Y2VA 8AT1A 3B60A 5ITWA 4JWKA 3K72B 1FNSA 1KMIY 3FTFA 2I4RA 5JO9A 3QY0A 2PUDA 2MK3A 2HTEA 1RQLA 1M1KW 2WMNB 2IEIA 2YYAA 4EMSA 3UW3A 4JP2A 5IVHA 2WA3A 1QNFA 4YJGB 4LAFA 4CUKA 4DF3A 1YU6A 3F7NA 1L4UA 2AEMA 5I9MA 3OLYA 2C57A 4D3ZA 5BW6B 2GH1A 4FD2A 3UICA 2AXPA 1DZ3A 1TT7A 1OHHA 5KTOA 2B8EA 3ENNA 5H02A 3BE6A 2B4AA 4D56A 2XSZA 1CUBA 5C18A 3WQSB 3OIYA 1CFJA 2UYOA 3CUTA 5FFFA 2X0KA 3B6JA 1UWLA 4O25A 2J45A 4ZYZA 1UMDB 1SUPA 1E2DA 1LBIA 5G2OA 3U7QB 3QKWA 5I9IA 3RKSA 2Q62A 1XMIA 1QKJA 3LY5A 1V7ZA 4KXMA 5EFOA 3RJTA 3A31A 3SIRA 3FOWA 1PBNA 4Y3UA 1IWBB 3HY4A 1NJIW 1RLOA 4N5NA 3A6JA 5F1PA 5TE9A 1I1QB 3K70D 3WGUA 1GQRA 4CW7A 5FBZA 3HYSA 1AKRA 1GKUB 3T5PA 4UQOA 4A23A 3ZD6A 1XLVA 4FNMA 1PWXA 3VPXA 4A0QA 3CNLA 2XMDA 1BYUA 3QOXA 4OHXA 2QN6A 1PNMA 4YRSA 1FRQA 1IPEA 1XTRA 1XL0A 1PGQA 2W6OA 2UUCO 2E4UA 4GBJA 3SF8B 3W2HA 4PR3A 4COOA 1Y37A 2IEBA 4OAPA 4E7PA 3EUWA 3ENWA 3FF1A 1GAQA 1W0KD 2AMFA 4GVPA 4JGIA 4LCJA 1KKUA 3BMQB 1TYZA 3KAQA 1XZMA 2GV9A 1EH5A 4OKNA 3P9IA 4QTUB 3T1VA 3ZBQA 4DPMA 1W93A 2P9TA 3OT7A 1KOJA 1Q92A 2WEKA 3E1SA 4NG5A 4OGLA 5JPIA 3EHDA 2F43G 4ZMBA 2A5YB 4WKPA 3KU1A 2J9FA 1QIEA 1XXHB 2AHOA 4W6ZA 1WL8A 2Y8EA 1QP0A 2QMEA 4IIDA 2CLDX 2IE0A 2Y1WA 1POXA 1Z2GA 5ALWA 3E83A 5IYZF 3H16A 3ROGA 3T1OA 3ICQB 1QLEC 4IGIA 4QL3A 4OQPA 1OY1A 1ZCZA 2Q27A 4DV5B 4KEAA 5JASA 3N7TA 1O4VA 1WMBA 1V8ZA 4XUGB 2WLKA 1VJ1A 5KI6A 4ZGBA 3QITA 4B6FA 2JAWA 1DBVO 2B21A 4F4JA 5H83A 2EIHA 2LKCA 3CH6A 3T1HO 2ARKA 2OG1A 1A82A 1W1UA 3LTEA 4JJ8A 2X8AA 2EWMA 1ZX3A 3IILA 4ZAWA 3VNQA 4BQOA 1YRAA 5CG1A 4YCMA 1HNZB 1IPFA 1BMQA 4GZRB 4N0DA 1A9PA 3KOWA 3SGLA 1T2DA 2IU6A 4L22A 3SXJA 2OGZA 4PX3A 4QPZA 1X1CA 1X7WB 4MICA 3JSLA 4NCNA 3FZQA 1JG3A 2E4XA 3C3PA 3VV3A 4UEWA 4YDRA 2W6ID 5KSZA 2EV9A 3KC2A 1U9IA 5SYAA 4XXHA 4J0GA 3VOUA 2RGGA 3RIYA 1GN4A 4FJ1A 4YRBA 5FX2A 2VNHA 3WWEA 3IAFA 4LDAA 5I7RA 2DFPA 4IH9A 4XIJA 2QMUA 2EG9A 3E2MA 5FXMA 1KEPA 2HY7A 1HNXO 2FF5A 4GX1A 2YXHA 1ULSA 4QHYA 2HT6A 4U4AA 2FV8A 3PQ2A 2CH7B 1NH2D 1HE8B 3CRMA 3BSSA 4QNMA 1RPTA 1U2DC 1VG9B 4YONB 1F0PA 4DR4B 4MITA 4BFWA 1RIIA 3M82A 4DCTA 4DUPA 2YWCA 1NRXA 3MWEB 5DCWA 3RG8A 5DWQA 1L7NA 2DCMA 1ZL8B 2QM8A 2QTTA 3OIFA 3AR4A 4JI3B 2FGKA 2EP8A 1ACJA 1VQMV 1T9GS 3GMSA 3HWSA 3O92A 3Q0EA 2CYAA 5F35A 5BQOA 3EVFA 2ZYHA 4BMZA 1HL3A 4YRKA 5AVVA 3THWB 1PV4A 1CJSA 2IEGA 4FIPC 2PN1A 3A1DA 1J8QA 1XJ0A 2IJKA 1QMGA 3M70A 2VWJA 1RSOA 4K40A 5EN4A 3UMRA 3O8QB 3EFFK 1WKVA 2ZWMA 1OX4B 4WXHA 2C82A 3VR1A 5HKBA 1VKNA 2TSYB 1SS3A 3AG5A 3D43A 4KP4A 1E1YA 3WB2A 2GPAA 2JFXA 1TO6A 3C3SA 3IQZA 4LYFA 1JYEA 4RFSB 5ECWA 1WABA 4KSYA 2Y71A 3K4PA 4IIEA 4PRYA 3ZHBA 1CP3A 4C9BA 1YZGA 1PR6A 3GEPA 3HR8A 4NBKA 4TXMA 2FW1A 5I8ZA 5D3MA 1V5FA 3CRQA 4ZC1A 4DW1A 1GL9B 2QGNA 2OXCA 4L2IB 3C90A 4MS3B 5AKLA 4ARZA 1V6CA 2OZPA 4Z1OA 1EQUA 1EUDA 2GRJA 3BUSA 1NXXA 5LYJB 2XTNA 4HLUA 4M0PA 4QTXA 2ZTMA 2FWAA 1E64A 2CDRA 3QLUC 2HI0A 3OZVA 3R0JA 2WM2A 4IUDS 4BEWA 4BATA 1XP8A 1QO7A 2EL7A 1MNAA 2FSHA 4FQ7A 3UCEA 2GNAA 3CSSA 4IYHA 1J0XO 5DGXA 5DNCA 1EVKA 3FWHA 2IYVA 1VPVA 4DNFA 1I1NA 1A0OA 4IKEA 2ZWVA 5GM2A 3STVA 1I5EA 3G9QA 4UREA 2CDNA 5KKAA 4WXRA 3ME5A 3P2JA 3ZOZA 1H2AS 1NU1H 1XTUA 4F04A 5A6SA 4Q39A 5HUQA 3SSMA 4LQCA 3OTOB 1E62A 4XM0A 2X1MA 4LZNA 3BQNB 3LPLA 1XLWA 3PSAA 5LR6A 2DKFA 4BLSA 2YXBA 4HB3A 2HA2A 3TEMA 3W8NA 5IWAO 3SYOA 1BCCH 1UXJA 1TMGE 5AVSA 3GJSA 2G9NA 3GGPA 2I4NA 3W5DA 2FH5B 3HO6A 3O4GA 1UP7A 3F9CA 2HCRA 4KH1A 1RAIA 5AI6A 5HIKA 5I9LA 3LX8A 3AX6A 4PSAA 5J9FA 3HBLA 3AUYA 3AG4B 3L9XA 1B3RA 2COEA 1MRSA 4Z7QB 4MWSA 3EIQA 3AFNA 5C31A 3ZDXB 3EVKA 3QEMA 1B15A 2R9VA 2WFAA 1UM9A 2HMSA 5GIOE 4LZOA 1HFKA 1NW6A 5B53A 4MUEA 5AI9A 3S1AA 4AG3A 2Q5ZA 4TTTS 3LSQA 1G2PA 3WGHA 4BNHA 4DADA 4YUAA 3LUGA 2FZLA 2QR2A 1I9CA 3ESYA 3H42B 4J75A 1IK4A 3ELDA 5DNAA 2DULA 1KZ6A 4MGYR 5KJ1A 1KIFA 4NFSA 2B78