3WB2A

Hcgb from methanocaldococcus jannaschii in complex with the guanylyl-pyridinol product in a model reaction of [fe]-hydrogenase cofactor biosynthesis
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
160
structure length
160
Chain Sequence
VVMEEIIKKAFIESINNIRRGDKEEELKKIQEKIVNAKKIVVATNNQKKFKVIRDIMLRVCNAEIKMLDIDTRFADLTRMPALTKGLIALDIEKADLYIARGRLGAPGSGSMLVILDEKGRVLTASLSPSSVIHKEDIEERIKKELIEALSRIGISILEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the HcgB enzyme in [Fe]-hydrogenase-cofactor biosynthesis.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Uncharacterized protein MJ0488
total genus 55
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3wb2A01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 3wb2A02
4DK1A 3AUJB 5D5QA 2F1MA 4GYCB 1DIOB 5D5PA 5JJJB 1MMFB 1EEXB 1VF7A 1NBWB 4DK0A 3BRCA 2F93B 2V4DA 1H2SB 3WB1A 2D0OB 3LNNA 1T5EA 1EGMB 1UC5B 4L8JA 5JJNB 2F95B 3WB2A 1IWBB 1RSOA 5JJEB 1IWPB 2D0PB 1UC4B 3WB0A 1EGVB
chains in the Genus database with same CATH superfamily
3EZ9A 1QKIA 1V96A 4E70A 4AJ9A 1C3JA 4P3XA 2VIIA 5I47A 3I4FA 3ZWAA 2PKYX 1E6LA 3GLVA 1KBQA 5IAKA 3KK0A 2IZ1A 4OV6B 5AJZA 1LW7A 3VH4A 3K8ZA 3KCQA 4M1QA 5K4HA 1H2SB 1I4WA 1UJ6A 1UH5A 4R31A 1PX2A 3P0EA 4XQ9A 3ZYCA 5F9FA 4DBVO 3IOEA 1SZCA 4Q18A 1BA2A 2X4LA 3QFTA 2JG3A 4NXMO 1CYDA 2ZS7A 5EYPB 4DO2A 3JQ8B 2GHYA 5CVTA 3HL0A 1W73A 2WEKA 1SK9A 4UVAA 2VNHA 2OUKA 4ICGA 2YOFA 1Q1EA 3I1IA 3E82A 4PO3X 3ZWYA 4FGZA 4RESA 4C43A 4PR0A 3OA0A 2E5LO 2XMBA 4I9UA 5ESXA 2QYTA 2VPQA 1RRKA 5B3JC 4UHCA 4A5SA 4Q4DA 2PS3A 4R5HA 3KT0A 1FQOA 4XX1A 5KAMA 1D2DA 4PG7A 4TS4A 1RBQA 2GQ0A 3UG7A 5A6SA 3HA7A 5IWAB 1JQ0A 3APQA 3GJYA 4N48A 2EJ7A 3DXXA 1EHIA 3AT1A 4U2KA 2FE1A 3IVAA 2QI9F 2O5CA 3I6MA 5DGIA 1L5LA 4EY4A 1IQ0A 2A78A 2F1IA 3FOBA 4KR3A 4UW9A 2AW3A 1OTXA 4HQLA 3E22A 3C5EA 5J2UA 4DPKA 1DSSG 1IHDA 2OGUA 2F9MA 4OPAA 3JZIA 3RRNA 3VAZA 5ARBA 4PZYA 2FPUA 4TT8A 1HE8B 2JEZA 4AI6A 3RHZA 3SX4A 1XMQO 4R2KA 2BGJA 3RJZA 3SYCA 1MT3A 3LPDA 1L0LH 2JRCA 2BSKB 2QRMA 1AK9A 3A32A 2QP3A 3F7MA 1YGYA 3QLUC 4P32A 3TL2A 1IB0A 2XUZA 1L7BA 2D62A 1XMIA 3AQIA 1U0FA 3HKEB 3A6GA 3E4CA 1FDRA 4HMQA 5AVXA 4FYYA 2QYHA 5KYTA 4CEIB 4DV0B 1Z6XA 1AZTA 3OQ1A 3FNIA 4DCJA 5HX7A 2DKFA 2HSEA 3DWIA 4I3HA 3T3EA 1OCOB 2QRQA 1JHVA 1KJWA 1CJSA 2ZRAA 2OCYC 1KXZA 3MUOA 3ONWA 5ENDA 1N8SA 3BCRA 3THWB 1N2CA 4HEJA 2HL6A 3WLNA 3EZXA 4A8PA 1QRUA 1V55B 3PIRA 3L1VA 3G3EA 4GZLA 1ADFA 5F7JA 3I9FA 2GA9A 3FBWA 3R9WA 1PAUA 2D7JA 4GX0A 4MHSA 4B79A 1LZLA 1Q8IA 1QYVA 1RQLA 2J33A 2NYAA 1B6RA 2PLWA 4PQGA 3SKXA 2QTZA 2BGMA 4ZOCA 4BNWA 5JRDS 3M9WA 1GTL1 3J7AC 9GPBA 3WMEA 2M6YA 3STVA 1M2WA 1KYVA 5A1TA 3IPAA 1U3GA 4IEIA 4NOJA 4UTVA 4W99A 1GILA 1IPHA 2K6GA 1U98A 3DE7X 1N6OA 2ZVJA 2V4DA 2GF9A 4JP5A 4YBRA 3MRVA 3ZK7A 2NN4A 4CQJA 2O8CA 2D1QA 4LY3A 2LIVA 3OZDA 3ASNB 3OIYA 1OPXA 2LKDA 3IRUA 3B78A 4HB3A 3CNBA 4IQFA 1MP0A 4CM7A 3FPCA 3E9YA 2DOSA 2WD7A 3U4IA 1MJNA 1I01A 2O5EA 4DR3O 2Y9PB 4LF7B 2QZZA 2RGWA 3RT3C 2V8BA 3QOXA 3N70A 4HY3A 4MLZA 2F66C 4KP4A 3PNKA 4LOJA 3U49A 3D6VA 5KVSA 2BLLA 2BELA 5CD1A 3PFFA 3AVWA 2N47A 3LDFA 2VHCA 3SQMA 3K5IA 4LFCO 1JQ3A 3AVXA 3NJ4A 4W5TA 1L4BA 3H2BA 1PVOA 3EE6A 3IQEA 3RFVA 1OROA 2ZJ1A 4IDGA 3ZBTA 3IOYA 4YQFA 3BRCA 1I7SB 1A8SA 1JG2A 5I9LA 1J9EA 1XT6A 2RB5A 3WR5A 4FPXA 5J1SB 4PN3A 3LVFO 2EKZA 2JD0A 2XVAA 3GK3A 3AERB 2NGRA 4WINA 5P21A 2OYCA 2YXEA 2DE0X 5CA3A 3F1KA 2DN9A 2QDXA 1DGQA 3QG5A 4M9SA 2I2CA 4KR9A 4G4IA 1KC1A 3MWDA 1ZI8A 4AZ3A 4IDOA 1PNRA 1DIHA 3RTBA 1WETA 2J7PD 1L3CA 5FNVB 1WB4A 4DCNA 4DLSA 2FHPA 3ER8A 1X3LA 1GQOA 1AOXA 4PFKA 5EFZA 1GXSB 3OUFA 1OZAA 3K94A 1G38A 3JTEA 1J1ZA 2H18A 2CK3D 4R1PA 1LVGA 3MXTA 3AEKA 3WGQA 4FB5A 1L5MA 5ADHA 4RGBA 5EG5A 4J07A 1K06A 2BFOA 2C4TA 1WXQA 3N39C 4YFVA 1N2HA 4JF3A 3L0CA 3HJCA 2B4TO 4TTTS 4EHJA 3LP6A 1JEQB 3UY4A 1GUAA 5AVOA 1E62A 2PMEA 4A26A 4C4AA 4WCVA 2OB1A 1JDVA 2QMQA 3JZAA 3KPWA 2RKWA 3GJ0A 1JFTA 3L7LA 1G8FA 4XCVA 4DR5B 4NPCA 3P2MA 3AHEA 4C08A 2O2YA 2RH4A 3DHEA 4MVJF 3U4DA 3RS8A 4C0JA 1XQ1A 4JGBA 4WV3A 1KI1A 5CA0A 1U7TA 3JSLA 2CXQA 3UYKA 5EC8A 1A04A 1M3SA 5CCDA 4TT3D 2WWRA 4ID9A 2BGLA 3CSXA 2YXBA 1HETA 3BK7A 4G09A 4WCFA 2JGEA 4YJGB 5G0WA 1TUBB 4C6TB 5J2UF 4FMCB 4RACA 3E89A 1N9ZA 2HK8A 4MUIA 4QQKA 4LNAA 3ZWNA 3IP6A 3EFEA 4UMFA 2O7NA 4C0KA 4DWOA 3DE2X 2J85A 2QPTA 1SC9A 1RBYA 1N5LA 1S1MA 1T2FA 4FK5C 2GD1O 2VJMA 2ZRMA 1M1YB 3IIEA 4G1CA 2UV8A 5FOSA 4YUZA 2J45A 3LRTA 1SCJA 4MAAA 1FXHA 2IW5A 1OHHA 3DA8A 2P4HX 4O6VA 1U1EA 3SI7A 1AI5A 4EFNA 5GONB 1VJDA 1Y34E 1KVTA 2HEGA 2TRSB 3CLVA 4N5LA 3SK0A 4TZ0A 1ZLYA 3PHHA 1P80A 3EK2A 3VTAA 4AKHA 1Z39A 3NUQA 3IBGA 3SLGA 2W2KB 2YJNA 3UN1A 3BMQA 2V7QG 4WFGA 1T0JB 4BLRA 4BWAA 1DAMA 1P7BA 3PN1A 2NT4A 2V6JA 3LNCA 1K8QA 5SZHB 3VUFA 1OH6A 5FORA 1II9A 1JI3A 1SIBE 5LSAA 2VDNB 2F90A 4C7UA 1VLLA 2FJUA 5DM70 3BN3A 1H2NA 1SG0A 1JG7A 3LT4A 1MAVA 3ICXA 1IQRA 3CLUD 1Y5NA 4UHEA 3A10A 3BWDD 5A6SB 2QM3A 4LSWA 3KKEA 3QNWA 4R1OA 3JAKB 4WFIA 2YVAA 2ZM6O 4HWOA 2NUPA 3GZTB 1KE1A 4W9MC 1QZZA 3DBHB 1JP7A 4CF4A 2ZR8A 3E22B 5H68A 1KYOF 4FYWA 2EHDA 4PNPA 3HLTA 5FPYA 3W7VA 2YIAA 1CUXA 3T4PA 4BMZA 3HKBB 2FX3A 2C9MA 2H51A 1BOFA 1UDAA 4ZQEA 2PD3A 4HAOA 1NJGA 2EF1A 1DCTA 2PMFA 3EOZA 2A7QA 2XYRA 1P73A 2DOKA 1R0XA 4DRXA 3IRVA 2APJA 3ET5A 4BNVA 2IS4A 1G5RA 1ORDA 2HHAA 1NBMG 1ZRMA 2X8WA 1XOIA 2BZ1A 1NW6A 1DOAA 1YJ5A 2KS6A 2QD5A 2R7KA 3APOA 3WISA 1GDTA 5TPWA 1HORA 1RKQA 2HIMA 3NOQA 3IQHX 1DZIA 1IXBA 3QP9A 4HZ3A 4LE1A 4N54A 5CT8A 1KZ9A 3TDKA 4JJEA 4LF8B 1HO3A 3VR6A 5HUQA 5EC2C 1M34E 1GADO 2QA5A 4WK6A 1ZNWA 4MVOA 1RI3A 3WGZA 4OSOA 3U7FB 1JDPA 2VQDA 3LBAA 4RDIA 5DYGA 4C9BA 2X23A 4MV1A 5F1YA 1I1NA 4IDFA 4AF7A 4WFBV 3CEHA 4Q9LA 3UNXA 1K63A 3M99B 5KA6A 1C3VA 2UUOA 3B6MA 4LWSB 3E1GA 5DP1A 2QTHA 4DV0O 1BS1A 1J2JA 1SXIA 4M1WA 3K7EA 5G4KB 3AV3A 2YRXA 5J4VA 2ZJ2A 1XRPA 2Y0PA 3G67A 5LP1A 3TRKA 3VPGA 4CQMA 2EV9A 5DKFA 2FJ0A 3K0AB 4EKIA 2QL5A 1WXWA 3CQ9A 3R5JA 1WO8A 2WJJA 3W3AA 2CNBA 3F71A 3T9AA 1YZTA 3DXZA 1FD9A 2C8KA 2OK8A 4OY3A 4RV9A 1VCOA 2ZBVA 3K0CC 3T5MA 1H0KA 1XZJA 5F4BA 1JB9A 3W5CA 1TYZA 1SUDA 3ZY3A 4BQNA 2DFDA 2Q6OA 4X7PA 5ALXA 3DC6A 1H2FA 2GLXA 4DFDA 1GPNA 1NBME 3M1AA 2V3WA 1NBEA 4JYAO 2MU1A 2FZLA 4WASA 2UZ1B 4R7GA 3OIFA 4MWTA 5FPHA 4EAAA 2E87A 2VDUE 2XX3A 3B70A 1D03A 3IBYA 5ITWA 4XRGA 4Q3EA 5J4LA 2LXNA 2Y1LA 4WCFC 5E6SA 4X66O 1YZYA 2VQ3A 3PFGA 4HB4A 4E4RA 3QEBZ 2WF9A 2DR3A 2GJ8A 4F72A 3Q3GE 4UU0A 3X2FA 3CPWU 1BMQA 2HY7A 1CUBA 2P27A 2Q1XA 3ANYB 2IPAB 2PT5A 3G89A 1W29A 1FS6A 1WW3A 3JVDA 3PUJA 1EMDA 5B3SB 1GZDA 1L4GA 2C3UA 2OQIA 2H9AA 1NJSA 4W7HA 1BDHA 5AW7A 4KP7A 2QR4A 5MDHA 4URHA 4ENWA 5K8UA 4UDXX 4F9EA 4RHTA 2XAJA 1S5JA 4IHJF 1F8FA 2JVKA 3I5AA 3LSYA 2AOTB 4WLEA 2BDEA 1KWKA 3THYB 2FL4A 5EVJA 4LEIA 5JDCC 3MWDB 4N6OA 2FX5A 2YJTD 4LZJA 1WV1A 3VNRA 3IMEA 1KMIY 2OBLA 1QLHA 4C7XA 4PCAA 3GZ4A 1PS8A 2C20A 1Z2GA 3HRKA 4X44A 4LF4B 4ECEA 5AT1A 4YRAA 1ENVA 1F60A 2F1RA 4ISBA 4Y30A 3FTEA 3D5QA 3M6IA 4OFWA 3B9RA 2OFPA 2ZULA 4FIDA 2F93B 4ILKA 1EDDA 5F7OA 2FW7A 2Y93A 5HZKA 2ZATA 3UT5B 3FBTA 4XJXA 1EA7A 3SSAA 1C4OA 2VUSA 4LN1A 3DHYA 1K97A 4C14A 1W34A 5EZYB 3BA6A 4G89A 5HS4A 3QEAZ 5C46F 4UQLA 4ENQA 1GFWA 1YVEI 5I7VA 5KPJA 1XCMA 3PEUA 3Q7SA 4QULA 1NJ8A 2GJ9A 3LUPA 4R2HA 5NULA 4CG2A 3H42B 1E9RA 3W2HA 2R60A 1T36A 1MOZA 1YB4A 2Z3WA 1Q7RA 3IKVA 1MLDA 1FY2A 3L6RA 5B1YA 5AFSA 1S02A 2JLBA 4R1QA 3VZSA 3H5OA 4ZOQI 1C7IA 2OORC 4LNHA 3T2MA 1OFUA 1CKEA 3F3SA 5K45A 1FUYB 3A36A 2XE7A 1V9LA 4UMDA 3RVMA 1QP0A 1GH6A 2PR7A 4WNAA 4OM7A 1EFVA 2O9JA 3Q98A 1TUBA 4GVLA 3E9ZA 3EAGA 2ZREA 4LZLA 1EZZA 1M1NB 3EWAA 1FYFA 3GEMA 4LS3A 4TLMB 3K2QA 2XNDD 2DH6A 1M7GA 3BXZA 3KOWA 2FNAA 4DZZA 5JW6A 2PUBA 1IIRA 2PKEA 1N2SA 2I87A 4UNRA 4RLSA 3WWCA 1AURA 3T0GA 3UH1A 1JX6A 4K8OA 4EECA 4L6IA 2E2WA 3SJ7A 5BVHA 4GL2A 3BDVA 3BULA 3EQ7A 3RYHB 1IULA 2PZKA 2AI2A 1U2EA 1M76A 3O8OB 4GPZA 4XOUA 2JLRA 5HUJA 1V5EA 1AJPA 4I55B 2PZJA 5KX5B 3EFBA 4ZMBA 1LUWA 2O8FA 4DR4B 2CXSA 2NXEA 2KE5A 3ZW7A 2L69A 2BMJA 3DONA 3L4BC 4OLBA 4K1XA 1ZW1A 2PYIA 4D97A 4XM0A 1KSFX 2ACEA 3FMIA 4AUEA 3GROA 3SJUA 5T6MA 1JF8A 1NE7A 1A4IA 1LDYA 2RARA 3HDQA 4K28A 4XARA 2BJWA 4B9AA 1RZRA 1V3VA 1UDCA 1DRKA 1YBVA 3INRA 2VJQA 3HYSA 3NXKA 1C4XA 5JBNA 3O4GA 4PYMA 3ZDCA 5BNIA 1E69A 4FONA 2M6RA 3IB6A 2PGGA 4QDOA 1XPOA 1Q91A 1ISMA 1XX6A 2CVFA 1CJMA 2UVDA 1Z4LA 1ZMTA 5AVKA 1TVKB 3LUBA 4EI2A 3FPKA 4AMYA 4OBEA 4V0MA 3OQNA 4L73A 4M99A 4AM8A 1NA5A 1L5RA 1NKVA 4PI0A 2Q4EA 5IULC 4KXFB 3VOUA 1CY8A 2FMIA 4Z7QB 2FOIA 1P45A 2PGLA 3CGGA 4PZZA 7REQB 1N6RA 1Q7YW 1DEXA 1NW8A 1YBMA 3FBGA 3R44A 3O93A 2H11A 5G1PA 1EFLA 2HSGA 2YCLA 3OY7A 5SZKB 3U26A 4YRBA 4K46A 5IH3A 5BURA 4KWHA 1TD1A 3L74H 4HVLA 1UCFA 4W5OA 2CZCA 1UMBA 3KOUA 2DXIA 3I2YX 1H65A 1BCSA 3DXYA 3T1CA 3LC0A 3PL1A 3M6VA 5B3SC 4FDAA 3ND6A 4YRIA 4LSZA 1W94A 4NJMA 3LDEA 1RCTE 5CDHA 5KKNB 1TT7A 4DKXA 2NO0A 2RHTA 4U9HS 4L8FA 1TYCA 3KHKA 2IJIA 2C2YA 3DMHA 3VZQA 4NE7A 3IV6A 5JBIA 3AHGA 1DAHA 1CPYA 4REQB 1GLVA 5EVCA 4KFSA 3ZV4A 5FTLA 3MAAC 2XNSA 5FI3A 2A4KA 3G5LA 4LWSA 1ZJ5A 1ZH6A 3X1WA 3ANLA 5JO9A 3AG1B 4IHJA 1YS7A 3RWBA 3TMYA 3K0FB 2CLMB 4FHEA 3S2YA 3H16A 4PSVA 4WOJA 4ZT3A 3C7CB 1E9SA 2QB5A 4O2RA 5GV8A 1NMZA 4ITVA 4MKXA 3D2BA 3LGXA 4OMFG 4J80A 3L84A 4QRDA 5D6OA 2PMCA 4YMSA 2ZSDA 1RC8A 2OCXA 4MNTA 4U6SA 4JUDX 4KFUA 4G07A 1X1BA 4Z7NB 1R0ZA 4NK4A 3CCUV 4FSDA 1RJWA 1FVOA 2JJYA 3ZWQA 1EE9A 3LUDA 1Q1AA 3KPJA 2VO1A 3OG9A 5HQJA 8ADHA 3LXRA 4YMIA 4JYZA 4IJ5A 4MGEA 5IVIA 2H1IA 3TZBA 2R6DA 3KZCA 1N75A 3OCYA 3FCXA 3DZHA 3AIOA 1C4WA 3BORA 4NXNB 5J2TF 1GPLA 3QXGA 2ZSHA 3AJ9A 1W0JG 1JI0A 1N5KA 4OK3A 3DEJA 3Q4HA 4QGBA 1P1IA 4EPXA 3ACCA 4XOIA 3PUKA 1E3WA 3TUJC 3GP8A 2O7QA 2O1XA 3MBOA 3MXOA 1M0TA 3NC1C 3GXBA 1TM2A 3NHSA 3T7DA 1C3EA 4CIYA 1ZHOA 2LJ2A 2H0QA 1X59A 1QYWA 3H5RA 4FBGA 3KKKA 4DUGD 3OJEA 4JB8A 1IZ3A 1Z36A 3UANA 1GJRA 3GCZA 3TAHA 4Y2XA 4C6SA 4F4DA 1UBEA 1QG0A 2RGCA 1ZDMA 2ZSBA 4FJCC 1AGXA 3L4EA 3O4VA 4IP0A 2N05A 1HT3A 2VKQA 3IXQA 1SAYA 3BAFA 3OM9A 4GR5A 3JD0A 4S1WA 3NXSA 3UB2A 2J3MA 1UK6A 3VU9A 2YQZA 1WB6A 4U2CA 1WKBA 4JEMA 1V16B 3K92A 1QTIA 4FZ3A 1QF6A 5BR7A 2R70A 2OP1A 2X8JB 3GGPA 2ZR2A 3H6GA 2VNSA 3IVRA 3OX1A 4IH1A 5I4CA 4XYEA 3T1OA 2IL1A 2QMEA 1KC8W 3QELB 2FEOA 4Q4JB 4XB6B 3UAWA 4MW0A 2HMUA 1YF3A 1YTLA 3JSNA 3ZJZA 2JAHA 3O3NB 4MQEA 5CX1B 1XLWA 2DLDA 1KRHA 2Z2ZA 1S8AA 2ZP1A 5EGNA 4ZVKA 2WA2A 1B1AA 4FYHA 4G5XA 4DY6A 3W7XA 3KOZA 3FYIB 5AW6A 5EJMA 4OHOA 3B8MA 1CFZA 2DFPA 2HFEC 2WKSA 2AX3A 2Z5GA 3B7WA 3BAZA 4FR2A 4B33A 3ZVKA 4TV8B 3PWTA 4PWZA 2BOBC 2D7DA 4YS6A 1UBRS 1RWNA 3FVRA 2WP0A 3GAZA 1YB1A 5CTAA 4DAEA 4JZKA 3PV0A 4RK0A 4QOSA 4DGQA 2AZXA 4ZCRA 2XITA 1KO4A 5TF0A 4BMNA 4DMMA 1CQIA 1CVLA 3PTAA 1AHHA 3CLRD 1SHZA 1HT0A 1CE8B 3GFBA 2PSHA 5HF8A 3IEVA 1WQ1R 4OFXA 2HA7A 2XAHA 1Q22A 3C3MA 4REMA 5EESA 2HZBA 1YVRA 4LQDA 3CU5A 2O2HA 4PYLA 4F60A 4MKIA 1SVLA 3FSGD 1G291 3H1EA 1YRYE 5G4LA 1BVUA 4DV3O 3PQ4A 1Y89A 2P2DA 1TZCA 4QDUA 3CCMV 2NPIA 1GCUA 3GJTA 3GUHA 3HBFA 1VJ0A 4UE3S 5L8VA 1UJMA 3PFIA 4X63A 3A9TA 3QUBA 3N2GB 5DDIP 3L7OA 1KEPA 4H0NA 3LQRA 5IVKA 4I55A 4H4EA 3JQ8A 1IAVA 1EP1B 2IRWA 2O4CA 3B12A 2B2CA 3CG4A 4J03A 1RFYA 1E5XA 1H9BA 3SDBA 4DA7A 4M1KA 2JK1A 1YJNV 2ZJBA 4KYVA 4XQCA 3UK7A 1GZSA 3EQ8A 1XVTA 2O8BB 4JZ2A 1GWNA 4P7JA 1E9EA 4GYWA 3OZTA 1DX9A 1VMIA 3GLSA 4B83A 4C05A 2GPTA 2L0XA 2ODQA 5EGSA 4FFVA 2VJLA 3DFZA 3GEHA 1H4SA 2BEUA 2Q28A 2O7SA 3F1LA 2GAIA 3JW8A 1KQ3A 3GWOA 4AL4A 5LOVA 2BMVA 5AVRA 5CCBA 1SU7A 4UFOA 3TJTA 2N04A 1Z2PX 2D0PB 1USGA 1R2QA 1BYUA 4EELA 5T8KC 4HRVA 4FILA 2WC1A 4PVDA 2GZ2A 3W5IA 1CS0A 1N33B 1ND6A 1O95A 5AK0A 4MQUA 4E5NA 3WG7B 5KNBD 3G23A 3D4PA 1BO6A 5DRTA 5LPNA 4ZO7A 5LL6P 4DT1B 3NIFB 5HOQA 1AJNA 2R5WA 4GC9A 5K51A 4DIFA 4AX4A 4JLMA 3RAGA 1U3UA 2AR9A 3USES 2EJVA 2R8BA 2WK1A 4CH3A 5KTSA 2HRRA 3H5VA 3JQ9C 3NALA 1C9YA 5CH8A 1YQWA 4CL0A 5BT8A 4RBNA 1Z28A 3R5KA 3MJFA 3HB7A 3TQRA 3PKZA 3UJ7A 3HO8A 3W3ZB 5KNLA 2P1RA 2QN1A 3O2NA 4IIGA 2WFLB 2RAFA 1W44A 5HCIA 2Y4NA 3LYHA 3QTBA 5T6BA 2BR4A 2VH1A 3GUYA 4L72A 3D8HA 4W1RA 1Z4OA 3B53X 1QOZA 5EKDA 4ALLA 4Z4QA 4PZ0A 1F0KA 4YIHA 2RGUA 4UHFA 2PX2A 1E3TA 5FOUA 3V4LA 4CLRB 4UUJC 4Z99A 3M0EA 3TGWA 4NZOA 1EBBA 1OWNA 4B2LA 4E22A 5FEUA 4PNZA 2OTLV 1NN1A 1UP7A 2RJNA 2CZQA 3TNYA 4R83A 3VAYA 4UUBA 1N2CB 5E1MA 3WK6A 3WXBA 3IURA 3MJRA 4NZPA 4F91B 5H5JA 5LP6A 4DSUA 3HCNA 3E15A 1VKRA 3FHTA 2EKPA 5HQ3B 4NZ9A 1ZK4A 2YJGA 1HNXB 3V4VB 5IUNC 4L3OA 1T9GS 2XYPA 3BJIC 5EWLA 3VVCA 3VZCA 1JHRA 1NHWA 4IIYA 3PC6A 4DSNA 1V1RA 3FWHA 4PAWA 5CH5A 1QF7A 4CI9A 5E7QA 4BBAA 2XEXA 2KB1A 3C3DA 2EVWX 3ZHTA 3MYYA 3PJGA 4QFMA 1J4AA 3HWWA 1XL4A 1F4VA 3ZMZA 5CLGA 2O8CB 2VHJA 3UJ6A 4ZANA 2C4VA 1OBHA 5FBZA 1W9HA 5KYXB 2NYVA 4TYYA 1CQJA 2K2WA 2OFFA 3KXKA 4GOOD 4LV6A 4JP1A 1KZYC 4JX8A 4YDQA 1WBJB 3NEAA 4PHGA 2NSDA 4X71A 5JZVA 3FHOA 1VPTA 3JXEA 2F64A 1QH9A 1DBWA 3U4CA 1KOFA 2EFYA 1N1EA 3A9SA 1VF6A 3UGKA 4GDFA 5B2EA 3RC8A 2GXSA 2YFQA 3TD9A 5ISMA 1BE3H 3C3EA 1JFFB 1GL7A 3VA7A 1QHIA 1SG6A 4EBFA 4RLFA 1F0PA 5LDDC 1IXYA 2Q6AA 1GUBA 4MGHA 1Z4IA 3KG2A 2OGZA 3QMPA 2EQAA 1ZESA 4H77A 2CE7A 4MQLA 4MRRA 1LGYA 3KT8A 4O3FA 3CRCA 1AO3A 2ZIAA 4O4JA 4X1IA 3C43A 4RIGA 2DFTA 3SVZA 2I91A 5CN0A 2KSQA 1QHHB 3E70C 3RH0A 1F8UA 4DK1A 2JHPA 1ZAUA 4BATA 1GNRA 1ESNA 1JLLA 1BC5A 1W76A 1WPRA 1X80A 2P2CA 2XGGA 2YUIA 3K1TA 1SIWA 1B43A 1GNTA 1SBHA 3OX3A 3P3NA 2VHXA 2CV2A 5AESA 2V96A 1OFUX 4KGDA 4O0LA 2OQ2A 5K8JB 1XB2A 2YUAA 2BF4A 2WWFA 3COJA 2ZQYA 1R3LC 2W8ZA 2ITCC 4X65O 3PLNA 2H7XA 1CIVA 1P2FA 4RKYA 1XC7A 4GM0A 4TT3G 1NF3A 3AEKB 3UKMA 4DIKA 4F38A 1YSCA 5KA5A 4U2FA 2WSLA 2ROQA 1FJ2A 1B73A 4X9XA 4BMPB 1L7XA 4MVJE 5LVAA 4RJIA 3PFBA 2WB2A 4MQEB 3IEPA 3JVVA 1NJ2A 1DRWA 3SZGA 3ZJVA 2ZTVA 1D6JA 1M5TA 4EZEA 2P9EA 4LPSA 3KTAA 4B43A 1JDUA 1H6BA 4LDPA 3BFKA 1DWOA 1SVNA 1CTQA 1YAJA 2J7KA 4G0QA 4N7RA 4XQ0A 1M6EX 3FMVA 4IY1A 5F2KA 4JA0A 4WXPA 3DEYX 4OXYA 1CJTC 4H44B 4Q4LA 4WKPA 4M2LA 1NG9A 3EVDA 3IAM6 5FYDA 1B0AA 2VR1A 2O2IA 2GTAA 2VRZA 4AKEA 3IEIA 4C6TA 2GK7A 1BDJA 2TMYA 3I64A 2CFTA 3EY4A 5F3WB 3CX4A 4ZXFA 3DE6X 3V7WA 4D57A 4EUSA 2Z3YA 1G3IA 3P9KA 5JDCA 4BZZA 3FR7A 5JJBA 3TIVA 1VKJA 4I5EA 4RGVA 1GAJA 1EU1A 3ABOB 1LR1A 5TT0A 2R1UA 4JI0B 4DS3A 1T1JA 3EOBI 3LA8A 2PZSA 4NBVA 5KU7A 3MRSA 3PCTA 1JMVA 1UJBA 4RDHA 3P5BA 5JJLA 3FGPA 2QUIA 3ZKAA 1NMXA 6YASA 3TPCA 3ESRA 5FYQA 2AVDA 2HGSA 1DS6A 1I2ZA 1TUEB 3RUIA 3DHWC 2J0UB 4TKVA 4X6XA 1U3FA 3BEOA 3KB6A 3FPEA 4ZPJA 2WPDG 3O3OB 3LSUA 5GGYA 4NECA 2QGNA 4PC7A 4WNIA 1UC5B 2P9BA 2FHSA 1FXVA 1SY7A 1CV2A 4AUKA 3GRAA 2L17A 1IZ8A 4QOHA 1V9CA 1MQ9A 3AETA 5HF5A 6PFKA 4MQ4A 4NAUA 4AUNA 3BGIA 2J9YB 2QF7A 4LWPA 4GWLA 1H2RS 1GEEA 3AR7A 3C7DB 2GASA 2OA0A 3MTGA 4FGWA 4EDHA 1L1FA 1JR4A 1WSWA 3O74A 2DUUA 2GZ1A 3MCVA 3SCZA 5JE8A 1FYVA 4BO3A 1N2ZA 1T2CA 4W1QA 2DWCA 4HWGA 2ZE6A 4JIMA 1FU7A 2IX9A 1KMIZ 1R00A 3VKVA 1D2AA 5CPFA 3EF3A 4NYMR 3VGPA 3OLZA 5FUBA 1EX6A 4L8JA 1O6CA 3DMDA 3R66A 4PICA 3B7PA 3FNRA 5H59A 1Z0IA 3KSUA 3SGLA 4O4IF 2HHHB 1NN3A 1ESMA 1X1TA 2JI4A 3DQQA 3HGTA 4Q7EA 3DVQX 1OXUA 3FJYA 4QUHA 5J5AA 2D54A 1BHQ1 1HYEA 1PS9A 3VQYA 3PVSA 4FDTA 4P1ZA 1IXKA 2WFLA 2QTVA 2ZUDA 2ZBEA 3GJ7A 3D8CA 4AZ0B 4BMSA 4NVRA 4RTSA 4N5MA 1TZJA 4S2EA 1W2GA 2GR9A 4RPIA 1QG6A 2ESRA 2FQ1A 2JVIA 1GQ2A 1UQRA 1ROPA 2VBGA 1OIWA 3GT4A 3U7JA 1YQEA 2AR0A 4EUFA 3TGLA 1S2OA 3GT7A 2TMDA 3RUEA 1OV6A 4LF5O 2PY5A 3HFGA 4WKGA 3G79A 1T9BA 1XCGB 4QTUB 5LBQA 4TM8A 4DUPA 1YS9A 2PO7A 5HK9A 1NY6A 1TK3A 4ZCQA 4NCBA 4JEUA 1QPGA 2EBHX 3QEOA 1N7HA 5D00A 4B5KA 1V11B 1U0LA 2WPDA 2YXHA 3DAFA 1EBOA 3TJMA 5BSVA 1Q57A 2AFIB 4FI3C 4WK2B 1RWMA 4UHDA 3DLHA 5I7WA 1Q0ZA 3AR4A 1U1IA 3D7MA 4JQOA 4QDXA 5E9WA 1QLEB 3WGGA 1RZUA 1UPCA 1H8EA 2VUTA 3K1ZA 4QJFB 1R3IC 2WF6A 1VKOA 4GMFA 2BGGA 3L9WA 4LOIA 1Z3CA 2ZETA 4M9XA 3NV9A 4M1EA 1SXJC 4UZSA 1YUMA 1KJ9A 1QF9A 1KH2A 2DHEA 1K5GA 3OEEG 4HGOA 5AVJA 1JZTA 2Q3MA 5GONF 3VI3B 2Z30A 3SPCA 1L5YA 3OX2A 4JJFA 1GKLA 1Y9JA 2B35A 3HYNA 1VHTA 4PC1A 3G2JA 4HNQA 2Q27A 3WL5A 5DNUA 2DR2A 4EPTA 2YRFA 1KVUA 3F8TA 2RDMA 1P77A 2QM8A 1PGQA 4QU0A 3ZZ1A 1PIWA 2IIBA 4B35A 4DM4A 2GHTA 5DF1A 4AKSA 2J0VA 2X0NA 1N2JA 1OTYA 3HZHA 4KIGA 2HF8A 3S2FA 3I6YA 4LRQA 1FLAA 2CLKB 3D1JA 2POQX 4RLQA 5K9ZA 1JR3E 2QUAA 2FWRA 4IUYA 1SOAA 5A2QN 4HTFB 5CDUA 4Q03A 2ZJYA 4XYBA 4PELA 3F2VA 3I4LA 1SO8A 4KH0A 1O96B 5AOAA 4D4MA 2D2FA 1B23P 4UVCA 2QTWB 2NW6A 3SXUA 4IDEA 2B8EA 5D5PA 3LFUA 3P8ZA 5CM2Z 4I08A 5AW2A 2A84A 2QQEA 1RQ7A 4B4WA 3D6FA 1ZI9A 4KXNA 4H6PA 3TQHA 3SJCA 2MSCB 1COWA 1TA0A 4WXEA 3O4JA 3USZA 3E7FA 4I46A 1SERA 4HZUA 3U1VA 3CJTA 4RUEA 2E55A 4PX3A 3ZWWA 1KOLA 3JALA 1FRFS 1H0RA 2B99A 2P75A 3EULA 3AEUB 1WBBA 2XCRB 1ACJA 4U6QA 5KHHA 1QORA 1J2TA 4J90A 1NKTA 1XTBA 2YMQA 3K09A 1YJBA 3A26A 4OREX 3ORRA 4WPGA 2HX1A 3K8OE 5CU7A 1ID1A 5K3AA 1ZJYA 1T4MA 1TGVA 1CIJA 5CVEA 2VTKA 4Y2TA 3SP1A 2BCGY 4L5BA 5B1OA 1OAAA 1BW9B 5IBCA 4KZPA 4N1AA 4FOSA 3NORA 4OYRA 3D0QA 4KFTA 4QIHA 4Z0TA 4X97A 3SSOA 4EG6A 5BSFA 2XE6A 5LYJA 3DAOA 3D6TB 1LVHA 5LHHA 1ZWKA 1ZD8A 2BIFA 2ZBPA 2OQVA 1KZ7B 1OGIA 4CLHA 5JHGB 4WLNA 1DT3A 1MIOB 5BV1A 4CETA 2E4ZA 1J0BA 2HN9A 5CBPB 2MHCA 3SWWA 4ZOAA 1SEPA 5BQOA 1JU3A 3R6LA 4D7TA 1ZINA 2IYPA 2SCUA 1RI2A 4KQKA 5IEJA 5IF9A 1VA5A 2EZTA 2E1PA 2PGAA 3INGA 3OF2A 2K5UA 3PRYA 4DNQA 2F55A 4B6GA 3AVVA 5HF6A 1L8XA 3UGTA 1M2VA 4LVNA 1KFBB 3TFQA 2RK6A 3U3OA 4EB8A 4F96A 5IT9A 2A5DA 5L3QA 1BQ0A 1JB1A 4DB4A 3P19A 1HDCA 4ARUA 3RADC 4QNHB 1FP2A 3WO0A 4Q9NA 5G02A 1OE0A 2FSGA 3EWNA 3NTUA 3FIJA 5K5EA 2R9IA 3GLRA 521PA 5FAKA 3LP5A 4UBJA 1SXQA 1RADA 4O4IA 1J33A 1U5BA 1M0EA 4OYHA 1T1IA 4EHNA 1N9KA 2TECE 1XQXA 3KVVA 3O2SB 4H7FA 4Z1MG 3RDPA 3A6KA 5IAGA 3RS3A 4CKCB 5IYZB 4NMWA 1Z83A 3X1JA 5AJVB 4XBFA 1KFJB 2QXUA 4DLZA 5KJFA 2X14A 3FDJA 3A2KA 5JSKA 4TX1A 5T5QA 2PWPA 4KPFC 3S3WA 1HFWA 1U7DA 4U3JB 2EW8A 3NASA 3LQKA 3R3XA 3B1JA 4M0DA 3CZCA 1KKCA 4K2HA 5F21A 5BV0A 2PKCA 4FYPA 3BTVA 1T2NA 1AGNA 2QSYA 2C54A 3E81A 1H8HD 4ZQBA 5J5VA 2F4VO 1F2VA 1HV8A 1Z73A 1W1WA 3KD3A 3NH9A 3EDCA 1SXJE 2IDMA 3PXBA 1L1QA 5DOZA 1XD2B 2Z8XA 2YWJA 4BLPA 3E3NA 4I50F 4B74A 1W85B 1E1QD 1CY0A 2IUFA 4RW0A 4MS1A 2IX3A 4WLVA 3OP1A 2K9PA 4C6RA 1MG5A 1MAUA 5LJLA 2MYPA 2XE4A 1CZHA 2ZJZA 2GZRA 3UCFA 3KLBA 4I3GA 4HQ0A 3A0RB 5L3SA 2WDPA 2XGMA 2ZANA 4J0DA 4PHTA 1VYUA 3HK2A 3HJBA 2BMFA 4MHOA 2JKVA 4MEBA 3L0BA 4KUHA 1EK5A 3QNEA 2NTJA 1BXKA 1NPYA 2O3JA 4U6NA 4B4VA 3AHDA 3RVOA 1DBRA 2X1VA 3V5NA 3BJRA 2NO7A 4LJ7A 1P5HA 4QEZA 3ASOB 3ESCA 2O8DB 1A7AA 1PJTA 1ZVVA 1BDMA 3R65A 4F3RA 4GMKA 2Q3HA 4EFEA 4QXAA 1PFWA 1I80A 2AYXA 5CIQA 1KO1A 4YT5A 3M82A 4J42A 4LSGA 1DDOA 5JARA 3FR8A 3MC1A 4I1YA 1Z34A 4H1HA 1G8AA 4L0CA 2GXUA 5I7EA 4N76A 2ZWIA 4J0QA 3HN2A 2GVDC 4LBZA 4LDNA 4YCDA 1KY4A 4UEKA 5LQSA 3VU8A 3L8ZA 4JFRA 2ISCA 1XQVA 4GXRA 4XRRA 4XW2A 3VR5D 2ZIXB 5H3CA 1GKYA 1D8AA 5CT5A 2CUKA 2HJ9A 1WR8A 4EATA 5KNDH 1N9GB 2GESA 2PZFA 3EIEA 3VQWA 4Q93A 5BW8A 2VAVA 3GYGA 5DOVA 4FIZA 1J8MF 1F7YA 1QQ5A 1BZKA 3VUEA 5KKCA 5LXTF 1V8FA 1LWNA 1KDPA 2ZJOA 2Y3IA 1XMJA 2XKKA 4P2GA 1NM5A 1A8HA 5E8RA 5GZ3A 4JI2B 1VCHA 3NTOA 3RSHA 1QXSA 1I24A 2HF9A 1II8A 3LBFA 3AUXA 1LLFA 1EKXA 1GGEA 2GV9A 3JARB 4DMGA 2CLIB 1YZKA 4J9ZB 5L4SA 3V55A 4RK4A 4IFIA 4IQ0A 4OQLA 1NH2D 4UCQA 4RFVA 4ZI7B 3OTIA 3L4JA 5K20A 3Q3EA 2XBLA 1KDRA 4MS4A 1G2IA 4LE0A 2H5IA 3PNMA 2CXPA 4JIGA 4DA0A 2Q67A 4GI5A 4JJAA 2X41A 3KAQA 1BFUA 3GDWA 1JECA 1IDOA 3ZHYA 1Q20A 4DW0A 1H85A 4BO2A 2XBUA 4IINA 3N2KA 1I51A 1V5WA 1OGYA 1O94D 3Q3CA 1N8KA 2VSNA 4HQ6A 4KMSA 4CV0A 2JDIA 2YVQA 4KB5A 3IDQA 4C89A 3E9CA 1OHHD 2E48A 3LY5A 4V0RA 4LY9A 3C4QA 1BHJA 4HN4B 2A6PA 1ZRSA 2ETVA 2BEWA 1P1JA 3CR8A 1OV9A 2H54A 5JDIA 2QWQB 2ZKLA 5LP6C 3T7KA 3VDRA 5B1BB 3W06A 4ER5A 621PA 1AXRA 3CR3C 5FP0A 3EA5A 1IXZA 1N4AA 1OBCA 3IALA 3EEBA 1DB3A 2QAGC 4XA8A 5P8WA 4DC0A 3O8NA 1MU0A 1ZX3A 4UVBA 1MVOA 5DXFA 1MEJA 1F6DA 3I28A 4TT3A 4YP0A 3WKEA 4C4TA 2C2HA 3SEQA 3T15A 5IKMA 1OX6A 4I5DA 3J80N 1C0IA 1YC2A 2B92A 3C7KA 3JYQA 4RABA 4S0XA 3U3DA 2CBXA 3VDXA 4BKPA 4YCCA 1P4RA 2G83A 2H7CA 5H0IA 5LA6A 4K9SA 2W2MA 3ZDQA 1L6IA 1US8A 3T06B 1QIFA 4AJHA 2RI1A 4P36A 2C4NA 5D5HA 5EZYF 3NKVA 3STUA 4XWOA 2OFXA 3GZNB 3A28A 1GKIA 1R5JA 3OEED 4JU9A 2GPAA 2Z0MA 3PVCA 2FMKA 4FWTA 3RRFA 1X87A 4MQ5A 1D2CA 4MSWC 4BJ5A 4DV7B 1KZ4A 4E15A 3HC7A 2R97A 3ENNA 1ZNZA 2QNRA 2UZ0A 4G8JA 3CISA 4HG2A 4LYJA 1KQSU 1AZWA 1OLUA 1E1CA 2RHJA 4XD7A 5FWXB 4L3WA 1MOPA 1MX3A 3E7PA 1ETUA 4BMOB 4R2MA 3RIGA 1UADA 4JXJA 5L3RA 3LDCA 2HCBA 4IMJB 1TTPB 3RGWS 2DLNA 1H5NA 5HMMA 4QREA 1CERA 4YP6A 1C2YA 4PA4A 5HFAA 2ZWOA 1L7NA 2PF4E 2NSYA 1VF7A 4UU7A 1VSQA 2PZBA 1OCRC 1ZJWA 4ZJZA 3JPYA 5B4UA 2EEZA 3EUFA 2Z3VA 5ADUS 3ANSA 4BEBA 1WW8A 1QGUA 1X42A 2ZB8A 4C7VA 2PQMA 4YT8A 1YI1A 3FYSA 1I5EA 4U8HA 1E2PA 3JS5A 1NP3A 1QIGA 3WJ2A 4FTWA 4MZXA 4P0TA 5KC9A 2HF2A 4R54A 3VSAA 4AFNA 3SQDA 3WMGA 1XSEA 2EYQA 1IWPB 2I6GA 4RUFA 2XXAA 3FTCA 2PYJA 1VARA 3A3PA 3ZUGA 1KEZA 4YJFA 1UBTS 4YV2A 4PC3A 4DDWA 3RFTA 3ROKA 3KCYA 2IJJA 2VAPA 5FA8A 3V3TA 4DRYA 4ER3A 4URVR 1ZU5A 3ZDBA 1EFAA 1IUNA 3NUZA 5IX8A 1NKDA 2XHZA 1K27A 4UV8A 1JHDA 1A9SA 4UTXA 4NB5A 3ZHSA 4RVDA 5HJ2A 3ZK8A 2A9JA 5HFNA 4OXXA 5LQRA 5GW7A 2C77A 3E61A 3CRQA 4X95A 3RAEC 4R41A 3IO5A 3LVQE 2Q3DA 3NM5A 1GAQA 3VTZA 1HRDA 1CP2A 2ZNIA 3G0BA 4V1CI 2IU0A 4IHKA 3H97A 3LUJA 1PK9A 1U8YA 3HCPA 2JATA 4OLJA 1PJCA 2CNLA 3VYWA 4D3SA 5D5QA 5CB4B 1UAGA 1R4NA 2GVZC 2XRMA 1BJRE 2P9YA 3SYKA 1NF2A 3UMGA 2ZD9A 4I4IA 1CRWG 4WX2B 1YKSA 3PFKA 3LDUA 1A8UA 3RJTA 2I6FA 3PWSA 3KX2A 4JVSB 4BB9A 1UC9A 1H1LB 4WJLA 3RFUA 3KHSA 3D3KA 4QPJA 3NO4A 3K5HA 4G97A 4BAUA 4QM7A 4IS3A 1KHTA 1MHPA 1ULBA 1X9IA 4R9NA 1ZD1A 3BRQA 4PD4F 4L7QA 1OXKB 3ABSB 2WJYA 4BUCA 3TTVA 3GIDA 4OJKA 4ZMRA 1UC4B 2IOHA 3NGXA 3T7AA 2ZIGA 3GFRA 1ULTA 4DMUB 5HQ3A 2WLJA 1K0FA 1YJQA 2V9PA 1CUDA 1KEEA 2XBMA 1K4KA 4Q5IA 2QKCA 3MMPA 4BEVA 5EWLB 2FUG1 1TKBA 2PCJA 3M2TA 3H11A 1DTOA 4MVSA 3DJYA 5I7AA 1AA6A 3S3XA 1V1RB 2BP7B 2JCBA 5LBIA 1G8PA 1G42A 2PRYA 2VDWA 4ICIA 4CIXA 1P39A 3IKLA 1G59A 2D5LA 2G7ZA 4K9RA 5FO1A 1G4YB 3T34A 3THSA 4M6WA 2MR5A 4LXUA 3REQA 3BC1A 2NR5A 4LXIA 1Y6RA 1BOOA 5JCXA 1R1BA 4FOOA 4Y6OA 3GJ6A 4DIDA 2R1TB 3FB4A 1SN7A 4IAOA 4ZD6A 4EG5A 2PUCA 4IRUB 3JRXA 3JYLA 5EBWC 3GQBA 4MQFA 3TE7A 2ZSEA 3SQXA 5I7FA 3S7ZA 2B9ZA 2FZKA 4ZI7A 4GFDA 2L42A 4QUEA 4DJAA 5JY6A 2VKTA 1MHTA 2CEKA 3VH3A 1U02A 2JGUA 1WHSA 3CMCO 1JFFA 3G2LA 3L06A 3OW2U 1IBRA 4IIEA 3GPCA 5EJ5A 2JDID 4G2TA 4P84A 5DMHA 4YXWA 3N75A 4EVSA 5AIBA 4JVNA 1VDMA 3CH7A 4TQFA 1QUFA 4WUTA 1OLXA 4H59A 1Q0LA 5FUWA 2I3BA 2IU6A 1T8YA 2O1WA 1HRKA 2GS9A 2PKXA 3QKUA 5CW1A 3U39A 3QO7A 1PJ3A 2GN9A 2GMWA 2HK6A 2R86A 3QI7A 4QPZA 3TNJA 4GNKA 1RRCA 2PGDA 2XVYA 3KFXA 4O2AF 4A23A 3D3WA 4QLAA 5FWYA 4ZT4A 3V46A 1ZJ6A 1MW9X 2B83A 1QHNA 1X1EA 2Y27A 3MTQA 3VJKA 4AKTA 3EGXA 3UAVA 3I5UA 4OIFA 3DBRA 1TM1E 1YK1A 1YOVB 3K9HA 2QWPB 3CC2V 4I66A 4TPKA 3DH0A 4KVZA 3CF2A 3AY3A 3H7AA 5B2ZA 1XLTA 2Q7DA 2YW2A 4P98A 5G0TA 3AZOA 2PMKA 3Q6IA 2P4UA 4OJNA 5BN4B 2HW8A 3BTOA 2DRIA 5E8JA 3CVYA 1DBSA 3UJDA 3AESA 3FTPA 1B1CA 2BBSA 1O57A 3KZKA 4B7KA 4WF9V 4N7MA 4DUZO 1RCFA 4EF4A 3LPLA 3U7QB 4RQBA 5A62A 3AY6A 3PC2A 1JQ5A 4XPZA 1VXRA 3LX6A 4MLDA 2FPIA 3HBNA 3M9LA 1NVBA 1MMMA 3KSMA 3GD5A 1QDLB 4FS8A 4RSRA 4X0EA 3WZLA 3MWLA 1VSUA 1OPRA 1P2VA 2B20A 4BPRA 3HCCA 2OZLA 3EXEB 3GZJA 2X7RB 1FJGO 4UB6Z 3R75A 4L4ZA 4C07A 1H9AA 1UKYA 4ZDJA 3GH1A 1C30B 1NMEA 1PDOA 2XEDA 1YONA 3DB1A 4D9EA 1U6KA 2JGDA 3DDNA 3FUTA 4EL0A 1ACLA 4X88A 4DV4B 5KKAA 1I4OA 2BD0A 1NRJB 1DDGA 5CEFA 3FNFA 2OBYA 1N57A 3RARA 2ARHA 5JASA 4JLAA 2YVLA 4HUQB 3B77A 3UJCA 5JI2E 1BN7A 1JSXA 1O94A 3LTEA 4S05A 3H5WA 2Y05A 1LWOA 3DEIA 2ZI9A 3VKHA 1QUEA 1VJTA 4CL2A 4MUHA 4E1BA 5ALDA 1GPBA 2BZGA 1VSVA 1CJVC 4H18A 4KHPO 1IRIA 3HEAA 1TUEA 1OWMA 2J0UA 2XMSA 3PHCA 4X24A 1JFSA 4J7JA 2P3LA 1HI9A 4DYVA 1RM0A 1THZA 1IPFA 4RWUA 1XZKA 1YE3A 2MDTA 3DAYA 1MNQA 3DLTA 3CKYA 3E05A 3LUGA 3OZFA 2IKSA 4N5IX 3TRDA 4BJHB 4KWCA 3RHTA 4UUAA 1CNEA 4L02A 4XWYA 1WS6A 3NTRA 5AMXA 3PLAE 1RVV1 1P7CA 2Z9CA 4X8OA 3CBGA 2CT8A 1WQ4A 2O06A 2ZWPA 4MW7A 1GU7A 2WSMA 3TXQA 1ZKDA 1V8BA 5D3MA 3RJMA 1J2YA 3X3HA 4FI3F 2FSVC 1KAOA 2NVUA 1NNSA 3K9WA 4PSKA 3FTDA 1PFKA 3W4IA 2P3SA 3NVDA 2QXYA 2A67A 4DEVA 4K7JA 2WJPA 4PDMA 1E5TA 4H27A 4UHBA 3TRIA 2XCUA 5JD3A 1JA8A 2AOVA 1W4RA 1NYLA 5B5EZ 3AG1C 1F3LA 4CUZA 1NVEA 4CUKA 5JWPA 3W0LB 3CR7A 4YCSA 1U96A 5G1OA 2XWJI 4I8XA 4QC2A 4L2IA 4MZDA 1X3SA 3AG5A 4ZIBA 1WB5A 1XUOA 1RHJA 1PW7A 3QHQA 1XDBA 5HILA 4IILA 2D0OB 2A9QA 4HNRA 5BRJA 4TTPA 4UXIA 2ZSUA 5E6UA 3DLBA 1B2LA 3ZN0A 2CCKA 3CC4V 1LK7A 2VXBA 2NP6A 1S4QA 2YFHA 4E31A 4IVPA 2J31A 2VRNA 2VRBA 2Y66A 1D1QA 1GR0A 1Y6JA 3HJNA 3IMKA 3AUYA 1Y1PA 1J5XA 2IQ5A 4NCNA 2AGAA 1DFGA 4KO8A 4TLBA 5L3FA 5TR9A 4M0EA 3DO5A 2YBEA 1VXOA 3CX3A 1E9CA 1YDMA 3FWZA 3KQSA 1VFNA 3BL6A 4HLQB 1HBJA 1VMAA 4DJDC 2DBRA 4JDUA 4UEWA 2AHOA 3Q7PA 1LTHR 3OPQA 2OCCC 1YCHA 1ZSYA 3OC6A 4XEUA 4CYMA 2EC5A 3WGTA 3O90A 3FAKA 1G60A 4DB2A 1HEIA 5TVGA 3UK0A 1J0AA 3HPQA 4MUFA 4PG4A 1EN6A 2HQSA 2W6PA 1WXIA 4JBIA 2AOWA 4MW1A 4QPJC 1CZOA 2RGAA 3QVMA 1H38A 4LYDA 1TIKA 1NLUA 4EB6A 5JR3A 1U8EA 4MVYA 4J0FA 1YR2A 2A59A 3EDMA 4HNAA 1X6VA 1YDWA 4PF1A 5HTOA 3TVDA 3PHLA 2Q0AA 1ESDA 4FW9A 2E4AA 4NDNE 3G0OA 5DZSA 1TA8A 1TZKA 2WWXA 4YHHO 1AS3A 2GBCA 3UPUA 4DV2B 1E79D 2UYQA 1OTHA 1WOYA 4L78A 1COWD 4YAKA 4XTCS 4C4ZA 1QJCA 5LQDA 1Q83A 4UXJA 2C2KA 2GN8A 4L0QA 1DC5A 2DQYA 4U39A 5FD8A 3WLPA 2BBTA 5JECA 3T3IA 1F4PA 1WUIS 2JL1A 3G8DA 1EBFA 2GK6A 2H48A 3L1UA 5A3QA 2XYGA 8AT1A 2GBIA 2IEYA 2FSHA 3B3JA 4HWKA 2O23A 1BA3A 4J8PA 1RSOA 3UOWA 5CT9A 4E3WA 5JAUA 5L7WA 1EHYA 5GJBA 5CT4A 3SF8B 3AK2A 1P72A 5CGZA 2IWRA 1PZGA 3IOBA 4BFXA 4P34A 4TVSA 5I8PA 4RY8A 3AF3A 1SKYB 2JFFA 3ZQ6A 4ZEMA 2XCLA 2HG5C 3CEPB 2L82A 1U2PA 4U7NA 3AEUA 5HCUA 4B76A 1FVHA 2VT7A 3EWSA 1R8QA 2JI9A 2HXGA 4B0OA 1NDUA 2ZWVA 2ZCEA 3H7IA 2FN7A 1DBPA 2X5NA 1Q7EA 4LCJA 2XD9A 3GRUA 3L1KA 1QU7A 1X4TA 1Q16A 2RSLA 1P1BA 4HJRA 4L76A 5ED4A 2YWFA 2WSBA 3IP5A 3KZXA 1W88B 3IHWA 4ZCTA 1FYEA 2QX6A 4RY0A 2O0JA 4TSFA 5EE5B 1B0UA 4U3FH 1RJFA 4G1EB 3UG6A 5CCEA 1TA9A 1YR3A 4FWIB 5GWXA 3CUEF 4KQFA 3UQ8A 3I2IA 3K5LA 1MIOA 1OREA 4KSBA 4BECA 3OWOA 1MVLA 2R9AA 4D02A 4ZICA 3N8GA 1MV5A 1QK5A 3E8XA 4F6RB 4ASUA 5C7IO 3K08A 1A2QA 5KYGA 1DEHA 2CNNA 1N0VC 2Q3JA 2XJ9A 5CA1F 1WB8A 5KOHA 3B6KA 1Y6XA 2H4ZA 3L77A 4Q7QA 1RWXA 4PG8A 1KFEB 1AA9A 3H2GA 1P61B 1SHLA 2XLBA 1IY2A 3CURA 5I4IA 3E1SA 1T0UA 4QU8A 1DXQA 5JH7A 4BKUA 5C2JB 5GIOE 3VO1A 1GG2A 3C6KA 3I1FA 1GL6A 1KDZA 3CTPA 5J2TA 3QITA 2DW4A 2YYSA 4NYIQ 4F1JA 3GNTA 5AKXA 2I76A 3OTFA 2OVFA 3O2JA 1YQTA 4C0BA 1WXEA 5AJUA 3QWFA 1MUUA 4MVJI 3AERA 3ID6C 3ZXYA 1D6SA 5IYZA 2QWXA 2C3YA 2WPNA 4BVKA 3WSVA 2PTMA 3R0ZA 1U80A 4AZ3B 3K0HA 2B34A 2A0YA 5IVDA 1K4DC 1M56B 4A2WA 4C7OB 2HMAA 3H18A 5C37A 1P7VA 3UM7A 1M1ZA 2V0CA 5ELLA 3QBEA 1JEAA 4MRPA 4DDMA 4N0EA 1Z0FA 4BJ3A 1C8LA 3KXPA 4EGCB 5C53B 3NH6A 3HB9A 1VKHA 1BMTA 2DMRA 3FTNA 3M33A 3QUCA 2YMPA 4N39A 2J32A 5CVUA 2PSDA 4JLKA 2I8LA 1E6UA 1MABA 3SM9A 1BMFG 4BFWA 1TJ4A 3QVNA 2ZKOA 4JT8A 5JJEB 1G7SA 3G0DA 1KSHA 4FFBA 1NJ1A 3Q72A 1PV0A 5ICEA 1H2AS 1CY6A 1TXGA 3FSEA 2A94A 2BGUA 4ESHA 2CLLB 3A27A 2CMHA 3RRBA 1XAHA 3ZU4A 4YHHB 1TQ2A 1W581 1YR9A 2QD4A 2XUFA 4FK8A 3LH5A 5CT6A 4D9MA 3OKFA 5E79Z 5LU8A 1JPVA 1OFGA 5GP1A 3A0RA 2HU5A 2XWSA 4YJKA 2IW3A 2Z8YA 4DXWA 1EXMA 2O5VA 4WY8A 1R50A 2ECQA 3F67A 4OVKA 1O9BA 3SBOA 2AC2A 1LLQA 1W93A 1N5OX 2RKOA 3ZWPA 2V6GA 1V55C 1CF2O 1GRRA 3G02A 5DN6A 1REQA 1LVUA 3V1KA 2BKXA 1VLVA 2ZXFA 2AUNA 3WNVA 2O8EB 3H2ZA 2IKQA 3ZTTA 1J42A 3EQ9A 4PFSA 3ZI4A 5GOZA 2FSFA 5KTMA 1ETHA 3CLTC 2Z1MA 4M1OA 5E6UB 4MS3A 2IGBA 3OJFA 3WLHA 4NI5A 3UMSA 4V1CB 5HFMA 4GZ3A 3CX5F 3IHTA 3LJKA 1L7MA 5D87A 1ZM2A 4IS2A 3WYBA 2C0PA 2XW6A 1FLVA 2GD6A 2QM4A 1G5TA 4FMDF 2A92A 3K9QO 3FHCB 3NAGA 4JC8A 3H1LH 1ZRHA 2EKBA 4ENSA 5ICMA 4QDTA 3COPA 4X6UA 3Q8MA 1H6DA 4LE2A 5KYUA 1DG9A 2G1KA 2CB0A 1EEHA 1HMYA 2R6CA 1VL8A 1MX9A 4BMYA 4BHTA 3S2UA 2QIPA 1E1NA 2FN3A 3A11A 5DWQA 4CKXA 2IP4A 2WQ7A 1E4EB 1Y7TA 5K0NA 1Z7YA 3PNBA 2OAQ1 3RYCA 1IN8A 1X7WB 2CHEA 2QGFA 3OIDA 4B82A 1OFVA 2R4TA 1U5AA 3OFVA 4BW5A 1CZKA 1LSOA 1LK0A 2OV8A 4FKMA 1KE2A 4RV4A 4EKEA 1A71A 3UFXA 4MDEA 2Q1UA 1E79A 3BJMA 4R1NA 4YRLA 1R6BX 2OXRA 1KXJA 3W9UA 1GYPA 2P6NA 2P5UA 2VWGA 3Q9UA 4OG2A 1LX7A 3HNOA 4FLEA 5BV8A 3DCJA 3ROEA 7MDHA 1YJXA 2Y4OA 4XVUA 3WS7A 2EQ5A 2H00A 3ILVA 3AKYA 3KS9A 1NJIW 2CMGA 4M8LA 5G40A 2NPFA 4EI9A 1FMLA 5TT1A 3AU9A 3NBKA 4TV9F 1YDFA 1DQNA 2KSDA 1WPGA 1WTAA 1MGOA 1WLSA 3O26A 4URZR 4C0AC 4ARBA 4O4LA 2VP4A 3EF1A 3EFOB 4GQIA 3EIWA 3ONVA 3BA9A 2W83A 3GLQA 4JYPA 4POOA 1GTG1 4H15A 4IM7A 5CA1A 4KTTE 2REXB 1O6BA 2AEFA 5BSGA 4OHKA 2OZPA 4LMPA 1W2BU 1FPQA 1CXZA 4A15A 5FA6A 2F8TA 1O8CA 1YXMA 2ENWA 2JGRA 3ELYA 4WQMA 5TNXA 1I2DA 4UNQA 1NONA 3PPYA 4IJQA 3H1AA 2PFKA 4FNOA 4IQ8A 5B1IA 2A4MA 4FR0A 1XTSA 1N4DA 3LLUA 4HVTA 1OCZC 3LGAA 1SVMA 2FMLA 1S2IA 3FA2A 4BNKA 1F51A 4GI1A 4CF3A 2QE7A 4DYHA 4EYSA 5BNWA 4HPXB 5CK4A 5AKZA 4H7HA 1O87A 3MTBA 3ASYA 5FFFA 3AG7A 3QF4A 4K9QA 3W90A 1CZRA 3NM6B 3PENA 1DARA 2D5AA 5EI5A 4EF5A 5I9SA 5AHWA 4NH0A 1NW9B 3KQWA 2VH5R 2WAOA 1K6JA 4NBUA 1V9SA 3AO0B 2RBKA 3LUFA 3JD1A 2W71A 3MUFA 4RTPA 2FKNA 1VF5B 1Y9AA 3AV0B 5LNK1 5ALMA 4PLHA 2ZB3A 5HJEA 4H7PA 1S0VA 4DQLA 1B3QA 3L01A 3IOCA 4EBBA 4ROSA 2JJ2G 1Q1GA 1EK2A 1ZI6A 3NDRA 1ISIA 3QQ5A 3MM4A 3L2OB 1SC4A 1T3GA 2VVTA 1Z6ZA 1IN7A 2V9ZA 3OJWA 2VTBA 3M7MX 3OUSA 3A4LA 5JSYA 1NXTA 5IDWA 5J4KA 1QHXA 1OCCB 2NPOA 1Z5NA 3G9ZA 5BN3A 2B4YA 3T4UA 5KOHB 3GLFE 1E1CB 2NM0A 5FWXA 4ZDWA 4OH7A 4DCSA 1R73A 3BMCA 2PNFA 1S72V 1SZPA 1EI9A 3S7TA 5DYNA 3B1ZA 1FXUA 1ZMXA 1OZHA 1XJ5A 4Q7JB 3WGJA 2QRJA 2RHHA 2GSMB 1NTMH 1EAYA 2WIFA 2VATA 4F5ZA 1FS0G 1JEQA 1NOKA 1G5PA 1GKKA 2YIBD 1IBCA 3TSZA 2B2XA 5K0BA 3TIXB 4CF6A 1RZVA 4B3SO 1YS1X 221PA 5ALWA 1J7KA 5A04A 4R4JA 1PDVA 2EIXA 4FU0A 1XZFA 4TTSA 4QBGB 3RFXA 4LF5B 2GPYA 1B14A 3SR3A 4TN1A 5EC1C 2INGX 1EE1A 2OG2A 3W2FA 4DQKA 2GK4A 3KAPA 5FUYA 3AVQA 3CZRA 3HABA 4DR1B 1GTJ1 2NTVA 3OJXA 3AJRA 1G5HA 2E9SA 2DULA 3KXLA 2IZOA 3C3WA 2ZIFA 4JLOA 4ZGWA 4Q00A 1ZAYA 1M1XB 2ASVA 3KR2A 1EQ2A 1HK7A 2PVCA 2IYXA 4BB0A 1NP7A 3U4HA 3AM1A 3OR7C 3MB5A 4PLWA 4L16A 3IE1A 1U0NA 3RO7A 1GL3A 2VXCA 1F2UB 1VM6A 4ABYA 2NXNA 1GQQA 1V37A 1KSJA 2FDRA 2W70A 2CMFA 2ZYRA 3Q9NA 3EOAI 3THXB 1KI3A 3CCCA 4JJIA 1YCFA 4AO7A 2F2TA 1SC6A 1Z62A 2VJOA 3HCAA 3VQXA 1B6GA 1R18A 2PIAA 1IH8A 3R3SA 3X2SA 3F7NA 4G9BA 4P4LA 1VPWA 4C21A 5DBOA 3I1JA 3OKCA 4TWRA 1PD1A 1LW6E 1TAQA 5A4KA 4L75A 2C1XA 2PZMA 4B6OA 1GM5A 4WNAB 1NZ6A 1EFVB 3FJ1A 5CB4A 4Q4AB 3VPSA 1R4NB 1M8GA 1E5QA 4AWBA 3RAFC 3W8DA 1OCOC 2P6JA 1X0VA 4A73A 3PR2B 1ELOA 3B8HA 4HP8A 5EKSA 4ESEA 5BVGB 3KTDA 4Q15A 1EGVB 4NR1A 4U7DA 5EPEA 3DGEA 3JQAB 4BZPA 4CDGA 1R0RE 5JOQA 1TUIA 2C94A 1ZK0A 3V7UA 2P6UA 2XB6A 3PFNA 3BPZA 2QR2A 2YXDA 4QG7A 5BPFA 3F3MA 1E0JA 3GRZA 4HRYA 2VDQB 3BFPA 3QVKA 3ZCXA 4NULA 4URUR 4ZVNA 4MVZA 2G4CA 3AXSA 4CGZA 4ANFA 4NP6A 3T1QA 4ZARA 1CLUA 3VVBA 5IN4A 2ZM5A 4NV0A 2IYQA 4KPYA 1URPA 1QDEA 4L7VA 4B6RA 2ZRBA 1YJWV 5JRJA 3IVCA 4C4SA 1KO5A 4BV8A 1D5WA 3A2NA 2PPLA 1MFPA 3JZMA 4RHUA 3MQFA 3VNAA 1RLMA 3ORYA 5EJ6A 4Q02A 5SYMA 2VDWB 5KNBA 3V2IA 2I6UA 2ZUFA 1KMMA 4QT0A 5CW2A 3QTTA 1M6WA 4YPFA 3X1KA 1V54B 1WP4A 2KHZA 4M6WB 4CIBA 3AHHA 3SDSA 1RM4A 3L07A 2YIDA 4PPNA 2ANBA 2JEXA 4GECA 3FFWA 3OM8A 2CGOA 4YRNA 3AM3A 3Q5GA 4EKGA 1E9AA 5BNFA 3QLVA 2ZDIA 1VBMA 1O5TA 3P9PA 4IKPA 3PPVA 1X0XA 4UBNA 2Q68A 5HG0A 1RBZA 3V1TC 3UBMA 4F2GA 4OHMA 2P2GA 4MUYA 5I3ZA 1LDBA 3GOQA 3K0BA 3A4VA 2GN1A 2HA6A 2WTMA 3HQ4O 2UZ3A 3KQKA 1Y5IA 4O4LB 5DLPA 2X0JA 1SUPA 4INPA 5DU2A 5BQ5A 4BO9A 1Q12A 3SJQC 2EBFX 1PZXA 3MINB 1TX4B 3C3AA 3QKSB 4TWAA 4J76A 4DUGA 5I9MA 2CFCA 1OKKA 3BSWA 3MT0A 3OZAA 4B3JA 4D82A 5JNLA 4JZGA 3I9V6 1RE0A 4M9RA 2Z04A 4Y8VA 2F9FA 2P9CA 3F9IA 4GZMA 1IUKA 4MTOA 1RPAA 1YH3A 1T9AA 1U1DA 3RNLA 3SKYA 4EG3A 3I32A 4CCYA 1G2PA 1UBNA 4NJMB 1U9IA 4MVJG 4P81A 3V2HA 5IT9N 4TGLA 4I4TA 2ODEA 4FHFA 5EJFA 3O0DA 3X2QB 3SHQA 1W6UA 4FDLA 5IYCO 5CYFA 1NUQA 1HLPA 1LA2A 1PI3A 1VQKV 3EUEA 2VF7A 3VX3A 5K3BA 1P2BA 1GPAA 1X1AA 1TK2A 1VJ1A 3BWXA 1Z0JA 1L4HA 1E5DA 3VPHA 1GTRA 1E9BA 1PWEA 5EWJA 4QOJA 3UCSC 3H87A 5IEBA 5JNWA 1XR3A 3OPYB 2XZLA 4PONA 1UR5A 4CT0A 1V7CA 5AKGA 5THQA 2C4WA 1Q92A 3QY0A 1V2HE 2C82A 4MW9A 3JZFA 2WJ6A 4BP1A 4CRWB 2AT1A 5T64A 1T35A 1VQLV 1OVGA 5EP2A 1S3FA 3W6OA 3W7SA 5B7QA 3P9RA 2I8CA 3ABRB 4TMXA 3W5AA 1TM3E 1UZAA 2CBGA 4DPLA 2VQEO 4HAUA 1H2KA 3LY7A 4OJMX 3O84A 3W6ZA 5IJZA 4ZVVA 4IGAA 3D7SA 1DQSA 4AN0A 3WV5A 1N78A 3RK1A 3FDIA 3FD8A 3DMGA 3VQVA 6ABPA 1F5NA 2F3SA 5JWHA 4F04A 3LS2A 2AJ8A 5GM1A 1S4MA 2FZGA 4TTVA 4MAMA 1FRQA 3JWIA 1XRJA 2FK7A 4YN3A 3RROA 4P7GA 4DQVA 2HPHA 3ZE2B 3UT5A 3C5WP 4N82A 2JAWA 4FOLA 4H1UA 4NQZA 4QUGA 5BP7A 4XAQA 3NNSA 4OP1A 4EKNB 3U1BA 1W5EA 1ZM9A 3K0SA 3D7LA 4F1KA 4OLAA 3FLBA 4KR6A 3EHBB 1MGPA 1V8OA 3E27A 4IZIA 4NXNO 2B3TA 4OAQA 5DV9A 3FG9A 1T36B 3FDZB 1VG9B 4XDLA 2OCPA 1WF3A 1CUSA 1YUBA 1D5CA 2ZBUA 4OHUA 4W9NC 1NVKA 4P82A 5JXHA 3UJNA 2ST1A 1TMOA 4YECA 1FDTA 2GN2A 4C7KA 5KSPA 3TNFA 3K70D 2HBZA 2BGWA 1E4VA 2JFBA 1GXSA 1ECFA 5SYNA 3TTUA 2IZ5A 2Y1XA 3K4HA 1T0PA 2OSVA 3UENA 2ODBA 4B7AA 2WQ6A 3W5SA 7ADHA 3UF0A 1D4OA 4YROA 1QQ7A 1ZM4A 2XMCA 1DOHA 1KVRA 2XADA 3A4YA 4UUPA 3Q12A 4IIVA 3EVTA 2BDUA 1XELA 2X9VA 3KLNA 3FFQA 4Q01A 3BGDA 5DYTA 5JAOA 3U0BA 3V9PA 2CWWA 1DAPA 3IUQA 1QYIA 3KVRA 1FXKA 2Q73A 3F5WC 4LJ5A 4PQEA 3QU9A 4QOGA 5GV7A 1KI4A 4BDTA 1K3TA 4NJOA 3ZKWB 1R0CA 3O38A 3OEEA 3PL5A 4JL8A 4K35A 3O8OA 4WKOA 3RSCA 3SHVA 1H0HA 2Y77A 3CRNA 4I14A 5AH0A 5AXDA 3RRYA 5A9RA 5JU6A 2O2GA 1RAEA 2I1WA 1UBKS 3CVOA 3L4BA 3ZGYA 4G36A 1NJ6A 1LH0A 4CKWB 2LW7A 4YV1A 2W0SA 1NQ5A 2ZR0A 3F7VC 1IFXA 1NVXQ 2CJFA 4LVUA 1A4RA 2HADA 3X2QC 4CTMA 3TBFA 2P3QA 2AV6A 2FLWA 2WI8A 1EGHA 3M8KA 5DX0A 3G49A 3ZY5A 5AVUA 4Q3CA 2YVUA 3S99A 2BI4A 3CJQA 4DJEC 3TIIA 3BSFA 3PQCA 1EFPB 1B2RA 1NM5C 3M5WA 5EWMA 4CC6A 3T3MB 2W2XA 5JJCA 3BAAA 1U8CB 2PL9A 4GUAA 4A82A 4UCVA 2WLIA 1UJCA 5IBQA 5DN6D 2ZJ7A 1UEIA 2RMKA 1I08A 1GZ6A 2ZEJA 3QV1A 2G80A 4OATA 4ASUD 4BFLA 1VPVA 5LJIA 1NULA 2CHVA 2X22A 4PGMA 2Q41A 5GONA 3C70A 4P5DA 4OQPA 2RHLA 2VI5A 2H8PC 4L07A 4QRIA 5ENVA 1L5NA 4FVMA 4X89A 1JQJC 4IDDA 3JYHA 4N0PA 3RVJA 1VRWA 3F5QA 4FLZA 2QQ5A 3BXHA 3RW0A 1CS4C 2JIOA 2LZ0A 4AMUA 4F11A 1FQKA 3R7LA 4EEXA 2DYSC 1A9YA 2PKRA 3BF8A 5DCYA 1HNXO 4MYHA 1RAGA 2QRHA 3OPNA 2W2PA 3OM1A 1N8RW 3C3BA 1B04A 1YB7A 4UKDA 4X60A 1UMBB 5CUQA 5AW5A 3TAUA 2ZJFA 1YRWA 4CIDA 1T15A 2CK3G 3Q88A 4K8RB 5JJKA 1DO2A 3IUMA 3O83A 3R3HA 1ORHA 5IFLA 1SB9A 2CDRA 4ZVUA 1NLFA 4C88A 2FSSA 4REQA 4WN9A 3C8UA 3Q4GA 1KK1A 2Q9LA 4JBYA 4ISCA 1H1TA 3OBBA 3EC1A 5ALFA 1QYRA 1ZIDA 2AG5A 2C5HA 2Y2UA 3ZMVA 4LI3X 1LRJA 3AYXB 3PCRB 4IDCA 3FUVA 3RABA 2ZDHA 4BO1A 1Z06A 1ZH8A 1ITZA 4XUCA 3K79A 1MOFA 1E94E 3QG1A 4N47A 3SC2B 1NVPD 1S2DA 2OP0A 3WWPA 1QHFA 5KUTA 5JJJB 2YI8A 4GMHA 3H9EO 3VYSB 4A1FA 1Q86W 3OUTA 2LP7A 3R24A 4AF6A 1YR1A 1G41A 1ORWA 3GJ5A 2M9MA 4HWPA 3QTLA 3M34A 4RA9A 5B1HA 3D59A 3AU8A 3VR5A 1ZGAA 2RCYA 1EFTA 3G5TA 4MQBA 4KNYA 3SF8A 3ZI0A 4Z4IA 2Y0CA 3H1HH 1Y37A 4XIJA 1OMOA 3BH7A 4NSNA 1D1PA 1LBEA 4IXMA 5GTIZ 5ES4B 3Q85A 2W4QA 5HXAA 3FSJX 4N40A 3RUPA 3R5HA 1WZ2A 3G7UA 1JJOA 3K58A 1IUOA 1XWIA 3BILA 5EQTA 3VNQA 3HKDB 1MB9A 1NXPA 4YI3A 1BS9A 5DEIA 3K9LA 1UT6A 2AFIE 1PJQA 4FFMA 4GHWA 1LPSA 4YVFA 5EHNA 5K8IA 3CRVA 1X8JA 3U4MA 3NHAA 1JILA 2ONCA 2FZEA 3ZV5A 3AFOA 1MC8A 3MS4A 4BGDA 1Z0SA 1F8YA 4W5QA 3RVZA 2XCIA 1SNYA 1ZEMA 4H7IA 5F4ZA 4F8JA 1O9HA 4RVUA 1T6BY 1TEVA 3R9XB 2P68A 3SYMA 2VT6A 4XJSA 4C4OA 2R1ZA 3X1XA 3IC5A 5TLSA 5U4XA 2OILA 4WTOA 1C1DB 2GDJA 3QPVA 5COQA 1FVFA 4BGUA 1QLEC 1IBKO 2Q3EA 5JXGA 4FLVA 1UBMS 2DT8A 5JPDA 4OUKX 1X1CA 2NNWB 5DW0A 3N8KA 4KWTA 5J43A 3O1JC 2ADPA 2BHLA 3WQQA 1JSRA 4GEGA 4MGZR 1WMEA 1TEHA 4BMXA 4F4IA 1Z0DA 1ONOA 1QYCA 4FCWA 4K86A 3T4EA 3DSRA 4DHEA 1V7QA 4RHEA 1YRHA 3G6BA 2L2QA 1RQPA 4MWBA 2HU2A 2E18A 4URYR 4XZ3A 1T9CA 2X8JA 4J75A 4C30A 2X8AA 4L9SA 2I33A 5FBWB 4ZI3A 3L6EA 4ILEA 4DVGA 2AWOA 2WA3A 1ONPA 1IL0A 1SHTX 2Z2KA 2XWPA 3AG2C 2OEPA 1BG6A 2HDOA 1CC1S 3DL0A 1HQYE 1M2HA 3NOOA 3QLVC 4K81B 4LX0A 3W1VA 2WIJA 1KI6B 5TISZ 5KHKA 4KR7A 4E7OA 2YWEA 1MIHA 3NTXA 2QP9X 5ICSA 2GBOA 5LMUB 1H42A 4Z7JA 4KUMA 1MJ5A 2QY6A 3TB4A 2ZUBA 4L0DA 1HNZB 3T7RA 2FGJA 4QTTB 2ODNA 1NE2A 3EGOA 3ZZUA 4HDKA 3LECA 3SF0A 1QP4A 2OXEA 2RN9A 2PUJA 2F9LA 3C3TA 4ENPA 3F98A 3EPLA 3OU7A 4B5LA 5JVDA 1D7OA 3D31A 2R9RB 1M67A 2XMRA 2BSXA 2A1IA 1SD2A 3BUSA 16PKA 3NT5A 3V48A 2GFQA 4BL5A 1P7WA 2R8PA 4MKRA 2W6CX 3LWBA 2MSNA 1KMCA 2AI3A 4HWSA 1E2HA 5EE1A 5TE9A 4NS1A 2ZI5A 1MO4A 4V2UA 1RDFA 2FFAA 3WG7C 2AVNA 4WXRA 4I0XA 1H8EG 3WRVA 3UKOA 1FX1A 1OZFA 1A2OA 5CGQB 3DGFC 3AUFA 4NBWA 5DE3A 3BEHA 1M75A 4O4HA 4BNYA 5CBHA 5J23A 3E0QA 4QQNA 1H22A 4G0YA 3HDYA 1GZVA 4N3NA 3UAOA 4UJ5A 5JSZB 4CQMD 1Z7BA 2DYRC 4MW6A 3ANTA 4C0WA 3E2PA 1I5OA 4C29A 5JSHA 2B1JA 2IEBA 1A2KC 3CNLA 4JLUA 4K6GA 1OBFO 4XIIA 1GNVA 5DBGA 3VSCA 3ZGNA 2ZZMA 2BLNA 4OTZA 3K70C 1QOPB 1DO8A 2PI5A 1F1JA 4IKEA 5DLDA 3KTFA 4LF9O 1BL8A 1KY2A 1ADYA 2DQKA 2DCUA 3QE2A 5DNWA 4JZYA 1RFGE 4FFPA 2CN1A 2M1XA 4P31A 2PLNA 2DEUA 4HDRA 4Z7OB 4S2UA 3RKUA 2IEIA 4NE9A 1BU8A 5LOVB 1WDKA 2WNHA 4DIBA 5KQMA 1TMKA 3SJAC 4IO0A 1T0HB 1JAZA 3NHRA 1VTKA 3PXCX 5H3LA 1APBA 3FAVA 3GHYA 4MPTA 3SE7A 2GNAA 3KQOA 3NHUA 1KQOA 4WFQA 3ZMSA 2JFXA 3VNBA 2P9ZA 2OCLA 2QRVB 3GPBA 4YT2A 1GTSA 2X0DA 4DR1O 3AKEA 4GXTA 1QZ3A 2VUIB 4D9IA 4PTZA 2WUDA 3DOOA 3TZHA 4HAMA 4F97A 4MUGA 4JBNA 1LDMA 4L5CA 3IQWA 4UOEA 1G1XB 1GM9A 2XR1A 5EPUA 5F51A 5KYUB 3NQ41 3TE6A 4GF5A 3MGKA 2JLCA 4RU1A 3UUGA 4P35A 4BO7A 3HHEA 1RRPA 3I8SA 1R8YA 4ZOLF 2JHAA 2IYYA 2Z2JA 4YJ3F 4E5PA 1DKMA 4J7CA 1USKA 2PLFA 3WWDA 4LRTB 4D3XA 2BMWA 2CL6X 5JXWA 2COEA 5LIRA 3W7WA 4G5HA 1QZXA 1XQYA 2GXQA 3EGVA 3ZHVA 4LMAA 3V8MA 4E5UA 5FLYA 2KX7A 1XCJA 4KK3A 3U5ZB 1TU4A 3GLUA 4OLFA 5IC6A 3D02A 4AICA 1BD4A 1E18A 2JJ1G 3NZEA 1V47A 4LQ4A 5JJ5A 4HDSB 1SVOA 1ZNXA 5GY7A 3D8RA 1DKRA 1QQ6A 2K87A 4RQUA 2EX3A 5HKLA 1US6A 1I7PA 1YCGA 4MO9A 4O2BA 2OO3A 2Z09A 1TM4E 1WSDA 1UANA 1ZL8B 2RFLA 1LBIA 1X7HA 3I8OA 2YNMC 1EN5A 3KSDO 3KOMA 3LV8A 2CVQA 4S1NA 5FWYB 4US2R 5DISB 1NXQA 3C6MA 4H9GA 1W49A 1QWOA 1T4DA 1OX4B 2DQSA 3FI0A 2JD2A 1OA0A 1T5DX 5F2EA 1YASA 5HJ7A 3I5DA 5AI9A 4L9WA 3TEMA 2O2DA 1SD1A 2A9RA 4Z8YA 5FI5A 2XY4A 3AC0A 2ASEA 3O8BA 4R98A 5K3FA 3W2IA 1XQ8A 1ZVJA 4V0NA 5BNZA 3N0VA 1CQJB 5BSHA 1MT0A 5AKYA 4PAOA 4A6EA 3SS7X 3C85A 4NNPA 1FQWA 4M9CA 4NDZA 3KR0A 1T9DA 2DWPA 3UH0A 1N6HA 1GGJA 1VMEA 4DR7O 2Q8QA 4RF4A 1F48A 4M37A 4N5HX 1YZ3A 4F5EA 5HSGA 3LCMA 1N3BA 2CLEB 2IF0A 4M98A 1VLJA 3UAGA 4M49A 1DOZA 4DUYO 3BIJA 5ALOA 4JI2O 2JAQA 3DZKA 4M38A 2NU9A 1KERA 5A9TA 1M2FA 1EUDA 3RTCA 1AK2A 3PI7A 3R1IA 3T9FA 2YWBA 4UEJA 4B2YA 2FSUA 2QTTA 4XFKA 4C0QC 2C9OA 4ZJYA 3PGMA 5FX2A 5JD4A 3MD9A 5G0SA 3N53A 3FYUC 2PGIA 1KI8A 2HJGA 2XQJA 1AR5A 2XUQA 1I8TA 4HDNA 2XODA 5IY5C 4HR7A 4MUJA 2PGJA 3KPUA 4HH0A 4E32A 1H3EA 2B5OA 4EUKA 1I6KA 3QU5A 1L0NH 1ZSNA 5I9TA 5FBVB 4E2FA 4PAMA 4ZKEA 3DWGA 4EEQA 1A5SB 1M2KA 1K8RA 1U2GC 1AF7A 4MVUA 3KL2A 2YYYA 1ZTEA 3OOWA 2V45A 3WU2Z 1AQYA 1QDUA 5F2OA 5C3UA 3TSAA 3I01M 4O4HF 4ZOEA 2RC6A 1IG0A 1MD9A 1XEQA 4RENA 4BGVA 2AUMA 1LQTA 3Q4HB 5AKIA 5KVVA 4R1SA 4L9RA 4ZO4A 2QSZA 3C6YA 2OCAA 1YCDA 4JI6O 1XTJA 1ZXXA 3RC7A 3MGGA 3Q0EA 4D6YA 5JCJD 4BP3A 3BMOB 3QLTA 3GGGA 4ZODA 5EXXA 1I4TD 2HMWA 3VPFA 4BE4A 3PJEA 4HL6A 1H2LA 4WCDA 1K34A 2NV2B 5F7XA 2EGHA 1JHYA 4PS0A 1IN5A 2V55B 2ZYAA 3TNLA 2IH5A 3PUHA 1JJAA 1P0MA 4BPBA 1G64A 2ECKA 3TD2A 4QYXA 5KINB 2FFBA 3FY4A 5IAJA 4NARA 4PZ9A 1QE0A 1JMKC 3VKWA 5M34A 1YB5A 4AJ4A 4YJ2B 1GUDA 3CYFA 3PUVA 4GIBA 1NIPA 4PBTA 4TUYF 4D8YA 2EKLA 5KDLA 4Y7DA 1I94O 1WA8B 2AJBA 3WLOA 5I7RA 3L82B 2ZRLA 1QVWA 4RK6A 3S6JA 5AUOB 3A4MA 3K5NA 1HOTA 4QL3A 3WTCA 1B42A 5ECGC 2PYLA 4K8ZA 2QN6A 3QHAA 2DUJA 2QROA 3C5HA 3KC2A 1X38A 4JFAA 4QU5A 4Z4GA 2PQ2A 3PXUA 4H60A 4QE9A 1DKQA 1P4GA 2MMCA 3WHKA 1XNQO 4Y6SA 1Z5GA 3PZRA 4TWIA 5FBKA 5KYNA 1XLVA 1E1RA 4FGKA 2H3HA 3W2GA 3HVKA 3JYOA 1LSSA 4BAZA 3DVLA 1E1DA 1ECCA 1Q6IA 1WAZA 2P5OA 1XZHA 3DTVB 4ZVOA 1EWRA 1VCMA 4R0NA 1WJGA 1PV4A 1RQRA 2D13A 4CDRA 3Q7IA 5AJWA 1XP8A 2PHZA 1KDVA 3ZBPA 4LH6A 3TF5A 4JU8A 2C2GA 4AJNA 5KTOA 2QLMA 3OPXA 1YXBA 3QVLA 3QFRA 5BW5A 2G17A 3D43A 3R0QA 3TOVA 3BD9A 1VBFA 4A1OA 5CB8A 2AG6A 5DRYA 1SU4A 2HMSA 2PRIA 1O03A 2GCNA 4R16A 4ZAXA 2LPMA 3HNRA 1MB4A 1CW2B 4O2BF 5A4FS 4E1VA 5BVGA 3NIDB 2OE2A 4OHPA 4UBOA 3ONNA 2WWWA 2JJ1A 2EIJB 3QVTA 4DBLE 1K3UB 1YHZA 4XD7D 1B3RA 1TQHA 2DPGA 1NBMD 2BFWA 2P91A 2Q4DA 3AJ8A 3FAVB 1PZEA 4ND2A 1XTUA 4HLUC 4NMHA 4V02A 1Z13A 2A0KA 3D7KA 3IFSA 3LIPA 2YZKA 3DV9A 4GKVA 4GRIA 5CXUA 5LIPA 1ZISA 4OBBA 5M2QA 1Q0RA 4BTVA 5HKBA 2XZOA 1MJFA 1QP8A 2HA0A 3MBKA 3OOHA 4FBLA 4IJWA 4PO9A 4Q7LA 3R74A 2BEVA 4MULA 4BBJA 3D4LA 2FMTA 3SS8A 3GGDA 2J59A 3G82C 2IYLD 1KD1W 3RC3A 4WZAE 2JLVA 3HADA 4G1FA 3VYUB 4K9PA 2GF2A 3O8RA 1YRAA 3C16C 1L3BA 1E1RD 1VJRA 2O05A 3OFSA 4MEJA 3SYNA 1JPXA 3FVQA 3T5TA 3ZWDA 2H52A 5D01A 5D85A 1A9QA 2J3LA 1Q21A 1XDCA 2BEUB 3BXPA 3U4AA 4X3PA 3HXTA 3OT1B 1T5EA 1H8HG 4JI7B 1Q77A 3T3GA 2E7ZA 4N41A 4W1SA 2H4FA 1YNOA 2PUHA 3D8NA 3KYCA 4COOA 4RCYA 3WKBA 3K9GA 5DVZA 1J07A 2G82A 1I3LA 2CDBA 1IZZA 2B94A 2XMGA 3OMXA 4ZV7A 2WFZA 5TQ2B 3L4SO 4WKNA 4A9AA 1FUKA 2D2VA 2R6AA 4Z4HA 1XIVA 3QEMB 5EKUA 2PV0A 2VDLB 3M1IA 1SKQA 2C5BA 3STWA 2A33A 1O9GA 3OIVA 4QEL