3WBAA

Rice os3bglu6 e178q with covalent glucosyl moiety from p-nitrophenyl glucopyranoside.
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
478
structure length
478
Chain Sequence
GLTRGSFPEGFVFGTASAAYQYEGAVKEDGRGQTIWDTFAHTFGKITDFSNADVAVDQYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPYVTLYHWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNQPHTVAIQGYDAGLQAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKATQNGQLGIAFDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRFTADEAAVVKGALDFVGINHYTTYYTRHNNTNIIGTLLNNTLADTGTVSLPFKNGKPIGDRANSIWLYIVPRGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIKYHNDYLTNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSVQWFKALLKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucosidase 6
publication title Enzymatic and structural characterization of hydrolysis of gibberellin A4 glucosyl ester by a rice beta-d-glucosidase
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Hydrolase
total genus 193
structure length 478
sequence length 478
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wbaA00
2DSWA 5D8WA 1FHLA 2YOCA 4A3YA 4QFUA 3AISA 4PYSA 2O92A 3VIGA 4D6CA 2W63A 1BQCA 2WVTA 2YA0A 3WH8A 3BSGA 1E0WA 1FH8A 3BAXA 3WDRA 1UA3A 3GXFA 2XSAA 2CKSA 2WYSA 4BQ5A 1VRXA 4ZXLA 4M29A 5A6KA 5AY7A 1OBAA 4CN6A 1X6LA 3LPGA 4R27A 4F8XA 3ALFA 4PMOA 2VCCA 1V6UA 2ZX9A 3VM5A 1LL6A 1GOKA 5D4YA 1UOKA 1JZ2A 1WZAA 4JL2A 5I77A 1BPLB 1QI0A 1GHSA 3WN6A 1C90A 2DT3A 1XRVA 3QHOA 3THCA 4D72A 3MMUA 4P7RA 1YQ2A 3MKKA 3VOCA 1GOOA 4HZ6A 2V5CA 1UWTA 1FFRA 1V6VA 5HDRA 3RM8A 3SUUA 2WHKA 2CEQA 3ZSTA 1E6ZA 1LLOA 4UR9A 5JBFA 1Q6CA 2YIHA 2DSVA 4UQAA 3DECA 2FH6A 1OINA 2DGAA 3NDYA 3BXWA 3EDKA 4CD5A 5JBEA 4CU8A 3MU7A 4C7GA 1JG9A 3D3AA 1HP5A 4JHZA 1V02A 3CZ8A 3RDKA 3WL0A 2DDXA 3QOMA 5BWFA 1E1EA 2VR5A 4X9YA 3ZOAA 2J79A 3T2PA 1PX3A 2CXGA 3FY1A 5HPCA 1KXVA 1PZ2A 4CVWA 2PWDA 2ZE0A 3IJ9A 1TUXA 2X0HA 3OLGA 4CD4A 2JF6A 3VIPA 5CSYA 1KCLA 3SUTA 1W91A 4W85A 1E43A 2BVDA 1KR0A 2V3FA 2WMHA 4Z2KA 4AIUA 4GI9A 1SFSA 4F9DA 3CGTA 4PMXA 3MUIA 1GHRA 4B3KA 2O9RA 5CPSA 5DEZA 1AVAA 4L4OA 1V3LA 1ZB5A 4PMDA 1F4HA 4NRRA 2ZWZA 2E40A 5A8MA 2YL6A 8CGTA 7A3HA 5CLWA 1UR8A 2V3GA 5M17A 4AIOA 1ISZA 5TD4A 3W29A 1OD8A 3POCA 4MAZA 3IJ7A 4AD2A 3WNOA 3ZJ8A 3GBEA 3HJEA 1MW2A 4JFSA 2JALA 4FLQA 3W82A 5HPOA 4AZ5A 1UQYA 4E8DA 1G0CA 2VRQA 4W89A 2E8YA 2IUZA 1GCYA 1DTUA 5I3DA 4AXNA 1E6SM 3LPOA 1BSIA 1NARA 4BS0A 3PBGA 3OLDA 4P8WA 5A94A 4JZ5A 2Z1KA 4WSKA 2YL8A 4AD0A 3AYRA 2D3NA 1CXIA 1E6RA 2V3EA 3QR3A 2YKKA 4M80A 2CHOA 5ABFA 1OWQA 1WZMA 1WZLA 4FLRA 3GH5A 4LPCA 4BQ4A 4AIEA 1UZ1A 3W28A 3W81A 1JYVA 4PMRA 4RE4A 1UWQA 2W4XA 2V38A 3CLWA 2WNWA 2EPKX 4E2OA 3ARZA 1H2JA 3ZJ6A 1K9EA 3CUGA 2WBKA 4D6IA 3N17A 3VIJA 2PC8A 3E1F1 1C3FA 4LXFA 1U30A 5E6YA 5A6BA 4U3CA 1ZJAA 1CLXA 3ZJKA 2Y8VA 3WQ5A 4MPKA 3EMZA 2W61A 3ARYA 1J0ZA 2YL9A 1J18A 3CZJA 3PZQA 5D9MA 1H09A 1D7FA 4D6HA 3U5YA 1A47A 2Z1SA 1JI2A 1W3LA 2CKRA 5ABGA 3FAWA 1J11A 1NWTA 2J7GA 4J3XA 4QP0A 2QLYA 4GZIA 2Y5EA 1V3KA 4M56A 1M03A 3WFLA 3SUWA 2EO7A 5ABFB 2WMJA 1PPIA 1BG9A 3U7VA 4DWSD 1VEMA 5A6LA 1LWHA 6A3HA 1GNXA 1BF2A 1XH0A 4YHEA 1HVXA 1E40A 4QLLA 1R7AA 1VIWA 2VUYA 3K46A 3UESA 2O9PA 1JYNA 4GO9A 3FN9A 1CNVA 1KWGA 1JZ8A 1V6YA 3CMGA 1X1NA 2G41A 1JYWA 1EDQA 2Q8XA 4W88A 1OSEA 4Z2LA 2UY5A 1J12A 1B3YA 1WZKA 3T09A 4J27A 5I23A 3SCUA 4R5EA 1J10A 1R87A 1PJ9A 2QPSA 3CHDA 1MW0A 4IISA 4AD5A 1E5JA 1CXEA 3AICA 1G94A 2ZUVA 3UCQA 1OM0A 4XUYA 3WL1A 4PTVA 1PEZA 1UR9A 3M6DA 2BXYA 2CBUA 3NSMA 1K6AA 2V3DA 1DWFM 3WQ8A 2YLLA 1WE5A 4TVDA 4GIAA 2ZUTA 5E0FA 1M04A 4QAWA 3WQVA 3OIHA 1C8YA 2E9LA 3WIJA 3VIOA 5A69A 1UQZA 1QNPA 3ARVA 1QI2A 2EEXA 1UWRA 4MDPA 3WMBA 1KWKA 4PMNA 3ZT5A 2JEQA 5E0CA 3BH4A 1MW3A 3EMQA 4FMVA 1W3JA 3AIVA 3HN3A 2XWEA 3J7HA 1QI4A 3BGAA 3W27A 4W7UA 1GUVA 4NZCA 1UG6A 3BAIA 4M24A 1OT2A 1QPKA 4OKDA 1MQQA 1WDQA 1Q6DA 1W9VA 2OYLA 5AYIA 4DUVA 1XCXA 4K68A 3VIMA 1ZS2A 1X6NA 3T0AA 2J4GA 1EIBA 1UD4A 2VRJA 2WCSA 7CGTA 1XSJA 1SR0A 2CERA 5AC5A 4MDOA 4P7NA 4DUWA 4C7DA 3GH7A 1MFVA 2J8FA 2OWWA 3CUIA 2HVMA 2PWFA 4HA3A 4KGJA 1NWUA 1XD0A 4AW7A 2XGBA 3GXIA 1QW8A 4M1RA 4KWUA 1CBGA 2G3IA 5C70A 3VMNA 1AQ0A 1V6WA 3RCNA 2XTKA 2PWGA 2VCAA 1PX4A 3BMVA 2XGIA 2WCAA 5IHSA 3KWXA 2FGZA 2W92A 1HKIA 4B15A 4W7WA 3W6MA 4D1JA 3SEPA 2GJPA 4GKLA 4PMUA 1J0HA 3NIYA 5CGMA 1TZ7A 4P8UA 1UWIA 1VEPA 2WZHA 4JKLA 4S3KA 3TTOA 5A8QA 5JUVA 2VX4A 3MS8A 2WMIA 1BGAA 3VTRA 2Y24A 4W84A 3PZIA 1GW1A 3N04A 3WNPA 1HN1A 3WD0A 3B9EA 2W66A 1R85A 2JEPA 1WKYA 1B3VA 4Z2HA 4TUFA 1CTNA 1B0IA 4UQCA 3QOKA 3U57A 3ARQA 4YPJA 3IAQA 2FHFA 4MJ2A 4UCFA 4TVUA 3WEOA 3PN8A 4JCLA 2WC4A 2ZICA 2WLZA 4TX6A 4TVCA 1B2YA 5HNNA 3WDPP 4D71A 3ARPA 1E73M 3PTKA 4Q7NA 4W7VA 1GOQA 2WHMA 3WD2A 3VX0A 1Q4NX 4UQDA 1C91A 1OB0A 2A3BA 1WP6A 3W26A 1VEOA 2UY2A 4ATDA 3MMWA 2XYLA 1BVNP 1QBBA 1HL8A 2WMKA 2WMIB 2WWCA 4HOWA 3VD7A 2CIPA 2J77A 1IV8A 3SCWA 3N13A 2DSUA 2B31A 3WF0A 1HKMA 3AXXA 4W8LA 2FH8A 2GSJA 2XWDA 1RD6A 2CESA 1B9ZA 1E3XA 4HMCA 1NOWA 2PBOA 4PN2A 1CGUA 4U2YA 4H04A 2FHCA 4CU7A 1JAKA 1BTCA 1AQHA 5IFPA 3MO4A 5LA0A 2X2YA 4U31A 1K9DA 4MJ4A 2WBGA 3VNYA 3NYDA 1KGXA 1XYZA 4U33A 1KQZA 4HMDA 4UFJA 5IXEA 4OBRA 3ALGA 4HOXA 1W1PA 2WCGA 3VINA 4C7FA 1ITXA 2GJXB 3CUFA 5E9AA 4TOQA 3U7BA 1BVZA 5CJ5A 2O9TA 1J0KA 3AQUA 1CEOA 4WLCA 2JFEX 3FAXA 2O9OA 2XFFA 4BF7A 4QCFA 4W86A 1LG1A 3VNZA 1EO7A 5A8OA 1E4LA 3G6LA 3AS3A 1AQMA 3APGA 3WKZA 3CO4A 2XIIA 1BFNA 2J7HA 1VAHA 3VIFA 4W87A 3OGRA 4M81A 2WVSA 2A3HA 1M7XA 2A3AA 3OLIA 4XX6A 2QMJA 4ACYA 1KQYA 3GNRA 2G4FA 3BCFA 3O6AA 1CYGA 4HPHA 3UR7A 3VUPA 2ZOXA 1MW1A 4QLJA 4Z2JA 1UH3A 4BQ3A 1KB3A 1EGZA 1RH9A 4PSRA 1M01A 3WDIA 2OYMA 3VD4A 3VIKA 1RPKA 4BQ2A 1ZBVA 4AZ7A 3VIHA 2WM0A 1W1YA 2OSXA 5I5RA 2BY1A 4OJYA 2VMFA 3CZGA 3ARTA 1KXQA 2DSZA 1E15A 4H8UA 1ITCA 1GQLA 2W91A 3CUJA 1E3ZA 3GH4A 5BXTA 4U5IA 4MNLA 2YA1A 4AZ6A 2BHZA 1ISWA 1UKOA 4KH2A 2YLAA 3UEQA 5EFFA 2HISA 6TAAA 1KBKA 4GPNA 2ZX6A 2ZUSA 3RM4A 5I6SA 2VO5A 3MV01 4PTXA 1ISXA 1BYDA 1CLVA 3IANA 4J3UA 1HIZA 4FF5A 1V0KA 5HOSA 1V0MA 4UOQA 2YDRA 1H0IA 1H1NA 3WDJA 1W3HA 3POHA 4KRUA 4AC1X 5CLTA 1LJYA 5EFDA 1IZJA 3DHPA 1W1TA 3OB8A 1ESWA 1EHAA 5CXPA 2OYKA 3L4YA 4GXPA 1L8NA 3AZRA 5A1AA 8A3HA 2J7DA 4TX8A 1JD7A 2YDQA 5CPTA 1GQKA 3A3HA 4IM4A 1UR0A 3RM9A 3PZGA 4MNKA 1W1VA 1B1YA 3BLPX 4PCTA 2YL5A 3BMWA 4CCDA 4PUDA 3VIIA 3FHAA 3FNDA 1L0PA 2VTFA 1KBBA 3VD9A 1E6NA 4GQQA 3L4TA 4MNJA 1J0YA 3G6MA 4PBGA 2EPLX 2J8GA 1TMQA 1GPFA 1E5NA 4U5KA 4ZE4A 4WIWA 2WLYA 1UWUA 1DWIM 4OZOA 3VVGA 1C7TA 3WH9A 1W9PA 5FKYA 5DF0A 3AYSA 3SUVA 1JGIA 4WSJA 3GXMA 3VDAA 2XPKA 4JAWA 4WF7A 3WEMA 2TAAA 1WDRA 2VZSA 4OBSA 3PHAA 5EBAA 5A6AA 4EK7A 2ZXBA 3UG3A 1Y7VA 3WF2A 1R7OA 3O9NA 4ATWA 3SCQA 2CBVA 2CITA 2J7CA 2ZX7A 5D9PA 3BSHA 1ODZA 4CCCA 1NM9A 4PMZA 1W9XA 4V2XA 2WVVA 1UH4A 4HPGA 5BXPA 4OOUA 1QVBA 2J75A 4E4PA 2UY4A 3K4DA 2W5FA 1HJSA 2J78A 2E9MA 4UQBA 1DWAM 1JIBA 1UR1A 1EDGA 1VENA 2XG9A 1WAWA 4JCMA 5HXMA 1WCGA 1H41A 1J0IA 4CN1A 5FL1A 1HJWA 1ZBCA 4H7VA 5EMYA 1EOMA 1WO2A 3AHXA 5CG0A 4AD3A 4H41A 2PBGA 1BHGA 2E4TA 2VVNA 3B9AA 1QNOA 2VZUA 4NI3A 4B9ZA 3OG2A 1XH1A 3PZMA 1M53A 3M07A 5DT7A 1XYFA 3QGVA 4PMYA 2YBUA 2DQXA 2PI6A 2WSKA 3EDDA 1B31A 1OGSA 1XSIA 1W3KA 3GZAA 1HNYA 2XJ7A 5A2AA 2WVVB 4L4PA 1OIMA 4UFKA 4IPNB 1Q6GA 3TTSA 4EKJA 3IJ8A 3A47A 1I1XA 3ZIZA 3FHQA 7TAAA 2GFTA 1JDDA 4JFUA 2VCBA 4J3WA 4AZBA 3GM8A 4DM1A 3AZTA 1RP8A 3L4XA 3LPFA 1LL7A 3I3EA 4GQRA 3MMDA 3A4AA 1JXKA 2EPNA 3WQWA 3ARXA 2J74A 1E6XM 2A3CA 2WC3A 2DT1A 1CZ1A 1UZ4A 3TP4A 1C7SA 3EYPA 1MXDA 1B3ZA 4LYPA 1W9BM 3L2LA 4QDMA 2EXOA 4UQ9A 4GZEA 2JIWA 1AMYA 1JZ5A 4AWEA 1TA3A 5AC4A 4TTUA 4CD6A 1BAGA 1TE1A 3RJXA 2EPMX 2DSKA 3B8SA 1F4AA 2BFGA 2Y8KA 3WQ6A 3AIWA 3W25A 3M46A 3RPMA 2VZVA 1Q6FA 2VQTA 3SURA 5I79A 1E0XA 1H4PA 3VX1A 4MB3A 2PF0A 5CPQA 1XSKA 1UKPA 3L4UA 4PTMA 1KXTA 1QBAA 2BVYA 2D23A 3AIBA 1B3XA 4FLOA 3OGVA 4IPLA 1KGUA 4AZCA 4OOZA 2NT1A 1OCQA 5E6ZA 4MB1A 1O7AA 2F2HA 1WPCA 1HJUA 3VILA 1EO5A 3TTYA 1PIGA 1WB0A 1O6IA 4EAMA 3ZJ7A 2XSBA 2DH2A 4P7OA 4AD1A 2G3NA 1UYQA 1HJQA 4UNIA 2J25A 4JFTA 3WQ4A 1TA3B 3EDFA 3KL3A 2XIBA 6CGTA 2VZOA 2CNCA 2XVPA 3VM7A 1WDPA 3AMGA 3ZM8A 4WK9A 1KCKA 2OWXA 3MV11 1UD8A 1V6XA 3VD5A 1PIFA 2DH3A 3T0BA 4S3JA 5JIPA 4HU0A 5LA1A 3U5UA 4UFMA 2C8NA 1VJSA 5JIWA 1EQPA 4HZ8A 4CU6A 2OSYA 5DO8A 3CZLA 4BZYA 3SCVA 1HJVA 1GQIA 1SMAA 1HJXA 1R8LA 4YN5A 2WZIA 1ZU8A 4CCEA 1CXLA 5C8BB 3MANA 4HU8A 2W67A 3NDZA 4AZCB 3AIUA 4XB3A 2DIEA 5JBDA 1XHGA 1JNEA 4PUEA 2CCRA 1V3JA 3JUGA 1US3A 3MUAA 2WW5A 3QHNA 2NT0A 4WKFA 2NW0A 2F8QA 1H49A 2C0HA 1DWGM 1BYCA 3W6LA 1G01A 4JFVA 1G9HA 3KL0A 1GOWA 2XFYA 2QF8A 3CZKA 5EB8A 3WUFA 3K8MA 5CSUA 3WF1A 5GNXA 2BNJA 3AHVA 1JZ6A 1FHDA 2D0HA 1J9YA 3T2OA 3AI0A 2J7EA 5A6BD 2X8RA 4PTWA 4FLSA 1JDAA 2BHYA 3AXIA 2G3JA 4CKQA 1GQJA 1GZJA 3N11A 1BGGA 2XVNA 4V28A 3KL5A 3WD3A 3AS0A 3NCOA 2PWHA 3VGHA 3WNNA 5I78A 4E8CA 2VQUA 1QOXA 4LX4A 4ML4A 3WF3A 4ATLA 3AXHA 4AZHA 5A8PA 1PAMA 4W93A 1CXFA 1HP4A 5I2UA 2D0GA 4MAVA 2FGLA 1E6PA 1VB9A 5BYWA 1BYBA 1HKJA 1E4MM 3AIRA 5AYBA 1IZKA 1MYRA 2VX5A 3OZOA 2E0PA 4D6GA 4M82A 3CZEA 2Y2WA 5I0DA 4AY1A 3ARWA 4RE3A 4WKAA 3GBDA 4N42A 2XVKA 3QHMA 3AS1A 1UD2A 4H8VA 3PZTA 3D5HA 1VFOA 5FL0A 2CYGA 1H5VA 3AHZA 1GJUA 3WD1A 2C7FA 4GZJA 1KGWA 2NSXA 2VX6A 1HVQA 3MUY1 1E9LA 1VFUA 1H11A 1V3MA 4P8VA 4OIFA 1E72M 3VDHA 3L4WA 3EDJA 3PZ9A 1UH2A 1QW9A 4GI6A 3DC0A 1ISYA 4WJXA 4QCEA 4H8HA 4UOJA 4PRWA 5FOOA 1C8XA 1LG2A 3WELA 2ZX8A 1OIFA 4JFWA 3AIQA 1SYTA 3WH6A 1UHVA 1TCMA 1XGZA 1CGXA 1GONA 1FH9A 4HP5A 3VGDA 3EDEA 4KMQA 1E70M 1E4NA 3T0DA 3WDHA 3OGSA 2UWFA 3B9DA 2VL4A 4DUXA 1A3HA 3HMCA 1CGTA 2DEPA 5D9OA 2XVGA 3WUGA 4GINA 1HF6A 1I1WA 2EBNA 4OUEA 4AMCA 3AMDA 3GNOA 4PCSA 1TG7A 3M7SA 3VU2A 2XUCA 3SCSA 1QHZA 1W2PA 4MTVA 2BY0A 4PMVA 3N12A 3FXYA 3WENA 2WMFA 4H2CA 3AMCA 2WPGA 4HOZA 1K9TA 2WSPA 1JNDA 1EHNA 1NOUA 1P6WA 3NUKA 3DYMA 2BS9A 2EPOA 2J7FA 5FD0A 5BROA 1UD3A 3L4ZA 3WH5A 1GOIA 5E09A 2ZUMA 5ABHA 2GJRA 2GDUA 1HXJA 3WMCA 1XC6A 2AMGA 1VFMA 1HKKA 5BRQA 1E6QM 1NP2A 4LYRA 4B16A 3CIVA 4D1IA 2VX7A 4TXEA 4DWSA 4J3SA 1CENA 4X0NA 1KR1A 3UETA 4NSBA 4W5UA 2WAGA 4CD8A 3ZSSA 5ECUA 3W4RA 4IUGA 4JKKA 5BRPA 1NWSA 1JF5A 2BXZA 3PZNA 1FOBA 3CBWA 3CHFA 1QNQA 1V03A 2VI0A 4J28A 3TOPA 2MANA 4J7RA 2V5DA 3ZQ9A 3VMOA 1B30A 1OGGA 1VBUA 1UUQA 2WKLA 4W5ZA 4CVUA 4YHGA 1MXGA 2VOTA 4UZSA 3PTQA 3F5LA 1H3GA 3II1A 4URIA 2VC9A 1PX8A 3SCNA 3ZR6A 4P7LA 2E3ZA 2OWCA 4PSPA 1FP9A 3N18A 1NH6A 1SMDA 2D20A 2IXVA 2VT0A 3N9KA 5A3HA 1EDTA 2G3MA 2WVUA 4DWSB 4LYQA 2VNCA 1ZJBA 3PTMA 4AYSA 5ABEA 3A4XA 1HL9A 1UA7A 1MQPA 2PWEA 1UKTA 3VGEA 5HBFA 1EH9A 2D24A 1JI1A 3AROA 1OGBA 5CGTA 4CD7A 4DWSC 3LMYA 1BLIA 1WNOA 1ECEA 4HA4A 3K8KA 5CQ1A 1JZ7A 3VMPA 1GVIA 1QHOA 1E55A 1R86A 5BXRA 2X05A 1LF1A 2WHJA 4PMQA 3VDCA 1U33A 3WBEA 2OLHA 4ZE5A 4D6EA 2ZX5A 4P8XA 4TTGA 3W38A 3I3DA 4M8UA 1NWRA 2GK1A 2XVLA 4UFHA 1C93A 4F66A 1D2KA 1FP8A 1MVYA 1DWHM 4RE2A 4Z2GA 1V3HA 3TONA 3L2MA 4KRTA 2YDSA 3F5KA 5IHRA 3N15A 3MUZ1 1EA9C 3TTQA 1V08A 3O2LA 3OA5A 4AZGA 3UG5A 1CGVA 3EBVA 4WKHA 3ZMRA 1N82A 4JKMA 2ZWYA 3CPUA 1BYAA 5DFAA 5LA2A 3K1DA 3ZT6A 1LWJA 4CUCA 2VURA 1G5AA 1B90A 1E56A 1FH7A 2BVTA 3VO0A 3T08A 2EJ1A 3A4WA 2IXUA 1OT1A 5A6JA 1VF8A 2D3LA 3SCPA 3UERA 5CZKA 2CPUA 1XH2A 3IK2A 3MSGA 3ZT7A 2YA2A 5C71A 1XD1A 2GK1B 1UKQA 4BCEA 4J3TA 5DT5A 2QPUA 3AMKA 3BAJA 4Z2IA 1ODUA 3ZO9A 1I75A 3WNMA 2X09A 3VPLA 1EXPA 1OD0A 2RGLA 5D9NA 2QMKA 3ARRA 1E0VA 4LQ1A 4HMEA 3BAWA 2ZUUA 1HX0A 3S6TA 2ZXQA 3GNPA 2J47A 5A6MA 1FA2A 3RO8A 1JXJA 3PZVA 3N1AA 1CGWA 2WXDM 1IT0A 5A2CA 1TVPA 1CWYA 5FIPA 1W2VA 3VGFA 2WHLA 4JL1A 1EOKA 2VZTA 1H0GA 3ARSA 4GO8A 1JF6A 2J7BA 3ARUA 4AEEA 5A95A 1XCWA 1VFFA 2VJXA 2WZEA 2Y4SA 3WBAA 5BCAA 2VR4A 1JZ4A 1CXHA 1U2YA 1CECA 2QHAA 1NP0A 5KZ6A 2F61A 2WMGA 3ZR5A 4B3LA 3SCRA 5DMYA 3BAYA 2DT2A 3GYCA 4PEEA 3RMEA 3S2CA 1PBGA 3MSDA 3UG4A 2BY2A 3AZSA 2WANA 4MB4A 4AISA 1UD6A 1NQ6A 5IDIA 1G1YA 2E9BA 4ACZA 5A8NA 4AD4A 1DEDA 3VGGA 1YHTA 3FW6A 3SUSA 1CPUA 4QLKA 3I3BA 2XFRA 4RL3A 3WEZA 4AZIA 3A6OA 2ZUNA 1MQRA 3AIEA 3K4AA 3AS2A 3T2QA 1FFQA 4D6DA 3RJYA 4A4AA 1K9FA 1B3WA 1QNSA 3WUBA 5A6SA 1ISVA 1E4IA 1CDGA 3AHTA 4Q22A 1CGYA 1W32A 4UOZA 3K8LA 4GI8A 4D6FA 3WUEA 1QNRA 3AMLA 4FK9A 3W0KA 1J0JA 2J62A 1E1FA 3KE0A 3SIMA 2D0FA 1UWSA 2YJQA 3AJ7A 3PZOA 1KXHA 4XZWA 4UQEA 4U2ZA 2DT0A 3WNKA 5IFTA 1Q6EA 2X0YA 1UD5A 2UY3A 1JZ3A 4AEFA 1UR2A 1CXKA 3KZSA 4HTYA 2XHYA 1UKSA 2WKGA 3BC9A 4ACZB 3WSUA 1EQCA 2CBIA 5A2BA 3SCTA 4NF7A 3HU7A 2D2OA 3AFBA 4J3VA 4DM2A 3L4VA 3CH9A 3UR8A 5FCZA 2JIEA 1TFVA 4ZENA 3WDQA 1XV8A 5D8ZA 2W62A 1ZL1A 1V0NA 1GOMA 1VJZA 3SCOA 2FHBA 1J01A 1ZBKA 2G8ZA 2PB1A 1MFUA 2WK2A 5M5DA 4MNMA 1LL4A 4HA1A 1KFWA 3ECQA 1MWOA 2RGMA 1QI3A 3THDA 1Z32X 4BA0A 2DIJA 3KEHA 3NJ3A 2YBTA 4W8AA 5E70A 1CIUA 3OLEA 3RIKA 5M3WA 2D22A 4V27A 1VBRA 4UZUA 5BXSA 1PZ3A 1RP9A 4CGTA 1W9UA 3CTTA 1DWJM 2GDVA 4N0RA 2ESCA 3W53A 4KGLA 1GVYA 4F9JA 3F5JA 3NSXA 3DYOA 3GTNA 1WDSA 1JD9A 1C8QA 4LGXA 1NOFA 2FDMA 1DP0A 1ZBWA 2A3EA 3EMCA 5GNYA 4X0VA 9CGTA 4JIEA 1S46A 2VVSA 3W37A 5F7UA 3F4VA 3WFZA 1GORA 3WMSA 4EANA 1JFXA 2OSWA 5M03A 3BCDA 3TA9A 4UTFA 2GUYA 2GVYA 1V3IA 4MB5A 4MADA 2WC7A 4D6JA 2D1ZA 3AHYA 3DHUA 1E71M 2ZXDA 3GXDA 5GQBA 2QV4A 3BLKA 1C92A 4U3AA 4P7QA 1V0LA 2ZIDA 4A3HA 4UFLA 2X1IA 3WD4A 4Y7EA 3BAKA 3RILA 2CETA 3NSNA 3GDBA 4JHOA 2E8ZA 4F79A 3PZUA 1DHKA 3VGBA 5LYRA 2CHNA 3IAPA 2BY3A 3DYPA 2DPEA 3AOFA 1JYXA 2GJXA 3VDBA 2BV9A 5I24A 1JDCA 1D3CA 1JFHA 1LQ0A 2AAAA 2XM1A 5GPRA 2WB5A 1TR1A 2CBJA 4CN4A 4ZXOA 3CHCA 3OZPA 4NRSA 4UFIA 2JF7A 4XV0A 2ZXAA 3WNLA 1JL8A 3W24A 3CHEA 3CMJA 3VD3A 3WH7A 1US2A 4HZ7A 1TVNA 3CUHA 2JE8A 2ZUWA 3WF4A 5KEZA 1GJWA 4EE9A 4B9YA 3OBAA 3WY1A 1V02E 2XM2A 4ZEPA 2EQDA 1QHPA 3LPPA 4ZFMA 5GNZA 1HT6A 2VRKA 3VKKA 1UR4A 1QI5A 1BG4A 4W8BA 2AOSA 4XZBA 1W9DM 2WWDA 1JAEA 2BHUA
chains in the Genus database with same CATH superfamily
2DSWA 3H22A 4F3HA 5FEWA 1EFZA 3BJSA 2X16A 4HSHA 5G4EA 4D6CA 1FWJC 2W63A 3LN3A 3H2FA 1AFSA 4PH6A 1RVGA 2P0OA 7REQB 2TODA 1E0WA 1FH8A 3TSBA 2NQZA 4H01A 3GXFA 2CKSA 1J8VA 2WYSA 6ALDA 3PPGA 2JGQA 2YGYA 1A5UA 1U22A 1EWDA 5A6KA 5AY7A 2Y5JA 4CN6A 4XVEA 4RXGA 4F8XA 4F2BA 4E6MA 1IF2A 2P5NA 1GKQA 2YCJA 1PO9A 3A3WA 2CLKA 4Z1BA 1ZLPA 4R3UA 1NAL1 4FHAA 2E09A 2FZNA 1WZAA 1BPLB 2FFCA 1GHSA 4ZO9A 2DT3A 1XRVA 3PWIA 4NKCA 3W70A 1GOOA 1TYGA 2V5CA 2HK0A 4B5TA 3RM8A 4NUWA 2I7GA 2V68A 4UTUA 1HKVA 1E6ZA 4JDYA 3GTHA 1O5RA 3SN0A 1Q6CA 1EKOA 4GGHA 2VGBA 4UQAA 2DGAA 2OELA 4CD5A 2QUVA 3NTYA 3MU7A 4CU8A 1NTHA 4XD3A 3CZ8A 3S2JA 3S1GA 3BDKA 1AD1A 3DG7A 2BX7A 4B2DD 5AOUA 1XBXA 3SAZA 3B97A 3FY1A 3LCIA 1ZNNA 1PZ2A 2W9MA 3GG1A 3STFA 3N9RA 4B3ZA 5TF0A 1TUXA 2FPYA 2XIJA 3L23A 2X0HA 2ZRVA 1ZY9A 4YTSA 3OLGA 2JF6A 3VNJA 2Y7DA 3SUTA 1W91A 4M6VA 1E43A 4BKNA 5BU9A 5IBXA 1KBJA 3GIYA 5G1MA 3ZZ1A 1FWHC 2O56A 1SFSA 4GNJA 5DRCA 5CPSA 3W2KA 5DEZA 1AVAA 1EJXC 3EOEA 4FAMA 4RDYA 4NRRA 2ZWZA 5JXQA 2ASHA 3P8JA 1DJIA 4Y2WA 5A8MA 8CGTA 1UR8A 5M17A 1ISZA 2OCZA 1TPFA 2PC4A 3TFCA 3D6NA 4DLMA 3W29A 3POCA 3GD6A 3CL7A 5CG7A 4GKTA 2GGHA 4Q4MA 3WNOA 2PTZA 3GBEA 4QQ3A 1SU5A 5EYWA 4QG8A 1W1B1 1I2QA 1H7RA 1KM4A 4Q8NA 1DORA 2F7FA 2HVNA 3FEMA 4WDTA 4NZJA 3RLUA 4BS0A 4P8WA 1NDVA 2Z1KA 3RRXA 2FIQA 1FRBA 2YL8A 3QXBA 1BTMA 2YPIA 2RJGA 3CL6A 1E6RA 4ALDA 2YKKA 2E6FA 3DFTA 2CHOA 1A0CA 5ABFA 4WJEA 3W76A 4LPCA 4AWSA 3W28A 1UWQA 4AU0A 1H7OA 2H8ZA 5LNRA 3SM0A 2MNRA 5KSWA 4OWGA 3NM3A 4HPXA 3WJWA 3TR9A 3PP7A 1Q13A 5H1WA 3A9IA 4IIGA 3E1F1 3K4WA 2BVWA 3ZJKA 3SN1A 2Y8VA 3JZUA 4Q4RA 3PBUA 2W61A 1TPUA 5AKQA 5D9MA 1JCXA 2OLAA 2CXEA 4HHLA 4AHQA 3U5YA 1JI2A 4WSHA 1W3LA 2CKRA 3LTYA 3OVPA 1FQ0A 2CZFA 1M03A 1Z48A 1ADOA 4M51A 4INFA 4JN6A 2X30A 3Q2DA 4DWSD 2QCLA 4O0QA 4HCDA 1BF2A 3PUDA 5AC6A 4O0KA 4K38A 4GY1A 1VIWA 3LCHA 2VUYA 1EC8A 4MJZA 3UESA 2ALDA 3FLUA 3NL2A 2TSYA 1YDOA 3NQVA 1FWCC 3HURA 3CMGA 3KX6A 4EVZA 2G41A 3OVGA 4GIRA 1R3YA 4W88A 1XLHA 2ZRYA 4J27A 3ABQA 3P93A 2RJHA 4IISA 4AD5A 2YDAA 4QX4A 3VC6A 1G94A 3LCGA 3ITVA 1F61A 4XUYA 5LNWA 3WL1A 2I1OA 1PYFA 2ZQ0A 4S1FA 4HU4A 2BXYA 2CBUA 2QVHA 4LANA 3WQ8A 2PF8A 1IGWA 2OQYA 2X40A 2FJUB 4QAWA 4A29A 5A69A 4RKAA 4I5XA 3ARVA 2ZTJA 2AAMA 1KWKA 4PMNA 4O1CA 2P8CA 2J6VA 4DVOA 4PB5A 1ONEA 3EPMA 4UNKA 3AIVA 3W2LA 3BGAA 3W27A 1GUVA 4NZCA 1TPC1 3BAIA 1XLCA 5TIMA 1EZWA 3ITYA 4H8NA 2CC0A 3UQNA 1QPKA 4OKDA 1XIFA 2AGTA 1MQQA 1WDQA 1YNQA 1MRAA 3QY6A 1F6PA 4AVNA 3VIMA 1UD4A 2C13A 3OBEA 5LXEA 3QW3A 1SR0A 1N2VA 4MDOA 4NNCA 3FX4A 1GYLA 1VFTA 3GTFA 3TXZA 5EMJA 3EKZA 5DMLA 1PE1A 2J8FA 2OWWA 2PWFA 4KGJA 3W7RA 1QRQA 4NJHA 1JQVA 1I8JA 3QTPA 4DBDA 1QW8A 2B7NA 4EF9A 4UC5A 1RQEA 3KOFA 3RCNA 3U4FA 4EPBC 2WJDA 3K1GA 3R43A 2VCAA 4H83A 4DPQA 2WCAA 2VFDA 4S39A 4V1YA 3PY2A 5I3KA 1DTNA 5IHSA 3KWXA 2FGZA 3L12A 2HROA 3DGRA 5I3JA 1TQXA 1HO4A 3CTLA 1I9CB 4PMUA 1J0HA 4FS9A 2DZBA 2IMRA 5HULA 3GAYA 1SFLA 2PLKA 4YCOA 1VEPA 3DIPA 4S3KA 3UCDA 4D8AA 1GW1A 2J9ZA 4MLRA 3WNPA 3CV2A 4FX6M 1HN1A 4DZHA 3WD0A 2W66A 1HZYA 4Z2HA 1R30A 4HN4A 3WLQA 1EJTC 3WJYA 2PURA 1OX5A 1S5WA 3RCMA 3VFCA 4GQ0A 3IAQA 5I09A 2PDUA 3B8IA 3LV5A 3WEOA 1HUVA 4JCLA 2DW6A 1HKWA 1XQLA 1T5AA 2CLHA 4N6EA 4TVCA 3H70A 3GHUA 3N29A 2C79A 3MW7A 2UBPC 3GKAA 2WSYA 4GBDA 2C15A 4W7VA 4TR9A 3IVSA 4LUSB 5FF0A 3BGGA 1PKNA 5L6UA 2UY2A 4GX8A 3G0SA 2POTA 1Q2SA 2WMIB 3VD7A 2X7WA 2FYMA 2V67A 1ONWA 2DORA 1WBJA 2DZPA 4GOAA 3AXXA 4W8LA 1RD6A 4MOZA 4G7FA 1S38A 2ZZ6A 4DBSA 2R6OA 1B9ZA 4HMCA 4KCUA 1NOWA 1XICA 3GC5A 1TIWA 4H04A 4HNNA 4OBTA 1MEHA 1A53A 4V33A 4CU7A 1BTCA 2D2JA 3W7HA 4MVAA 3MO4A 1OC7A 4MJ4A 2NVDA 4Z1AA 5FJPA 4L6DA 2Q01A 4U33A 2OTDA 4ERIA 1XGEA 1XYBA 4UFJA 4H9XA 1DIDA 4OV4A 1EJWC 1ITXA 2GJXB 4Z1CA 5DRIA 5E9AA 3E38A 2PFHA 1J0KA 1F05A 4WLCA 3H2OA 4AG0A 3FAXA 1F6KA 5CZTA 1LG1A 2FZ8A 5C9RA 3G6LA 1MUMA 3EWUA 1PDZA 2OEJA 4HCHA 3NVDA 3OGRA 4M81A 2QCHA 5K7JA 1Z41A 3C3UA 3OLIA 4AMAA 1KQYA 2WQPA 1VCVA 3C0LA 1MW1A 3KLKA 1EPXA 4W9TA 4QLJA 3THUA 2XIMA 4BQ3A 4DJDC 1O68A 3Q58A 1JDFA 3W7OA 4PSRA 3WDIA 1BSLA 2PCQA 2PDCA 3GTXA 4NX5A 1A3WA 4LW7A 5FA5A 4S3CA 2IPWA 3GG8A 4H8UA 1GQLA 4IMFA 3VKAA 5CC6A 3M5ZA 2JKPA 5BXTA 3B3DA 4AZ6A 2BOGX 1ISWA 1UKOA 4KH2A 4E2DA 3SJNA 3E96A 5HUPA 5GJNA 3MV01 4JQ1A 1OY0A 3F2DA 2Y89A 1BYDA 5DLCA 4IIHA 3PBYA 5HOSA 3S46A 4UOQA 1H1NA 4KRUA 2OODA 4REQA 3H55A 5F2IA 3N2BA 5DY3A 1LJYA 1AMKA 3MVIA 3TZNA 5RUBA 3CAQA 3HGSA 4GXPA 3W86A 4Y8FA 1Q45A 4M6QA 1L8NA 3AZRA 5A1AA 3C2OA 3LGGA 1MEIA 4TX8A 4IJRA 4QS5A 4GQGA 3L5AA 3W7EA 1GVEA 1XLIA 3T05A 2TYSA 3PZGA 4MNKA 1B1YA 1TREA 3KDNA 2C6QA 5D30A 3M0VA 3TQKA 2XSXA 3MDUA 3FHAA 2VTFA 1KBBA 1A3XA 3G1FA 3VD9A 3L4TA 1QT1A 1PVNA 1OADA 2J8GA 1TMQA 4JN8A 1GPFA 1JUKA 1XS2A 3ZVHA 4O50A 4OZOA 3EX3A 2FZ9A 3M4HA 4XZMX 2XPKA 2Y63A 4Q4QA 3WEMA 2VZSA 2PTYA 3PHAA 5A6AA 2ZXBA 4J3ZA 3V3WA 4J4KA 3W1UA 3UG3A 3OPSA 1VH7A 1CB2A 4Z1YA 3O9NA 7ENLA 4BJHA 3W84A 1EZ2A 5D9PA 1CX9A 2QAFA 3H2AA 3MPGA 1Y5VA 4XZ9A 4GCXA 1TTJA 4GWEA 2PDFA 2PU1A 5F1UA 4HCLA 4HYRA 3GX9A 3TJXA 2A4AA 2UY4A 4L9ZA 3K4DA 1HJSA 2J9XA 2J78A 5G2HA 1JIBA 4RNIA 4IGMA 1LDCA 4JCMA 3R8RA 5HXMA 2Z27A 1J0IA 5LHFA 4CN1A 4DNMA 4HN8A 2RFGA 5EMYA 3UF9A 5HNTA 1WO2A 3OO2A 1LT7A 2PBGA 4JTIA 4JN7A 3TOYA 1DJWA 4LV4A 4NI3A 1F3TA 3OG2A 1YX1A 2HS6A 3BPWA 3LM7A 3M07A 5DT7A 1N8IA 4C6KA 4PMYA 2YBUA 4FALA 2WSKA 4WY0B 4EP8C 1OGSA 3IIOA 4JBRA 1HNYA 1GEQA 4DAFA 5A2AA 2QJIA 4L6OA 2V0TA 4IPNB 2PTDA 3KCLA 3VI2A 3IJ8A 4JIQA 1A5MC 5FSEC 3LQLA 3T1GA 2GFTA 2HXTA 3W01A 1JDDA 4J3WA 4M1BA 3GM8A 3AZTA 1REQB 1NF0A 3TK7A 1LL7A 3BW3A 4C60A 2Y5SA 3OTRA 3W85A 2Y7EA 3NEVA 4MY8A 1EYEA 3MJYA 2J74A 2A3CA 2WC3A 3SSZA 3TP4A 1UZ4A 2GGIA 4UTTC 1B3ZA 3WLMA 5C7HA 3L2LA 2EXOA 1LTDA 4HPNA 2JIWA 2Z7KA 4UCGA 4NQ1A 1XLLA 5AC4A 4B5SA 1BAGA 1TE1A 3M0XA 3MC5A 1F4AA 3ZR4A 2Y8KA 3WQ6A 1W5PA 2DP3A 3RPMA 2OO0A 2CLIA 1YEYA 1Q6FA 2GGGA 3O6YX 1H4PA 1KFEA 2PF0A 3PBVA 4IH3A 4IFOA 4NAEA 4MM1A 1B3XA 1QWKA 1FWAC 1T8QA 1X1ZA 2F2HA 4R9OA 1WPCA 3U2ZA 1PIGA 1WB0A 4EWND 4Y90A 3M0JA 2DH2A 3W1NA 3ATZA 4UNIA 2J25A 2EKGA 4GVHA 4JFTA 5AYZA 1TA3B 3UPWA 4MFEA 2BODX 3H26A 3IIVA 4J2MA 1EJRC 1ZAHA 2CNCA 3BK0A 3VM7A 3AMGA 4H2HA 3B8TA 3MI3A 4WK9A 4O1FA 4JIIX 3VD5A 2DH3A 3PNZA 1A5AA 4O1DA 1OFAA 4LOCA 3U5UA 4A3RA 5C9UA 1NDYA 2QJHA 2VGIA 2C18A 3VNDA 5AHFA 1ICQA 4BI6A 4LS1A 4CU6A 2OSYA 3W1PA 3CZLA 4I6VA 1SMAA 4QQUA 3SB0A 4AY7A 1R8LA 3GU9A 4I9MA 2VM8A 4AZCB 3VFLA 1PHWA 4HMNA 4XB3A 3I7SA 4R33A 4XBSA 2KAUC 2CCRA 3JUGA 3R10A 3UZ5A 4HIBA 3L5LA 2NT0A 3PPCA 4IFRA 4GGBA 2TRSA 2OZ8A 2C0HA 4LS0A 3W6LA 1G01A 4IF2A 4I5UA 1S5MA 1GOWA 2XFYA 5EB8A 3WUFA 3N4EA 4IWWA 1KTBA 3OHMB 2BNJA 2CLLA 2VFGA 4DPPA 3V5OA 2ABAA 2D0HA 1GW9A 1NIUA 3KTXA 2HSAA 3DFNA 4LALA 4LF2A 3DFOA 3AI0A 3WQEA 2PDHA 3EB2A 1Q6RA 3MP3A 1GZ1A 1PZ1A 3AXIA 1GQJA 2GWGA 1A4MA 3UXKA 3N11A 1O1ZA 1F3WA 3VGHA 1BXNA 1L6SA 2ISWA 5I78A 2VQUA 3E02A 4ML4A 4QS6A 4ATLA 3AXHA 1SJDA 5AVNA 4Y9NA 3O63A 2Q6ZA 3PNUA 4MAVA 5HK4A 1E6PA 3KHJA 2C71A 1T99A 2HRWA 1IEIA 4FNPA 3CPGA 4OU1A 1X98A 4QJ3B 3CMFA 4PRTA 3AS1A 2CW6A 4NXKA 3LERA 1V93A 1VFOA 1JUBA 4E2BA 4UTMA 1H5VA 5L9FA 4B92A 1GJUA 3RX3A 5DQPA 3H53A 1E9LA 1LQ2A 1H11A 1TTQA 4OIFA 1EEXA 3L4WA 1GKPA 1W8SA 4DJDA 3PZ9A 1UP3A 4IQDA 2VFIA 1ISYA 1XPGA 3QR0A 1C8XA 4JY9A 4JY8A 1OIFA 4JFWA 1LT8A 1TCMA 1FH9A 4HP5A 2FPTA 4KMQA 2PUZA 3P60A 3T0DA 1BD0A 4N4PA 3M47A 2UWFA 2X41A 3B9DA 3M0IA 1EP1A 3UPBA 1EBHA 4R7JA 3HQNA 1CGTA 3D46A 2DEPA 3CQIA 2EBNA 4RR4A 1AZ1A 4H6RA 3M7SA 3BCJA 5M1TA 2XUCA 1J5SA 3SQMA 3AMCA 1VD6A 2WPGA 4HOZA 2BXVA 3STGA 2E6DA 1NOUA 2BS9A 2PGWA 2EPOA 2J7FA 1UD3A 3BWWA 3WH5A 3OBKA 4IP5A 2FTWA 2GDUA 3FSTA 3IUDA 1SJAA 3M0HA 3XISA 1HKKA 1OFRA 4DY1A 3RLVA 2E6AA 5DN1A 3PB2A 5REQA 4B16A 5EKYA 1RCXB 5J8LA 3MBDA 3UVAA 4CLMA 4FR6A 3ICJA 3ATYA 1Q7QA 3UXAA 4DZIA 1CENA 1RY8A 4X0NA 3H4GA 3FS2A 4W5UA 5HQEA 1XKYA 3SZ8A 5BU6A 3BICA 1OABA 1NWSA 1TTIA 2AL2A 2IPJA 4LCSA 4IXHA 2ZA3A 4C6PA 3APYA 2Y61A 4S2CA 4QRNA 3AU2A 1V03A 2VI0A 4J28A 1AZ2A 3TOPA 4J7RA 4YHGA 5AVHA 3IV3A 1NFBA 3GWQA 3V7PA 3II1A 1PX8A 3W3OA 5FSDC 2IS7A 2OWCA 3T6CA 3N18A 2YW3A 4GH1A 3B8UA 1MRQA 1MXSA 3TU9A 3U0HA 3B0XA 1EDTA 1NEYA 3M0KA 4ZTXA 5IM51 4LYQA 4WUIA 4QJ5B 2ZRWA 1HL9A 5GJPA 3H2EA 2W3ZA 4L80A 1WXJA 2Z1WA 2IKIA 1OGBA 4CD7A 1IZCA 1BLIA 4HA4A 1JZ7A 1UJQA 3IPWA 1AUSL 4RNJA 1QHOA 2ZDRA 1R86A 3NM1A 1VYRA 3O15A 3UA3A 1EYWA 1U33A 1UUOA 2OLHA 4D6EA 3LU2A 2ZX5A 4P8XA 4TTGA 4GBUA 3ZXWA 4M8UA 3LENA 2L5HA 1FP8A 2BSLA 3P0WA 4MY9A 3NQAA 1OFQA 2XH7A 3VC5A 1OHLA 3CEPA 1V3HA 1EC7A 2YDSA 4KRTA 3CUXA 3M7WA 1UBSA 1OX4A 1EA9C 4XUGA 3TTQA 3O2LA 4P61A 1Y5WA 1QTWA 3PM6A 1KC7A 1N82A 4JKMA 1ITUA 5D2WA 1VKFA 4JS3A 1WUEA 3E49A 4EAYA 2PPGA 5DFAA 4QXIA 5LA2A 2Q09A 3VO0A 2VC5A 5D2TA 4LEFA 3K2GA 4UTTA 3T7VA 3VKCA 3N34A 4CNNA 2ZC1A 3VOIA 2D3LA 3SCPA 1S2AA 3IK2A 3MSGA 3ZT7A 4LVAA 1W3NA 2GK1B 1TZ9A 4MLJA 3W02A 2ADAA 4RPPA 1VQTA 2QYGA 1QFEA 1VGAA 3AMKA 3BAJA 1EP3A 4Z2IA 1BRLA 3N25A 2A7NA 1EJSC 3U48A 2RGLA 5D9NA 4Q8VA 3QGAC 3ARRA 2ZA1A 1E0VA 4LQ1A 2CZDA 1RLDA 1FCVA 3NURA 1YW1A 2FJKA 4WQ6A 3UY7A 1Q65A 3W1LA 1JXJA 4GK8A 1CGWA 4AX6A 1A49A 1IT0A 4NIRA 3TLLA 2XU2A 4A2SA 4C5YA 4MG4A 1G4PA 1TVPA 5HR7A 1CWYA 1SW7A 3VGFA 4UTKA 4DJEA 4QG9A 1EOKA 3ABZA 3APTA 3NXFA 3ARSA 3C0JA 3GDMA 4YS1A 1K4GA 4WRHA 2X1TA 3W7QA 3DZ1A 2Q8ZA 1XCWA 2VJXA 2WZEA 1RBLA 4S3FA 1L6WA 1CXHA 1TV8A 2QHAA 5LIWX 3CU2A 4ZOCA 1O4UA 3BW2A 1UR3M 4JTHA 5DMYA 1XLDA 4GIYA 3GYCA 3S2CA 1PBGA 4MKNA 1XISA 2I57A 2GOKA 2BY2A 5TAOA 5CZJA 1U5JA 4QJ1A 1NQ6A 3N73A 2QW5A 4O53A 1G1YA 2VFHA 1X6UA 1A80A 2ZZ7A 4TU1A 2QNEA 1LZOA 3VGGA 3QRHA 1MNSA 5DMNA 3FW6A 4RL3A 2NV9A 2I5QA 3A6OA 2WSRA 3WJZA 3AIEA 2LLEA 3AS2A 3T2QA 1FFQA 2EGZA 2QUMA 3UJFA 5IRPA 2Z1VA 3T0CA 1DJZA 3CYVA 3LBMA 4N9EA 1CGYA 7PTDA 2HWGA 4UOZA 2YFOA 4D6FA 4J2PA 2PDKA 3AMLA 2YXGA 3W0KA 3RO6A 1UWSA 2YJQA 3PZOA 3E0VA 3KS6A 1AA1B 1OZMA 3F4CA 1UD5A 4DI9A 4Q8UA 1CXKA 4HTYA 1H7WA 1UKSA 1H7NA 1OYCA 3RLHA 4LUTB 4ACZB 3TSMA 1M3UA 4ICMA 4Q6XA 4NF7A 1GEHA 3AFBA 3FGCA 4J3VA 3MI6A 3SI9A 4ZENA 3CV7A 2IKJA 4C6MA 2NUWA 1ZL1A 1V0NA 1GOMA 4ZGYA 4OUIA 3I6EA 2FHBA 3DFSA 3D47A 3VCNA 2G8ZA 3PK7A 4IL0A 2PODA 2DVUA 4QJ4B 2GL5A 3LRLA 2RGMA 3KVLA 5BOOA 3FJ4A 3VNMA 3WMLA 3KEHA 3NJ3A 1EF2A 3W83A 1CIUA 1O95A 4HA0A 4CEUC 2WNQA 4CGTA 1W9UA 1RJPA 2O0TA 1DWJM 3HPSA 3SQLA 4N0RA 3O7UA 1G4EA 1YXDA 1M7OA 4JTRA 1C8QA 1GG1A 1NOFA 3E3HA 3UWQA 1ZBWA 2PWVA 3EMCA 1IEXA 5GNYA 4X0VA 1AG1O 1H5YA 4IFKB 3R8GA 2CZVA 1P5BA 4LVGA 3SADA 5M03A 2OSWA 4XAFA 1D9EA 2O55A 3V0UA 3TA9A 2GVYA 2V6AA 3TSDA 5AHLA 4D6JA 1ME9A 4ONVA 4ZSUA 2ZXDA 4MZ8A 5GQBA 4JTUA 3OIXA 4EF8A 4U3AA 4P7QA 3LMZA 3OG3A 1W3TA 4KWSA 1A5KC 1SZEA 4Y7EA 1QPQA 1Q3NA 3NSNA 3GDBA 1QUMA 5I07A 4QEEA 2SFPA 3GFYA 5CGQA 3UGRA 3S5OA 4EXQA 5LYRA 2CHNA 3IAPA 3FA3A 4XIMA 2BY3A 3MKCA 3V35A 3NA8A 1P1XA 4OT7A 2AAAA 4GUFA 1LUCB 4ZXOA 3FDGA 4R7OA 7REQA 4UFIA 4XV0A 1JL8A 2JKAA 3CAWA 3CHEA 4LB3A 1XBYA 1US2A 2HBVA 4AWTA 4C6LA 4HZ7A 2JE8A 3WF4A 2E67A 3EOLA 4HTBA 4H1ZA 4O17A 1HT6A 2F2KA 4BEQA 3KCJA 3LZ3A 4JYEA 4KFPA 4C6JA 2P76A 2BHUA 3W1TA 3OU8A 5D8WA 1FHLA 2YOCA 4QFUA 1PSCA 3FYOA 1QU4A 1QASA 2KX9A 2XH2A 3M16A 2RAGA 4ZB5A 2QCMA 3H4XA 2YA0A 3TYEA 3SIZA 3BSGA 4FEZA 3BAXA 4YWSA 2OGYA 1QK0A 4BQ5A 1VRXA 1F3EA 3TQPA 3LPGA 2FMOA 4ZO6A 4I8DA 4XZNX 1Z9AA 4H7ZA 4HK7A 2OQLA 2ZX9A 3ELFA 4JIHA 1W8GA 5MKGB 1GOKA 3P7YA 3FVMA 4E0CA 2CLFA 3WN6A 1C90A 1JJKA 2E5BA 1IGSA 4L1WA 3MMUA 4KCVA 4P7RA 1YQ2A 4HZ6A 1MZHA 1UWTA 2VC7A 1V6VA 5HDRA 4O28A 4F0MA 2YZ5A 3ZSTA 3W22A 3NL5A 5CC3A 5JBFA 3NDOA 2YIHA 2NV1A 1RVKA 2BBFA 4KEZA 2PLCA 1VFHA 2PDIA 1WX0A 1OINA 4UTJA 2PP0A 1R3TA 1JCNA 1TV7A 3W7PA 4G7EB 4C7GA 2OT0A 3RLGA 3D3AA 4RNFA 1HP5A 3WL0A 2DDXA 1Z3NA 2CWXA 5BWFA 3HG2A 2Z1XA 3TN4A 4DLFA 2ZKMX 2GVLA 1JRCA 4N9BA 1Q2RA 4NZ4A 4DZ5A 5CSRA 2P10A 3ANYA 1Q8JA 3LHYA 1X1OA 2BVDA 1KR0A 4Z2KA 4AIUA 3S2NA 4IP7A 4B5VA 5G1YA 4ZTYA 4F9DA 1SW0A 4PMXA 2BOEX 2O9RA 1Q63A 1LYXA 4YCPA 3W7DA 1V3LA 1ZB5A 4PMDA 1ZENA 3RHGA 5G4WA 3DKLA 3TYDA 4HNOA 1DL3A 3W87A 3T81A 2VP8A 3W2MA 3R2GA 4DAIA 5XIMA 4AD2A 1GKRA 3HJEA 1MW2A 4JFSA 4IX2A 2JALA 3KRSA 2GVEA 5HMFA 4FLQA 4GJJA 3G1DA 4AZ5A 4E8DA 1HGWA 1G0CA 4MKVA 3DH7A 2IUZA 1ZAIA 3INPA 1E6SM 1NARA 3RMJA 1EX1A 4UIOA 4K7YA 4C90A 4JZ5A 4WSKA 4U10A 4QGCA 2FTPA 4C5ZA 4AD0A 3AYRA 4PBFA 3ZYZA 2V3EA 3AALA 4AHPA 4JTJA 1OFPA 3WX7A 3FK4A 1WZLA 4AIEA 3QKEA 4QE1A 3W81A 5HWJA 3UWVA 2W4XA 3BJTA 2GSEA 4ZFCA 1NU5A 2EPKX 4GMEA 1GYNA 1H2JA 3PAJA 3UJSA 3ZJ6A 3CUGA 4GY7A 4UMAA 2ISDA 3VIJA 3UP8A 2PC8A 5HA7A 3SFKA 4FNTA 3GC2A 4C6CA 4LXFA 3SECA 2YX0A 5E6YA 4U3CA 1VBGA 3QN3A 3FOKA 1CLXA 1MUWA 2ON3A 2VFEA 4MPKA 3ARYA 1TTPA 4P2VA 3WQDA 2YL9A 1J18A 3RFAA 1D7FA 3PSWA 4D6HA 1F07A 4XD4A 1NWTA 1MDLA 4IPJA 2VGGA 2J7GA 3TYCA 4GZIA 1V3KA 4M56A 1Y8BA 3SUWA 3GHRA 3L66A 5D2VA 2X7VA 1CT5A 5FJJA 4LAMA 3FJNA 4PFHA 5EL1A 5A6LA 1GNXA 4GZ7A 4KERA 4YHEA 4Q4SA 3VOJA 1E40A 3ONCA 3R0KA 4QLLA 4HBKA 3ITCA 4GQBA 3LLFA 5K4XA 4LC6A 1JYNA 4GO9A 3R0DA 4DO6A 1V6YA 3B8DA 2QDDA 4H9MA 1EDQA 1EGVA 2Q8XA 3H12A 4FB7A 1B3YA 4PUUA 2YZRA 2G50A 4F0LA 1CXEA 3AICA 3V16A 2ZUVA 1RCOB 1OM0A 4Q7IA 4PTVA 1AJ0A 1UR9A 3NSMA 4F48A 2PSNA 4XK2A 1OX6A 4GIAA 4MYXA 5E0FA 2AKMA 2JBMA 3OIHA 3BMXA 2E9LA 1S2CA 1YNYA 4WOQA 1QNPA 1GQNA 4M3PA 1QI2A 1RUSA 3O8AA 3ZT5A 5E0CA 2F38A 3BH4A 5BMXA 3B9NA 1QI4A 4GUHA 1MI3A 1KV5A 5J5RA 4XAYA 1TPEA 2PDBA 4O1AA 1QCWA 1OT2A 3FA4A 3FJLA 4NYYA 4UNLA 3PFMA 5FI8A 1L2QA 3ANVA 3T9PA 4R9XA 1ZP3A 5AYIA 2OYLA 3EWWA 4DUVA 4JTTA 2AKZA 1TJ0A 3HPZA 4M5PA 1EIBA 3CIWA 2WCSA 3GDLA 7CGTA 3LCFA 2CERA 3N2CA 1XLMA 4DUWA 4C7DA 3GH7A 4C1NB 2DZTA 1NWUA 4YWIA 1F74A 2QIIA 1FHUA 3ES7A 3ZLGA 3LHVA 3BTNA 3NWRA 4JTKA 1WDDA 4UXDA 4ZCWA 3MYPA 3VCRA 4YXGA 3C2RA 4LYKA 3TV8A 1AQ0A 1MUCA 4D9PA 2IKGA 3MTWA 3BMVA 2XGIA 1MEWA 1UB3A 1M7JA 4YTRA 3NZ1A 1HKIA 2Z6JA 3SRHA 3UNTA 2QV5A 3W6MA 1FWGC 3SEPA 3IIZA 4LUSA 2GJPA 3NIYA 5CGMA 4GX9A 2QJJA 1FWRA 1O94A 3O0FA 4P8UA 1V4YA 4JKLA 4AC7C 3WBYA 1XP3A 3BE7A 3ABRA 3EEGA 3UJRA 4AX7A 2WMIA 1BGAA 2Y24A 3BZJA 1R47A 3SY8A 5AECA 4C6QA 3UGVA 1JCMP 1R85A 2JEPA 4A8IA 4LC8A 2P3EA 1MZRA 1ICPA 1CTNA 4RW5A 4XBJA 4UQCA 4DJED 3QOKA 3U57A 3ARQA 3B0YA 2GUUA 1E1CB 3PTDA 2Y1HA 3GDRA 3PN8A 3UBPC 2WC4A 2ZICA 4QNWA 3IK4A 2WLZA 4RV3A 1IXNA 2JKEA 2NQ9A 4GUJA 1G7UA 2D2HA 5HNNA 3CASA 4BFAA 2QJMA 3PTKA 3UNDA 4DJFA 3ZVIA 4GYJA 4LCRA 3BZGA 1Q4NX 2OO6A 1C91A 1OB0A 1EL3A 2A3BA 3W26A 2YCIX 4WXZA 2VEGA 2XYLA 3QC0A 2EG6A 9XIMA 1HL8A 2WMKA 2TMDA 4LRSA 4H7CA 2CU0A 4E38A 1ZGDA 1HKMA 1EEPA 3NZRA 2GOUA 3PS7A 4G56A 2PBOA 3DU0A 2Z2AA 1CGUA 4U2YA 1RALA 3STEA 1VS1A 3V0SA 4IXXA 3VOFA 4YVVA 3TWBA 1AQHA 4A6GA 4NXSA 2OOFA 2NX1A 2WBGA 3L0NA 2CHRA 4L61A 4K3ZA 1KQZA 2ONEA 1XIMA 3P2VA 3ALGA 4K37A 4UTHA 5AC8A 2WCGA 4C7FA 1I2NA 6REQA 2OZ0A 2H6RA 2V2HA 2NVCA 3HG4A 3P14A 5CJ5A 4C6EA 3C52A 2O9TA 1CEOA 1ICSA 1M6JA 3W7JA 1PKMA 1V51A 3V5CA 2O9OA 4BF7A 1QPOA 1XUZA 3P84A 4W86A 4AUBA 1E4LA 1S2VA 1YTEA 4HPJA 1AQMA 1IEWA 1BFNA 4LUJA 2HE5A 3MP4A 3W72A 3VIFA 4W87A 2WVSA 3LY0A 5D03A 1OCNA 4ACYA 3EWXA 1A50A 4JEQA 2G4FA 2E77A 3BCFA 1CYGA 1K03A 3D3FA 5ECVA 3B4UA 3KBJA 3VUPA 1WKDA 4GG9A 4MFDA 3OZMA 1KB3A 1EGZA 1F7BA 4HHPA 1M01A 4IICA 3CIXA 3USZA 3VD4A 2E28A 4R88A 1ZBVA 2A7PA 5F2GA 2OSXA 2BY1A 2VMFA 3ARTA 2NUXA 2W91A 1PV8A 1L6FA 4I6KA 1AK5A 2RDUA 4U5IA 4MWAE 1DVJA 2OR2A 1IIHA 1OC5A 4DYKA 1TJ2A 5I02A 1YKWA 1XIHA 1KFLA 5F4WA 5EFFA 3W2UA 6TAAA 1OFEA 2ZX6A 2ZUSA 1YXCA 3CV1A 1AODA 1T6MA 1KM5A 2H3BA 1GK8A 1UC4A 2GLKA 3IANA 4J3UA 1HIZA 1V0KA 1SZRA 2O7SA 2V9DA 4Z1DA 1YIXA 2VEPA 1FWFC 1RSCA 3P61A 3PPHA 4I9AA 5CLTA 4LSBA 4DIAA 2OOGA 3L0KA 3DHPA 3DESA 4CQDA 1W1TA 1EHAA 4ROQA 2R9RA 1P0BA 2B81A 3W2JA 3R11A 3TW9A 5FEZA 2YDQA 4OECA 2ICSA 1ADDA 4N6FA 4XKYB 8TIMA 2QGYA 3TKFA 4KETA 1UR0A 2PZ0A 1J6OA 4H6KA 4PCTA 4NU7A 2RUSA 2PLJA 3EPNA 2UV8G 1J2WA 3BVJA 1J0YA 3G6MA 2VELA 1I2RA 1XLGA 3GHSA 1DQXA 4U5KA 5CAHA 4WIWA 2Z00A 1UWUA 1DWIM 2HTMA 2VUNA 4H4IA 3WH9A 1KV8A 2DZSA 5D37A 5TQLA 5DF0A 3SUVA 1JGIA 4WSJA 4IMEA 5JU6A 4L6HA 4WF7A 3GIQA 1Q8AA 1Y7VA 1R7OA 4IJCA 4ATWA 2CBVA 2CITA 2J7CA 5KZDA 1I45A 2OU4A 4GC3A 4WY0A 5FAJA 1R9XA 3BSHA 3QMRA 1ODZA 4CCCA 1NM9A 3GZ3A 4PMZA 1S1PA 1KCXA 3QLDA 3LA4A 4OOUA 4NILA 4JIPA 1QVBA 1WOBA 1SSGA 4GFIA 3IJQA 3O16A 1XINA 1REQA 1UR1A 1EDGA 2OFJA 3FYPA 1IEQA 4MUZA 3I7RA 3KOXA 4PUJA 4NJJA 2FGBA 1HJWA 1WUFA 4H7VA 3CWOX 1XFBA 4IL2A 1EOMA 3AHXA 1VZWA 1BHGA 1UJPA 2ACRA 4YVXA 2GVGA 2VZUA 3SGUA 4O57A 1ZSXA 3NG3A 4JOMA 1XYFA 3QGVA 4PE8A 2DQXA 2X42A 2PI6A 4UB9A 2G96A 3NOEA 4F2UA 3GZAA 4MWAB 4L4PA 4FO4A 3TTSA 5JH2A 4RV8A 2C1IA 3A47A 7TAAA 2W79A 2QCGA 4JFUA 4A05A 1FWWA 1RP8A 3HGOA 3L4XA 3WFAA 3AJXA 4GQRA 4NP7A 3A4AA 1YPXA 2I5IA 1IIGA 3ARXA 2DT1A 3EOOA 3MKVA 3EYPA 1MXDA 1V8EA 4XISA 5AHIA 3K30A 2QCNA 1R2RA 4R34A 1WAUA 1T7LA 2J27A 4PFMA 4UQ9A 3T07A 2R1LA 4S3AA 1TA3A 2OG9A 2PEVA 2A2IA 1VJIA 2EPMX 4ZOEA 1K4HA 3B8SA 5LHEA 2BFGA 2OX4A 4PEKA 3GW0A 3M46A 3QFEA 1HGYA 2B0MA 3OZYA 3LCLA 2I9UA 2VZVA 2VQTA 3WQFA 1T0OA 5LIUX 2QDGA 5I79A 1R3SA 1PUDA 4IMCA 5C9ZA 3H23A 2W27A 3C6CA 2XDFA 5HMEA 1SVDA 1UKPA 3JVAA 3L4UA 4UR7A 1KXTA 1QBAA 2BVYA 3LV6A 2WJFA 3BV4A 4ZB0A 3AIBA 1QO5A 3OGVA 1QPRA 3AYTA 4AZCA 1K3UA 4CNPA 4TIMA 1XRFA 1O7AA 4E2VA 4Z17A 4CCZA 3SBFA 1VHNA 4XO6A 1TWZA 1O6IA 3E0IA 3LD5A 1LRNA 4EAMA 3ZJ7A 3P3BA 2QDEA 1P1MA 4ZR8A 2G3NA 3WQ4A 1XG4A 3QJAA 3CJPA 1RAKA 6CGTA 1LRTA 2WV8A 2VZOA 3KS5A 3ZLHA 2VGFA 5EGRA 1JCYA 4EXAA 5D05A 2Z26A 4S3JA 4HU0A 3TJIA 2J66A 4XD5A 5CZSA 4H00A 3FIGA 3SCVA 1FCQA 1HJVA 3XINA 3RX4A 4JYDA 3UZWA 4HGXA 3LXBA 5I3FA 5C8BB 4HZMA 5D33A 1VRDA 4MPQA 1QOQA 2NX3A 3QY7A 2YCLB 2A3LA 1R9ZA 1W1IE 4PUEA 3IS4A 1FKXA 4GJIA 3HZ3A 3QHNA 4K8GA 1XXXA 3C8NA 2NW0A 2FVLA 2F8QA 4DO5A 1H49A 5F4SA 1G9HA 5D2XA 3CZKA 4CNOA 3IIPA 4D2JA 3WF1A 5LZLA 1FDZA 3ITTA 2VKZG 2PDJA 5FF3A 3AHVA 1JZ6A 1FHDA 5HQMA 2Y62A 4O12A 4XAPA 1J9YA 1GJPA 3GNNA 4EPDC 4PTWA 1JDAA 3P74A 3LLXA 4ZB2A 3EGJA 3NPUA 2G3JA 3JZEA 1OJXA 3W74A 3BOXA 4V28A 3WD3A 3NCOA 2PWHA 2PDQA 5CBIA 4E8CA 1QOXA 4LX4A 3WF3A 3HB9A 3WJSA 1CXFA 1HP4A 4QSFA 4ROPA 3ZS4A 4JPGA 4MSSA 2WNZA 5LNUA 4QDPA 5BYWA 4HJWA 1ZZMA 3EAUA 3SJ3A 1E4MM 1TRIA 2FVMA 1O5KA 2VX5A 3DBNA 2E0PA 4D6GA 4M82A 3CZEA 4J5NA 4IP4A 4AY1A 4G2DA 3ARWA 4H9VA 3WLJA 2Z2BA 3GBDA 1BEUA 4N42A 3TMQA 4JQ2A 4B5XA 2ZZ4A 4XBKA 3D5HA 1Y5XA 3WQOA 1M41A 2C7FA 4GZJA 4JHMA 3MUY1 2WJZA 3NYZA 1ME7A 3WLTA 1KFJA 3ABOA 1B54A 1FDJA 2V82A 3EDJA 5AB3A 2Y7GA 5SWUA 2P50A 4H8HA 4PRWA 3VDGA 4G5DA 3QMTA 1LG2A 2VYOA 4PR4A 2VEMA 2ZX8A 2NUYA 3AIQA 2CWNA 2B4GA 1R6WA 2PDNA 1OF8A 3WH6A 1CGXA 2CZEA 3M5VA 3P8IA 4GYKA 4LNYA 4U28A 3VGDA 2IQDA 1L2UA 4Z08A 4NNAA 5LNSA 3JU2A 3WDHA 1VP5A 2GUBA 1F76A 4WDWA 1IEVA 3K13A 3WK0A 4KWOA 3GNDA 4DELA 4GINA 2UZ9A 1NF7A 1DXEA 2ZVIA 1X39A 4IJBA 3GNOA 1QHZA 1QJWA 1W2PA 2AL1A 4PMVA 3N12A 3OHIA 1FVPA 3R94A 2YCEA 2PGEA 2X0SA 4RLIA 5FD0A 5BROA 2ZVRA 3L4ZA 1YE4A 1GOIA 1FCBA 4OVXA 1HXJA 2DZWA 2OKTA 4IMDA 1QPNA 3SY5A 1E6QM 3GR8A 3TA6A 4WDXA 2YFNA 5CSSA 4LYRA 3CIVA 1R3RA 4RZ4A 4XTDA 4DF0A 4E4UA 1YPIA 3GK0A 4FIRA 3OQ8A 1XBZA 5T26A 3RN6A 3RG6A 1A5SA 4TMCA 5HJYA 4CNSA 5ECUA 3LOTA 3W4RA 4JKKA 3HOJA 2PD9A 3NGJA 4GXWA 3ZLFA 1UW9A 4B4FA 2YBVA 2MANA 1POKA 2V5DA 1B30A 1LOLA 2NVAA 1OGGA 1VBUA 2WKLA 1MXGA 3PTQA 4YTQA 1H3GA 2VC9A 4GRSA 4NZ5A 2E3ZA 3QQ0A 1FP9A 3TN3A 2IXVA 2D20A 3M0LA 1PB0A 2OZ3A 1TMLA 2R1MA 4LUYA 1POJA 2WVUA 4XSLA 3H2MA 2V5KA 4AYSA 4X63A 3A4XA 1UP2A 1V79A 2A6NA 1MQPA 2PWEA 1EH9A 2Z24A 2D24A 4DJFD 3P0XA 5CGTA 4DWSC 4RZ6A 1FDYA 4MYAA 3CS2A 1E9ZB 1D3HA 5I3IA 1E55A 3HQPA 1EJUC 5BXRA 5AC7A 4REQB 1LF1A 3MCMA 3VDCA 1P0EA 3HQ1A 4LVFA 4NNBA 3QH2A 3LHUA 3I3DA 4J1OA 3RK8A 5K9XA 2GK1A 4KIRA 4UFHA 4F66A 3GB6A 4KRZA 5T9CE 1DWHM 2VD8A 1V7YA 3IUHA 4WVXA 4WCJA 3L2MA 3HA1A 4ICCX 4YJ5A 4A35A 4HNLA 2R91A 3L0GA 1V08A 3OA5A 3A23A 1CGVA 3EBVA 5AHNA 4MZYA 4WKHA 2BGSA 1F8IA 2ZWYA 3CPUA 4KFOA 3CWNA 1BYAA 3ZT6A 1LWJA 1QAPA 3CT2A 4LAZA 2PDMA 2CZ5A 4E5TA 1B90A 4PODA 1VF8A 3H7UA 1UWAA 4WX2A 4UR8A 2FFIA 4J3TA 5DT5A 1KLZA 4JD4A 3H6OA 2REQA 4F0RA 3NGFA 1ODUA 1WXZA 3ZO9A 3WNMA 6TIMA 1J93A 1IT8A 1C8VA 2Z4GA 3VPLA 3DFPA 1OD0A 4WGHA 3NZGA 2QMKA 3COTA 3BAWA 2ZXQA 3GNPA 2QZRA 2KZHA 4AF0B 3RO8A 2IQ0A 3HV8A 4RPQA 2WXDM 2H90A 2IW0A 3HMJG 1KW1A 2WHLA 1PL9A 3U2OA 2VEFA 1ZFJA 4JDBA 3MHUA 1H0GA 4I9TA 3B4YA 3G0UA 4LWWA 3BLDA 3TNOA 4AEEA 4JX4A 4KEMA 4MKSA 1VFFA 4YTUA 2Y4SA 2VR4A 3PWAA 4H9YA 1NP0A 5DBTA 2ZFAA 2Z7GA 2WMGA 3O1NA 3ZR5A 4B3LA 1UMYA 3EWZA 3UXDA 3QPZA 4PEEA 3ZFHA 5JVLA 2J9YA 2QGHA 2XZ9A 3T42A 3UG4A 3AZSA 3V18A 2WANA 4CNTA 3CO8A 3RITA 3TR2A 1YMYA 4OTKA 4FXFA 3PPFA 4LUTA 4ACZA 1Z44A 3F4DA 5A8NA 3BOLA 1SO3A 5CPMA 4AD4A 1DEDA 3TH6A 1XYAA 2O4MA 3I3BA 4JTFA 3WYZA 5C2CA 3WEZA 2ZUNA 1C9DA 1MQRA 2AQVA 3H4WA 4CNUA 3S2LA 3NO3A 4HU3A 2PTXA 3WUBA 1I2PA 1BXBA 1XLBA 1CDGA 3AHTA 3UU0A 3U8GA 3TQ0A 3QZEA 3K8LA 4DF1A 1D8CA 4RE0A 7ODCA 1SZNA 3E0FA 2HBXA 4XZWA 4DUOA 1JCLA 2W0UA 5JH1A 3W71A 4Z0JA 2X0YA 1B5TA 3T44A 2EPHA 3MP5A 2WKGA 1ITQA 1AL8A 4PGLA 4DX3A 2ATMA 3SCTA 4O4WA 4DM2A 4ILSA 4FXSA 3UR8A 5FCZA 2JIEA 1TFVA 3WDQA 2QULA 2W62A 1Q6OA 3S3GA 3SCOA 3M6YA 3F03K 4IFKA 3HM7A 1G4SA 4S3BA 3W7KA 2AQOA 1J01A 4D8ZA 4HT3A 4HQVA 3BV7A 4MNMA 1LL4A 3KP0A 4HA1A 1KFWA 4X2RA 1MWOA 4BA0A 1W5NA 4H6QA 2ZZ2A 2YBTA 1OCBA 1ELSA 3RIKA 4YTTA 2GQ3A 2R1PA 4KIEA 5M3WA 3C2YA 4V27A 4UZUA 4IMAA 2GDVA 3WLIA 2ESCA 1GVYA 3TN6A 4F9JA 1KM0A 3F5JA 3VABA 1UC5A 4GE8A 3AWOA 5EBUA 1DP0A 3JW7A 3ABXA 3G1HA 1YXYA 3W1RA 1Z8AA 3IIXA 3PVFA 4UMCA 1AH4A 3C2VA 4MMWA 1LUCA 1TWSA 2ZZ3A 4UTWC 4ENLA 5F7UA 4XD6A 1ML1A 3V75A 1JFXA 1QW7A 2D1ZA 3UZYA 3AHYA 3R13A 3EZ4A 2QV4A 3BLKA 1FKWA 5IDZA 4X61A 3P82A 1V0LA 4RX0A 4C1LA 4RDWA 3L68A 3E6EA 3BAKA 4JX6A 3WLSA 4HHMA 2E8ZA 3NO5A 3MCOA 3VGBA 2WSQA 1K77A 1TB3A 3DYPA 3LK6A 1XX1A 1JYXA 4C6DA 1XIEA 3I4EA 2VR2A 1IR1A 2BV9A 4O8AA 3ID7A 4IOTA 3GVVA 3O0KA 2WB5A 4CN4A 1TPWA 3GG7A 2P3ZA 3CHCA 1YBQA 4NRSA 2ZXAA 3WNLA 4LVBA 3VD3A 2NXIA 1X7FA 1TVNA 1XLKA 2ZUWA 3W23A 3BL3A 1GJWA 5A8GA 3QV7A 1IXQA 1V02E 4V15A 4ZEPA 2EQDA 3HFTA 2VDHA 1QHPA 3LPPA 4R85A 5LNVA 5GNZA 1GTEA 1UR4A 4GLEA 3NQCA 3NQBA 2AOSA 3UZZA 5MKGA 2XFWA 1GZGA 1W9DM 1EA0A 2WWDA 3CB3A 2ZCGA 3NQ6A 4AH7A 4A3YA 3LGEA 4PYSA 2FZDA 2HEJA 2O92A 3VIGA 3DFHA 3VKDA 3LM3A 4H9TA 4N9CA 1BKHA 4DBEA 3WDRA 2E7FA 3IJ6A 2PRHA 1LROA 4ZXLA 3W07A 3MO7A 1OBAA 1KCZA 3KRZA 1NVMA 4R27A 1K8YA 4PMOA 3BLOA 3MI2A 2VCCA 3HG3A 3S5SA 3VM5A 1LL6A 3PUGA 5D4YA 1JZ2A 2PDGA 5I77A 2G37A 3TAKA 3LRMA 2WM1A 4D72A 2VXNA 1DQUA 1DJXA 3S47A 3MKKA 3FXGA 1FFRA 1KNWA 5HATA 2WHKA 3NPWA 4CQBA 1V5XA 3LGDA 1XIJA 2XIQA 3JS3A 1LLOA 3PAOA 2E25A 2DSVA 3DXIA 2QT3A 2AGKA 3FV9A 2QS8A 1UZDA 3BXWA 1YE6A 1JG9A 1QO2A 1GYMA 1ONRA 3RDKA 1H7XA 1EXBA 3QOMA 5AHEA 3N4AA 3BG3A 4X9YA 5B7YA 1SQ7A 1OYAA 2A6LA 3T2PA 1AL7A 3USBA 1H51A 1KXVA 1GOXA 2HS8A 3UVIA 1TCDA 2MUCA 2PWDA 3IGHX 3EWBX 2ZE0A 3G8EA 3WLLA 2B7PA 3CNYA 4QBXA 3R4IA 4CD4A 2YYTA 1KCLA 4W85A 3VCCA 2V3FA 4GI9A 3T8QA 1R3WA 4PUMA 3KWSA 1S2TA 3CGTA 3MUIA 2RDWA 4A2RA 4O18A 1F4HA 1EX5A 3QYSA 4FOKA 2G95A 5C5YA 7A3HA 1KBIA 5CLWA 1XBVA 4AIOA 3SY1A 5I7GA 1TIMA 1OD8A 4JXCA 4MAZA 3ZJ8A 3WK3A 2QJNA 1PCWA 2VFFA 3P80A 2VRQA 1U1HA 1K7FA 3OODA 5I3DA 4AXNA 1SJBA 1BSIA 4GISA 2DY3A 2INZA 2DZXA 3VNIA 3PBGA 4XTIA 2PU0A 4MZ1A 3L21A 1O12A 2D3NA 1CXIA 3QPYA 1MDRA 4GACA 5IBXC 3QR3A 4M80A 1S2UA 2J24A 2PLMA 1OWQA 4FLRA 1EBGA 2WO5A 4JR5A 1K8ZA 1UZ1A 1JYVA 4PMRA 3T40A 4FX7A 4TV5A 3LTPA 3W7MA 1G67A 2V38A 3GXNA 2WNWA 3N14A 3NPXA 5DCEA 4E2OA 3ARZA 1K9EA 2R1KA 2WBKA 3FEQA 3S1XA 4GUGA 5JMUA 2A21A 3ABSA 1ZJAA 3DI0A 4JIRA 3WO8A 1W37A 3H21A 1Q5MA 4ICNA 4MJMA 1NELA 3KP1A 3F1QA 4C6IA 1J0ZA 1VYSX 3CZJA 1H09A 4FNUA 1A47A 3W88A 3GAKA 3FAWA 1J11A 1QATA 2V69A 2Y5EA 1K1DA 4NT0A 3WFLA 3M5YA 5FJRA 3MUCA 3MCNA 2XGZA 1AW1A 2Z0IA 1PPIA 1BG9A 4MWAC 1N8FA 1TPVA 1LWHA 6A3HA 3F2BA 3RPDA 1Q85A 1R7AA 3LNMA 3K46A 1DXIA 3MT1A 5HJLA 4FNSA 1FUYA 2CFFA 3FN9A 5C7VA 4YMZA 4GIEA 1JZ8A 1TR9A 3LBOA 3FKKA 1JYWA 3GKFA 1LLWA 1JPIA 1R9YA 1OSEA 4Z2LA 2UY5A 2F6KA 5F1VA 3T09A 3KVMA 1GVQA 2EG7A 3URAA 3SCUA 4R5EA 1RV8A 4H6EA 3CHDA 1MW0A 5E9XA 1AW5A 3QW4B 3GYEA 3PG9A 2XINA 1PEZA 2BG5A 2ABBA 2FLIA 1K6AA 3VAVA 5H8UA 4MIMA 4K8EA 5BNKA 3S4TA 3AO0A 1QK2A 1M04A 3CPRA 1P7TA 3DBPA 2H9AA 1R46A 4C1NA 1UQZA 3LCWA 3N6JA 1EF3A 2EEXA 1UWRA 4MDPA 4XZHA 3WMBA 1S5NA 1X8FA 3VXGA 1XL9A 2JEQA 3G77A 3BW4A 3BQ5A 1MW3A 3EMQA 4PTDA 5C9WA 4FMVA 3HPFA 1UCWA 3QMSA 1O66A 5MF5A 1IR2A 3HN3A 2XWEA 3J7HA 3RCYA 3V0TA 3SR7A 5C2GA 4M24A 2R82A 1Q6DA 1XCXA 4K68A 3PSVA 5I3HA 1ZS2A 3W7NA 1A5BA 4NL1A 3HGRA 5CCZA 2VRJA 1ZUAX 4UTWA 2HK1A 3GXPA 5AC5A 1QOPA 4P7NA 2HVMA 4HA3A 2DZVA 1VFSA 2OJPA 1SR9A 4YL2A 1XD0A 1XYCA 3IVUA 2XGBA 1LRQA 3CUZA 3GXIA 3OA3A 4ADSA 2INEA 4M1RA 1CBGA 2G3IA 1NFPA 5C70A 4RZBA 2PGRA 3E5PA 1E1CA 1NY1A 3VZXA 1SJCA 1PTDA 3UR2A 3S0CA 5BW6A 4AQLA 4ZODA 2PWGA 1TMHA 2NSOA 4XAZA 4JTLA 1PIIA 2QCDB 2W92A 3KBNA 3OP2A 4W7WA 3S1WA 4RUBA 1KM1A 4UTIA 4D1JA 4O16A 4IQLA 3NQGA 2HNEA 1UWIA 3TTOA 2WZHA 1G69A 4NY2A 3MS8A 3ISIX 3VTRA 4W84A 4FSAA 3N04A 5T9BG 2PGFA 1NJJA 1KRMA 3B9EA 3WBXA 1WKYA 3RR4A 1B3VA 3G2GA 4TUFA 6XIAA 5EMLA 1B0IA 4X60A 5D04C 1Q7MA 2QF7A 1FWIC 4YPJA 2B7OA 4MJ2A 5FF7A 4TVUA 1N8WA 4KEUA 5CEWA 5DELA 1SPQA 2YR1A 1ZCCA 1SO6A 4ZQRA 2H8XA 3KBMA 1TUFA 1SUXA 1B2YA 3QSRA 1UUMA 3ARPA 1UASA 2G0WA 2RKXA 3H54A 1ZAJA 3WD2A 4UQDA 3GUWA 1WP6A 1P43A 2TPSA 4ZQPA 4P5UA 3H7RA 4US6A 4LTSA 2CIPA 1IV8A 1VR6A 1M1BA 2DFAA 5HWNA 4JNZA 5B80A 2GSJA 5BMWA 2QDHA 1UROA 3QTGA 2CESA 2R1NA 1E3XA 3PJUA 3HTWA 4PN2A 4GC4A 3HPAA 2FHCA 4PCNA 1JAKA 1R5YA 5IFPA 5LA0A 4C65A 1K9DA 2VWTA 3URQA 1RXOB 3TCEA 2BMBA 3VNYA 5K4ZA 5IXEA 4OBRA 3LG3A 4HOXA 1W1PA 3DI1A 1HQTA 3U7BA 1BVZA 1VPXA 4ZO8A 1JPHA 2P1FA 3QQWA 2YB4A 4JTEA 1JVNA 2YB1A 1ENUA 2XFFA 2YSWA 1TJRA 3VNZA 2ZADA 5A8OA 3UZXA 2RH9A 1XRSA 3AS3A 4FIQA 3UFYA 5JQ9A 3CO4A 2XIIA 1N55A 2J7HA 5F4XA 1VAHA 1VLWA 3MWCA 3N2XA 3H2CA 4NAFB 2NQJA 4UWMA 3DENA 2A3AA 1M7XA 4XX6A 2QMJA 3ONBA 2NX9A 3KTSA 2Y7FA 3GNRA 3NPVA 1KM6A 3UR7A 2HCVA 1ADSA 3UW6A 3WJXA 3QV9A 2ZOXA 3HF3A 1RH9A 1MO0A 1K02A 1RPKA 1UMLA 4AZ7A 4ASTA 1FCUA 5I5RA 5FJIA 4LCQA 4GXMA 1KXQA 2DSZA 1E15A 1ITCA 1C29A 3FA5A 3CUJA 1T40A 3DAQA 5DX7A 4XKYA 2YCKX 2QAPA 3GH4A 3O3RA 1X8CA 3QZAA 2YA1A 3BGJA 1SW3A 2HISA 4F40A 4GPNA 1TO3A 1ISXA 1CLVA 1TE6A 4FF5A 3TDFA 1A5NC 2BWGA 1V0MA 5KINA 2YDRA 3WDJA 1W3HA 3POHA 2A5HA 2NQ5A 3AXMA 1U5HA 4JTDA 1ZALA 2DW7A 1H1YA 4IGHA 1VLIA 4XIAA 3Q94A 3OB8A 4ZQCA 3M0MA 3PBWA 3AUOA 2V2CA 1NSJA 8A3HA 1GVRA 2J7DA 3GVRA 3KBVA 5CPTA 3GFZA 3REQB 1P4CA 1XPYA 4IM4A 2DJLA 3VK5A 4DBUA 4K1GA 4UUIA 1ZP4A 3BLPX 4CCDA 4CQCA 4PUDA 2QCEA 3P6LA 1V6TA 4C6OA 1E6NA 4GQQA 4MNJA 1ME8A 1F73A 3NAVA 4PBGA 1E5NA 1KTNA 1VBHA 3VVGA 2D2GA 1US0A 1C7TA 2WZMA 2PDXA 8RUCA 3TLQA 3TTEA 4O13A 1FWDC 3GXMA 4IG2B 3R25A 3WK1A 4JAWA 2TAAA 1UPMB 1WDRA 3G1YA 3LHWA 1EP2A 5EBAA 3W75A 2ODOA 4KWWA 1JCTA 2RDTA 3IVTA 5FEPA 2WZTA 3KOWA 3R0UA 1PS9A 4MWAA 1EJ7L 3N2MA 1RBAA 4V2XA 1UH4A 4R7WA 1BWVA 2G3FA 1W1A1 3OYZA 1W54A 3GRIA 4GABA 2X2GA 2J75A 4E4PA 2W5FA 5DANA 2J6XA 3OOQA 4UQBA 1O5XA 2XG9A 3KUMA 1WCGA 4F2TA 5FL1A 1OFOA 2A7RA 4HVXA 3B0PA 4IHCA 3GO2A 4H41A 3R89A 1KO0A 1F9CA 2VVNA 3GNXA 1SM9A 3PULA 4B9ZA 1XH1A 5TNVA 4F0SA 3A13A 1RHCA 4WGXA 1U1UA 3EDDA 1XSIA 2XJ7A 2ZDSA 3ITOA 2WVVB 3B06A 3A24A 3N2TA 2WPBA 1W5QA 1Q6GA 4EKJA 3GVGA 1I1XA 5LSMA 4AZBA 2VEIA 2HPMA 2ISVA 1THFD 5KTLA 4WJ8A 3Q45A 3MMDA 2P88A 3Q4DA 1JXKA 4QIUA 2EPNA 2Y85A 1E6XM 1R38A 1C7SA 3A9BA 1JPDX 2XN2A 4QDMA 1F5ZA 2OVLA 1N7KA 3NEHA 2DZUA 1JZ5A 1H61A 3CM4A 1OFBA 4TTUA 4NG3A 4CD6A 4FNQA 4LS2A 1M9HA 1XUUA 3M41A 1W0MA 3EX4A 3AIWA 1KKRA 1ZPTA 1LCOA 4B91A 2DZAA 5DCDA 4B5UA 4Q8QA 1H62A 5CPQA 4LU0A 1JEZA 1I4NA 2GWNA 4KF1A 3S5YA 5FF4A 5AZ1A 3PJWA 2QR6A 4H19A 4IPLA 3S6DA 4OOZA 2NT1A 5E6ZA 3BO9A 2YCLA 1RR2A 1HJUA 1XDLA 4RXFA 1BQGA 1EO5A 4FI4A 3TTYA 2XSBA 1ZJHA 5LIYX 3EDFA 4LV9A 1HO1A 1JGMA 1WDPA 3DFYA 1KCKA 2OWXA 1UD8A 2R8WA 4X3ZA 3T0BA 3YPIA 5LA1A 1H50A 4UFMA