3WB2A

Hcgb from methanocaldococcus jannaschii in complex with the guanylyl-pyridinol product in a model reaction of [fe]-hydrogenase cofactor biosynthesis
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
160
structure length
160
Chain Sequence
VVMEEIIKKAFIESINNIRRGDKEEELKKIQEKIVNAKKIVVATNNQKKFKVIRDIMLRVCNAEIKMLDIDTRFADLTRMPALTKGLIALDIEKADLYIARGRLGAPGSGSMLVILDEKGRVLTASLSPSSVIHKEDIEERIKKELIEALSRIGISILEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0488
publication title Identification of the HcgB enzyme in [Fe]-hydrogenase-cofactor biosynthesis.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 55
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3wb2A01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 3wb2A02
3AUJB 1VF7A 1EGMB 2D0PB 1RSOA 2F95B 3WB2A 2V4DA 1MMFB 1UC5B 5JJJB 1DIOB 5D5PA 1NBWB 1T5EA 1EGVB 2D0OB 3BRCA 1H2SB 3WB1A 4DK1A 3LNNA 1IWBB 5JJNB 5JJEB 4DK0A 4GYCB 2F1MA 2F93B 1UC4B 5D5QA 1IWPB 1EEXB 3WB0A 4L8JA
chains in the Genus database with same CATH superfamily
1B6SA 4R1UA 2I3AA 4EY4A 4CG1A 3CUYA 1FFDA 4DT1A 5ALHA 1UZMA 1XJCA 5AXDA 4Y98A 1BEZA 2ZDIC 2ZNIA 5JVDF 1IHDA 3VH4A 4US2R 2Z2JA 1J90A 4ND2A 3O3MB 1FYWA 3T9FA 2IYTA 2NP6A 1QCEA 3OICA 5IC4A 1GTG1 3ZXYA 4TL9A 1QOQB 1Y8AA 2WSBA 4RX1A 4F21A 4M0PA 4IAOA 3QUCA 4U0JA 3SYLA 4QQ8A 3MTEA 3MINB 3Q0TA 3C5EA 2PL3A 2H48A 2WM3A 2BGIA 1I5RA 1WMEA 2HMYB 3V8QA 1QZZA 3PU6A 3P2JA 3G2PA 4FLFA 3QOFA 3K9NA 4DR7B 2ZIGA 3OAAG 4KAXA 3CT6A 1FFEA 4DNOA 1JT2A 4UQLA 3LC2O 5CCBA 1YBFA 1GRCA 3P96A 1YCHA 3C6XA 5ECWA 3UAYA 3HEAA 4JUAA 1OR8A 4GLFA 4KXLA 4G07A 1NNUA 3ID6C 4EMUA 3EZYA 4NEGA 2BFFB 5CCXA 1H8HD 4RMGA 4Q47A 4DW0A 3IAEA 4QXAA 2PA0A 1Y9ZA 2XRZA 3CZMA 1T5IA 4GWGA 2VPZA 3ABKC 3SYOA 3W6UA 1ZJJA 5KUTA 3HKBA 4XM2A 3VYRB 2CMDA 4FSXA 3G0CA 3ZD9A 1OJLA 4UNPA 4F97A 4XGKA 1DJPA 1M6WA 4EPXA 1ECGA 2M9MA 3D8UA 1TJNA 4ND3A 3JQ8B 3EXHC 1GTVA 2NYAA 4LXQA 1XQVA 1MGOA 4E2YA 1GEEA 4A8JA 1XQ6A 2YXNA 3DXZA 4KMSA 1XCLA 3FRIA 3EQ7A 3RVRA 1XK7A 1OI4A 1PR3A 4RTSA 3OFJA 3OJXA 4BJ1A 5D3QA 2D0OB 4JLPA 3ZQJA 3B40A 4UE2A 4M7PA 3R23A 1DE0A 1GQFA 4NFSA 2QOEA 4FJCC 5TGTA 4DMLA 3FNIA 4YS6A 4DJAA 5BY2A 2VJPA 3CWBH 4LDJA 3GNTA 3WLPA 3P5SA 3WZ2A 4P86A 4DEYA 1U5CA 3K5LA 3AETB 3GRCA 4MPJA 2XR1A 2ZSIA 3ZZTA 2JJYA 2PGOA 4E2XA 1CZOA 4R9SA 4FFBA 1BOFA 2B0JA 3T3PB 1G291 1KH3A 1PIWA 3FRJA 4L5BA 3TXYA 1C8VB 3DFZA 4I55B 4TM8A 1XMPA 4CDRA 2O0KA 4UNIA 2H17A 2A9JA 2J6HA 4OXKA 3LT5A 2R6AA 4PW0A 3OMWA 3Q8WA 3HXTA 4S1WA 4QRDA 4IDGA 2PZFA 1ZVKA 1EVQA 4EFKA 5AOCA 2D6FA 3EISA 4O4JA 3OLVA 3G2MA 1MB3A 4H18A 1L5FA 1CSEE 2O0JA 4JVOA 1FLDA 1HXHA 2XITA 3QNMA 4F7WA 1L5RA 3ND6A 2H57A 3WLQA 4LOKA 4XASA 1YJXA 3B9RA 1ZVQA 5DM4A 1VQ9V 5AG2A 5DTIA 1IWOA 4G8JA 1U2EA 4GHWA 1PVDA 3BMXA 4HDSA 2GTPA 3YASA 3E3NA 2QG9A 4ZT2A 1RM4A 5E9JA 1OC2A 4KAJA 1KP9A 3NEPX 1WMSA 3UHFA 2H4FA 2BAGA 2GEKA 3JD3A 2SKDA 1J7KA 1HZJA 1S89A 3TRDA 1KYOF 2DQ4A 1IHPA 3TIFA 4EUEA 1JJ2U 1AK2A 1N8TA 2EZ4A 2X4GA 4CLOB 3ZKWA 3DL0A 3SJCA 1NDHA 5AKLA 4MVRA 5EWJB 1Y82A 5LYYA 1MZVA 2XA1A 1A82A 1NW7A 1QDEA 4YJHA 3KQLA 3X1DA 3SFZA 3HVHA 4CIAA 2Z6UA 4WKGA 3DZIA 3OAAA 1E62A 4P34A 1A0OA 4I5GA 1UPUA 2IOHA 2I6XA 1MJFA 3N3BC 2VXYA 4GOXA 3UM7A 4HZIA 5FLYA 5HDBB 3NI2A 2Z56A 3BWBA 1JOYA 5LP6F 1Q16A 1EDEA 3NKLA 3I5MA 3IEUA 3F5WC 1YMVA 5MFZA 2B1QA 4YPOA 4HGNA 2ACVA 4PG7A 2E6UX 1KMCA 1ZVMA 3L6DA 2Q2OA 3N8KA 3IIEA 3SR4A 3LO8A 5BN4A 3T4ZA 2WZQA 4NMLA 3M7IA 4O4HF 2QPTA 5IFLA 1JLMA 4KGDA 1IHOA 1B0ZA 3UO2A 3ZRWA 3WGTA 3JZMA 5EZSA 3ZVRA 3JPWA 3L0OA 5CNMA 3DEYX 2GK7A 4GVLA 1LC0A 5EWMA 4H7KA 2HK6A 1U8UA 3L02A 5JFGA 1N2SA 4H3SA 2CLCX 2MSWA 5KNDD 221PA 3MJ4A 1F20A 4A6EA 4ZRNA 4FKMA 4EGAA 2OK7A 3QWHA 4F2DA 4BJ6A 5KEIA 1U3TA 1AKRA 1NVVQ 1HL3A 4L27A 1NIJA 3HU1A 2DN9A 3W0LB 3UKMA 1KHTA 1W36D 3SHFA 3KLNA 1RS0A 3WGYA 5ENZA 2OQRA 1C1HA 1PHRA 4ZIRB 3AL0C 3MTDA 1W9MA 1GD1O 4D8TA 3FWHA 4UTRA 1HURA 2OENG 3NONA 4BKRA 3GFGA 4AC9A 2ONKA 3L49A 4LX0A 5LOVF 3DB2A 3GVPA 4N5IX 3LRPA 1XZPA 2GJ4A 3VKWA 4BZZA 1GXSB 1MC5A 1XAIA 1T0UA 4UMVA 5K3OA 4R6WA 2W2NA 3NCTA 2D5AA 3MJHA 2ES4A 3UJHA 2NU7A 5DN9A 1WQ1R 2WSIA 1JX9A 3M4NA 1DRUA 2WA4A 1YMUA 3NH9A 1E77A 3KLPX 5EHZA 3G2KA 4MTGA 4QJIA 4TM7A 5H80A 5CA1F 4Q01A 3PUXA 5HEKA 3FWZA 4NBLA 2IHTA 1UWVA 3D59A 4EJSA 4QPZA 2GV9A 3NZEA 2ASVA 5EESA 1Q0RA 1OKKD 3M6VA 2A1IA 3UY4A 1SHZA 2PRYA 2GOYA 2MINA 4BX9A 1XK6A 1R4MA 4TS1A 3K9WA 5K3BA 2LPMA 2IOFA 4RLQA 1V1JA 4U02A 4Q7MB 5KHAA 2C2XA 4O63O 3U7IA 1JS1X 5KTPA 1MKYA 1O9BA 4RAIA 1WA8B 2JF0A 2VP3A 2CLMB 4LTDA 4L78A 4HWKA 4NY1A 1Z0DA 1QM5A 2FWMX 3K30A 2WJIA 1TF7A 1TD9A 4JLVA 3P71T 4UCSA 1U0NA 2G07A 4RVCA 2ZBUA 3VQXA 1SBNE 2NG1A 1NFQA 3TL2A 3ZWQA 4DCJA 4YT5A 1JDBC 5CXQA 5KKNB 5F7OA 4C0KA 1AF4A 2VQFB 3CX5F 1QLJA 4MVJI 3G5MA 2ZSEA 3B1JA 4FU0A 3PGA1 1WXGA 3WAJA 3INRA 1EUDA 3BB3A 4L9SA 3OT5A 3QHPA 3FCOA 2Y0PA 4K46A 2OGSA 2HAEA 1Y5MA 4L57A 3DCYA 3IDSA 2EBHX 4IT5A 1ODIA 3H05A 1ZRSA 2RAPA 1Q95A 2FWIA 2YUTA 3SQWA 3QVVA 3PFIA 5JG7A 2WIGA 4U7PB 2QRJA 4N40A 3IBYA 5CLFA 5K8VA 1DELA 5AVJA 1YOBA 4W5OA 2F3RA 5FUWA 1DEKA 3SC4A 4FJ1A 4NU6A 4P3XA 2OGTA 1PFUA 5EIBD 2LW1A 4BPBA 3FUCA 1Q2UA 3UMVA 4CWAA 1MNGA 2WLKA 1VQ5V 2FKXA 2Z0AA 1RC1A 2AN1A 5K6AA 1FRNA 1YFKA 4KXNA 5AVOA 1W85A 4S1PA 3LDHA 3ANNA 3U4QB 1WBDA 2O6LA 3OKFA 4EHHA 1TQ2A 1P2GA 1E3SA 3MJTA 4LE2A 2R60A 3DPUA 4E2ZA 1S5LZ 2B5UA 3A2FA 3GELA 3HGQA 4N8SA 4AZTA 1QQBA 2WJWA 3S81A 2HRRA 3OTQA 3WISA 1GPMA 4OHOA 1MFZA 4MULA 1ZY2A 3P0FA 4HH1A 1P45A 1UWLA 2GPYA 3KZMA 4DG9A 4DCNA 2WNIA 1A7KA 3GRRA 3CRAA 1TM5E 3KV1A 3RWBA 1GGMA 1Z68A 5EIWA 1ZVVA 3D3KA 5K0TA 3AF0A 1UJWB 2AC7A 3Q6MA 2R8OA 2HTFA 3B70A 5BN3B 1X4TA 5DEDA 2JB9A 2H8PC 4DLZA 3MOIA 2C7PA 3PRJA 4B6PA 2V3CC 3KLBA 1FFCA 1DAIA 5B1BB 2GARA 4RF3A 4RV9A 3KJGA 1KOLA 1EINA 4CS2A 4DZTA 2Q8VA 3H04A 4N9WA 5BW4A 1X8LA 2A1UA 5EJMA 2CK3D 1KMMA 1GQRA 2WVJA 4MP3A 1Z4MA 2H4ZA 4LQ4A 4JL5A 2H7CA 4FZ1A 2HLDD 3OI7A 1QJCA 2FK8A 3LK7A 2B2CA 1DPGA 2O8FA 3AG4B 3CLSD 1RKVA 3EVTA 4P81A 1N2HA 4BCBA 1NHGA 2WD9A 1GNVA 1CHDA 3S2EA 1BH2A 1VQPV 4KFTA 3SZ3A 1SCAA 2G28A 1ZOPA 2GK6A 4NFLA 3ZV7A 2NVOA 2WZCA 1U4OA 4EF4A 4YQYA 4RJ2A 1YL6A 4URVR 1E1NA 4HVTA 4BO6A 1D8AA 3GZJA 5B3LA 1QOZA 3OPYA 4P35A 1CZHA 4N5MA 4K81B 4B87A 1FD9A 5FWAA 2QR2A 2F66C 1TVKA 1GYPA 4HGPA 1VIBA 3K03A 3M9LA 3NGMA 3S70A 4B6GA 3BHJA 3L4BA 4WUTA 2R1TB 5TEVA 1PJRA 3PQ2A 1DIBA 4HMOA 4LYYA 4WN9A 2RHWA 3ML0A 2O2SA 3THWA 2ZKOA 4LJAA 4LDZA 1QO7A 3AFIA 3QEBZ 1LDBA 3E8FA 1J56A 4QD3A 1J8MF 1QKJA 2MSDB 2E4XA 3MC1A 5DLDA 1N8NA 1A8SA 4ZI3A 3F6SA 1Z4QA 2JZOA 1HF3A 1SCDA 3M33A 4DCCA 2CMGA 2DECA 3KT3A 3EGIA 3KL4A 5J2UF 1II9A 3OU2A 1QNFA 3Q1KA 1LI7A 2HPVA 1T36B 5CT9A 2ASEA 4IGKA 1UDWA 2VJKA 1O2DA 5DYGA 1W29A 3UC5A 1CRZA 2DR3A 2ZJ6A 2QTZA 4LV8B 4ZDWA 1UOPA 3DMHA 1TKAA 3ZLJA 4BGUA 5FUXA 2O59A 4PE5B 3GUHA 1OF1A 2JNWA 1NQVA 2PO7A 2FPMA 2XCIA 3IT1A 3RSFA 5FBRB 3DOHA 2JLSA 4UV8A 2CF5A 4TZKA 2KHZA 2EIKC 4A7PA 4XDKA 4C6SA 1NDUA 3PDIA 2X3YA 5DM70 2HF7A 4RA9B 2NM0A 3ENWA 4IKOA 3GWZA 4GUDA 4HVLA 6PFKA 4EB6A 3Q8KA 4B45A 3OTOO 4Z4GA 3Q7RA 3U60B 5DIFA 1ZFNA 2OL4A 1ZU5A 1OLOA 4RVOA 4IOMA 2EOAA 1NQXA 3L8HA 3OO0A 2Z8YA 6REQA 1XI1A 4F5YA 5JFOA 5HQJA 3G1TA 1S9HA 3FVRA 2O5VA 5IF3A 2GEBA 2EX3A 1DINA 3DZHA 3TBFA 2CV2A 4DA0A 1X1EA 3ZHSA 1FLVA 2DFLA 4NMXB 4KNVA 3GBSA 3IUSA 4GPZA 2YHAA 3EAGA 2Z08A 2CBXA 2GTSA 4RDXA 1H6AA 3T9AA 1KAGA 4FBLA 3BVPA 4ND8A 1SBYA 2E74B 1U0RA 4J9VA 4TV8A 4L15A 2ZLBA 4DV5O 3LLMA 4M1YA 5BMVB 4AY5A 3LPMA 5B53A 3PFBA 4PC2A 3C3AA 2DZDA 4RENA 2O8DA 3FBGA 1Z6QA 5ERYA 4GL2A 4ARZB 4D0LB 4UMEA 4ALNA 1ETUA 2SHKA 1V4NA 1JUDA 3PI7A 4W1RA 3K2BA 3DUFA 4AVYA 2XT0A 2H1LA 3VKVA 2XIJA 1S3SA 2P0YA 1EQUA 3V1NA 2HJ9A 4FE4A 1T1EA 2QT0A 3A1TA 3OU6A 3OCCA 3EXAA 3T38A 5FA6A 3ITNA 3IO3A 5LMZA 4BB0A 1U2ZA 1RM5A 2C3OA 1IN8A 1EE2A 4ALMA 2FFHA 4Y2YA 3G88A 3RUHA 4YFVA 3TQOA 3AI1A 3TLAA 4LGMA 4BLVA 1ONNA 1UKAA 2YOFA 5AFSA 4X84A 1B8OA 1CP3A 4KV7A 3RFVA 1W5SA 4W8HA 4Q3CA 1E0KA 2ECQA 5L7TA 1P2UA 4IEFB 3HO6A 4D92A 2ZPTX 3ASNC 1BXGA 1IPFA 5FQNA 4RVFA 2XECA 4LGVA 4JLOA 2IYWA 1QYCA 2O50A 4CT0A 4MIOA 1XQ8A 3ECAA 4C6HA 4KX5A 4W5RA 4Q16A 4F71A 1VJDA 4MGEA 2E3JA 1WZIA 1OFIA 3F8TA 4YQFA 4I9WA 4WKCA 3WWPA 2YL2A 2J67A 2A79B 4FFDA 4BWYA 3ST7A 2JLXA 1RKXA 2IYYA 4MEJA 4JQCA 2P41A 3MUFA 2CB0A 2GN6A 3P2OA 5D51S 3IP7A 3HXQA 3NBUA 4M1OA 3H5VA 2BEUB 1Z0AA 3F46A 2PV7A 2GTIA 3PXXA 4YEDA 3IOEA 2QJFA 3CVJA 1YZYA 4GI5A 2FLKA 4KNWA 1OCRC 3H9EO 4QL3A 1R0LA 2XY4A 4R9VA 3GL9A 1QYDA 3AEKA 3AIOA 1K33A 1LSSA 2C2WA 3O3NB 3Q3JB 4H3VA 4ARUA 1SQ6A 2RK4A 4YRQA 4BBJA 5AVSA 3DZJA 2PLWA 1C9EA 2NU6B 4OQ4A 1KE2A 4R1SA 1VE3A 4MNTA 1GDDA 1Y48E 4R8RA 4CIDA 1PFWA 3P0EA 1G19A 5HRAA 4NG4A 4ACAA 1LV7A 4DY4A 3R5KA 4C08A 1WHTB 2WIJA 3BB1A 3PK0A 3I6MA 1M6VB 2P5SA 3BKWA 4JV5O 1SKMA 1FQOA 2HK7A 3BGDA 4YJ2A 1HDOA 4LNAA 1KP3A 2GEVA 3V8MA 5B3JC 4RDCA 2J33A 2V8OA 5A3QA 1ZGJA 4FW9A 2X2FA 4Q34A 421PA 2YRXA 1Y5LA 5IXYA 1EFPB 2VH1A 1XDCA 3H5LA 1P2TA 3OQIB 1YB1A 1VHTA 1WL8A 3E7FA 1XYYA 4JITA 2Z3ZA 4LOAA 4NNOA 1XPJA 2VHYA 4B1FA 1MQAA 1OXBB 1B3RA 4WZBB 2GBFA 3R7FA 1S01A 3OOWA 5KREA 5AESA 1AP5A 3WSWA 4DA4A 1CJUC 5E4FA 3VM6A 4JJKA 1LZLA 5C7YA 1DHRA 1DBWA 1PPJH 1US8B 1YR2A 2BJVA 4C0SA 4ECEA 4ZEWA 5CDGA 5ADWA 2P6RA 3GAMA 4WZAB 1EVLA 3TLCA 1LLDA 4WOBA 2G7MC 4OBBA 1RRVA 1SOWA 4DQ0A 2W6QA 3V1LA 2JHFA 3C8DA 5IKMA 3LBAA 3PFNA 2Q7DA 3KRTA 1V3QE 5IJAA 1EWYA 5CA3A 1NONA 1E4VA 1HQDA 1U0BB 2G08A 1H69A 4JFAA 2GBLC 4PZPA 2HR1A 1J0DA 1YKSA 4LXHA 4UM7A 1XUOA 1NWHA 5HTOA 1DKOA 3NTQA 3REFA 3JQ9C 5LDGA 4CYMA 1FDSA 1W30A 1YRYE 1S4QA 3PUKA 2Z4RA 4AG5A 4Q24A 5HS6A 2AW9A 1G1XB 2D3WA 4BVEA 2C8KA 4JBWA 2HCJB 3WLIA 5JISA 5I4CA 3PUJA 3BK1A 1KIAA 2NO0A 3CPEA 5CW2A 4EJ6A 4KSBA 1EZZA 3QOXA 4Q1EA 2P77A 4BAYA 1AU9A 5J5VA 4WZZA 2O2JA 2IU6A 4ZHQB 1CUGA 1Z5VA 3QKSB 1F51A 1MW9X 3SZGA 3FCCA 1P2SA 5DHSA 1PLJA 4DLWA 1N0VC 1C3VA 2GCOA 4G01B 5DHTA 4JELA 4D8UA 4B74A 1CYDA 2QLMA 4JB2A 1TJ3A 3UAOA 1NAHA 2HP8A 3ED1A 4DQLA 3PTLA 3E7PA 4ISCA 4EW6A 2ZUWA 1ZIOA 1GGNA 4PAOA 1GNRA 3AM5A 4YCJA 1VLHA 4D02A 1QQ6A 1MV8A 5GPBA 1X19A 5M2QA 4ZI7A 2XE8A 4FFRA 1Z15A 4OHFA 3S2GA 1R8YA 3A6PC 1GOTA 3GNLA 4J4HA 4N5DA 1CB7A 4H13B 4WACA 1KZHA 4DTIA 3IJPA 3GOQA 4NABA 2FPUA 5ERGB 5EMHA 4UNQA 2REQA 4NHOA 1GYRA 1DLIA 1VECA 3EK2A 2B35A 3BT7A 3EPRA 4EO9A 4LHZA 3QPUA 2ZDQA 1DEXA 4C7KA 4R7CA 1KQGA 2V7QA 2A0FA 1C0PA 3CX7A 1KMNA 3TD6A 2IIQA 2FR1A 3GJ3A 5IY5C 3RI3A 1NNEA 3JALB 4OQLA 3BVOA 1UOOA 5HJ5A 4DYVA 1M3SA 4M98A 4NJOA 3MYYA 3ABQB 1XZDA 3G13A 2B2NA 2XZLA 4Q05A 1S8FA 4I8IA 1OZFA 3AXTA 4Y2QA 1FFXB 1AB3A 5AP9A 2BZ1A 3MAJA 3JAMA 2ZIXA 3L06A 3CEJA 2VK4A 1Q1ZA 5AVVA 5F12A 3B2QA 2GXAA 1UBGA 4C9BA 1XNHA 2X6QA 3KPWA 3P9KA 4FMCB 4QDTA 4NBVA 1ZLZA 1RW4A 3D4NA 3IJ5A 1KK3A 5DLEA 3WKEA 2FRDA 5IW8A 4CF6A 1OTXA 3MJDA 1G2QA 2G0NA 3WC4A 1J8YF 5JTTA 2I67A 4BQIA 2XVZA 1XWFA 1BGYH 5K4AA 2DOKA 2DBVO 1XAHA 2PUDA 2WWRA 4OJKA 1JEQB 1R8XA 2Y4UA 1WMFA 4UBLA 3FNQA 4OB6A 2W6ZA 3EZ7A 1VL5A 4BUJA 3PUHA 3Q2KA 2PM8A 2R85A 4B81A 4LCJA 1ZXBA 2EINB 1F12A 2WJYA 4N01A 4CF7A 5G0SA 3K96A 3HBLA 4I6GA 1K5HA 3KQVA 1VQMV 2NO4A 2XMZA 4AZ0B 1A1VA 4K28A 3RIHA 1K9MW 5A4FS 5A4MS 3GRUA 4J43A 2RBEA 5DYIA 4XUDA 1ZGGA 3N8DA 3TW6A 2CZCA 4YUWA 5I6DA 5JPDA 2JAHA 3ER6A 2RIRA 5E1MA 1L5GB 2QGZA 1L9KA 2PRZA 3SLRA 2ZYIA 5TQ2A 3ZDFA 2X13A 4G36A 3HADA 3HB0A 4PTLA 4FBMA 3HYSA 4RW0A 4KQHA 3DLCA 4YXFA 4UFNA 5J23A 3KQNA 2QUIA 2X5NA 1MUUA 3NP9A 3TR5A 3P2YA 2GR9A 1K4KA 1G5RA 4X61A 3KKMA 4DXWA 2YJTD 1CEZA 4Q18A 4FQ5A 2W0FC 3G2HA 3MTIA 3RRBA 1G3MA 2Q6TA 3OQMA 3STLC 1FS0G 2BOVA 4QJFB 1K3EA 3NEAA 4AO8A 3UUWA 1N6OA 3BDVA 4ROTA 2CVOA 2H5EA 4F12A 4Z1OA 3ZE1B 2G5GX 2Y76A 2GZ2A 2PT9A 1PT6A 4U7GA 3LS2A 1GR1A 4MICA 1PG2A 2PJRA 3NT5A 3S1SA 3RC2A 4FVTA 1ORRA 1HGXA 3MRSA 4RY9A 3VC7A 3OZ7A 4Q9DA 5HFAA 2PWYA 2OC4A 4L85A 5EEHA 2Q5ZA 4HGQA 1T9KA 2AOTA 1A97A 4JT9A 3E61A 4JYCA 3T1HO 4AAYA 4L5IA 3SKXA 4YCCA 2QTSA 4C20A 5EJFA 3DWIA 4MAFA 3CH5A 3SX2A 2AR7A 4NENA 2F9LA 3ESYA 2OXIA 4E12A 4O5OA 3PNSA 3I6IA 3G80A 4GPIB 3HCRA 4UFOA 3V4SA 1WMDA 4M1MA 4HB3A 1L5OA 5EN4A 4D80A 3BEDA 1F23A 2IY9A 5BSGA 2E5LO 2A7QA 3UV3A 3DFKA 5C8YA 1SC4A 5JD3A 3PC4A 4AY4A 1NW3A 2FN8A 4RIEA 1PK7A 3K70B 1W8DA 4MPPA 1ZL2A 4Y1RA 4QPCA 3RASA 3CE2A 4ZCSA 4OMUA 5F64A 2WG0A 1E0AA 1YJ8A 3VR5D 1KIMA 3REOA 2IQ5A 2OUIA 3TSAA 2EYUA 2BRUA 3DZKA 1J1ZA 1PWYE 2QROA 4LHWA 3LDDA 4Q82A 4TRRA 3S8MA 2DSTA 3VNUA 3MD9A 1KC1A 2PVSA 1UF9A 1C5KA 3FB8C 4DUYB 2Q5FA 4UMFA 3AL2A 4X3CA 2AT1A 3QH4A 3AI7A 6CHYA 1SCKA 1GL3A 4Y7DA 5KAMA 5NULA 4II7A 4BL5A 4TTIA 3H99A 4BJHB 1MMMA 3O2SB 3TFWA 4W9NC 1VIVA 4GMXA 2AHRA 4YV1A 4IVPA 3N2KB 2YCBA 4G4SO 4G0MA 4UHCA 3H1IH 4AROA 3NX4A 2EGUA 4ZOEA 4LFCB 1NOKA 2QEQA 3LPNA 3T0IA 3F90A 1O0BA 2HRCA 4IDDA 3ZE7A 2DTXA 3H13A 4TN5A 4X3PA 1T25A 1E5XA 4M0EA 4FZRA 4B7KA 1F7YA 5FTWA 3W9UA 3HXKA 3IEKA 1Y4UA 1OWOA 3DVSX 3PRKE 3WRYC 3GG9A 4WK4B 4RF5A 1JAIA 3AQ4A 1VLMA 1EGAA 3COZA 3HZOA 1QYIA 4DAEA 4E4RA 1F2UB 3VNVA 3JR7A 2QHXA 4I9UA 2UZ3A 4CCWA 2CHUA 5CFQA 3LHDA 2C9DA 5E3JA 3UK6A 4AX8A 2VEDA 4R9RA 4RPHA 1A4XA 4TROA 1IEQA 1YZ3A 3G8CA 2F9FA 1R50A 4IG4A 1ECCA 4M55A 3WK9A 2ALJA 3BQMB 1Y8ZA 4E3WA 1WEHA 1XMOB 2I6GA 3FJOA 5JC1A 4D43A 5TDHA 5EPUA 4E5UA 5JWPA 3UVEA 16PKA 4FR5A 3WGGA 1CUEA 3FNEA 4JZ2A 2CLKB 1DWOA 3W5JA 3FDXA 3K31A 2NXCA 2VDVE 2QDKA 4NWIA 3H1FA 4EIWA 3CBGA 2BM8A 3IC7A 4F6RA 4FR0A 3L92A 5EXTA 1NLZA 1JQKA 5LBUA 3C3WA 3IT2A 1V5EA 4P7GA 3W7UA 4ZCIA 1PYOA 1CLEA 3AUJB 5ES4B 4WOPA 1DKNA 5KQGA 1M34B 5B4TA 2CUZA 1UJMA 4XJTA 1L7NA 4CM6A 1EYZA 3DKVA 1G8JA 4H6XA 1NG9A 3DMTC 3H4VA 4IDFA 5ICGA 1V35A 2N9UA 4G0WA 1IZ9A 2QTNA 1O3YA 5K45A 3H6KA 4S04A 2ZI3A 3WTBA 1T6NA 2W6OA 5IYDO 2ZR7A 2JKZA 2NGRA 1M2WA 4ZK2A 8ATCA 3MGKA 4B3MB 4D9CA 3L6OO 1RWPA 1N3BA 2XMSA 1Q1BA 1V1MA 3BL8A 5IT5A 3UGJA 3MWYW 1YS2X 2KSDA 4ZAZA 4F45A 3ROFA 1SWWA 3CTMA 1QHYA 4U5QA 5KMGB 1Y6RA 4D7AA 2CNNA 4OO3A 1ZMXA 4YQEA 2HJFC 4G8DA 4L8FA 2YWDA 1ZOOA 3ZE0B 3L7JA 3UJBA 5GZ6A 4RZIA 2C5BA 5HCUA 3LTEA 1EZVH 3B78A 2LR0A 1CS0A 1LD3A 5DN6D 3E9RA 3N05A 2IKQA 2CDAA 1BHJA 2H2GA 2IIPA 4MGIR 3DOOA 1UBTS 4IRMA 3UOWA 3GGJA 2RI6A 5IKPA 3O4HA 3P9IA 2UUBB 2VIIA 4AJ1A 3I9FA 4RZHA 4YPFA 5E7MA 5BNZA 2FV8A 3U49A 2O8VA 2V3VA 3ZRSA 4H6WA 3RYTC 2E4AA 4F6EA 2QTAA 3VV3A 4X65B 4KUEA 2ONZA 1XXHB 4FZVA 3O82A 4X64O 1NNSA 1QIKA 3U3XA 1NF9A 2OKCA 4M21A 2PUTA 2NSLA 1X86B 3HKEB 4PDVA 4W9RA 1CE8A 1J21A 3S44A 1JPNA 5ALIA 2Z6VA 1MH1A 3EC1A 3RG8A 3TXQA 4GEKA 3WYBA 1H2XA 1M2FA 3LYUA 4CEIA 1R10A 2NN3C 2H7YA 1ZESA 4JLSA 1OXKB 3FX7A 4KFSA 1Y4ZA 4XH9B 4Y1GA 3A28A 4DE5A 3RYFA 1AJPA 4I99A 1ZMRA 2ATIA 3LYLA 3IUQA 5ALDA 1DL5A 4JI1O 1F6WA 3H2GA 3OE4A 1S8NA 2CL0X 5M3BA 3UJCA 3JVVA 4LJSA 2JGKA 3K9FC 1TU3A 1FNBA 4ZYVA 3M4ZA 1I4WA 2D8MA 4OLAA 4X92A 3TX2A 4B7AA 2J9FB 3K0AA 2AGVA 4O5AA 1G98A 3CUUA 2WLIA 4I7EA 2G71A 4RVUA 2QM7A 4YECA 2DE0X 4Y6SA 4PC6A 3BQ9A 5EZQA 3M6LA 1JQAA 1UM8A 4GLOA 2WKRA 1DO8A 1FTWA 4CZ2A 1EAYA 3RFUA 2YC2C 4OP1A 1NPYA 2OV8A 2PYIA 3WL8A 2J6CA 3E86A 5FH9A 1OLUA 3GFTA 1R4ZA 2OIEA 2IJHA 4YXWG 3LO5A 5FWXA 3DC7A 3NKVA 4CT5A 5TMBA 4MR7A 2FZGA 1SQSA 2HREA 1O57A 2OT5A 3EOAI 5I48A 3OLWA 2AZXA 3FNHA 3L8MA 4FGSA 2IHYA 2Y48A 2PI4A 3KXDA 4FMDB 4B4WA 1GG2A 1FCJA 3ELUA 1OH5A 2JAQA 5J5CA 3A1WA 3ODPA 4HO1X 2SKCA 4IINA 5DSZA 5HRUA 3LQ1A 5CGQB 3BHPA 3C85A 4L8VA 3G8DA 1AUVA 3GEIA 1QIMA 2I55A 3GP5A 3ZJ4A 2YJ6A 2PZ8A 2W2MA 3OFSA 2AN4A 5E6SA 4RULA 2QQGA 4LF9O 2OFXA 2IUYA 4KGXA 4ESHA 1NW4A 1E3QA 3A2LA 3M4JA 1N5LA 1LFDB 3O4VA 2AMVA 3FPLA 5AKKA 2ETXA 1ULUA 5JZMA 3OW2U 1YBVA 5B3SC 4M0CA 1IATA 2F62A 3S3XA 2C5FA 2CXQA 2OCYC 4H16A 2QD3A 3V7YA 1ZSYA 1L4LA 1M2GA 2W6NA 1BKYA 4J6EA 2HPHA 5IVPA 2ID8A 1J4AA 4IIVA 2QNIA 5TVGA 2OHGA 3GAAA 4RD1A 2RJOA 2DWCA 4KIGA 3TFQA 5MN6A 4WXHA 3W1WA 3ZN1A 2AI1A 3PZBA 3WZLA 2FP4A 1QGUB 2IOYA 1AOXA 1GNLA 1RBMA 1HSOA 1YS6A 5KCMA 2O3UA 4JBLA 1U7XA 1MOFA 5AKEA 2HU5A 3B9BA 3NG1A 2XUDA 1JCHA 5IEJA 3JYNA 4XIIA 1P7VA 1JHPA 2R4UA 3ZCSA 4AS2A 5DXFA 1J22A 4F4DA 3OQJA 2JI6A 2P9ZA 2OPHA 5JDCA 3L2OB 4YIOA 5KU7A 2OC9A 3C1AA 4Z2YA 1GDTA 2A4MA 2XXBA 3ME5A 1RHKA 3QU4A 3R7AA 5BR1A 4WGFA 1DJQA 3WBFA 3PNPA 4PYKA 2Y69B 4JSYA 1XWWA 2JFHA 1HLDA 4FE7A 4P3PA 3IPLA 4C4SA 1FUYB 2JL1A 4I8DA 5IJ9B 4O4LF 5HKBA 2RGRA 1WDKA 1SCUB 2IPOA 1X2EA 1VE9A 4HYTA 1N0NA 3COJA 1W73A 1WXHA 3DFMA 2CH7B 3LIIA 3FZEA 1TVMA 4PR0A 3L4EA 1P31A 7GPBA 1NT2B 2EARA 2MYUA 3HJNA 5TE9A 3KSAC 1M57B 1SHKA 3OPXA 3ZW7A 3V1TC 3NBKA 2YVLA 4HLCA 4NXMO 1BS9A 3FTPA 4HHEA 1BFDA 2TS1A 4H77A 3F7MA 1FMCA 1V1RB 5C4IA 2QN8A 1ETHA 1G20E 1QRAA 4YMGA 2QIOA 3D7NA 4YXWA 3B5JA 3P9RA 1FLNA 3EGEA 2QAJA 2EBUA 4IUDS 2VDJA 1U1DA 2O54A 1Z6TA 1EU1A 3V9PA 3GU3A 4C29A 4J0DA 3BCRA 2B7BA 3LC0A 2Y1XA 1JQLB 1SKYB 3B9QA 3PEEA 2HDOA 4UZEA 2D7JA 3T61A 4JI5O 3W9BA 1JR2A 1OX5A 4K0KB 4RGVA 3OC6A 4HDRA 4L6IA 1WXFA 4OFZA 2AG6A 3NTUA 1ZM9A 1P0IA 3DLBA 4G85A 3OX4A 5A5DA 4RFLA 1G38A 3DL4A 1N5DA 1Y81A 1U02A 3NVKI 3GGCA 4E46A 4K2AA 1NN3A 1DLBA 1EJBA 2EFCB 3R5JA 3R75A 2BMJA 1TADA 1YVWA 1LU9A 4BQOA 1NI3A 2BUCA 1KEPA 1YONA 1WY7A 3IQWA 2D5CA 2DPHA 1VPVA 4HJXA 2WAYA 3A9WA 1KJWA 1BW9B 1M2NA 1H2HA 1RHMA 3L84A 3TTTA 4E2WA 3EARA 3NWOA 2LV8A 4S2UA 2E49A 3PUZA 1CJKC 1UPFA 2FLVA 4HSEA 4KMRA 3HNPA 3VYUB 1RD4A 1X9IA 2CC2A 4Z4CA 5EQJB 3PNOA 3GARA 2KKWA 3EVGA 1A8UA 1DIGA 2C0PA 4NL4H 4CH4A 1L5KA 1JA9A 4FM0A 5JO0A 2R87A 4DV4O 3FTQA 2UU9O 3U5ZB 2ISQA 4V24A 3VPHA 4D1YA 2IH4A 1PR2A 2XDAA 4OGGA 4D8WA 4D9IA 2CBGA 4H9GA 3K5PA 1TO6A 2OP1A 5FUMA 2V7GA 4PNHA 1ZWKA 4LRTB 3TRIA 2OHHA 4MTFA 2D1TA 2WMDA 3LYHA 3ZGYA 4DYHA 5JI2E 1RWXA 3FZGA 1WBBA 3KJZA 2WAOA 4KWHA 1M1ZA 2Y1KA 1G6UA 4LYGA 4YCNA 1Q0ZA 2FPKA 1D1QA 3ZWDA 5I9NA 4EO4A 4DG5A 4JZKA 5DW0A 3A1VA 3WLJA 5KYUB 3VMMA 1N32B 1XD2A 4IJKA 3VU0A 3OTGA 3KEGA 4D0NA 3E9EA 4HDKB 3C16C 2G5TA 4WDRA 5MGNA 3RFTA 1VIMA 5SY9A 3HYRA 4UVHA 3ZCPA 4IUYA 4GX0A 1RFLA 1XU4A 4BNDA 3MPUA 2OSVA 3QW4B 2WABA 1AO3A 2HM7A 4UW9A 4RZXA 1LPNA 4RLSA 2RDCA 1SWVA 4FHFA 1MOSA 1IZ7A 4R1NA 3SMVA 4FOOA 4BBAA 4JEUA 4RKQA 1XVLA 2FH5B 3MBOA 1M33A 1DCMA 3ROPA 3LECA 2PY6A 1QTNA 3HUDA 2XNDG 3S2SA 1DBVO 1DRJA 1UAGA 3BIOA 3SYCA 4OFXA 4F96A 2R7NA 2WUEA 2QD2A 1JX6A 3AFOA 5C2JB 1PL8A 4QFDA 3GWOA 3FKQA 3QX9A 4ZQIA 3KCQA 2XTMA 1F0NA 1VPTA 1K5SA 4MIKA 3DEJA 5M29A 1NURA 2QN1A 3E0XA 2DF8A 4V1CB 2ZUSA 1CXZA 1QQAA 3CUSA 4C4PA 5EIOA 4X1KB 2AYXA 1E89A 4XX1A 3SXUA 5FO1A 2HGZA 1Y8RA 2BC9A 1B00A 4BTLA 1ID1A 1UMDB 4M0FA 2AK2A 3HUFA 4RCVA 2PZGA 1E1MA 4HDCA 4FQ8A 4RVSA 3MD0A 2WT8A 2KWIA 3TDNA 5HIIA 5EKSA 3VDQA 4YY3O 4OA5A 1N2CA 4C1BA 1D4ZA 3JQQA 4IRXA 3FBWA 1FXKA 1E4OA 3ANXA 3EAFA 1EWRA 5CX1A 1P19A 4R0MA 5BXYA 1MJHA 4LF7B 1EE1A 5FTJA 1GG5A 3B6IA 5FEMA 2O3SA 1OPXA 4QVKA 4E1BA 1DXQA 3I83A 2HH9A 4J76A 3FI9A 1QLWA 4HQNA 1NJIW 821PA 5A7HA 2A06H 2C92A 1C9KA 2UVPB 5D5QA 4LRQA 5G41A 2XYVA 5LQRA 3WLHA 4MVOA 4OAQA 3FPJA 5HRCA 3TKYA 2P4UA 1YRLA 3DC6A 5K3DA 4L4YA 4D74A 1PNKA 1U63A 7REQB 2H4HA 1YE8A 3LC1O 5LQSA 2YSUB 2FFAA 1O89A 1V2GA 4MW0A 1Q3HA 2BFDB 1LVHA 1DC8A 1RFGE 1LDEA 4MOWA 1N3YA 4GXNA 1Y74A 3SEQA 1T2UA 1X8XA 4JBHA 1QE0A 3SF8A 2XAQA 5JSHA 4KDFA 2G17A 4KQMA 5CJJA 3ZD8A 1OV6A 1L1EA 2YEVA 1Y5IA 5CLGA 4JC8A 3CRMA 2QL6A 1SC3A 1NJ1A 2OE2A 3DT6A 1PJ2A 4KGZA 4YMTA 3L40A 5E4JA 1E0JA 5B7PA 3CW2A 4OLBA 1G9XA 3E0QA 5F2EA 2J3KA 3QE3A 1L4EA 3NVMB 1EHCA 1L4UA 3E22A 1Y6GA 1DG1G 3E5HA 3DXXA 3H2IA 3RYIB 2Z8ZA 4RK7A 2QZPA 3DE0X 4QE9A 2V7VA 2XHEA 3OQBA 3L0BA 4QPNA 1F8UA 1OA1A 1MIHA 3W5VA 4AN4A 4MUXA 1HKUA 1QIGA 2H2FA 2R1VB 2GM9A 1IJKA 5BSVA 4OBXA 4ZKIA 4ARSA 5IDXA 4X7MA 4M0KA 1K7DA 3H5WA 4NYJR 3TLBA 1CY2A 1J95A 5IKOA 4BMDA 1J2RA 1SXJC 1BL8A 1QB7A 3L9XA 4OK5A 3D36A 4YP0A 2G77B 3DKRA 5B57C 1C1DB 5G4LA 2OAGA 1PK9A 3RUAA 1YDGA 1JFFB 4P98A 4CMEA 2EEZA 3HXLA 1B8PA 1NNLA 3FMGA 2B25A 3KLMX 3N0WA 3L8ZA 4ZANA 3AEUB 4FFOA 4Q37A 4A3SA 3ZQ6A 3DHVA 1S0VA 1K9SA 3EXG2 3A3PA 5A3SA 1JR3A 4O4IF 2A92A 3LV8A 2D2VA 4LPKA 1CY0A 2XNDA 3BA9A 5JH7B 3MUEA 1BE3H 1P9OA 2I29A 2Y0BA 1Y7HA 4IP0A 1AHNA 4B71A 1SKAA 2MU1A 4F4FA 2QKSA 2H7VA 4IUBS 2ZG6A 3HEMA 1CF4A 2CSUA 3DEHA 5JXHA 2AMYA 2VAMA 4URXR 2BGKA 5FPYA 3ZCCA 1LDGA 3IAS6 3UJ6A 2AWOA 4AJPA 4II3A 3K0SA 3QEKA 3MT0A 2CL7X 3IALA 5KNBD 2VSYA 4RCYA 5IH7A 4I1YA 5NLLA 4MWZA 1II8B 4LH7A 5GV7A 5CEFA 1JQ0A 2ZTUA 4LF8O 3QVGA 1T24A 4BAGA 1MRSA 3WFZA 2D1QA 2A3NA 1BH6A 5C7LO 3SVZA 2KLHA 3DDUA 3RKUA 1NW5A 3BH0A 3FNFA 3L7AA 3K1ZA 2DJIA 3IVAA 4RJIA 1M73E 1Z08A 4UKDA 3DLHA 3KVNA 3SWWA 1M2EA 3MLBA 1H3EA 4RQBA 2IODA 5DJ5A 2QLLA 4BGIA 4ME6A 1XCOA 4O29A 3KYJB 4AF8A 1WP4A 3DTYA 3SYAA 4X9XA 2O4CA 2JI7A 3KXLA 5HVNA 2RMKA 1RQ7A 3PJFA 2PMDA 1JSXA 1ZJ5A 2XV1A 3Q7IA 1DLJA 2V3WA 2MYPA 3KM0A 2BBWA 5JCPA 4PA7A 3U3MA 3CTPA 4NESA 1I3NA 1W0KG 3PWKA 3JAWB 3IE0A 1N36B 3MWDA 4B3HA 2CB9A 2QJRA 4O25A 4WA7A 1U2GA 4LXXA 4C6TA 1A5AB 2LIPA 1KY2A 3NC4A 8GPBA 2JIQA 1VLJA 1LWNA 2FF5A 2VC2B 4J9YB 5JC8A 3JYOA 4KK4A 4YB8A 2DGDA 4Y67A 4M4SA 1RSOA 4KSYA 4JGSA 4YMHA 3ROXA 4UQPA 3ASUA 4NVPA 3WGMA 1GAWA 2BLLA 1OIXA 1F8FA 4LC9A 4DUZB 4MQMA 1M5IA 5DO9A 5EQDA 4ZZ1A 2Q4OA 4BKQA 2HFKA 4E2LA 3HB9A 1U6JA 4G5XA 4NZPA 3N86A 3R2JA 2DW4A 1XU7A 4UU0A 3LPDA 2W9XA 5L9AA 4BYMA 3HA7A 1DI0A 2B4TO 3ONNA 1RRKA 4ZAWA 2ERCA 3ZDBA 1KYYA 1YRWA 4X41A 2NTYC 1R6AA 1Z0UA 3DEAA 2OCCB 3LFUA 4PSKA 3FLEA 3TZLA 4CTKA 4C7VA 3AF2A 4MHTA 2F1HA 2GN2A 1Q1NA 2EYQA 2V6IA 3VX4A 3H4IA 2HB6A 1UT6A 2M1ZA 2ZU0C 1ENYA 4GOKA 2Q6AA 4I4IA 3ZCQA 5C3UA 5J4KA 1ZWIC 3B3JA 2HMTA 2CD9A 2H2AA 3LAWA 2CXNA 1K3UB 2KQXA 1OUMA 3OZDA 1Z28A 4AURA 5THQA 1QU7A 2QN6A 3IPAA 5BY1A 2JRCA 4NV3A 1TJ5A 4J41A 4O2AB 3QKIA 3T4EA 2OO5C 3O31A 2CYCA 1ISJA 1JSRA 3V33A 5T4EA 3ADCA 4K9MA 3AR8A 5AI6A 1TK9A 1VG9B 2HOQA 2F2TA 2JW5A 2PXCA 4UXIA 1YZQA 5T67A 4CM1A 1UPAA 4QM6A 2NSJA 3HMKA 4PYRA 121PA 4Y9SA 4R84A 1TQDA 2JRIA 4L76A 4BRUA 3ROTA 3E9NA 3BZBA 4WNAA 4KHZA 3L01A 2GQ0A 2ORIA 4LBWA 1I1NA 4E09A 1NVKA 2EILC 3TZ6A 2Q1WA 1T5SA 2H65A 3S6JA 2X5XA 2ZWOA 4Y2UA 1YC5A 3GJ8A 2ZCEA 2E0IA 1DRKA 2AW5A 3C3BA 1NUPA 2NUPB 1YOVB 1PZXA 2NNWB 3K6SA 3Q88A 3U4MA 1Z5ZA 4V3CA 5CCDA 3A2NA 2FP3A 3AESA 2GS9A 3IQIX 1W0KA 3IJEB 3UYKA 1ZAYA 1GZHB 5IYZF 4P9PA 4D3XA 2VLBA 3K32A 2PL9A 1RXYA 4DA8A 4ZODA 1T1RA 3UWSA 2CMFA 4MQFA 3BJEA 1KJNA 3RVZA 2LFSA 3I56V 1S2DA 3ENQA 1KSHA 3QIVA 3GLGE 3NYIA 4S2EA 1Z5OA 2JI9A 3F4LA 3HP4A 4FFPA 1VF7A 2Z5LA 4ZZ2A 2DH5A 2OGUA 3FOAA 4MUKA 3H75A 1GP2A 1SVNA 2WU0A 1R9NA 3UEOA 2PJDA 5B7NA 1SHJA 1FB5A 3PFKA 1G8HA 4JI7B 1CQPA 1QZUA 5F9MA 2R44A 1HLFA 2ECPA 1BT8A 5EHXA 5LUAA 4V0RA 1P7PA 4FIDA 2I65A 4OKIA 3I2IA 3K4HA 4I08A 4NS4A 3M70A 2V7QG 2Z8XA 3TK1A 1YQ9A 4R5MA 5T4BA 4OHPA 3DXRA 1G3UA 2GAJA 1QO9A 2DQKA 2X9LA 4MVWA 4OI1A 1QAQA 1FDTA 3C3YA 4GOLD 4FYWA 4X71A 3HCPA 4G0YA 1CB0A 3VAYA 1U28A 3QVTA 4QUBA 1J5EB 3ECSA 3FUXA 4C0JA 1BQ3A 2HA0A 4HH4A 3OZBA 3BIJA 1U99A 2Z9DA 4YDHB 5L8VA 3G4SV 1K98A 3KBOA 2P4VA 5B3KA 3C48A 2JBAA 3N5KA 5JQGF 3ZY6A 2Z43A 3ZW8A 3V46A 3OJLA 1TECE 4LJLA 1QHFA 1E63A 1W35A 2WPDG 1QK4A 3Q6IA 4Q02A 3KWJA 4C0QC 1O54A 1RBZA 1V3TA 1L8XA 3P32A 5DHQA 1ABFA 4CGZA 3EEQA 1NH2D 4M22A 5FFNA 3FLMA 4OB7A 3F5DA 1IBLO 2AFIE 2JKYA 4X54A 3AP2A 5IZCC 2C20A 4MW3A 3K06A 4MKXA 4XYEA 1PEYA 3WMEA 2EU8A 4L1KA 4N7JA 4S0ZA 1U3WA 3T5PA 1XLUA 3EWNA 5L3GA 1GUYA 2C7BA 4M8SA 1KZGB 1Z3CA 1EBBA 4MRRA 1F8XA 3HL4A 2HQ1A 1Z88A 4KWIA 1NYRA 4PZ0A 3VO1A 1NKTA 3U80A 1N2GA 1XDZA 1ZM7A 5ED4A 4QRHA 3B36A 3A14A 3QJYA 1HDIA 3T7EA 3BH6A 2B5WA 2FR8C 2CZQA 3ZCXA 5A2GA 5AHRA 1AUOA 1T29A 2QTHA 1S02A 1OCEA 2XF8A 4GSYA 1J9EA 3PE4A 4DLXA 4GOND 3FPKA 3QO5A 4JYBA 1GUAA 2PNJA 1XJ5A 6Q21A 2E75B 2A9PA 3F9RA 1X1RA 3HWWA 1UBEA 1GGHA 1OGIA 2QR3A 3SCZA 1IPHA 1S7GA 1VB5A 3JTMA 5KJCA 1OZAA 4NK5A 3LZ6A 2WV9A 4EHIA 2A9KA 4I66A 3VZCA 3H8VA 2LP7A 3D9QX 1ZGCA 2IXTA 2PAFA 4IHJF 4H4CA 3TL3A 2EV9A 2Q8PA 3VR2A 2QD5A 1NUAA 4G0UA 5IF9A 2OHVA 5AUNB 3QK7A 3V55A 4UVAA 3OT1A 1C8BA 1OV4A 4KIWA 4ZVSA 3DVAA 2A88A 3W7WA 4XOUA 5J2TF 2OT3B 4C43A 2ERXA 1O6GA 4Z1MG 3OAAD 1GM9A 4PHTA 4TKVA 1LSUA 1XC7A 3PNVA 3BE4A 1T6YA 3L07A 2UZ0A 3KZIZ 3J7TA 1DADA 1Q7RA 1GRNA 1NYQA 5L3ZA 5ITVA 1NXWA 1HNXO 1R37A 3MT8A 5KYXA 4D6YA 5JDIC 2ZPUA 4RH3A 3KZCA 5A62A 1XIVA 2DMRA 3EIWA 4JROA 3V3KA 3EF1A 4TMZA 3NPMA 3JQCA 3D7SA 2AEFA 5C5IA 2NZXA 4WK6A 5GIPE 4RVNA 4DYDA 4NCHA 2V55B 2QTBA 3FYUA 5IAGA 3BFPA 4HN4B 2IYEA 3ECCA 5LJIA 1KYWA 2I3ZA 1G64A 4FJ2A 3ZDQA 1W36B 3KUCA 4P4SA 4FM1A 2C9CA 4OXNA 5AM5A 1XELA 4MRMB 4RMHA 5L6LB 2YHIB 4LZPA 3RS3A 2EATA 4AZ3B 3X2EA 1KVTA 1C4KA 3H5RA 3U4AA 4YJGB 3ETJA 2IYLD 1KI2A 4EG4A 4UULA 2P62A 4DV2B 5JSZB 5BQOA 1R3JC 2FQWA 1Q0LA 1M0TA 4YBZA 2PYZA 4UASA 1BEEA 4Q9JA 1Q81W 2J7KA 2FW1A 2YRWA 3NM5A 3ABUA 3HVRA 1NOJA 3SR2C 3AYXB 4CKYA 3DAPA 2W70A 2BUBA 1JG7A 3AUYA 3A4MA 4O33A 1HTWA 3OY7A 1ATIA 3PVCA 4S35A 2WPDA 3GGSA 3BPSA 5BT8A 3OE1A 4KITB 3FVQA 2HCBA 2IFTA 2AR0A 3T15A 3OCXA 1VRWA 1R0KA 3INTA 1N6RA 2DQSA 3DH0A 3MFYA 4XFJA 2I54A 2YASA 2QENA 3IHTA 4BVKA 2VOEA 5GONB 3SJ7A 4R1LA 1ZC3A 4J0GA 1NTMH 4ZEOA 4GKJO 3HTXA 3BY6A 5IRCD 3ZU5A 3HA5A 4DMHA 5FAXA 3ILVA 3JXEA 1AZSC 2PLAA 4EVQA 3LQRA 1UIMA 5HTKA 4BQNA 2A1TR 3BFRA 3IGAC 2B4AA 5AKHA 1IXSB 1SKVA 1XT6A 2PGIA 2Q5EA 4Y9RA 4RTPA 3MXOA 1XD8A 4DXHA 5JS8A 3CJTA 5K3EA 3SR3A 4MUEA 1BE1A 4DWVA 1XKXA 2C2ZA 3BGSA 2ZBQA 1R0BA 5F9HA 4Q7EA 3STZC 2R11A 3VZSA 2W2TA 1W88A 1ZN7A 4ZDJA 4YRIA 4FNOA 1EP1B 3OLXA 3F7OA 2RH8A 3RJ5A 3CM0A 2PKEA 3EVDA 2SBTA 2I7DA 3O65A 1DPFA 4EQZA 3IPCA 1LPMA 2QL9A 2CF6A 3D3WA 5CXXA 2VPWA 5K05A 1J99A 4IOKA 3QJ5A 3A2KA 4Z1MA 4WDQA 4G2KA 1GU7A 1X94A 4LOIA 3ZZUA 2QE7G 2G9QA 1PL0A 2P1DA 4H44B 5LQAA 4CCAA 3QHAA 1OH6A 1GQQA 3DT8A 3H6GA 4ZEVA 2Z1NA 1IN1A 2RGAA 5A6SA 2MK3A 4LJ5A 1MVNA 4QBFA 3IMKA 3TAXA 2VJYA 2F4NA 5LCXA 5DYNA 2X8WA 3OE5A 4DR2B 3OZCA 1X1AA 6ADHA 3VC3A 2WF8A 2GM5A 4DZRA 5L3EA 5YASA 3FPCA 4HAMA 3EG5A 4CTNA 2XYPA 3K92A 1JJOA 3C5CA 1SVSA 1M93A 1U2PA 2VDMB 2WP0A 1I7NA 3VTAA 4WKBA 1VLLA 5HQ3B 5IN5A 4C7JA 3BRWA 3H5IA 3SHWA 1IY8A 1VMKA 1ZJYA 4UMDA 1PM9A 2YZGA 3CLTC 2P5OA 1Q1EA 2W0MA 2AJTA 2F3UA 2JBHA 3BORA 4NBKA 1G8AA 1CLUA 3NTOA 1P9WA 2PCJA 3GUYA 1M76A 3Q87B 1V25A 3FHLA 3E9CA 4G26A 5FWNA 4JDPA 2ATEA 3V1MA 1KETA 1SCBA 2PPLA 3K9LA 3LKVA 5LYJF 2J3MA 3DZBA 1ZD1A 4W1SA 5KDOA 5JZ9A 1RSZA 3CEHA 1FFSA 3COVA 4MUNA 4PQEA 4C0BA 1T9BA 3NC0C 4LVCA 4D82A 2BW0A 1EJ6A 3EZNA 2FSUA 2NT3A 5D3MB 2IU3A 1JSCA 1ZUNA 2SECE 1PS9A 3EVEA 2YV1A 3PEUA 3NP7A 3DDHA 4K26A 2Y0IA 1K89A 2W98A 4YUZA 4RZQA 4RTQA 4D0SA 3UICA 4PX5A 4KPGA 1PL4A 4RHCA 3W2EA 1JHVA 3GT3A 1Q1AA 2R8XA 4MVJH 4XW2A 2NIPA 5K1XA 4Y6RA 3A9UA 2QMYA 4CMHA 3SEFA 1NF2A 4FBGA 1F3OA 2REXB 3TMAA 3URKA 2Z4TA 1YQQA 1IM2A 1GAJA 3BIFA 1CIVA 3UJ9A 1ODTC 3ANTA 1JR3D 1ULHA 2EEPA 3STUA 3NM4A 5BSFA 3AEIA 4PELA 2XNDD 3TLKA 3T12A 1XHLA 4NYJQ 1OFVA 2AOXA 1MAHA 3PSHA 1AS0A 1G0OA 4H0LB 4FYHA 4DG8A 5KX5F 2OZKA 4OQFA 5A3VA 1P2DA 1C30A 1A50B 2JLCA 3UCXA 4LWSA 1GPLA 2V1XA 3ZPXA 4BQQA 1E6UA 721PA 5EEGA 1B0UA 4TMYA 1Y3IA 3DDWA 3KE9A 4R4JA 2RONA 2ZE7A 3CNLA 3KD3A 1TNDA 2DYSB 1F8YA 2FE4A 4HJRA 5ER9A 4WBXC 2G1AA 3ORYA 5FL3A 3DXYA 4E6PA 3T7AA 1BMTA 1G7TA 3TRKA 2D3TA 4YDSA 3BGOS 3CEPB 3BMQA 3SM3A 1CY1A 5F1YA 3RK4A 4E08A 1XRLA 1XNQO 1U0EA 1BDHA 3WGIA 1KUQA 2RB4A 3SD7A 1W76A 4W63A 3ASYA 4YYEA 2B3DA 1B41A 3R1IA 4TRJA 4M8LA 2QE7A 3FR7A 3IHKA 2QYHA 1X7WB 2ADQB 1O0CA 5HKOA 3GLTA 2J3QA 1R6UA 2A9HA 4XUEA 1YBMA 4KR9A 3IDOA 4O2BA 1SHUX 3QFRA 1WDTA 4U3FH 2L82A 4ZN6A 2B92A 2Z5FA 3CQ9A 1HG1A 2FMXA 2FJPA 4V0OA 5ITZA 1AJNA 3I01M 5DW3A 1WHSA 4JI3O 4H6VA 4KYTA 5B4UA 1PLKA 1WV1A 1NVDA 4KIJA 1E2EA 1PSDA 4MIYA 3W9YA 2WLNA 1DC6A 3S68A 2ZROA 3K6RA 4QATA 3HCAA 4OHXA 2Y2VA 2JLBA 5EZYA 1DUSA 2GSMB 5LQNA 2C0CA 3WB9A 1JGTA 3VZDA 1ZJWA 3COPA 1QG4A 2B94A 2GKOA 3N6VA 4N3GA 4H15A 3HJFA 3ZDYB 3DP9A 5FUBA 1GKYA 1AKNA 3QMMA 3C6MA 3C3XA 3UMRA 1YB5A 1LPBB 4I0XB 4OHYA 2GDZA 4WXPA 3S40A 4BMVA 5B5SA 5F78A 1RP7A 2Z58A 2V9CA 2FY8A 5EBMC 1NFFA 3TLGA 2VTVA 4EA8A 4AY2A 2GBGA 4OP2A 3A1FA 2H1OA 1YO6A 4EW2A 2YXYA 1SUFA 5ILOA 3R0VA 2O07A 3EZGA 4CS4A 3NHBA 3PTAA 3ZXIA 4BE9A 3AK3A 5ITWA 4JYAO 5AVTA 3TRJA 3ASVA 1TPYA 1Q8IA 3TYXA 1AA6A 2SKEA 1WMAA 4ZVTA 4ZI5A 3AVWA 2ZBFA 2X0RA 1KFEB 4LCBA 1DX6A 2PZLA 3CYFA 3R7LA 1LK0A 2B78A 4NBSA 1KQOA 2Y1DA 4DMUB 1CQXA 1UMCA 3PHIA 4L87A 2QLBA 3F6YA 1DX4A 2ONYA 1DIAA 2YQZA 3PJGA 4J0EA 4GGOA 1KZ1A 4LUCA 2I2DA 3NANA 5LMNB 1OC4A 4UCUA 2PKQP 5LZ8A 4ZALA 2F00A 4XGIA 2VZEA 3SR0A 3MRTA 4QPPA 3JR3A 2FSIA 4KQXA 3OLYA 4V02A 4WFHA 2WSSA 3WTCA 1DFIA 2CXXA 3U3OA 2FYUH 5JATA 3GEBA 4XSHA 4KQCA 2AHZA 1JIKA 3H1BA 3PCRB 3HFSA 1CP9A 4QZVA 3B6ZA 3CPSA 3BRQA 3RQIA 4PONA 1MF7A 2YHSA 1AHPA 2IYZA 3H97A 4NG5A 3WDLA 4H7IA 4BFUA 3EAQA 4A6PA 1LKZA 3VXKA 4HFNA 1LCIA 1BHBA 4HZGA 1BWQA 2FPLA 5DTEA 3CZQA 4OUDB 3K0BA 2IZZA 3BL6A 4UPEA 4JR2A 5FQOA 1PV4A 2QRVA 2HZBA 1TC1A 1XEWY 1GQOA 1L5WA 4JLUA 1NDQA 1VQ7V 3CG0A 5AQEA 2D3OW 1RRPA 2PVCA 2JGUA 2Z9BA 1QBKC 4DIDA 5BPHA 2GF2A 4IYJA 1IDN1 1QF6A 3P0RA 4K88A 3UO8B 5CVTA 3FKSG 2OK8A 3D1LA 1L8LA 2G09A 1W0KD 1ACJA 3QNUA 2I9KA 4UCVA 1RPJA 1NVAA 2R8RA 4HX9A 1GLVA 3OEHG 3L93A 2OQVA 2AX3A 1NVPD 3B8NA 4BLRA 3SBXA 2G1PA 3HDHA 3MB5A 3WO0A 1K8YB 3JZIA 5E2BA 2HHJA 4FX5A 1HL7A 2WYWA 3EDOA 2ZRIA 2A5LA 4YIKA 1PSWA 4DJFC 2O8BB 3N53A 4C06A 5ES3A 4IIYA 4M1WA 9LDBA 1JDJA 3A6EA 3DBLA 1E2NA 5HFLA 3M1IA 4M88A 4A8JB 2VBCA 4D79A 4PEVA 2QV7A 1NPDA 3FHTA 3UMGA 2C04A 4CRWB 1SS3A 5AHWA 5FLXA 1IPEA 4O2LA 4F1WA 3QELB 1W2WB 4HXFB 2AUMA 4KAAA 3G2QA 3MMNA 2E37A 4J4TA 1XFDA 3OO1A 2XRMA 2P6UA 2G40A 5KNCH 2YI8A 3T1YB 4MJ3A 3QU2A 4EI2A 3HJGA 1OI3A 1R0SA 2ZIUB 4GI2A 1UH5A 2XB2A 621PA 4E30A 1K7EB 1WB4A 4X44A 3GT0A 2AJBA 1ZCFA 1CDDA 4YV0A 4DLKA 2CSXA 4QUGA 3ZHOA 1GDHA 5JS2A 2OOSA 5J47A 1RAGA 2I5PO 4JI2B 5FPHA 1I8TA 5CNKA 5FHRA 1T15A 1L7AA 1VJGA 2VJBA 1MV5A 1ACLA 4MYUA 3R7WA 2QP4A 2P0EA 5JECA 5CVVA 4O4JB 3VPDA 4TUYF 2WFAA 1L8QA 4UDNA 1PBTA 1JIVA 4GCZA 3PBKA 5L3DA 4PLPA 5KHHA 3LUJA 1WD7A 1JKJB 3V6MA 1U3VA 3SHVA 2PH5A 1P1JA 1JAZA 4FMTA 4Y2TA 3WNVA 2D1SA 4DM4A 3B6KA 3AEQA 1U1GA 4OLFA 2EP8A 2R00C 3HLKA 3NGXA 3DOFA 4RHUA 3KCNA 3WXBA 4N3CA 2OYRA 2VJQA 3I39X 3FOFC 4H1WA 3QPBA 1HBJA 1AK9A 4MKFA 4HT3B 4LS3A 2EF0A 2ZETA 1FJ2A 3CJRA 3CO0S 2GPNA 1FZQA 2VA9A 2ZITA 4JB8A 3HSYA 5D2CA 4O1MA 3VTFA 3L70H 4N8DA 5ALQA 4CUJA 2CUKA 2PS0A 2I62A 4FZ3A 4Z0PA 1UK8A 1LI5A 3E4CA 2EHDA 1TEXA 3UN1A 2II6A 1JTEA 3H1JH 3FKSA 2AOWA 5HP4A 2AUNA 1C3LA 3E81A 1WB9A 2EKLA 3ZDDA 3K08A 1KBQA 3TZHA 2OHIA 1EB9A 1QHXA 3KJQA 3EZ2A 2GF0A 5BN4B 3OEHA 4MQBA 2G9VA 1A2BA 5H9WA 4RPJA 3ZRWB 5KYWA 4TS3A 2Y2UA 3G5LA 2D1YA 1RC8A 5EWMB 2C1ZA 3E2IA 3SLKA 2O2HA 4BNHA 2YJ3A 3WWYA 3MBIA 1RQXA 1IXZA 4CHTA 2B6HA 1QVFU 2YV4A 2OCKA 3GLSA 4TSRA 1MCZA 5F35A 3RIMA 1JNXX 3IXLA 1Z07A 2PXAA 3IO5A 3RFFA 1SB9A 4U3JB 5IAEA 3LFTA 3PIRA 3TDKA 5EMLA 1DC7A 4DUPA 3HJTA 3WG7B 3PC8C 3C4VA 1UIRA 3GZ4A 1WUHS 1F17A 5IWCA 3FHOA 2QAIA 4B32A 2NU8A 2V7QD 3ABOB 2A84A 3MLAA 1E2KA 5EHGA 5L3VA 1WMBA 4JAUA 2JJ8A 4DK0A 4O8ZA 3QLEA 1X3LA 4B3RO 4WVLA 1QR6A 3AHHA 1SVMA 3OC0A 4MJLA 1YQUA 1TEHA 1GL7A 3QXXA 2DWQA 2E4UA 1QWSA 3KD2A 2JH8A 1I7SB 1UP6A 1BVYF 1KAMA 1BTOA 1UDCA 2WPDD 3T1NA 4FI3C 1ULZA 2F3SA 2WJAA 4B3IA 3K9AA 2R47A 1C7FA 1WABA 2RGNA 3ZVMA 2VDWA 1JW9B 4QYIA 3I12A 1U9IA 4XWYA 1MNQA 4X8AA 1ZHFA 1T9DA 1Y37A 3CUVA 1P4HA 4B73A 2HSWA 1CU1A 1LJLA 4JQOA 4C2BA 4EELA 3STWA 3EW7A 3HR8A 1T9GR 3KPYA 4MTCA 4JC4A 5I9SA 3L41A 4EJSB 1UWCA 3FD8A 5BSEA 4HGOA 4CC6A 1Q11A 2HMVA 2DU8A 4N3AA 3WLEA 1S6YA 3A9CA 1R4MB 4KN5A 2GZ1A 1T8PA 3P0HA 1KPHA 3CSDA 4AF6A 2HIHA 3TCNA 2HWWA 3WKAA 1I2MA 4JKOA 4XDLA 4GI7A 3R9KA 3RRXA 1KYZA 1PX2A 5HKKA 4AICA 1MU0A 4MW4A 4K1XA 3HNRA 3PD1A 2DT8A 2OG1A 3QOWA 1WB7A 1MXHA 1OASA 2Q62A 1X42A 3I4LA 3D8NA 4N18A 3PNLA 3D8BA 2PU5A 5LB2A 3PKJA 3WHPA 2HBZA 5K4GA 2O1XA 1QHNA 3N2ZB 4JLJA 2ENUA 4XWKA 3K0FB 4YP6A 1T0PA 1G8FA 4HLNA 1U3CA 4BNLA 3WSVA 5IABA 2ZSHA 1WUIS 3GLFB 2QWRB 1YNSA 3C6YA 2I8LA 3GLIB 3ZIUA 1D2AA 1KK0A 4IS3A 1QTIA 1IVNA 3NORA 4JVNA 5AW3A 2QVBA 4LN1A 1O5IA 1EUDB 4XB1A 2XTZA 4FYPA 1R74A 2P5UA 3DHEA 2WQ6A 1CULC 4Z1MD 4XDHA 5CAEA 3DD5A 3WXMA 2PYDA 3A32A 3ORSA 3PKIA 4R05A 4W8OA 4EG5A 3OEWA 3LU1A 2GYVA 1ZTEA 3CCEV 3NTVA 3HG7A 2WDZA 5FTMA 2ZRJA 2R66A 3JARA 3PNKA 4C0HA 2CFSA 2AH5A 3CCUV 4X62B 4RS3A 2ZRKA 3REQA 1G21B 4M9UA 5FNVB 3U0BA 2DM6A 1P0FA 2QRZA 1JMYA 1WW3A 3L75H 3OLZA 2VYFA 1WLEA 4GP6A 4NU0A 1TA0A 5BURA 3DKPA 3HN2A 4PXAA 4HQ6A 5AW2A 3ENVA 3I37X 2P22C 2P7TC 2Q5QA 2I2WA 2XNKA 4PZ9A 1WCYA 4J75A 5I7WA 2BD0A 5JAPA 1CR6A 3SK0A 2CNLA 4HBNA 1L4KA 4JI4B 5FPSA 1C3OA 1OGYA 1FDRA 4QOEA 3KSMA 1N9GB 3K5IA 3ZNOA 4E51A 1WUKS 3BRWD 1SUEA 2A8YA 1C0KA 1HMPA 3BWEA 3PHGA 4R7ZA 2BMWA 4ZQBA 4XPZA 4UB6Z 1QUFA 1ZK1A 4DBVO 2AMFA 2J85A 2OIGA 4UBMA 1KH2A 2XXAA 3ZN0A 3FWKA 1E5QA 1FVOA 2P11A 5JXGA 2VS1A 4MS3A 5HJ2A 3ANLA 3ZBQA 4GVPA 1WW8A 2RGCA 4BO9A 3F98A 3F6CA 2BCEA 3GLVA 3EIHA 2QAGC 2IPNA 2ZYUX 1QMGA 3UGQA 5LHHA 1EXDA 1EGVB 5LXTA 3VA7A 4XVHA 1GRJA 4J1QA 1KF0A 1Y76A 2LBPA 2P9HA 4ZAVA 4IVNA 4UUJC 1PJ4A 1T8WA 3HRKA 4RSRA 4Y8VA 3SY8A 4EYKA 1YF3A 1ML3A 3SC2A 3AF6A 4HAOA 4E0BA 5LMUO 4IGEA 1ZCAA 2A1UB 3WV5A 4PPYA 3V1KA 2YIDA 3KFVA 4XVRA 4U4AA 3AKCA 4I4NA 3BHNA 4J80A 2QLFA 2CCGA 1QUEA 1CUXA 3DMRA 2JGDA 3UZUA 1I30A 5M04A 2JLVA 2R6HA 1SQQH 5DHPA 1TW2A 2O8FB 1SF9A 4KLNA 4LZAA 1RPOA 4QYSA 1WOMA 2QN7A 3KJXA 5IN4A 2PX8A 1X7GA 1G16A 1TQ4A 4BWAA 4A27A 2YIBA 3C7CB 1XDUA 1E2QA 1N7GA 1X8KA 2RJNA 2WIBA 5AM2A 4G4GA 3MXTA 4D7TA 3OEEG 2YN4A 1IOLA 1MIOA 4DMCA 4KXXA 4DWOA 4DVJA 2UUCO 2GJAA 3MJRA 1EWKA 4GW3A 1ZMOA 2V7BA 3W2GA 3TF5A 3IVCA 1TVKB 1AQNA 2WWTA 1EN4A 3QF4A 4J2OA 3F5QA 3FMPB 1FE8A 1J7JA 2R68A 3RIEA 4Y6QA 1I80A 1V3UA 4LOLA 3DE2X 2QW8A 4DLAA 3DMPA 3HEBA 4XQ9A 2FMTA 1DCTA 3F47A 2QE7D 1XOUA 4E03A 4LV5B 4KXFB 2GPBA 2BZ0A 4NTXA 1IJFA 3I52A 1YQWA 4NBUA 4IMIB 3D3JA 2C2HA 3FMIA 1CJTC 3GIDA 4RLFA 1HQKA 5HKLA 1ZXLA 3NM6B 4KE7A 3KVYA 4ZQGA 1RM1B 5JRJA 2YFQA 2LKDA 3BMOA 5HJ7A 3R7BA 4PO1A 1L1FA 4OQXA 4E5MA 1SK9A 4X7PA 3QXJA 5E1AC 4CQNA 2QTVA 3T5CA 4Z51A 4KP4A 2QJOA 2RI0A 1X92A 2WRZA 3ZE8A 3DMDA 3K2EA 3RUCA 5I7EA 3ZNPA 3ADPA 4H35A 5FWYB 4CUKA 3I30X 3FW1A 5L45A 1WBJB 2GLUA 4L50A 3Q7TA 2ABWA 3CJHA 2OD9A 2OHOA 4E22A 1T5EA 4I5FA 3ILHA 3TL6A 1NJFA 2GCIA 1VARA 3OJOA 5BWOA 4R31A 6ABPA 5BVHA 1JE1A 5FKJA 3ZU6A 4KTTE 3RE1A 4YJ3A 2UYHA 1JVMA 1SZCA 4LI3X 3WYEA 3MCAA 2YZ7A 4YT4A 2BZGA 2FWAA 3AGPA 4WF9V 1SURA 3OBBA 2EJWA 2OXEA 4Q0MA 4EB6B 5L4LA 2DPLA 3P52A 4D25A 4CMIA 5KTOA 1GPUA 1YE3A 5IM5A 1JXMA 2E55A 4PCLA 2O14A 4BGEA 3WLFA 2MOKA 1X80A 3S55A 4FYJA 1F5NA 2X0FA 5CBPA 4YRAA 4A8PA 1G3IA 2NXEA 2R6ZA 1QANA 3I2GA 3N2NA 4MRSA 1PS0A 3GLGA 2GKGA 3QKUA 5JTUA 4CKXA 3F8SA 3K2QA 1JBEA 3QEOA 3ZY3A 4HB0A 1GT6A 1JLRA 1S4MA 4NSNA 3G9ZA 5LVAA 1BDJA 4URZR 2G4LA 4YC7A 5SYNA 4MS4A 1ZM3A 5FLEX 1V8OA 4BLPA 4URUR 4KAFA 3TOZA 5BV2P 3DZFA 3JWPA 1PUXA 3D3QA 3LHIA 1U80A 3FGPA 1J6UA 4F93B 3ZY2A 4RTOA 4Q1FA 1XLTA 4BIMA 4TV8B 4M54A 2F90A 5F7XA 2BCJQ 1YF2A 4AWAA 2BDEA 1NBIA 1LB1B 1J39A 5DH9A 1SCJA 4PIVA 2TYSB 5KWEA 3OEEA 3HLYA 2O1WA 2HHHO 2JIZG 1V2HE 1RTTA 1W1WA 4TYQA 1XZEA 4KYUA 5B12A 4FZJA 2YIMA 4J10A 3C14C 2YW2A 2CMKA 3LTNC 2YMPA 3IEIA 3CC7V 3AVVA 1DX9A 2X14A 2SNIE 4FKBA 3ZS9A 1J23A 1NC1A 5LWQA 2L6LA 1KQSU 4KE9A 5H02A 1RAIA 3C7AA 5E0OA 4DMRA 1U8TA 2FSVA 1Z83A 4HQOA 5EYPA 3E3OA 1ST2A 5AIAA 4BNVA 4L72A 3TDMA 1CRLA 3WYCA 5CK4A 4M9XA 3GXBA 1M5UA 3NJRA 1BGVA 5JXIA 5DI3B 2C8JA 1CUJA 5B58C 1BE8A 4R71A 4EL0A 1GFSA 4WASA 1CUDA 3AXSA 4KV9A 4RKYA 4BNYA 2IYAA 2D59A 5A2QA 3FB1A 1BWRA 1BHO1 1GILA 3E8BA 2JDIA 4U8GA 4Q4AA 3AHJA 1ADCA 4BW5A 3NASA 1M8PA 4X00A 3PXCX 1VMGA 5ADVA 2Q0AA 2NQ2C 3NB0A 1RIIA 2GJKA 3L0SA 4M0UA 2ZJ0A 4A9AA 2GEUA 2GM4A 2H2HA 1YHQV 1F7VA 4ZPJA 3AV3A 2G04A 4KOAA 2F67A 1P8AA 1R8JA 3AR4A 3TGPA 1XR3A 2AC4A 3UTDA 4UBJA 4MGHA 5DGXA 4ZOBA 4R54A 3PPIA 3VR3A 4ZYTA 4FI3F 1FJGB 3AEKB 1DMRA 4ZKEA 3AJDA 1FNCA 5GJCA 1H4VB 4UHHA 3EVCA 4TV9F 3QEAZ 4Q3AA 4KJZA 5JY1A 3X1ZA 4R7TA 1U0HC 4Q9NA 4QDOA 1MB9A 4FILA 4GI1A 1L7DA 2PX4A 4DANA 4U39A 3GVXA 3DBHA 5AD1A 4F92B 4EFLA 2GCPA 4AULA 1L6RA 1B76A 4ZMRA 2V6MA 2BEWA 1GA4A 1R12A 3F6PA 4TMKA 2AFHB 2FW6A 5JHHB 1M1YE 2OCPA 1K5GA 1OAOA 5HWSA 4YJ2B 2J41A 2F95B 1UPTA 5H68A 4XCQA 1MSWD 1RRFA 5HUHA 3PIIA 2C2GA 4JDUA 3TG2A 2QRNA 3U16A 2VTBB 3T3GA 3KL2A 1A7UA 4U2KA 5B58T 3UHPA 4FN5A 2ZP1A 1EUYA 4CEHB 3KJIA 4BP3A 4QPJA 4JJZA 3PYMA 2OMKA 5EJ5A 4I9HA 3MJFA 3MBKA 3WICA 4NEQA 2Y1OA 2RKWA 2H29A 3WLRA 1ZJZA 1Q0HA 2PQ6A 3WK4A 5A5EA 4PLTA 5H59A 4XQEA 2BKXA 1XJWA 3MB8A 1ZN8A 4NCKA 4DM3A 3VZBA 5A7FA 3ZS8A 3QA3E 4QFBA 3IE1A 5K0ZA 3W34A 4BO0A 4MV8A 4XWAA 5DMHA 2JIMA 4RZ3A 4D4LA 3KYCB 4QREA 2QSYA 2X0KA 1PEAA 4BLOA 2J4FA 5H4HA 1LRJA 5HQTA 2JIZA 4AKTA 5JNVA 3C5WP 4W82A 3RSSA 4YI3A 3REGA 2Z6AA 2XVAA 3CIFA 1OXSC 4ABYA 1JEJA 2IK8A 1TRKA 3DKIA 1OB5A 1NATA 1DQZA 3EDYA 3ITKA 3F3KA 1XD9A 4MUFA 5GV8A 4JT2A 5JR3A 2FZCA 1NP6A 3T0FA 1GZ3A 4ZTBA 5EE3A 3W5CA 4IO0A 3R0ZA 4GGPA 2YWBA 1N0UA 2EFYA 4UTOA 1OFTA 4DNFA 4MVJE 2VAWA 5JJIA 4DL9A 3UG7A 3NBYC 3NIDB 4L8LA 1K63A 3UT5A 1R7RA 3SGIA 3D8RA 3HZRA 1XTVA 3H8WA 1GUDA 2NO5A 4D3DA 1R0ZA 4PZUA 5CFMA 1WSWA 2GCOB 4DSAA 3PXEA 4GE0A 3Q98A 1LBIA 2HFEC 3DAOA 5KI6A 3KS9A 2IYRA 4E4TA 2ZXWB 13PKA 2VYNA 2UXBB 5JANA 2GN8A 1KSJA 4MO2A 1VJ5A 2A0LA 2PKQO 1FXUA 3D54D 3EODA 4XAQA 3OEHD 1LVUA 4ZI7B 2VHZA 3KXPA 1E2FA 5TT0A 3BF8A 1FTSA 3HV2A 4EMBA 4PYIA 3MTAA 3D0RA 5CFLA 1YUNA 4WLNA 4YXWD 2W6MA 3V4ZA 4B8WA 3OCJA 2BWJA 1YZHA 1WO8A 3T5DA 2P1ZA 1PTJC 1ZWLA 2IRWA 1A32A 2O5RA 3ZK7A 1CUUA 3N5CA 2YIJA 4FZ5A 4HRXA 2IL1A 4BFYA 1U11A 1RVDA 2JASA 1PTKA 3ABLB 1S1MA 3JYCA 5BSUA 3LLVA 1YR8A 3UJPA 1QLEB 3KHSA 4BZXA 4RFSA 3GO4A 3R74A 5EERA 3ZR4B 3EASA 1CK4A 3LUTB 3CF4G 4MEBA 4QA9A 1DG9A 2CVZA 1QCCA 2VXBA 3F73A 5BNWA 4ENVA 2ODPA 2XGGA 1JU9A 1X1DA 3THOA 2A9QA 1ZN9A 4MV3A 2Z3WA 2BFCA 3GZNA 3W8EA 4L28A 2A3QA 2RHDA 3QE0A 3BWVA 3DBRA 4I4TA 3GEDA 3AVQA 3C39A 2ZIXB 5D1NA 3ESXA 1NJ5A 4UARA 2ODMA 1H2AS 2PS1A 4FXOA 4YO7A 4AMUA 4DC1A 2XE7A 2HA7A 1EWTA 3KUDA 1FDUA 2HIAA 2QWNB 1JHYA 2WNHA 2RQ6A 1P73A 1EGQA 1PI3A 5FUVA 3M5WA 7MHTA 4EGJA 2W71A 3DVQX 3SYQA 3KTOA 3WIOA 1WZCA 4JI0O 5TVKA 2WUVA 3Q7SA 5C5CA 1I3OA 3TLXA 3EQZA 3OUZA 2FPIB 3G7NA 1ZSVA 3ZWOA 2PEYA 1H4TA 1FXWA 2I33A 3ZVNA 3NUGA 2CTRA 4HNGA 3CF6R 3LVBA 3ZTWA 4ZVKA 2VCEA 3V4VB 2UYOA 5FPPA 3BTOA 2IX3A 4ZYLA 2ZE5A 3QX3A 5ALPA 1W9HA 4H7JA 4O08A 3IESA 2QMZA 4ZT6A 3L7KA 4FR2A 2OZEA 2Y6VA 2JJ1G 3ZXXA 3KBBA 3RSOA 1UJCA 2IW3A 2V7TA 1H2FA 4FN4A 2Q4BA 3RTGA 2WJVA 1TUEA 4B85A 4PGAA 2ZIEA 3DO8A 3FSEA 4L5YA 1WB6A 3C7DB 3RS2A 4KR2A 1FMLA 3ND7A 4E31A 3QKRA 4B46A 3WRXA 2JLRA 2ZCUA 4KQ6A 5AI4A 4PWYA 1NVFA 3O95A 1S77D 4GR4A 1I4LD 1GRVA 3IXMA 3W8RA 4DWJA 3S99A 3JAKA 4QTUB 3KYIB 3GUVA 1EGHA 2AHOA 1YCFA 5J3JA 3I1FA 2ZANA 1Z4IA 4JBIA 2Y05A 3LCVB 2HTEA 5KHKA 2BSXA 2QJWA 3G79A 3PPXA 3M1YA 5LZ2A 2GTAA 4NCAA 4K6HA 2Z1MA 1JFVA 4L8GA 2MSNA 4AN0A 4QT4A 3G8BA 3FF4A 1DKUA 2W11A 4ARBA 4YN3A 4X89A 4DA6A 1SEPA 4WK2B 2BJHA 3KK0A 1I2CA 4BVLA 3P26A 4K6KA 2NU9B 3AERB 3TFOA 4EHJA 2DBYA 2Q6VA 1CR4A 2VSXA 2CXSA 4N8EA 3WYAA 2X42A 2AOTB 6GPBA 3DMFA 2YXPX 3U5TA 5AXAA 1ZEJA 3KKYA 1OYVA 2Q9BA 3CKYA 3I0NA 1ZA1A 1T8TA 4INOA 4NENB 5LHGA 3O9VA 4M49A 4R1QA 5L6MB 3CF4A 4ZCTA 2UZ4A 4PYQA 4UEJA 3Q6NA 1FUKA 1MJNA 1SG9A 4RQAA 4F3CA 1PZFA 2Z2XA 1K34A 1B16A 1R0CA 3DFIA 5LLSA 4AWBA 2FRXA 1H2SB 4M3NA 2VJCA 4MR9B 1T4MA 4JU8A 2XUAA 4DV0O 2VNHA 4IXWA 5K3AA 4E32A 3RVLA 2QX7A 3IYLW 1XRPA 1VIAA 3CRCA 1UJ5A 3PE6A 1J0BA 3V8BA 1LPSA 4KFCA 1A9TA 1DKPA 4CBCA 3ZGZA 3U9SA 3NCHA 5KYNA 5AVXA 5JCOA 1KSGA 3VHQA 1SRQA 2XCTB 1WRBA 5CA0B 3I9V6 5DT9A 1XTQA 1I6WA 3K1TA 3M81A 1U0TA 5JEDA 5TS2A 4DCTA 3URMA 1JHQA 2P9EA 4BNMA 1M6YA 5SZHB 1EXWA 1WE2A 4L08A 3OQNA 3GA7A 1X9GA 1PEDA 1FU4A 3TXXA 4RK0A 4FPPA 2RCNA 1GSHA 1KO1A 1TCBA 5ALVA 5I3ZA 4G1MB 3D2AA 3LLCA 5CH8A 1VIYA 2E21A 3QWBA 4MQUA 1V6SA 1Q0PA 1JR9A 1KPGA 5F3WB 2HA4A 2GO1A 3D8SA 3FB5C 3V4OA 2GUZA 5K01A 3SJQC 5E38A 4LMAA 4ZOQI 4EB0A 1I33A 1QU3A 2JJ1A 3ZHVA 3ADOA 5IDWA 2QJ1A 3C90A 1EFCA 1JA8A 2YIBD 4I50B 2DPYA 4HBGA 4WERA 4ZYXA 5B1YA 3IDFA 4I1OA 2PSFA 1E2JA 2D8AA 3HM9A 4GR5A 4YUVA 4U7FA 1N2EA 4YJFA 4AJ2A 1N5MA 4A2PA 5CB4B 2B7LA 1FNDA 3EVZA 4RGBA 4I1VA 1Q77A 5DBHX 2V6FA 1PNOA 3N8HA 3O94A 1T3HA 5B6IA 1AKQA 1OILA 3KDSE 3ACBA 2B5OA 2ISSD 3D6AA 3HBMA 1TCUA 3VSBA 2Q8NA 5BV0A 2XCSB 4AJ9A 1TAGA 3VX3A 1DO0A 3D4OA 1UK6A 2QQ5A 4M1QA 1ULSA 2Q3CA 1O94A 3PVZA 1DGQA 2WSSG 4K6GA 3LT0A 1BMFA 4UUMA 2J5KA 2ATXA 3ZW9A 4MX8A 1U1EA 1XP8A 3VU9A 4MHOA 4HEQA 1ZI9A 5HUJA 1M1NA 4ZCPA 3QHQA 1DSSG 1BQZA 3NMUF 4I2NA 5KWIA 4BEWA 1A88A 4FGLA 2CTPA 2HI0A 3IEPA 5BYBA 1PK8A 2POCA 1XZIA 3MQ4A 2R96A 3SZOA 1UXGA 4EUKA 1QHTA 2WFLA 3CU5A 4NICA 4RGYA 2JAUA 1SD5A 2JGMA 2R72A 3VUFA 2XQVA 4KIUA 4IMRA 4H4DA 1KY3A 3IJRA 3FB6C 2O20A 3IPYA 1N7IA 2ZDHA 3C6BA 4GOMD 5CB0A 4B8ZA 3QFSA 2ZQMA 1RLMA 3B20A 1V1MB 1UFKA 5KKCA 3G0DA 2J9ZB 2AW3A 4P5EA 4JD5A 1TYCA 2XAUA 4GP7A 2ZYAA 4TWAA 3KTFA 3EXFB 2JCXA 4IMPA 4BX3A 4EFNA 3DCJA 2XODA 1GGJA 5JZVA 2HR3A 4EJ2A 1ENZA 2YMMA 2UZIR 3I4FA 2PQ0A 4RFVA 4JA0A 1BKDR 1OZHA 4AYWA 3N39C 2FMLA 4ALLA 4A91A 2XQFA 5JYDA 5BZBA 3NBFA 1RXWA 2BEKA 2KB0A 2QR5A 3ZH2A 2M1XA 2ZIZA 1L7PA 4I4LA 3VYTB 3SPCA 5ALRA 2RKBA 3TEMA 3NAQA 3AKEA 4INAA 4S1OA 3VC2A 4NC9A 1F14A 2QYTA 2PBLA 3C41J 4GZ6A 3CR7A 3R9WA 2Y9PB 3T06B 1F4LA 1CE8B 4BFTA 3I9LA 4WAUA 1VQKV 2PMBA 1KARA 5KAIZ 4NE2A 3UH0A 2I4MA 2VUTA 3CH7A 4CEIB 4K6MA 4V2IA 5B1BC 3OEED 1YZVA 3KVRA 2YICA 3LVQE 4BFXA 4EG6A 1J33A 4OM7A 3P0JA 1ZQ1A 2P9QA 3R66A 1Z2EA 4LF5B 4N5HX 2DFDA 3VRHA 5JZBA 3CMAV 1P4SA 1YTUA