3WBAA

Rice os3bglu6 e178q with covalent glucosyl moiety from p-nitrophenyl glucopyranoside.
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
478
structure length
478
Chain Sequence
GLTRGSFPEGFVFGTASAAYQYEGAVKEDGRGQTIWDTFAHTFGKITDFSNADVAVDQYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPYVTLYHWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNQPHTVAIQGYDAGLQAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKATQNGQLGIAFDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRFTADEAAVVKGALDFVGINHYTTYYTRHNNTNIIGTLLNNTLADTGTVSLPFKNGKPIGDRANSIWLYIVPRGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIKYHNDYLTNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSVQWFKALLKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enzymatic and structural characterization of hydrolysis of gibberellin A4 glucosyl ester by a rice beta-d-glucosidase
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Hydrolase
molecule keywords Beta-glucosidase 6
total genus 193
structure length 478
sequence length 478
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wbaA00
2PC8A 4AEFA 2BHYA 1E3XA 2YKKA 5E6YA 2XWDA 1WKYA 1CXKA 4F8XA 2WK2A 2WWDA 2PWHA 1E5JA 4PUDA 1KXHA 3SIMA 1CXHA 1EIBA 4PMOA 2GVYA 3NDZA 1C8XA 1NOWA 3GXIA 1QNQA 1EO7A 1WZKA 2WB5A 4FF5A 3J7HA 4QDMA 4UQCA 3AXIA 3CZ8A 2DSKA 5CXPA 4D6CA 5EB8A 2XGIA 2DGAA 2JIWA 3THDA 1UH3A 2D0HA 1V3JA 2W4XA 1FA2A 4JHOA 1CENA 2VX5A 2WBKA 3WD3A 4KGLA 4WJXA 2VQUA 3AIWA 5ABHA 4N0RA 3CZLA 1WDRA 4W85A 3WMSA 1E6SM 3N17A 2YA0A 1B3ZA 4B15A 4J28A 4P8WA 1W91A 4U3CA 3VD4A 2CKSA 4PMVA 1VFOA 3GTNA 3AS3A 3WDIA 3OLDA 2ZUNA 4MB5A 3VIFA 1FHLA 1UD8A 4MNLA 3W28A 2AOSA 3ARSA 1HKMA 1EGZA 3POCA 3LPOA 2ZXDA 4KWUA 1UA3A 4HZ7A 3OGRA 4LXFA 2WW5A 3SUTA 2ZX9A 1V6WA 4BCEA 5CPTA 4JKKA 2VX6A 4K68A 1B3WA 6CGTA 2GJXB 5ABFA 2XFYA 4AW7A 4HA4A 3MSDA 2CYGA 2EPMX 4DUVA 4KH2A 1US2A 1E15A 1WAWA 4Z2LA 1CGUA 1GOQA 1XC6A 1JYXA 4W86A 1NH6A 4CVUA 3ZO9A 1Q6EA 1H11A 3VX1A 1JXKA 1XV8A 3ARUA 3G6MA 2D3NA 1TFVA 3VPLA 3BAIA 4M80A 3L4TA 3MMWA 1F4HA 1DWGM 3OIHA 1CECA 3GZAA 1EA9C 4M82A 1W32A 2J7EA 3SCSA 1J9YA 4AYSA 2WM0A 3B9AA 2E4TA 3AIBA 4HMDA 4P7LA 2DT1A 2W91A 1QNOA 2G3IA 5IFPA 1GCYA 3GH4A 2J4GA 1EOKA 4AIEA 4PN2A 3QOMA 1CGTA 2G4FA 1QBBA 2BNJA 4PCTA 3B9EA 2X0YA 4EKJA 3OZPA 5I6SA 1EQCA 4M24A 1IT0A 4Z2JA 3AICA 1VIWA 1X1NA 1FP9A 3LPFA 4IISA 1TVNA 1BPLB 1E40A 3ARQA 1B31A 1JDCA 3QGVA 1H41A 1XCWA 2WMGA 2WKGA 3BH4A 1UKOA 5CLWA 3PN8A 2VZUA 3WL1A 1EDGA 1W9VA 4UOZA 3M07A 1R87A 1HNYA 1LL4A 4WSJA 4B16A 3G6LA 4FLOA 1Q6GA 4AZHA 3PZMA 1EH9A 1UOKA 4QCFA 4LYQA 3BXWA 1GHSA 2X05A 3W82A 5A6SA 4PEEA 3PTMA 1WZAA 3MUAA 1JAKA 4GIAA 5A1AA 5TD4A 4KMQA 1OIMA 2WXDM 1FH9A 1V02A 4M29A 2WAGA 2WMIB 3W25A 3VM5A 2WVVB 1R7AA 4GQQA 4PMDA 3UETA 2JEPA 3IJ7A 1KWGA 1K9DA 5BROA 4QFUA 1W3LA 1NWTA 2CKRA 1A47A 1H2JA 2GDUA 2CPUA 1JZ7A 1XSKA 2Y8KA 1ODZA 1D3CA 4UQDA 4BQ4A 2DEPA 3WF2A 1J0ZA 5FCZA 4J7RA 1UR1A 3ZSSA 4TTGA 3TOPA 1MXDA 3TTQA 3WELA 4HOXA 2OWXA 2BS9A 2VCCA 3OGSA 4ZXOA 5F7UA 4M1RA 3IAPA 4GO9A 5LYRA 5CGMA 3APGA 1B3XA 4V28A 1M7XA 1QBAA 1W1VA 5HPCA 1GJWA 1TR1A 1TCMA 3I3BA 5DEZA 2G8ZA 4DM2A 1CXEA 4MDOA 2WSKA 1ZL1A 3GNRA 2GJPA 4UFKA 4CU8A 3EMQA 5JIWA 3U5UA 4F9DA 2YDRA 2XIBA 2Y24A 3W38A 4KGJA 2VMFA 1XYFA 1XSJA 1DHKA 3SUSA 4CN6A 5A3HA 4UZSA 3LPGA 4UR9A 1NQ6A 2VCBA 2ZWYA 4GPNA 3ZJ6A 2WC4A 5CQ1A 2X0HA 5CPSA 3TTYA 1HJQA 1OT2A 1C7SA 4W7WA 1H5VA 3PZ9A 1F4AA 2JIEA 1UR2A 1JD9A 3WQ6A 4C7FA 5BCAA 3CZKA 4EANA 3AISA 1PX8A 2VVNA 5LA0A 2UY3A 4S3JA 1G94A 2WWCA 2XVNA 2F61A 5FOOA 2OSXA 3WEMA 1HJSA 1VF8A 5EFFA 3BAWA 1V0MA 3W53A 3SCVA 3N12A 3ALGA 5D8WA 1E6ZA 5A69A 3FAXA 4CN4A 4JIEA 5CG0A 3DYPA 4UFMA 4ZFMA 5DMYA 4HMEA 1C92A 2XYLA 2ZIDA 4U5IA 2XM1A 3WEOA 2EPKX 3VDBA 2A3AA 3F5KA 2E9BA 1E70M 1R7OA 4A3YA 2E3ZA 4GZEA 4P7OA 3MUZ1 4IUGA 1J0YA 4AMCA 2OYLA 1DEDA 1W1PA 1UR9A 1UD5A 3CGTA 3KL3A 1QHOA 2CNCA 4WIWA 3WF3A 1KCKA 1LL7A 3SCOA 4XB3A 3GBDA 1GOMA 1VB9A 2EXOA 2A3BA 4H41A 3WH5A 3SUVA 2D0GA 4TX8A 5E9AA 1NWSA 2YLAA 2DPEA 4AD5A 3F4VA 2D3LA 3RILA 4CCDA 3VGBA 3D5HA 4U31A 4AZBA 3E1F1 1V0NA 4HPGA 3W0KA 5FKYA 1JNEA 5BRPA 2VTFA 2ZUVA 4DUXA 3AQUA 2A3CA 1UWIA 4W87A 3RM8A 1JXJA 3VGGA 3CZEA 1JI2A 3AYSA 3RPMA 4F9JA 1E72M 3AMDA 2PBGA 3CUGA 1YHTA 3ZJ8A 1U30A 2YA1A 2QF8A 3VMPA 1K6AA 2XUCA 4XUYA 3GXDA 5A8MA 1WO2A 4GQRA 1JG9A 4AD2A 3QR3A 2Y8VA 2ZXAA 3AIEA 3ARTA 3CTTA 4J3UA 8CGTA 2BY0A 1OGGA 2DIEA 1I75A 1RD6A 5FD0A 4B3KA 3BAKA 1E0XA 1BHGA 4U5KA 2XM2A 4PBGA 5A95A 1LWHA 1Q6FA 4QLJA 2FGZA 3WDHA 4AIUA 4CCCA 1V6YA 2WHJA 2JF7A 4H8HA 3UERA 3AMCA 3PZIA 1WDSA 2OYKA 4D72A 1BLIA 1DWFM 1MW3A 5BYWA 2GFTA 4JKLA 4W88A 3BLPX 1WNOA 1BGAA 2VI0A 1G0CA 3CZJA 4HZ8A 1N82A 2FH6A 3AIVA 4CU6A 1K9TA 2YL6A 1UKSA 4RL3A 1JF5A 3L4UA 4MB1A 4ATDA 4M81A 1OM0A 1MW0A 3QHNA 4MJ4A 1VRXA 4R27A 4X0NA 5JBEA 3ZT6A 2PB1A 3BMWA 1XD1A 4PMXA 3CMJA 1CGVA 4DUWA 1Y7VA 5I0DA 1X6LA 4AZIA 2A3HA 2WVVA 4UFLA 3CUJA 3AHXA 2AMGA 4PTWA 1PX3A 3PZVA 5EBAA 1UKPA 4IM4A 3WD0A 1NM9A 4ACZA 2CERA 4BZYA 3AS0A 1FFRA 5HPOA 3AIRA 1UWTA 1HN1A 2DSWA 5JBDA 2QPUA 4CD7A 5CSUA 1CXLA 2WVTA 4TUFA 1ODUA 1UZ4A 1CWYA 1W3JA 5I77A 2QHAA 4PCSA 1NOFA 1UD2A 1BVZA 4W89A 3WBAA 1ESWA 1GONA 4U2ZA 1MXGA 5C70A 1B3VA 1MW1A 3UESA 3EDJA 4CKQA 4PRWA 2UWFA 4BQ5A 1KR0A 3N04A 1WE5A 4W5ZA 3PTQA 1W9PA 1KBKA 3LMYA 3GH5A 1QI0A 2VUYA 2RGMA 1BAGA 4ZENA 2OWWA 5BRQA 3WBEA 1R85A 2YBTA 3QOKA 1QW9A 2EPLX 3PZGA 3VD5A 4BA0A 1WZLA 2EQDA 5E70A 3K4DA 1E43A 4FMVA 3O6AA 1EXPA 3W27A 5IFTA 5E6ZA 3B8SA 2V3DA 3LPPA 2BVYA 4HA1A 4F66A 2J8FA 4D1JA 4GXPA 1CXFA 5AC4A 1LJYA 3KEHA 5BXPA 4W8LA 4TVCA 1GOKA 3PZNA 3WH6A 2V5DA 3M6DA 3AZSA 3T09A 1JYNA 4W93A 4V2XA 3WH7A 3KZSA 2ZUSA 2QLYA 5DT7A 4F79A 4JZ5A 4J3SA 3VTRA 3I3DA 2Y4SA 3ZT7A 1JF6A 5CSYA 1GHRA 1BYAA 1UQZA 3WD4A 2WYSA 1W2VA 4MB4A 3VGFA 3RM9A 1MVYA 3VDHA 5D9NA 2W61A 1WPCA 3VX0A 4U2YA 1HP4A 4ZE5A 3CO4A 3VMOA 3VD9A 4UFHA 2GUYA 1JZ2A 2XFFA 2VNCA 4HPHA 1JFXA 3DECA 1JDAA 1JD7A 2VZTA 1JNDA 3N13A 4KRTA 3OA5A 3NIYA 2VL4A 3VMNA 7TAAA 3L4XA 1CXIA 2XSAA 4JL1A 1DTUA 5LA2A 3N1AA 3AHVA 1JYWA 5GQBA 2E0PA 3WIJA 1QOXA 4AZCA 2V3EA 4A4AA 2D24A 3T2OA 1SMAA 3W37A 3OGVA 1HJWA 3K8MA 3WFZA 1H1NA 2WSPA 3ZIZA 2W66A 2W5FA 1KGUA 3VNZA 4ATLA 1UH4A 3W6LA 3FXYA 2WMHA 2BXYA 1QI5A 4Z2HA 1UWRA 3A4AA 1UR0A 4PTXA 4HZ6A 2FH8A 4MAVA 2WKLA 4OIFA 1UR8A 2FHCA 4H04A 3ZT5A 4GZJA 1SFSA 2ZUTA 4UZUA 2NW0A 4HU8A 2VOTA 3CBWA 5A6KA 1HXJA 1QNRA 1HX0A 2VR4A 4MB3A 2BVTA 5ECUA 1VAHA 3T0BA 4U3AA 1BFNA 1E4IA 4XX6A 5JBFA 4UOJA 1EDTA 3L4ZA 2VT0A 4M56A 4P7QA 3CUFA 3VIJA 1J0HA 1SMDA 1ZBKA 1V3KA 2J7GA 3VDCA 3GBEA 3WD2A 3RCNA 2XTKA 5A2BA 4AZ6A 3CH9A 1C93A 3A6OA 2UY5A 1C3FA 3CLWA 3VINA 4HU0A 1CGWA 4DWSD 4JCMA 3VM7A 4AZCB 3GYCA 2VX4A 1UZ1A 2WLYA 1MFVA 3AMLA 2ZXBA 4UQEA 3A4XA 1E56A 3KE0A 2J7FA 2QPSA 4UFJA 1GQIA 4L4PA 2O9RA 3WNPA 3SCNA 4TX6A 1UG6A 2ZUMA 4PMUA 1MQRA 3WENA 2PWDA 2DT3A 1HKKA 1J10A 2WPGA 2DDXA 4MAZA 1TG7A 1E55A 4TXEA 2BY3A 3ZJKA 1ISYA 3UG5A 1E71M 1NWUA 4AISA 1ISXA 4P7RA 3DHPA 2E9LA 2TAAA 4PTVA 2J79A 3QHOA 1UWSA 2CITA 2C7FA 4JFWA 2V5CA 1E6PA 3FY1A 1R8LA 4D71A 1B30A 2EEXA 1KQZA 3WQWA 2J7HA 4AY1A 1CLXA 3N18A 1V6UA 1CTNA 3WKZA 3BAXA 3AMKA 4GI8A 5D9MA 1VFMA 4MDPA 4GO8A 2BV9A 1EOMA 4W7UA 2DSZA 2GJRA 2CXGA 3VILA 4CD8A 2C8NA 3WH8A 4UTFA 2DH3A 2YA2A 1XH2A 2PI6A 4AEEA 2EPNA 3O9NA 3WUFA 4D6EA 3WQ8A 1PJ9A 1UA7A 2J74A 3CZGA 2FGLA 4HOWA 3A3HA 1PZ3A 4PMQA 3AS1A 2NT1A 1CGYA 1LWJA 1BSIA 4YHEA 4DM1A 1PBGA 3TP4A 4FLRA 5IDIA 4TTUA 4OZOA 1E4LA 1ZBCA 2VZVA 1GW1A 1HIZA 5AY7A 3MMUA 4MNKA 1KXTA 4CD6A 2YJQA 2J25A 4KRUA 3CPUA 1JYVA 1V6VA 5E0FA 1HKIA 3NSXA 3AI0A 3VIIA 2D20A 4Z2GA 5KEZA 4GI6A 1Z32X 2D22A 1XRVA 1J18A 2GK1A 3EBVA 3ZR5A 4W5UA 1P6WA 1MYRA 3N15A 2QMJA 5BXTA 4DWSA 1HP5A 3EYPA 4J3VA 3GM8A 5A6BD 5IHRA 2VZOA 1GNXA 3HMCA 2V3FA 3D3AA 2UY4A 3VIHA 3MU7A 4L4OA 5CPQA 4MNMA 1KFWA 1V02E 4V27A 3WN6A 3MKKA 3VGHA 1CEOA 1V3LA 1D2KA 1KXVA 3AHYA 1B3YA 3AJ7A 2DT2A 1QNPA 5A8PA 2E8YA 1E6XM 3SURA 2Q8XA 2BXZA 3WF4A 3PZTA 3MANA 1E6QM 1JFHA 4Y7EA 3AS2A 5D8ZA 1ITXA 1H09A 3ARPA 3GXFA 2VR5A 3RJYA 4D6DA 1ITCA 1PIGA 1VEPA 1BF2A 4CCEA 2YOCA 3F5JA 1FHDA 2CIPA 3WSUA 1W9XA 1XHGA 3WUEA 4HMCA 5KZ6A 1GUVA 1GVYA 3AFBA 1KBBA 4J3XA 1UQYA 3AHTA 4P8VA 4E2OA 5BWFA 1GVIA 1OD0A 2FHFA 2JE8A 2X2YA 6TAAA 1CIUA 3CHFA 3AMGA 1J01A 3ARRA 5ABGA 4WK9A 5M03A 4D6IA 1JGIA 1KCLA 1XH1A 1BG9A 3WNMA 2G3JA 4A3HA 2BVDA 1UYQA 5HDRA 1NARA 5DO8A 2DIJA 1BVNP 1QW8A 2WBGA 3BSHA 1JL8A 3NYDA 4OKDA 3ZM8A 2WNWA 1TUXA 2YL5A 4P7NA 3EDFA 4HA3A 2CCRA 3W24A 4JHZA 5A6BA 4JAWA 4UNIA 4GKLA 1UKQA 3CHEA 1E1FA 2J77A 1AQ0A 1UD3A 1WZMA 4ACYA 3WL0A 1BGGA 2JEQA 4ATWA 3L4WA 1MFUA 2XPKA 5AYBA 4B9YA 1UWUA 4AWEA 1XD0A 2VVSA 3AZTA 1QVBA 1ISZA 4EK7A 1XCXA 3VOCA 2PWFA 4OOUA 3UG4A 2BY2A 1G5AA 4UOQA 2Y2WA 5A8QA 1RP8A 4FLQA 1FH8A 3ZQ9A 4MPKA 3WNNA 2DSUA 4H8VA 2OLHA 3IAQA 1G9HA 1QI3A 2G41A 4H2CA 3U7BA 1US3A 2WMJA 2CBUA 2DSVA 4OBSA 4WKAA 1GORA 4TOQA 4QP0A 3U5YA 2VJXA 4FK9A 3ZOAA 5I79A 2XFRA 1WDQA 1OD8A 5E0CA 1LG2A 4ZEPA 4MNJA 4J3TA 4MTVA 4CN1A 3BCDA 1VEOA 2D23A 2ZXQA 4CVWA 1JZ8A 3MV01 4CUCA 4J27A 4QAWA 2CETA 3WNOA 2UY2A 2IUZA 4XZBA 1E0VA 3UR8A 2YL8A 1AQHA 4QLLA 2WMKA 4W84A 2WHMA 3WUBA 1E6NA 2BHZA 1ISVA 4D6GA 1NWRA 1M04A 3UEQA 1GOOA 2XJ7A 1V0LA 1QI4A 2OSYA 3HU7A 3NSMA 5JUVA 2WCAA 1BTCA 3PZUA 1L0PA 1VFFA 4Z2IA 3CUIA 2EPOA 1Q4NX 4AD0A 2A3EA 3T0AA 2VQTA 1LLOA 3ZSTA 1W9BM 1ZJAA 3TONA 1CZ1A 2WANA 2F2HA 2J78A 1I1XA 1ZJBA 1OIFA 5I24A 1RPKA 4E8DA 1E9LA 1XGZA 1M03A 2MANA 1EHNA 3KL5A 5A8OA 5A6JA 1HL9A 4PTMA 3TA9A 1GOWA 2YBUA 1MQQA 1BYCA 1JIBA 3IJ8A 4H7VA 3VD7A 4FLSA 2VX7A 1GOIA 3T2QA 3HJEA 1E1EA 2CBVA 3AZRA 4WLCA 3ECQA 2W62A 1GQJA 3EMZA 4UQBA 2ZE0A 5I5RA 1E6RA 2DH2A 4JCLA 1V03A 4LGXA 4ACZB 2BHUA 1C8QA 1W1TA 2CHOA 2V38A 3NSNA 1H3GA 2WMIA 1QHPA 4AXNA 5I78A 1L8NA 2Z1SA 3VNYA 2YIHA 2J62A 2VURA 1AMYA 4LYPA 4NF7A 2XVPA 1O6IA 2CBJA 1K9EA 1LQ0A 1E3ZA 2ZUUA 4XZWA 3EDKA 4E8CA 1KR1A 2C0HA 2XVLA 4UQ9A 1TVPA 1R86A 4B9ZA 4BS0A 4P8UA 1UH2A 3NUKA 2O92A 4YPJA 5I3DA 2XG9A 1U2YA 1HJVA 2WZEA 1ECEA 4M8UA 1W1YA 5HNNA 1I1WA 2ZX6A 4Q22A 2FHBA 3M46A 4NRSA 5M17A 1J12A 2DQXA 3DYOA 2E8ZA 3BSGA 3W29A 3CUHA 2WVSA 5A2AA 3FNDA 1D7FA 3WFLA 3OLGA 1WCGA 3WDJA 2QMKA 2X1IA 2PF0A 2W92A 3AOFA 3MMDA 3SCUA 3WF0A 4DWSC 3POHA 3ARYA 3MS8A 1B1YA 3MUIA 4CGTA 3IJ9A 5JIPA 3PZQA 3EDEA 5HBFA 1WDPA 4PMNA 3GNPA 3WDPP 2ESCA 3CHCA 1TZ7A 5EFDA 2CHNA 4NZCA 3T0DA 3PZOA 3ALFA 2VZSA 4R5EA 1XYZA 9CGTA 3BLKA 3K4AA 6A3HA 1X6NA 2D0FA 3L4VA 4J3WA 1B0IA 1JZ6A 5LA1A 1CNVA 4AZ7A 2XHYA 3A47A 4LYRA 3N11A 1J11A 4PMYA 1J0KA 1S46A 3MV11 3CIVA 1YQ2A 2WHLA 2PBOA 3GH7A 3L2MA 3WD1A 3PHAA 2WZIA 1OBAA 3ARXA 3VIKA 4H8UA 3SCQA 4W8AA 1KWKA 3RIKA 3VUPA 2OSWA 1WP6A 1LG1A 2VRQA 2XVKA 4UCFA 5BXSA 5CLTA 1OINA 1C90A 2JF6A 1M01A 3IANA 2YLLA 1M53A 4YHGA 2EJ1A 1HVQA 3M7SA 1VBUA 3WQVA 3MUY1 1E4MM 1ZBWA 1NP2A 2F8QA 5C71A 3BMVA 1PPIA 1UD4A 3WNLA 3ZR6A 2G3MA 1MW2A 5AC5A 5FL1A 3I3EA 1DWJM 3VIMA 1OT1A 3KL0A 3IK2A 4NI3A 1VJZA 3OBAA 3WMBA 2BY1A 1JAEA 1H0GA 2PWGA 3GXMA 4MADA 1QHZA 3L4YA 1RH9A 3PBGA 1DP0A 2O9OA 4ML4A 3VVGA 2D2OA 3THCA 3RJXA 4OBRA 3VD3A 1KGWA 3JUGA 1V0KA 2YL9A 3L2LA 2WLZA 3SUUA 1B9ZA 1A3HA 2AAAA 4PYSA 1K9FA 1OGSA 2JFEX 7CGTA 1B90A 3VKKA 1OWQA 4JL2A 1Q6CA 2CEQA 4UFIA 1ZU8A 3FW6A 1ZBVA 1JDDA 3T08A 4YN5A 4JFVA 3UG3A 1IZJA 3KWXA 3WY1A 1DWAM 4PSRA 1KXQA 3FHQA 1PX4A 4HTYA 5A6AA 1PIFA 1OSEA 5A6MA 4Q7NA 1HVXA 1E5NA 1TA3A 4CU7A 1FFQA 2OYMA 1J0JA 2XSBA 1ISWA 2ZUWA 4QCEA 2YDQA 5CJ5A 3CHDA 2WZHA 4PMRA 1FH7A 1OCQA 5ABEA 3ZMRA 4EE9A 5IXEA 1E4NA 1H4PA 1EQPA 2PWEA 2DT0A 4D1IA 1UWQA 1GPFA 2ZWZA 3WF1A 2RGLA 5GNZA 3MO4A 1VFUA 1UUQA 3OG2A 4X9YA 2O9TA 4GZIA 2EBNA 2Y5EA 1W2PA 4ZXLA 5D4YA 5M3WA 3NDYA 3AXXA 4GI9A 4B3LA 3GDBA 2HISA 4AD1A 3NCOA 1UR4A 2ZX5A 1AVAA 1CYGA 1PAMA 4RE3A 5GNXA 1C8YA 3W26A 3VIOA 1RP9A 4LQ1A 4C7GA 1KGXA 3VIGA 3II1A 1O7AA 3WUGA 3NJ3A 4AC1X 1DWHM 2VRKA 4UQAA 5FL0A 2J75A 4TVUA 1V08A 4CD4A 3VGDA 4HOZA 2CESA 1BQCA 4Z2KA 4EAMA 3EMCA 3UR7A 5FIPA 4OOZA 2XGBA 1TE1A 3MSGA 1QI2A 5D9PA 3TTSA 1SYTA 3AROA 4WSKA 4WKHA 1B2YA 8A3HA 1GQLA 4MJ2A 1IV8A 2V3GA 4HP5A 3CMGA 5A6LA 2BFGA 2J7BA 1PEZA 3A4WA 5A94A 1VENA 1LL6A 2NSXA 2JALA 1DWIM 1FOBA 1W3KA 1VJSA 2OWCA 1KB3A 3BC9A 1C91A 2B31A 1V3MA 4DWSB 3SCWA 2J8GA 1EHAA 2GJXA 5ABFB 4P8XA 2VC9A 2WC3A 1HT6A 1VEMA 5IHSA 3OZOA 4ZE4A 4JFSA 2D1ZA 1Q6DA 2XIIA 3F5LA 2GK1B 3WEZA 5A2CA 2GDVA 1G01A 4LPCA 3SEPA 3AIUA 5I2UA 4E4PA 1CPUA 5C8BB 1HKJA 3AIQA 1OB0A 3RM4A 2X09A 3UCQA 4AZ5A 3SCPA 1SR0A 2E40A 4IPNB 4XV0A 3W81A 4W7VA 1EO5A 1TMQA 2WCSA 1JZ5A 1H0IA 1ZB5A 3RMEA 2O9PA 5HOSA 4NSBA 2YDSA 3B9DA 4PMZA 3K46A 4RE2A 1V3IA 1BYBA 3WMCA 4OUEA 1JI1A 3WH9A 4D6FA 1E0WA 2XVGA 2HVMA 3OLEA 3VDAA 2Z1KA 4TVDA 1W3HA 1BYDA 2WMFA 4WF7A 3ARZA 3BAYA 1HL8A 4CD5A 1QNSA 3SCRA 2X8RA 3WDRA 3VGEA 2QV4A 4IPLA 3RDKA 4LX4A 4N42A 4S3KA 3EDDA 3W6MA 4NRRA 4JFUA 1KQYA 4WKFA 3ZJ7A 1J0IA 2J47A 3DYMA 4AD3A 4D6HA 3S6TA 1CDGA 1UKTA 1GJUA 3N9KA 5DT5A 1V6XA 5EMYA 3W4RA 2ZX7A 3K8KA 3WNKA 3K8LA 1GQKA 1VBRA 1HJUA 1UD6A 2XWEA 2W63A 2VRJA 3PTKA 4AD4A 3SCTA 1CGXA 4BQ3A 3BAJA 3AYRA 3FHAA 5AYIA 4QLKA 5DFAA 3OB8A 3TTOA 1H49A 2GSJA 4BF7A 5D9OA 1AQMA 1C7TA 3VO0A 5E09A 3WQ4A 3U7VA 2EO7A 2IXUA 2ZOXA 4C7DA 4URIA 2ZICA 4BQ2A 1ZS2A 3U57A 3HN3A 4PSPA 3S2CA 5A8NA 3QHMA 4PUEA 4U33A 3VU2A 1V3HA 3OLIA 2G3NA 3DC0A 3FN9A 4GINA 4X0VA 2J7CA 4AZGA 1OGBA 1JZ4A 1TA3B 1G1YA 5CZKA 4JKMA 2W67A 2E9MA 5CGTA 1NP0A 3O2LA 1MWOA 3GNOA 1W9UA 2ZX8A 4D6JA 5I23A 1UHVA 2FDMA 1WB0A 2VO5A 1GZJA 3ARWA 5GPRA 1E73M 3ARVA 2WHKA 3AXHA 3FAWA 1U33A 4AIOA 1HF6A 1LF1A 2WVUA 1QPKA 3RO8A 1W9DM 2NT0A 1MQPA 1XH0A 4W8BA 1NOUA 1BG4A 1FP8A 3WQ5A 3DHUA 7A3HA 3VIPA 1XSIA 5GNYA 3WDQA 5BXRA 2J7DA 4JFTA 1JZ3A 2VCAA 3SUWA 4RE4A 1CBGA 5DF0A 5HXMA 1PZ2A 3T2PA 3BGAA 1HJXA 2WCGA 3AHZA 1EDQA 4OJYA 3BCFA 2WC7A 5M5DA 3K1DA 1CLVA 2IXVA 1IZKA 2CBIA
chains in the Genus database with same CATH superfamily
2PC8A 4AEFA 3PJXA 3LHYA 1Q7QA 2ALDA 3SN0A 5E6YA 2QNEA 2ZFAA 2WK2A 2H3BA 3MY9A 3HGOA 4PMOA 3NDZA 4YMZA 3GFYA 2JGYA 3LNPA 2WB5A 3A5VA 1QMLA 2JIWA 1NJJA 4JHOA 1CENA 2VX5A 2WBKA 3M7WA 5FAGA 1QPOA 3IRDA 2X30A 1FRBA 3B3DA 3GWQA 2PDFA 4IUOA 1XUZA 3AUJA 4KEUA 4NXSA 1Y5VA 1W91A 3VD4A 5XIAA 2O56A 1YBQA 2GVJA 4HMNA 5BMXA 4HIBA 3GTNA 3AS3A 3WDIA 3OLDA 3SGUA 2QQ6A 3VIFA 1BXNA 3RG6A 3EX3A 1UD8A 1S5MA 4MNLA 3GR7A 2AOSA 2AQOA 3ARSA 4C1NB 1EGZA 3QMRA 3FEMA 1XBVA 4H2HA 2WW5A 4A8LA 3H21A 3REQB 4BCEA 1SW0A 4JKKA 2VX6A 2I5QA 1XBXA 1YNPA 1SO6A 4AW7A 1LT8A 1NU5A 3TLLA 3M5ZA 1IR2A 5C9XA 2V67A 1E15A 3V3WA 3BPWA 3W1PA 4O8RA 4LAKA 3I4EA 1GOQA 1JYXA 2EG8A 3ZO9A 3BURA 1Q6EA 1H11A 5D2YA 4IH3A 1KM3A 1SUXA 3G6MA 2D3NA 2R94A 3VPLA 1S5TA 3BAIA 1TZZA 4PUUA 1WV2A 1V7YA 3GFZA 5CJMA 5F2IA 1TV2A 1UUMA 5TBOA 3CAQA 3SCSA 1J9YA 4IG2A 3B9AA 2E4TA 1XGEA 4N9EA 4P61A 4WUIA 3CWHA 1FCUA 1EOKA 3CU2A 3NZRA 2V2DA 4MOZA 4NIRA 5IBXC 2BNJA 5CPMA 3B9EA 3K1GA 4IT1A 4EKJA 1EQCA 1TTIA 1RK5A 3AICA 1BPLB 1E40A 4IFKB 1DIOA 1H41A 2OZ8A 2WMGA 1GVQA 1UKOA 2DUXA 2POTA 5IDZA 3BOFA 3PN8A 1W9VA 5AZ0A 4UOZA 2OT1A 3M07A 1R87A 1NTHA 2DV0A 1JPKA 1LL4A 4WSJA 4B16A 4FLOA 3HQ1A 1QJWA 1UOKA 3KRZA 4A8NA 4QCFA 5I3FA 3GAYA 2X05A 3W82A 1S5VA 3I68A 1L6YA 2HBXA 3MUAA 1F3XA 4CNUA 3U0HA 4O4VA 4DX3A 1S38A 3LD5A 2WAGA 4UIOA 3VM5A 1R7AA 1VLWA 4GQQA 4PMDA 1GYLA 3IJ7A 4BF9A 4QJ5B 3R0KA 1W3LA 4JNMA 2GDUA 3BGGA 1PTGA 1R2RA 4KPLA 5I03A 1ODZA 1D3CA 2FFIA 4UQDA 4BQ4A 3N2TA 1D9EA 2DEPA 3LLDA 4CLMA 4WOQA 3TOPA 4HHLA 1MXDA 3CTLA 3TTQA 3UPMA 3VK5A 3HQOA 2VCCA 1OC5A 3OGSA 4DQWA 3H54A 4BKNA 5LYRA 3WJYA 4V28A 4FIRA 3QKZA 1QBAA 2EAWA 3QKEA 2Z28A 1XIHA 5DANA 1RLCL 1ZL1A 2FVKA 4UFKA 3U5UA 3DOPA 4F9DA 5F4XA 2Y24A 4KGJA 2NQ5A 3UXDA 2A3LA 1NF7A 3LPGA 2VCBA 2ZWYA 2Y62A 2WC4A 3V0UA 2VUNA 4NL1A 5FJJA 3UY8A 4GIEA 2X0HA 2VHLA 2F7FA 1HJQA 1K4GA 3U8GA 4NX5A 1LLZA 2QVNA 4Z1DA 4XAFA 3PZ9A 4C7FA 4A3UA 5BCAA 3MZNA 2DVTA 4S3JA 1M7PA 1G94A 1J6OA 3C0QA 2WWCA 3O63A 1YMYA 3TMLA 2QPXA 4UTWC 4LW7A 4K38A 1I2PA 2QAPA 4GH1A 1V0MA 4MG4A 1BF6A 3ATZA 5ABTA 1POJA 3M16A 5CG0A 1L2UA 2ZIDA 4U5IA 3WEOA 4GNJA 3WLOA 2E9BA 1E70M 4GZEA 3MUZ1 4NZ4A 3KL3A 3OU8A 3QGKC 2PDQA 3WF3A 4LYKA 4XVEA 3U2OA 2QCLA 4XTIA 1JCMP 2FTYA 1H1ZA 1S1PA 2CLOA 1R3RA 3H4XA 2ZYFA 1CB7B 2D0GA 5E9AA 4RDYA 1NWSA 3TLQA 1EC7A 3GSMA 3RILA 4CCDA 2ONEA 3D5HA 4GFSA 1OX4B 4AB4A 5C2GA 1JNEA 2NWSA 2VTFA 5AOUA 3AQUA 5EL1A 1JXJA 5F1UA 3LCFA 3CZEA 3AYSA 1POKA 3UJSA 1YHTA 1Q65A 4RDWA 3VMPA 3PUGA 3GLCA 3Q4DA 4O1AA 2Y8VA 4PUJA 4ZO6A 4EOUA 1XW8A 4OU1A 4J3UA 2YXXA 2BY0A 4XIAA 1RD6A 4LUTA 1GOXA 3ITVA 2PTXA 4PMJA 3KVKA 1M5WA 1BHGA 2NVDA 2XM2A 3I10A 5A95A 3WQFA 4KFNA 2FGZA 4A29A 3CHVA 4GK8A 4DAIA 2WHJA 4O1BA 1E51A 3LZ5A 3PZIA 5BYWA 2GFTA 4KESA 4RDZA 5CAKA 3CC1A 3FFSA 5AVNA 2VI0A 5AFDA 1G0CA 1WYIA 2FH6A 5FJPA 1NIUA 4CU6A 1GEQA 1L6GA 1K9TA 4L9ZA 4E3VA 4MB1A 3SQMA 4MY8A 1MW0A 4O1CA 2V68A 1O68A 1T41A 3BMWA 3B05A 1XD1A 4DUWA 5I0DA 1X6LA 2PC4A 4UFLA 1X97A 4PRTA 3N4AA 4PTWA 3PM6A 1FFRA 4O1FA 3ABZA 5HPOA 3AIRA 3G24A 3EOLA 4ZO9A 4HJFA 3P80A 1I2RA 2DSWA 3VNJA 3UCCA 5JBDA 4U28A 3PSWA 2QPUA 4CD7A 1CXLA 1ALDA 4JIQA 1KNWA 1J96A 1ML1A 4GQBA 2BODX 3W01A 1NOFA 1UD2A 4W89A 4N4QA 4KCVA 2V0TA 4GX9A 4DY1A 4M51A 1MXGA 1MW1A 2JGQA 4PRWA 4LVFA 1KR0A 2GGIA 3JZUA 3N04A 4F2BA 2PZ0A 4W5ZA 3PTQA 3NXLA 5A5WA 5K7JA 4O54A 2VUYA 1VR6A 3W2JA 2NQLA 2UBPC 3GZ3A 1A0DA 4ZQNA 2QUTA 3TSMA 1WZLA 4LALA 5E70A 3JS3A 4FMVA 3A64A 3B8SA 5K9XA 4HA1A 4F66A 4IXXA 1T0OA 2VGGA 3H2OA 2ATMA 1WUEA 3T07A 3TKFA 1FHUA 2CLKA 1LJYA 3KEHA 4TVCA 4PRRA 2V5DA 1A3WA 1EPVA 3F4WA 1AW5A 3S83A 1RUSA 3MBFA 1OX4A 1A5BA 2QUUA 3CM4A 3ZT7A 2PS2A 4YTQA 2GVLA 2OQLA 3G0UA 2G4JA 2IW0A 1ZAHA 1TPB1 2EJAA 5KZMA 1WPCA 1G4PA 4ERGA 5DY3A 2WQPA 1P6CA 3I6TA 2HROA 1I9CB 3W7DA 4GXWA 2XFFA 2Y88A 3BLFA 3ENLA 4MWAE 4IF2A 3BW2A 3USZA 5HR6A 3ABXA 3N13A 1T6MA 4LEQA 1REQA 4ALDA 5LA2A 4F0RA 1OHLA 4C6QA 4H9VA 2F2KA 4V15A 3WIJA 4ZL1A 3TXVA 2XZ9A 2QUMA 4FNRA 4DJFD 4DRSA 3WO8A 3QV6A 2HBVA 2ACQA 1K8CA 1WUFA 1ZHAA 1KGUA 3UA3A 1M7OA 1UH4A 3W6LA 3FXYA 4A6GA 3NG3A 3D3FA 3THUA 2BXVA 1R9ZA 1UWRA 4H01A 4JX5A 4PTXA 4DBEA 3NQCA 4MAVA 5HA7A 1PSCA 4WDTA 1HKVA 2PEVA 2WKLA 8RUCA 3VNMA 3DG7A 1AW1A 5I3HA 4R53A 4GZJA 2OCZA 2BOEX 3IUHA 3N6QA 3UZYA 2OU4A 4QR6A 3TR9A 4N6FA 1I2OA 2Z1BA 3QRHA 4PE8A 5HJYA 2VGIA 2O7QA 1HXJA 1QNRA 4YLWA 1Q7ZA 3R43A 3T0BA 4U3AA 2PDYA 3M0MA 2Z6JA 1QRQA 1W5MA 2VT0A 4O8AA 4M56A 2QJNA 1MI3A 2NUWA 2X7WA 5MHBA 3IJQA 1W5NA 2C6QA 3NQ6A 1J0HA 2VXNA 3C5QA 5FEXA 1Y5XA 2IKGA 3K13A 4H9YA 3VDCA 4LVAA 2WQDA 2QW5A 1S3HA 2UY5A 1C3FA 3GKAA 4MZYA 2X7VA 4GCXA 4LSBA 1N2VA 4K7VA 4JCMA 1FDJA 1QPQA 4DJEC 3AMLA 3RITA 1LBFA 2C16A 3LSCA 4UFJA 2JBMA 3WNPA 3SCNA 1SW3A 3TA6A 2CZVA 4MUZA 1XI3A 3P2VA 1WDDA 2DJXA 1XLJA 2I1OA 4C60A 2BGSA 5FF4A 4TXEA 4B5NA 4QXIA 1E71M 1ISXA 4P7RA 2E9LA 4Z42C 3SW6A 3LM7A 1K7FA 2Z27A 1M65A 3GC5A 4PTVA 4MWAC 3MI6A 3QHOA 4CNOA 2NX9A 4NNCA 1D7KA 1R8LA 4MY9A 3USBA 2VFIA 1UUOA 3N18A 1CTNA 3FYYA 2G96A 4IFKA 5D9MA 1F3EA 1JCTA 4MDPA 1X96A 2Z6IA 2GJRA 1DIDA 3VILA 3BG3A 4CD8A 2VM8A 2NV2A 2DH3A 2OX4A 4K8EA 2X41A 3TX9A 1TVLA 2PRMA 1XH2A 1A80A 1OX6A 2EPNA 4GC4A 3ITXA 3G8EA 4ML9A 1PJ9A 3QPYA 5G4EA 3LS9A 4IG2B 4JXCA 4NILA 3A3HA 6REQB 5F4WA 3TYCA 1CGYA 4AY7A 1IEQA 1K02A 2PDNA 4YHEA 1PBGA 3TYZA 4C1KA 1F07A 1RBOB 4QJ3B 3SY8A 2VZVA 4GQ0A 1RPXA 5AY7A 3OIXA 1JCYA 2XN2A 2YJQA 2Z00A 4LAZA 3P5ZA 4B4HA 1JYVA 4O13A 1EJWC 3DESA 3N3MA 1HKIA 1Q8AA 3BW4A 3APTA 3NSXA 5HINA 3GVWA 3WK2A 4GI6A 2HVNA 1MEWA 2D22A 3TQVA 1XRVA 1J18A 2XDFA 3DH7A 4B5VA 4W5UA 3S5NA 1TZ9A 3ZFHA 2QMJA 5BXTA 3WLQA 5A6BD 3GG1A 5IHRA 2VZOA 3HMCA 2V3FA 4C6JA 3O07A 5CPQA 4MNMA 1KFWA 4JICA 4V27A 3WN6A 2GQ3A 1T8QA 4J9JA 1MNZA 1GG0A 3S1VA 1U1JA 3OP2A 3AJ7A 1FKWA 1AZ2A 1E6XM 2Q8XA 2Q71A 2V30A 2ZA1A 4Y7EA 2CXEA 4KFOA 3GXFA 5I7GA 3R4IA 2VR5A 3RJYA 2FQIA 4M5PA 1OFBA 1PIGA 1WBJA 2HXTA 4CCEA 2XISA 2A7PA 3WSUA 2J8TA 3KBJA 4IMFA 3P84A 1FY6A 4HMCA 4ICMA 3GVVA 3ORWA 3EKGA 1KBBA 1IWAA 3CV2A 2HNEA 4O28A 3UR5A 3WCZA 3QXBA 1TWIA 5BWFA 1IXOA 1IIGA 2J13A 4ZQOA 2JE8A 1CIUA 3CHFA 3P3BA 2DY3A 2QUNA 3C8FA 3OHIA 3WNMA 3I4KA 4A3HA 5AYYA 3KDOA 2Z4GA 4HN4A 1F6YA 4K37A 1XWYA 1E0TA 1J8VA 1X7FA 2PRHA 2Q8LA 4V33A 2PLJA 1TUXA 4Q8OA 3EDFA 1D3GA 3FA4A 4HA3A 4JHZA 5DELA 4YXGA 3EWUA 4I90A 2I16A 2OKOA 3WFAA 3NQDA 3CHEA 2NXGA 1E1FA 4JR5A 4ACYA 2IQTA 2JEQA 5BU9A 3DI1A 1I4NA 1MFUA 1Q2RA 3VI2A 2XPKA 2IPJA 1O95A 4PTNA 1XD0A 2VVSA 3ISIX 3RXZA 1YE4A 1EIXA 1LRNA 2PP1A 3VOGA 4HPJA 4OHQA 4UOQA 2L5HA 3LRMA 3O7UA 3RPDA 3ZQ9A 2DSUA 2ZRVA 4H2CA 3H7RA 3APYA 2CBUA 3DIPA 1ZPTA 2KZHA 4QP0A 3U5YA 3ZOAA 1KM5A 5I79A 1K8XA 1JUKA 4UB9A 3L0GA 5E0CA 4MNJA 4HTBA 3W7RA 4U10A 1L6SA 4O16A 4GBDA 5CZ0A 1KRAC 3MTWA 4DI9A 5C54A 5B7YA 1JZ8A 4K36A 2P50A 4QAWA 2CLLA 2CETA 3TEVA 4GC3A 1E6NA 2BHZA 1ISVA 1BRLA 3LRKA 4FSAA 2F38A 3W7OA 2RJHA 3N2MA 1V0LA 2VENA 2IPGA 3HU7A 2E1DA 2TODA 3RR4A 1YPXA 4EWJA 2BMBA 4S3AA 4CQCA 1BTCA 1AJ0A 4O50A 4ERAA 1GZ1A 2A6LA 4BF5A 1VH7A 2WZMA 3WQEA 2Z25A 4AD0A 3ZSTA 1ZJAA 3TONA 2J78A 4G8TA 1R6WA 3XIMA 1OIFA 4E8DA 1BQGA 1E9LA 5A8OA 4YWSA 4C6BA 1IE7C 4PTMA 1X1OA 1TJ1A 1DHPA 3GXTA 2YBUA 7REQA 3AXMA 1JIBA 2OGJA 2Y63A 4CQ8A 3KHDA 4RXGA 3VD7A 3CT2A 4FLSA 5AYZA 4JTEA 1OCJA 2A2IA 1GQJA 2RAGA 5T9CE 4KEVA 5AB3A 3L21A 4HCDA 1TIMA 1C8QA 1TTPA 3W1XA 1H3GA 3L2IA 4GIYA 3BLDA 3CAWA 1UZDA 4Y8EA 1R3YA 3CNYA 3CL6A 5EGRA 3TN4A 3TYEA 1W1A1 1L8NA 1Z6KA 2VURA 4KRZA 3T40A 2C13A 3W73A 1O6IA 3VFCA 1K9EA 4E8CA 4Q4PA 3GHTA 2Z1VA 2GLKA 2C0HA 1X6UA 3NO1A 2D2JA 3TNOA 4AEOA 3FJNA 5D2WA 2OMAA 3CB3A 1IXPA 4P8UA 1UH2A 3NUKA 4LUSB 1HJVA 1QASA 4JIRA 4M8UA 3TQPA 3NQ2A 2VOMA 4WQ6A 4IJBA 3XINA 4I5RA 1EF3A 2OX1A 1JCJA 5HNRA 2DQXA 1KBLA 2VFGA 3KRSA 3QVQA 3MP4A 3P7YA 2WVSA 5LIKX 4Q6XA 3OLGA 3G5EA 1C9DA 1SFJA 4NZFA 4HNVA 3POHA 3ARYA 2ZADA 1B1YA 2DW6A 2OT0A 4QHRA 3IJ9A 2PCQA 3DFHA 4GGBA 3PZQA 3QBUA 1DJQA 3WLTA 3CHCA 4YYFA 3COTA 1XCFA 5EFDA 2CHNA 3C2RA 5AC7A 2EKCA 1TE6A 4AXKA 3ALFA 1KFLA 3LQGA 5G1MA 1XYZA 1PDZA 1XLHA 3GK0A 6A3HA 3N6JA 3NZ1A 3R12A 1X6NA 2FIQA 2D0FA 1V8EA 4MY1A 1EUAA 1S3TC 1B0IA 3CQHA 2CZFA 4E8GA 1Q5MA 4OUIA 4QAIA 1CNVA 3HQPA 1FCVA 2XHYA 4MUPA 3RPTA 3PPFA 3R7MA 4PMYA 1S46A 1U5JA 5HQLA 3WJXA 2YX0A 1EJSC 1YQ2A 2FZ9A 5C55A 3E38A 3L2MA 4UNLA 4HCHA 2BGQA 5JH2A 4FOUA 3E2QA 1XM3A 3VUPA 2HE8A 2OSWA 2C1IA 3BW3A 2XVKA 5BXSA 2W0UA 1MZRA 3S9YA 3EZ4A 4XG1A 2YLLA 1BXBA 4YHGA 4PBEA 1FBAA 3BE7A 1TV8A 4M7SA 2JQXA 3UPBA 3QFEA 3QMTA 3PJTA 1MW2A 5T8GA 1BWLA 3NZPA 3KL0A 4NI3A 4Y9AA 3W2KA 2BY1A 2WJZA 4GJJA 1OG6A 3W1LA 2AL1A 3HA1A 3C0SA 1QHZA 3L4YA 3P5YA 2INZA 2Z7KA 3SM0A 5AHEA 3K2GA 3G1AA 3VVGA 3THCA 4ILSA 3SECA 3ABSA 3HBLA 2WLZA 3V4BA 1A3HA 4QEEA 3OQ8A 3BV4A 1ZAJA 3GE7A 1OGSA 2V5KA 2VEGA 1Z7AA 2DU2A 3S0CA 1GK8A 1ZBVA 4YN5A 4JFVA 4IXHA 1IZJA 5G4HC 5JMUA 1VHCA 1TUFA 2DIKA 3S5SA 4ZMGA 3T78A 3WY1A 2R82A 1O5QA 4MIMA 4CEXC 4HTYA 5A6AA 4HHPA 1C8VA 5BNKA 1OSEA 4O11A 4Q7NA 3R89A 3C56A 1G7VA 1TA3A 1YW1A 4LS0A 2QCDA 4PL1A 1M7JA 5HWJA 2YDQA 4C1LA 1M41A 1KFBA 4AF0B 1UROA 3BZGA 1Z9AA 3OW1A 3JRKA 3QW3A 3SGGA 3MCOA 1GPWA 5ABEA 3GG8A 3NQ7A 4K6AA 2DT0A 2OZTA 4D1IA 1DQUA 1OF6A 4LTSA 3WF1A 5GNZA 4ZODA 3GDRA 3GRIA 2DZTA 2PFHA 2R8WA 2Y5EA 4ZXLA 5D4YA 2QS8A 3NOYA 1Y8BA 5CKSA 1LOSA 5M3WA 5I3GA 2HISA 4HCLA 3NCOA 1UR4A 2QJGA 2VYOA 1AVAA 1CYGA 1PAMA 5GNXA 4BY3A 3MSRA 5I3JA 5LNRA 4N02A 1V7AA 1KGXA 3H2FA 3NJ3A 3GS6A 4AC1X 4ZQPA 1DWHM 4KCUA 2NUYA 3NGJA 1V08A 3A13A 3EXSA 1LTDA 2H9AB 4JN6A 2V81A 3WK3A 4MFDA 3MSGA 1MO0A 1QI2A 4QG6A 3MKVA 3I7SA 5FF3A 5KZDA 4WSKA 3O05A 4MVAA 1GQLA 4L9YA 2V3GA 3W7JA 5A94A 1NQKA 3FSTA 3O15A 2NSXA 5I02A 2YW3A 2PD5A 2WO5A 2FZNA 4ZOCA 2G95A 4OT7A 4GXMA 1FCQA 5CPOA 1EEPA 3SJNA 1BKSA 3BC9A 3E0WA 3G8RA 1V3MA 4DWSB 6TIMA 3SCWA 2GJXA 1TMLA 1F61A 3E96A 2VC9A 1HT6A 3E02A 2V6AA 4RNJA 3WEZA 3HG2A 2GK1B 4DYKA 2GDVA 5C9WA 2NX1A 3O0KA 1HKJA 3AIQA 3RM4A 3S6DA 3SCPA 2EHHA 2J88A 3KCJA 4NY2A 3FS2A 4PFHA 4NNAA 3BLEA 5C7VA 4ZOAA 3WQOA 2XIMA 1A4MA 1XIMA 3H2AA 5HOSA 2PDJA 2YDSA 1EGMA 4KWVA 4ZBCA 4HHMA 1OFRA 4L1XA 1E0WA 4HK7A 4HN8A 4POCA 1QU4A 2WMFA 3ARZA 3BAYA 3UXKA 1PO9A 3LK6A 3LZ3A 2Y85A 1KTNA 1P6BA 4LB4A 4NRRA 5JU6A 3QZAA 1KQYA 1J0IA 2PDBA 1FWJC 5CGQA 3EPMA 1CDGA 1UKTA 4X61A 1TB3A 3N9KA 1LM1A 3W4RA 2ZX7A 1AH3A 3WNKA 4LAUA 2XWEA 5LIXX 2DZPA 3IGXA 3B8DA 4MLJA 1GEHA 3SCTA 1CGXA 3S47A 3VE9A 4BQ3A 3XISA 1AMKA 1SO3A 3QEZA 4Q4QA 5EY5A 3TTOA 1H49A 4BF7A 3HOJA 3VO0A 1K03A 3ANVA 2V69A 5FF0A 3VKBA 2EO7A 3SRFA 1YKWA 1SVDA 4PSPA 2QGHA 5U4NA 5A8NA 3PF3A 3QHMA 1WX0A 1YLVA 3H4GA 4H7ZA 4AZGA 4F40A 3CS2A 1OGBA 4LF1A 3WQCA 4ZO7A 3W2MA 3R0DA 2Z24A 1SM9A 2W67A 2E9MA 1Y0EA 5CGTA 2E6AA 4LC8A 1H7WA 3GU2A 4YL2A 5DCEA 3H26A 6ENLA 3ARWA 1E73M 4QS5A 3MI3A 3AXHA 4AIOA 2WVUA 5ECVA 1FWGC 2ZRWA 3OYXA 3TV8A 1NOUA 1BG4A 3M4HA 1FP8A 3WQ5A 4D9PA 3VIPA 3MCNA 3DDMA 4LCSA 2FZDA 5T9BG 3WDQA 5BXRA 2Z0IA 1EPXA 3OZYA 4JTRA 1JZ3A 3SUWA 4RE4A 5DF0A 1EP3A 3WG6A 3T2PA 1EDQA 2EPHA 4B5XA 4F0KA 4UOJA 2ALRA 3WYZA 2XINA 2BHYA 2OZ3A 2IPWA 2YKKA 2XWDA 4HA0A 3KOYA 3IJIA 3FJ4A 4PUDA 5DMMA 3SZ8A 1C8XA 5EMKA 4Z1CA 1WZKA 1PYMA 4FF5A 3V18A 4QDMA 3GUWA 4UQCA 3MJMA 3AXIA 3CZ8A 3GO2A 2XGIA 2DGAA 5K2ZA 1UH3A 1V3JA 1FA2A 1GKPA 3EWBX 4EX4A 1TYGA 2VQUA 4NX0A 4N0RA 4RV8A 4XZIA 1WDRA 4W85A 3WMSA 3N17A 3PP7A 5AKQA 4GWEA 1B3ZA 4B15A 3TUUA 3C8NA 4ZB5A 3MVTA 1VFOA 3TTEA 4IFOA 1VGAA 2PTWA 4MB5A 1FHLA 2Y6ZA 3N2CA 3ELFA 3RX3A 2FVLA 1GZGA 1HKMA 4NQ1A 3POCA 7ODCA 4KWUA 1UA3A 1NVMA 4LXFA 3KCLA 2ZX9A 4H9UA 5CPTA 1F6PA 3B8WA 1B3WA 5JH1A 6CGTA 5ABFA 2XFYA 3TW6A 1NDYA 3SQSA 1ZTVA 2CYGA 2EPMX 1JPDX 1QATA 4DUVA 1DV7A 4ZQMA 5C6MA 4S3EA 2ZTJA 3WMLA 4ENLA 4AYGA 2JKPA 4LU0A 2YR1A 3IIXA 4QGCA 1CGUA 1XC6A 1E1CB 2G97A 1EKOA 4W86A 1NH6A 2F6KA 1XQKA 4FX6M 3QSTA 1NDVA 4GFIA 4ADTA 5FI8A 1A5LC 3QYSA 3SADA 1TFVA 1YTKA 4XBJA 1F3TA 3L0NA 3LV6A 3MMWA 2PDIA 3MB9A 3U9IA 3OIHA 1DIEA 4S3FA 3GZAA 1LROA 1YTDA 3AIBA 4Z1YA 1QNOA 1GCYA 1QR7A 1Q2SA 1QAPA 3OJGA 4AIEA 4PN2A 3KLLA 4I7UA 3O8AA 1QBBA 3AALA 3KZPA 3EX1A 4CQBA 4AWUA 1VZWA 1IT0A 4DJDD 1F2JA 4IISA 1FP9A 3DFYA 3KRUA 1FCBA 2VFFA 3BH4A 3EOEA 5CLWA 2C1HA 3TC3A 3AU2A 1B54A 2VZUA 4JOMA 1BSLA 2ASHA 2RUSA 4O52A 4LEFA 4AY8A 5EMJA 4HPXA 3VOIA 1OK4A 2QCHA 1RY0A 4WVXA 3BXWA 2E67A 1UP2A 3LTSA 1FWFC 4FO4A 2QEZA 1WZAA 1K3UA 3TXZA 1AL8A 1JAKA 2ADAA 4YNGA 5A1AA 2E09A 1OIMA 2WXDM 3B97A 1FH9A 1EJUC 4L56A 2WMIB 3KM8A 3W25A 1XL9A 2WVVB 3UETA 4US5A 2PDPA 5HJLA 1KWGA 4U4MA 1K9DA 5BROA 2E1WA 4MJZA 4QFUA 4JNYA 3FVDA 3LGEA 5FF2A 4GMEA 4J7RA 1UR1A 4QQUA 4HNOA 4TTGA 5D32A 2BTMA 4FHAA 4UMCA 3WELA 2I5IA 2OWXA 2BS9A 4GY1A 4GYPA 4FP1A 4ZXOA 3ABRA 4W4QA 3APGA 1B3XA 4YCOA 4DBSA 5SWUA 1GJWA 4DAFA 1VC4A 3MWAA 4MJMA 2QULA 3D47A 2QJIA 1O5RA 4GCAA 4ZQRA 4LNYA 7ENLA 5HULA 1Z41A 3N25A 4IMCA 2ZDRA 4QITA 2NVCA 4BJHA 1TKKA 4C6MA 2H8XA 4WJEA 4PCPA 3WLKX 3PS7A 3W02A 4AAJA 1YXCA 3EWZA 4KT2A 4UR9A 1NQ6A 3ZLGA 3LXCA 1KO0A 1ZJHA 1WXYA 5F2GA 1ADDA 4L9XA 4IMGA 1O5XA 1F4AA 2JIEA 1JD9A 3S2JA 3UCDA 3WQ6A 1PX8A 2VVNA 3N9SA 1GVOA 1QPNA 2CC0A 3MMTA 3HTWA 4XIMA 1VFSA 1K6WA 2XVNA 3UPWA 2F61A 4KBXA 1T99A 1VF8A 5EFFA 1ENUA 1EC9A 3WLJA 4NU7A 3N12A 3PWGA 1E6ZA 1EJ7L 3UWVA 5AHNA 3DYPA 5A8GA 3EWCA 1C92A 3IGSA 4H6EA 2R1MA 3F5KA 2AQVA 4IGMA 3W23A 2E3ZA 4P7OA 2WNZA 4IUGA 4S2CA 1J0YA 1J2WA 1DEDA 3CPGA 3CGTA 4KETA 4R7JA 3B0XA 4DB7A 4DF2A 4E0CA 2BDQA 3LCXA 2I14A 8XIAA 4S3GA 4IP5A 1XYLA 2EXOA 2Q02A 3WH5A 3BOXA 4YVXA 2YLAA 2D3LA 3UU0A 4U31A 4Y2WA 1IEXA 1M6JA 4HPGA 5FKYA 3MHFA 5BRPA 2ZUVA 5H6HA 4DUXA 1UWIA 3PFMA 4DPPA 1NY1A 2QUVA 3RPMA 4DELA 4ICCX 1E72M 3DGRA 1QWGA 3EKLA 3TN6A 1K8ZA 3ZJ8A 1DPMA 4KERA 2YA1A 3P60A 4ERIA 3TJIA 1K6AA 2XUCA 4XUYA 4N6EA 5A8MA 4GQRA 4EPDC 4AD2A 3QR3A 1RCQA 1DIKA 3AIEA 3LEPA 4XSMA 1KA9F 2R1KA 8CGTA 1S5WA 1OGGA 2DIEA 3LHUA 1TWSA 3W72A 1DJIA 3TFCA 4PBGA 1Q6FA 1NELA 2JF7A 3UERA 4A35A 1JVNA 4D72A 1WDSA 2OB3A 3BLPX 2ZDSA 3BK0A 1BGAA 4S3CA 2OFJA 3CZJA 5JXQA 3H6OA 4N9DA 1N82A 4O1EA 4DNMA 1JULA 1UKSA 3L4UA 4DEFA 1UR3M 1X38A 3IJLA 1VYPX 3W7HA 4MJ4A 2PB1A 2QCFA 3AWOA 2FFCA 4IGHA 2DVUA 3CMJA 1CGVA 3NL6A 1Y7VA 4YCPA 3VZXA 3ZVIA 1XLGA 3CUJA 3AHXA 2AMGA 4PODA 2XSXA 3ONCA 4IM4A 3AS0A 1DQXA 1CCWB 3KW3A 3OO2A 3MWCA 2WVTA 2QCNA 1R30A 1ODUA 1UZ4A 1DE5A 2QHAA 3NGFA 4XZ9A 1ESWA 4JTHA 5C70A 3O6YX 3UESA 3W3OA 4WZHA 5BOFA 4BQ5A 5FJTA 1MUMA 1K70A 1WE5A 4KCWA 5D37A 3G77A 2FDSA 2QJMA 3MHGA 2ZZ6A 1DVJA 4QDPA 2SFPA 1H50A 3BZJA 3BLLA 5BRQA 1R85A 3QOKA 1QW9A 3PZGA 3S5OA 3VD5A 2OGYA 3KTCA 5EMLA 2OR2A 4BA0A 2EQDA 4ZR8A 1E43A 3G1FA 2J24A 3EWDA 3E49A 3IIPA 1XRTA 3HO8A 4CQDA 3LPPA 4GJ1A 3ZWSA 1LUCB 2P5NA 1SW7A 2Y7EA 3T44A 1CXFA 5AC4A 1VCGA 4WX2A 2OKTA 3QMSA 2VFDA 4NG3A 3FXGA 2FTPA 2QLYA 3VTRA 4L5ZA 2X0SA 3BQ5A 3UW6A 2WZTA 3IVSA 5C2XA 4M1BA 1JF6A 4DO4A 4B91A 2WYSA 3AO0A 1W2VA 3VGFA 1MVYA 5D9NA 2B0MA 2W61A 3L23A 4HK6A 1HUVA 3VX0A 4ORIA 3TJXA 4GVFA 4ZE5A 4MZ1A 3UZ5A 2TSYA 2V8ZA 2GUYA 1JZ2A 2OTDA 4J1OA 2VNCA 2GPTA 4ZGYA 3PNZA 2CLHA 3FX4A 5EMUA 3PAOA 3M1ZA 1F8IA 2VL4A 4AHQA 3VMNA 4L6DA 4FXRA 1CXIA 2XSAA 4MGGA 1W37A 1EFZA 5GQBA 3FYOA 1QOXA 3WLIA 4AZCA 4YJ5A 2V3EA 3KBNA 3V5FA 1SMAA 3R8HA 4EIVA 1LORA 3AU6A 1H1NA 3B0YA 1IGWA 3ZIZA 4DN1A 3RCYA 3VNZA 2A0NA 4IIBA 4JYFA 3IVTA 1H60A 1QI5A 3A4AA 3CWOX 2PDCA 2V5JA 1TPDA 4OIFA 2DZXA 4FNTA 2FHCA 3A9IA 3ZT5A 2GQ9A 3NQVA 5MKGA 3C6CA 3LCWA 1F6KA 5T91A 4HU8A 3C52A 5A6KA 1QUMA 1MRQA 2VR4A 3IK4A 4MB3A 4TU1A 5DBTA 4N2YA 3VNLA 3LOTA 1EDTA 3L4ZA 1Q6QA 2DUZA 1UCWA 2BZNA 4P7QA 2HS6A 3OOQA 1SMDA 2PPGA 3M0HA 4JTKA 1VIZA 4K1WA 1V3KA 3L65A 2J7GA 1OVDA 1SSDA 3RCNA 4AZ6A 3GY1A 3PVFA 5CC3A 3A6OA 4HU0A 4DWSD 3VM7A 4AZCB 2VX4A 4CQ9A 1UZ1A 1XDJA 3N29A 4RX0A 1YADA 4KEZA 3IS4A 1FDYA 3A4XA 1E56A 2J7FA 5CBIA 4QG8A 3LU2A 3DHDA 2C3ZA 2ZUMA 1MQRA 1TWZA 1J10A 4S39A 3LSBA 1W1B1 4E3TA 2DDXA 3BLIA 2VFHA 1XIFA 1ISYA 1NWUA 4AISA 3DHPA 2R1PA 3V7PA 5KETA 4UTKA 1GYNA 3W00A 3QH2A 1UWSA 2C7FA 3QR0A 1E6PA 3FK4A 4J3ZA 4LUJA 2I56A 2EEXA 4O10A 1KQZA 3N3TA 3DG6A 4HYVA 3AMKA 4GI8A 4LS2A 1VFMA 5HUOA 1JJKA 2E6YA 4RPPA 5DRIA 3TW9A 4J4KA 1UBSA 3O16A 4GX8A 1V51A 3NL3A 1PWLA 1LRQA 2A7RA 2CXGA 3WH8A 5AVHA 3BJSA 3SDOA 3L5AA 4M6VA 2AKMA 2PI6A 4BI7A 4RDVA 3R2GA 4PZVA 4DO5A 4D6EA 3TJ4A 2GOUA 3CZGA 1H51A 2FGLA 1DQWA 3RNDA 1PZ3A 3QTPA 3H8AA 2NT1A 2PF8A 1BSIA 2QCMA 3UWYA 1SJAA 3MW7A 1C29A 1ZRQA 3CYJA 1KXTA 2IPFA 4CD6A 2J25A 3WX7A 4BFAA 4UXDA 2DORA 3LHZA 3IJ6A 5K9CA 1U22A 9XIAA 2REQB 1S2TA 1KCZA 3ZR5A 1DXEA 1ME9A 4FNUA 4DJFC 4MYXA 3UWEA 1PKMA 3D3AA 4A2SA 1E9IA 2OXNA 2PP0A 2PGEA 4L4OA 1BWVA 1UPPA 3RLUA 3MKKA 4Z0JA 4NUWA 2B81A 1ZGDA 3N2XA 1B3YA 3QC0A 3GYEA 3SURA 3WF4A 3PZTA 3Q94A 2Y8UA 3MANA 1E6QM 1JFHA 1H63A 3AS2A 5D8ZA 5A6TC 1AJZA 1EC8A 4WGHA 1H09A 3NQEA 2NX3A 3ARPA 3AYVA 3B8UA 1GGOA 8XIMA 4MFEA 5I07A 1BF2A 1FWHC 2YOCA 3F5JA 3RF9A 1IR1A 1W9XA 1XHGA 4UTHA 3C86A 4XKYA 5D04C 3WBXA 4NAEB 4J3XA 1UQYA 3HF3A 4FZIA 4P8VA 4E2OA 1NAL1 2X2YA 1RCXB 5K4ZA 2PDLA 3AMGA 3GUGA 3KP1A 2X1UA 4WK9A 3FJLA 4GA8A 3QQWA 4ROQA 1UYQA 4HKPA 4S1FA 1UMYA 2WBGA 3BSHA 1JL8A 4OKDA 1DJWA 2YL5A 1IZCA 1LDCA 5A6BA 4UTUA 1AQ0A 1UD3A 4Q8NA 3WL0A 2X40A 3F4NA 4ATWA 1MMFA 5AYBA 3GIYA 4HSOA 3FA3A 2DUAA 3AZTA 1ISZA 3DFTA 3E0VA 3GFXA 1XCXA 3NQGA 2PWFA 7TIMA 3UG4A 2BY2A 1G5AA 2R91A 2Y2WA 5A8QA 3QY6A 1FH8A 4H8VA 3IAQA 1OC6A 2G41A 4G7EA 3MC5A 4X2PA 2DSVA 2V82A 4HB7A 5FSEC 1GORA 4TOQA 2WNQA 2VJXA 4FK9A 3BLOA 1WDQA 1OD8A 4WXYA 1DXFA 1I60A 4O1DA 4J3TA 3S8HA 4JTGA 2XIQA 3BCDA 2D23A 3VA8A 4CVWA 2I17A 4LF2A 2Z29A 4A2RA 4J27A 3WK1A 5E1QA 3V0TA 2EKGA 2VGFA 4XZBA 1E0VA 1V77A 3UR8A 5CG7A 4JGDA 1AQHA 2VELA 2WMKA 2WV8A 3T8QA 1RALA 3WUBA 4DZ5A 4GISA 4X3ZA 5G1YA 3LBCA 4D6GA 1IXNA 1NWRA 4KWOA 3UEQA 3M0JA 1MSSA 1QI4A 3SI9A 2OSYA 1OYBA 5JUVA 5L9FA 3P8JA 1L0PA 3ZLFA 1Q4NX 3T0AA 2VQTA 1LLOA 3STGA 1CZ1A 2A85A 4O17A 1I1XA 1ELSA 1VS1A 3NPWA 4IL2A 4DIAA 1XGZA 1M03A 1EHNA 3W75A 1O5KA 5FJRA 3VAVA 3TJLA 3R58A 3BDKA 4IPPA 1F73A 3MHUA 3S5ZA 1BYCA 4A05A 3WBWA 4H7VA 4YU1A 2VX7A 1GOIA 1VCVA 3PR2A 3ECQA 2W62A 3EMZA 4TR9A 4UQBA 3FOKA 1E6RA 4JCLA 2O55A 3L12A 4G5DA 1LOQA 4ACZB 3SFWA 3W1QA 2Y7DA 2WKJA 2GDQA 4OE7A 3NSNA 2XH7A 1QXLA 4DBWA 2WMIA 4L6OA 3P61A 1K8YA 4K1GA 3UQNA 3ABOA 3GXPA 1R3SA 3UJ2A 3DGBA 1JDEA 3IV8A 4MWAA 1E3ZA 4XZWA 1CI1A 3EDKA 4A22A 1KR1A 3VE7A 2YCJA 3W1UA 1MUWA 3CYVA 2XIOA 1TVPA 3G18A 4BS0A 5I3DA 1QT1A 1ECEA 4QE5A 1W1YA 1BVWA 2E5DA 1I1WA 4Q22A 2FHBA 1OYAA 3DAQA 5M17A 1WOAA 2E8ZA 1YPFA 3BSGA 3S9ZA 3VNKA 3CUHA 4DJEA 1D7FA 3WDJA 3CQ0A 2W92A 3AOFA 3RUBL 2CLPA 2JKAA 4O14A 4FF7A 3MKCA 3TC6A 4TIMA 3VNIA 4FNPA 5HR7A 4LUYA 4NZCA 3ATYA 1RK6A 3GW0A 3E5BA 1P1XA 4PB5A 3ITCA 2AL2A 2IKIA 5DY2A 1E1CA 4US5D 3K4AA 2ANUA 3NQ8A 3T7VA 3L4VA 6PTDA 4C6OA 3RU8X 1YDYA 4AQLA 1YNQA 2WM1A 4HBKA 4G1KA 1J11A 4MKNA 2BB0A 3IUDA 3MV11 5I09A 1THFD 1UASA 2WHLA 2PBOA 3GH7A 2YB1A 5C0QA 1UIPA 2ZZ2A 3PHAA 2F6XA 3ARXA 3V75A 3VIKA 4LBSA 3H2CA 4XK2A 4OFCA 1HGWA 3LB0A 4WR3A 4H1ZA 1KWKA 5GJPA 3RIKA 4LRSA 1EYWA 4Z0SA 1HG3A 2XN0A 4YYCA 4XAYA 1RQEA 3N14A 3QPZA 5CLTA 1OINA 1C90A 2JF6A 5CEWA 1P5BA 3TAKA 3L5MA 1PE1A 4HVXA 2Z2UA 3URBA 4RJEA 5LIWX 3A12A 1TREA 1E4MM 1XLKA 1FWEC 4DNHA 4XQ6A 3BMVA 1PPIA 3V5OA 1UD4A 3WNLA 1QOPA 2H8ZA 2G3MA 4I6KA 3H53A 5FL1A 5B7ZA 1TPEA 4EPEC 3OYZA 1DWJM 3SR7A 3VIMA 3Q65A 3I7QA 3GIQA 3PB2A 1FKXA 4NJJA 1RVKA 3OBAA 5AN7A 4DPQA 1N8WA 2MUCA 1I2NA 3V1HA 1R2TA 4GHRA 5F1VA 1U5VA 3GXMA 4MADA 3F2DA 2GVEA 4ZA0A 2G5WA 2PWVA 1XDMA 4H3DA 5BU6A 4E4UA 1O4UA 3M64A 2QDEA 3L2LA 1MEIA 3DC8A 3QR1A 2AAAA 3HQNA 4PYSA 1K9FA 3R25A 3MQTA 5CSRA 1B90A 3VKKA 1OWQA 2ODOA 4JL2A 3SBFA 4UFIA 1GVSA 3FW6A 3T08A 3KWXA 4ZZ9A 5HMEA 3JW7A 1M68A 2DZBA 4B5UA 1DE6A 4Y9NA 1H7RA 2EGZA 2Z2BA 3QY8A 1PIFA 4NVTA 3U2ZA 4K7YA 1HVXA 2P8BA 3WJWA 1FFQA 4RXFA 2WOQA 1J0JA 1A5AA 1ISWA 2XSBA 1ZFJA 3PB0A 3CHDA 3IIVA 2X2GA 2R14A 1LRTA 1TPH1 5LGXA 1FH7A 4D2JA 4JQ1A 4CNTA 4NAFB 1OCQA 4IIFA 1E4NA 2PWEA 1UWQA 2RGLA 1Z89A 4LBUA 3GXNA 4IICA 3MO4A 4XSLA 1VFUA 1UUQA 4INFA 4X9YA 2O9TA 2D69A 4DWDA 9XIMA 5DBUA 3AXXA 4F2UA 1A5CA 2ZX5A 4MPQA 1PKYA 4PBFA 3HPAA 5AHFA 4IMEA 7XIMA 4QSHA 2V2CA 1C8YA 3VIOA 1OZQA 3F1QA 2DW7A 4H6KA 3O6CA 3VIGA 3WUGA 1KRBC 4R88A 2RDWA 4NAEA 4DZHA 3NQMA 4UQAA 4B5SA 3W83A 4CD4A 4HOZA 2IS7A 2E25A 1BQCA 4Z2KA 1PHWA 5FIPA 4B92A 2XGBA 2OG9A 1TE1A 3T55A 4M6QA 3PAJA 1SYTA 1TX0A 4I5UA 1B2YA 4A8RA 4O0ZA 3AUOA 1PEZA 4GY7A 2PDHA 1B3OA 2GGHA 2ZZ1A 1VENA 4ZO8A 3ME3A 1SZEA 3M0YA 1IWBA 1FOBA 1VJSA 4YTUA 1PUDA 4GYJA 4RUBA 1ITUA 2R1NA 4LBRA 1EHAA 3KVLA 1U83A 5IHSA 3OZOA 4ZE4A 4JFSA 3L5LA 2XIIA 1TTJA 3PTDA 1TV7A 1JQVA 3SEPA 3AIUA 3OODA 1M3UA 5C8BB 3BJTA 3JVAA 1OB0A 4XZLX 4AZ5A 2PDKA 1EP2A 2Y7FA 1JDFA 1ZLPA 4XV0A 3W81A 2HPMA 3BMXA 3T4WA 4W7VA 2YXGA 1ZB5A 1K4HA 3O1NA 2FMNA 1XIEA 1W3TA 5BW6A 3B9DA 4PMZA 1FWCC 3W1TA 4OUEA 2ZQ0A 4GNKB 4C6LA 2HNHA 1ICPA 3GDLA 4RLIA 3TYBA 3DFNA 1S2UA 3EB2A 4ZTYA 1HL8A 1FWTA 3EXRA 4JPGA 2NQJA 4XWUA 1SZNA 2BWGA 5TAOA 1LQ2A 1A4LA 3KBWA 3CK5A 5LHFA 2QV4A 2WPBA 4IPLA 2RHGA 4LX4A 4N42A 3W6MA 4WDUA 4JFUA 2V9DA 2PDWA 3DYMA 3UFYA 4DO7A 3WJZA 5RUBA 4D6HA 3S6TA 5AC8A 3NQAA 1F74A 5DT5A 2ZRXA 1LOLA 1I0BA 1ADOA 3K8KA 4NT0A 1GQKA 3K8LA 1HJUA 2VRJA 4AD4A 4CQAA 4WY0A 3BAJA 3AYRA 3FHAA 4PH6A 4UTJA 1QDSA 3A23A 2CZDA 5BOEA 4FOJA 3G2GA 5FEPA 4M0XA 4NASA 3FSUA 4UWMA 3U7VA 1XIJA 2VKZG 2ZOXA 4C7DA 4BQ2A 2HZGA 3HN3A 3MVIA 3S2CA 1W0MA 3KBMA 1A5SA 1GT8A 3LM3A 4ZOBA 5XIMA 1ONWA 3LHVA 4EACA 1Q6OA 1V3HA 3FN9A 4GIRA 4GINA 1KM2A 3PJWA 2J7CA 4G6CA 1TA3B 3CT7A 3UWZA 1G1YA 5CZKA 1ICSA 3CO8A 4IP4A 1NP0A 1VJIA 2B4GA 1VHNA 1W9UA 4D6JA 5I23A 1WB0A 1GZJA 4G56A 1W1IE 3ARVA 1U33A 4EWND 5CZSA 3TYUA 2XZ7A 5G5IA 1A5NC 1WKDA 1IEVA 1XH0A 1HO1A 4UTIA 4QROA 1IT7A 7A3HA 1XSIA 2FZ8A 4DBDA 1OZMA 1UJQA 2J7DA 3SJ3A 4FXFA 1CBGA 2OO0A 4JQ2A 2QCCA 3N19B 4XISA 3BGAA 1VYRA 5TQLA 3SRKA 2WCGA 4OJYA 5CZJA 3W6YA 1CLVA 1IZKA 5DMNA 3URAA 3ZLHA 1E3XA 1WKYA 2HQAA 2WWDA 3NAVA 1E5JA 1GTHA 3R1ZA 1CXHA 1EIBA 3KBSA 4PULA 3OPSA 3AYTA 5HMDA 1TJ0A 5MKGB 3MO7A 4F3HA 3SIZA 3W07A 1P43A 5CXPA 3KBVA 4D6CA 5EB8A 3TW7A 2Y1HA 5H8UA 3HURA 3WD3A 4WJXA 1K7XA 3DFSA 5ABHA 3CZLA 4BWLA 2Z26A 3D6NA 3GB6A 3LI0A 1WDWA 4H00A 4P8WA 1ICQA 3CL7A 4DJED 4PUNA 2TRSA 2ZUNA 3NPUA 4J40A 5K3VA 5FAJA 3W28A 1JRCA 1FX6A 1WA3A 4I8YA 4ADUA 2ZXDA 1SFLA 4PGLA 3SUTA 4LVGA 3UR2A 3KTXA 4KEMA 2YPIA 3NQFA 3S1GA 1PCKA 1PHQA 4HA4A 5CPNA 4C6NA 4QM1A 1GKRA 4BI5A 3KVMA 1WAWA 2VC6A 3M41A 4ES4A 3UJEA 1PVNA 1VPQA 4FEZA 1EX1A 2KX9A 4HU3A 1JXKA 3W7CA 1AD1A 2NWRA 1O12A 1UP3A 3C3NA 5BWAA 3L4TA 1E9YB 1V79A 4AWTA 1F4HA 3I7RA 4N9BA 2G37A 1DWGM 3VNDA 2I9EA 1PB0A 3W2UA 1JPMA 1X39A 1CECA 3DBNA 2OVLA 1EA9C 1RCOB 4M82A 1W32A 4GYPC 3NNTA 3UZJA 1QPRA 3NXFA 4AYSA 2WM0A 4HMDA 4P7LA 2CLEA 2G3IA 5IFPA 4LY4A 4B5WA 2J4GA 1KM6A 1XLIA 4MM1A 3P14A 3QOMA 1CGTA 1TPFA 3MDWA 1QNVA 5KITA 3HPFA 1B57A 1FXQA 4Z2JA 1MDLA 1VIWA 3LPFA 4NXKA 1TVNA 3RK8A 4LY8A 1B31A 1JDCA 1XCWA 5DN1A 2WKGA 1IQ8A 1EUNA 4DJDC 5C5YA 3SQLA 3G6LA 4AZHA 3PZMA 1DOSA 4GVGA 4LYQA 1UP0A 1F05A 2ZZ4A 1KRCC 2W3ZA 4TO8A 2BVWA 3EAUA 1GHSA 2DZUA 2R1LA 2Z2AA 4PEEA 3PTMA 1GVEA 2HWGA 4GIAA 3THAA 3F4DA 5TD4A 2XH0A 1BEUA 1L9WA 1KV5A 4IWWA 2ISWA 5F2LA 5I06A 3LHTA 1W6TA 4AHPA 1ZCCA 3KWSA 2JEPA 3EOUA 1RJQA 3W2NA 4AUBA 3GTXA 2PA6A 3EX4A 1NWTA 2CKRA 1A47A 4UTMA 2CPUA 1XSKA 2Y8KA 4Y9MA 1QO5A 4FX8A 5FCZA 1GQNA 2FPVA 2NQZA 5LNWA 3NR0A 3HG4A 4YS1A 4HOXA 3VCCA 3TDFA 5F7UA 1TTQA 5DRCA 1YDOA 5CGMA 2QV5A 1VFLA 1W1VA 1KTCA 3P6LA 1TCMA 3G0XA 1XYCA 2PP3A 1CXEA 4DM2A 5ENLA 4MDOA 4MWAD 2PU0A 4H7CA 2GJPA 5CC5A 3W1MA 3FGCB 2J27A 2XIBA 3FA5A 3M0IA 2CHRA 1XYFA 4CN6A 5A3HA 1AQFA 3R94A 4K39A 4GPNA 3SN4A 3ZJ6A 5CQ1A 4CCZA 1PS9A 4L6HA 3TQKA 2XGZA 2AMXA 3TTYA 2CFFA 1BRLB 1C7SA 4W7WA 1H5VA 4L1WA 2P0IA 4ZVJA 4QTGA 5FJUA 1UR2A 4R9XA 1XYAA 3AISA 4GD0A 2UY3A 1N8IA 4NZ5A 4PTDA 1H5YA 1DL3A 2HSAA 5F2MA 3RAOA 4I9TA 1DTNA 4CNNA 1JPHA 5CJNA 1BTMA 5FOOA 2OSXA 3LHWA 3WEMA 1HJSA 2NUXA 5D02A 1R47A 3SCVA 1J79A 3ITYA 2PDGA 4DLMA 3ALGA 5A69A 3FAXA 4CN4A 1FHVA 4JIEA 4ZFMA 4H19A 5DMYA 4HMEA 4JDBA 3R8GA 2XM1A 2EPKX 3GNDA 3VDBA 3CLMA 1R7OA 3G3MA 4A3YA 3BO9A 2OYLA 1T8XA 1MRAA 1UD5A 2PODA 1QHOA 2ZTKA 4ECLA 2QDDA 4WIWA 2V5LA 2HV5A 2QVHA 1KCKA 3EKZA 3BANA 1LL7A 4WJ8A 5D09A 2A6NA 1VLIA 3U6WA 2Y61A 3MYOA 1GOMA 1VB9A 4B2DD 4GYFA 3ZYZA 2A3BA 3MZ2A 1Q7MA 2AL2B 4TX8A 1OF8A 4AD5A 3F4VA 3P67A 1DJHA 3VGBA 1N55A 3E2SA 1ME7A 1V0NA 2ISDA 4C6EA 4KWSA 4UR7A 3RM8A 1VBHA 4F9JA 2FGBA 3AMDA 5H91A 3LV5A 1RY8A 2QF8A 4RE0A 1FWSA 2GSEA 1WO2A 1LP6A 3ARTA 3WQPA 1X98A 3R79A 3KDNA 2OJPA 1W3NA 4B3KA 3BAKA 4RK8A 3TMQA 2B7OA 2NV1A 2VD9A 1E0XA 5J5DA 1L8PA 1ADSA 4UUIA 4DF1A 1LWHA 4QLJA 4LAOA 3WDHA 4AIUA 2BP1A 4CCCA 2A5HA 1V6YA 1FVPA 4H8HA 3KRBA 1BLIA 4GUJA 1MW3A 1ZSXA 1GTEA 4JS3A 3M6YA 3K30A 4W88A 2HS8A 1WNOA 4HZ8A 3T81A 1XFCA 1OFAA 2FLIA 3B8TA 5BMWA 3QV8A 4JN7A 4ATDA 4N9CA 3V5CA 1NEYA 5HAOA 2FTWA 1VRXA 4X0NA 3LTYA 3RN6A 4FA3A 3DKJA 2GSHA 1XISA 4AZIA 2WVVA 4Q3MA 2VWSA 2GWNA 3MA8A 3TWBA 1PX3A 3PZVA 3B0PA 4ACZA 4X22A 2CERA 3PBMA 4H6RA 4HHHA 2OEKA 1J5TA 1JPIA 1LCOA 4F0MA 4IOTA 5HANA 3S1UA 3TVAA 1AK5A 5CSUA 2GJNA 3I6EA 3Q2DA 4TUFA 1BWKA 1W3JA 1GVRA 2F9RA 1W8GA 1BVZA 4NNBA 3U3HA 1O94A 4C65A 3C2OA 2UWFA 5H8MA 3GC4A 1W9PA 1QFEA 1R3QA 3LMYA 4M19A 3GH5A 1R0MA 1BAGA 1GW9A 4ZENA 3QZ6A 4XD3A 2OWWA 2AGKA 3WBEA 1SSGA 4I7VA 6REQA 2YBTA 7PTDA 3VUSA 2HXUA 2WNNA 3Q45A 1TELA 1D8CA 4FR1A 2XIJA 1EXPA 1UC4A 4I9MA 5IFTA 5E6ZA 1OYCA 2BVYA 4KW2A 3LTPA 1P0EA 2J8FA 1FWAC 4GXPA 3S5YA 1VD6A 5BXPA 4W8LA 3PZNA 3W86A 3WH6A 5EA9A 1VBGA 4H6QA 3MJYA 1KFKA 1FWRA 3TN5A 2VC7A 4V2XA 2BLEA 1CW2A 2ZUSA 3WH7A 5DT7A 4F79A 4QDWA 3QLLA 3EA1A 4LJ3A 4LV9A 3F7JA 5CSYA 1GHRA 4Z1BA 3T0TA 1UQZA 3WD4A 3UWUA 4MB4A 3RM9A 2EG6A 3ITOA 3VDHA 3EOSA 4OTKA 2FJUB 1G4TA 2ABAA 4LV4A 3CO4A 3LY0A 1TRIA 4RNFA 1WAUA 4HPHA 1O60A 4G7EB 3DECA 5EMMA 4R7WA 5AYXA 4LOCA 2ISSA 4KRTA 3W7KA 1PZ1A 1D8WA 4LS1A 5IM51 1IIHA 4I9JA 4J2PA 1DTUA 3N1AA 3AHVA 3UP8A 3BQ6A 1JYWA 1BKHA 2Y5SA 4US6A 1V6TA 2W79A 4FAMA 4FB7A 2PDXA 3JU2A 3T2OA 4Q8TA 3W37A 2D73A 3OGVA 3K8MA 3W2LA 1F3WA 3WFZA 2ISVA 4O0QA 3F2BA 3EA2A 2W66A 4LWWA 1J4EA 1YXDA 1A5MC 2Z1WA 2Y7GA 4IGSA 2INFA 2BXYA 3UA4A 3BL3A 1UR0A 4MZ8A 2FH8A 4Q4MA 2VEFA 1UR8A 4H04A 3KP0A 4FXJA 3PC0A 1OG0A 4UZUA 2ZC1A 3W88A 3ZR4A 2VOTA 1SFTA 1KM4A 1FWDC 3CBWA 3FGCA 4XZNX 5DXXA 1HX0A 5CC6A 2BVTA 5ECUA 4XKYB 1E0UA 1VAHA 2F84A 1E4IA 4MF4A 5JBFA 1XUUA 4AIBA 3CUFA 3VIJA 3GU9A 3STFA 1AW2A 3TE9A 2NQHA 4C6FA 3CH9A 3HM7A 3VINA 3QV9A 2WLYA 1MFVA 1B4KA 4YIWA 2ZXBA 4DI8A 4JD4A 3KE0A 4NZJA 2YFNA 2QPSA 4HNCA 1GQIA 4L4PA 2O9RA 3QN3A 4XBSA 3DG3A 3ES7A 4XTDA 4GACA 4PMUA 4XVDA 4NYYA 1HKKA 1R3TA 3HJZA 2REQA 1H62A 2QGYA 5LNSA 1TG7A 5DXYA 1JCLA 3QF0A 3OBEA 4F0SA 3STPA 1E55A 2BY3A 3UG5A 2ACSA 2VP8A 3D0CA 4DHGA 1OCNA 3NO3A 2TAAA 5HJXA 2G0WA 2CITA 4JFWA 3UVAA 1AZ1A 2V5CA 4L64A 4F0LA 3NFUA 3FY1A 3NPVA 4D71A 1B30A 3RLHA 4HNLA 3WQWA 1XGDA 1CLXA 1V6UA 3WKZA 4GGHA 3E2RA 3BAXA 4QRNA 2C19A 4RKAA 4S2BA 5TF0A 3UNTA 4A21A 5CCZA 1EOMA 2DSZA 2C8NA 3B0UX 1KRMA 4UTFA 5I3IA 3H7VA 4F4RA 3NWRA 4AEEA 1VKFA 3O9NA 1QK0A 2D2GA 3BTNA 2J66A 5AC6A 3WQ8A 1UA7A 1P0NA 2J9ZA 1RXOB 5AZ1A 4PMQA 5TIMA 5LSMA 1WOBA 3B9NA 4R9OA 5D2VA 3TP4A 4QG9A 5IDIA 1SZRA 1VFTA 4ORMA 3URQA 1E4LA 5FJIA 1HIZA 4ADSA 3MMUA 4GOAA 4MNKA 1TPUA 4QS6A 3CPUA 4O15A 1V6VA 1WKFA 3NVDA 5E0FA 1XIIA 2GOKA 3VIIA 3LLXA 4Z2GA 5KEZA 3TIMA 2GK1A 3KOWA 1KFCA 1SZFA 1FWNA 1VQTA 2FZBA 4DWSA 1HP5A 3EYPA 4KCTA 2Z1XA 1B5TA 3H55A 1GNXA 2UY4A 3VIHA 4N7QA 3DKLA 2DZWA 3PUDA 4L80A 1HGYA 1RZMA 1V02E 1CX9A 3VGHA 1T5AA 1D2KA 1KXVA 3H7UA 3MP5A 1UC5A 3W9ZA 1QNPA 3WLNA 3IACA 3GR4A 4GG9A 2QT3A 4KFPA 2YXOA 3TZNA 5G2WA 1TPVA 4WEVX 3ANUA 1S39A 1VEPA 2PTDA 1FHDA 2AGTA 4F48A 5D03A 3WUEA 1GUVA 3AFBA 4LUTB 2QKFA 4QBXA 5LXEA 1JGMA 2BASA 2FHFA 3N4FA 4Y9PA 4TMBA 1J01A 5D33A 3G3DA 4D6IA 3AC0A 3VOJA 1KCLA 4LC6A 5TNVA 4UTLA 2QDGA 1XH1A 2BX7A 2BVDA 3KTSA 5DO8A 1R46A 3M0XA 4IQDA 5CC7A 3NA8A 4IX2A 4QE4A 4P7NA 1SO4A 1IXQA 4QNWA 1L6FA 2J9XA 3WQDA 4JQ4A