3WBAA

Rice os3bglu6 e178q with covalent glucosyl moiety from p-nitrophenyl glucopyranoside.
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
478
structure length
478
Chain Sequence
b'GLTRGSFPEGFVFGTASAAYQYEGAVKEDGRGQTIWDTFAHTFGKITDFSNADVAVDQYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPYVTLYHWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNQPHTVAIQGYDAGLQAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKATQNGQLGIAFDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRFTADEAAVVKGALDFVGINHYTTYYTRHNNTNIIGTLLNNTLADTGTVSLPFKNGKPIGDRANSIWLYIVPRGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIKYHNDYLTNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSVQWFKALLKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucosidase 6
publication title Enzymatic and structural characterization of hydrolysis of gibberellin A4 glucosyl ester by a rice beta-d-glucosidase
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Hydrolase
total genus 193
structure length 478
sequence length 478
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wbaA00
4J7RA 2E8YA 4UOQA 1I75A 1KWGA 2Y24A 3L4ZA 3WL1A 4MB3A 1VAHA 1A3HA 3CO4A 5IFTA 2OWXA 2VR4A 3SUVA 2QMJA 1NP0A 1CGYA 1GOIA 3SCUA 4U31A 4CVWA 4WLCA 5D9MA 1OM0A 3OIHA 1V3IA 3MMWA 1VBRA 3BAYA 3SCRA 3VGGA 3ZR5A 3APGA 1JI2A 3L4VA 1DEDA 1HKIA 2XIBA 1VIWA 4CD6A 1E1FA 2WMGA 5E0FA 1XC6A 3TOPA 4UOJA 1B31A 1UKQA 1CDGA 3K8KA 1G0CA 1ZBVA 1XSIA 3GH7A 5FKYA 4HOWA 4F66A 1XRVA 3FW6A 5I2UA 2FH8A 2MANA 3DECA 1H0IA 2WKLA 3ARYA 2WHLA 2XVGA 3KE0A 1P6WA 2YA1A 4P8XA 3WH6A 2VJXA 4PYSA 4LPCA 2XM2A 3BAIA 4AISA 1MFUA 3VU2A 4Q7NA 4B3KA 2X09A 1V3KA 5A95A 4IUGA 1GVYA 3ZO9A 3AXXA 4TXEA 4HZ6A 3BH4A 2ESCA 2VNCA 2VVSA 1I1XA 4CU6A 3GTNA 2IUZA 5ABGA 1CGUA 2GJXB 3ARPA 4DUWA 1KCKA 1JZ8A 4PMNA 3ZQ9A 2W62A 1VB9A 2OSXA 1U2YA 4HA4A 2J7GA 3HMCA 4URIA 1LWHA 1X6LA 3VGDA 3ZT6A 4LX4A 1PX8A 1HX0A 1UKOA 1O7AA 3CIVA 3WF4A 2YA0A 1HKJA 3ZJ7A 3N04A 5CSUA 2XFYA 1CXHA 1ISZA 2XG9A 1GQLA 4DWSA 1TA3A 1BLIA 2GFTA 2YBUA 1UWTA 4EE9A 1QW8A 1N82A 5I24A 5I5RA 2VZOA 1C3FA 2JIWA 3AZTA 2FHCA 2J4GA 1W1PA 3I3DA 3MV01 3EYPA 1VENA 1Q6CA 3FAXA 5CSYA 2AMGA 1J0JA 3VMOA 3WUBA 2QF8A 4DWSC 4J3UA 3VIIA 4CVUA 1HKMA 1RP8A 2WLZA 1V02A 3MV11 3MSGA 1QHZA 4H8HA 3MUIA 4GQQA 1GOWA 5IHRA 5BROA 4OIFA 1CXFA 2X0YA 4W87A 2AAAA 5GNXA 2X05A 3B9EA 2Y4SA 1ISWA 4P7QA 1IV8A 2WC3A 3W38A 3CPUA 1UWUA 3ARQA 4W5UA 4YPJA 3II1A 2QPSA 1J10A 3WY1A 1G01A 4TX8A 1KBBA 1V0KA 4CU8A 2BY2A 3IJ9A 1V6UA 1FFQA 2OSYA 1OGBA 3NJ3A 1UD6A 1GUVA 1MW0A 4W8AA 1ZB5A 1R85A 1EO7A 4OKDA 3W29A 5DMYA 1AQHA 4D6CA 1PIFA 1MXGA 4JFWA 1B2YA 2DIJA 2WHMA 4PEEA 4Z2GA 2CBIA 4PMDA 2WXDM 2XIIA 2D2OA 4AW7A 2YLLA 2QLYA 3RM9A 3RMEA 5BCAA 1DWGM 4FMVA 3CZKA 4HZ8A 1CGWA 4CD7A 1JGIA 1V6XA 1CGXA 2RGLA 2ZWZA 1UZ4A 1E6NA 1FH8A 1W9XA 5A6MA 3L4WA 3WSUA 5A8QA 3AZRA 1E73M 2OWWA 1V6VA 1PX3A 1EOMA 5JIPA 4XZBA 2V3EA 4IPNB 4Z2HA 5JUVA 1QI5A 2ZUNA 4HPGA 2G3IA 6A3HA 1EQPA 3MS8A 1PZ2A 2FHFA 1QNQA 3HU7A 1KFWA 4P8VA 3EMCA 5E6YA 4UFHA 4M80A 4WIWA 2VL4A 1Q6GA 4CD8A 3GH4A 1DWFM 1HP4A 3GYCA 5D9OA 1EIBA 1GJWA 1R86A 4Z2KA 2CBVA 2VQTA 3OZOA 2JEQA 1VF8A 4E8DA 3VIPA 1JAEA 1ZL1A 2G3JA 1W3JA 4W86A 1HT6A 2J75A 2XJ7A 3PTMA 1J0ZA 3SCWA 5ABFA 1MQPA 3W37A 4Q22A 1EOKA 2D3LA 1UOKA 2XVKA 4AIOA 4MAZA 3NDYA 4QAWA 1R7AA 1MWOA 1LQ0A 3AROA 3IJ8A 1EA9C 1LG2A 4AZGA 2E0PA 2FH6A 1OWQA 1B9ZA 3GBEA 3J7HA 2EQDA 1UWRA 3NSMA 4D6JA 3SCSA 3ZR6A 2W5FA 2O9OA 3CUHA 4BS0A 1NP2A 5IDIA 4D1IA 1MQQA 2VOTA 4BQ2A 3TA9A 3T08A 2E9MA 2WMIA 5CPSA 1Q6FA 2OYLA 3WH7A 2J62A 3UR7A 4AZ7A 1VEOA 1BTCA 2XVPA 2WANA 1B3VA 1GVIA 2PBOA 4MNMA 2WBGA 1WNOA 3AIUA 3L4YA 3RJXA 1CNVA 4MB5A 5BRQA 2J77A 2A3BA 4TOQA 4FLQA 3WDQA 2GK1B 1FFRA 1V6YA 4CUCA 3CUGA 4LYPA 3CUIA 5HNNA 3W25A 1PEZA 4AZBA 1D2KA 3PHAA 3SUWA 5IFPA 1JF6A 3WDIA 4DWSB 1TA3B 1WZLA 1V02E 1H0GA 3KEHA 4MDOA 4UQAA 1CXLA 4GZIA 5JIWA 1W3HA 3LPOA 3PZOA 3THDA 2Y8KA 5D9PA 3NCOA 2D0HA 3VIMA 4UQ9A 4C7GA 3SCQA 4GXPA 1KR0A 2XPKA 1PJ9A 2WLYA 2QHAA 3AIBA 1GHRA 1HL9A 1R87A 1GZJA 3I3EA 4BCEA 1VEPA 2C8NA 1GOQA 2C0HA 4GO8A 2VX4A 5EFFA 2GDVA 3WEMA 2XVLA 1HVQA 4CCCA 1CWYA 3E1F1 5DF0A 4NZCA 3VNYA 1KXVA 1H4PA 5GNYA 2DPEA 3LPPA 1V0NA 1IZJA 4CD5A 1QW9A 4OUEA 1B1YA 1KCLA 1W9UA 1M01A 1M7XA 1EDGA 2VT0A 3OA5A 4MNKA 3ARWA 5E09A 3AICA 1E6RA 3DYOA 4WKFA 2J79A 3WD2A 4AZ6A 4HU8A 1EHAA 1JXKA 1NQ6A 1E70M 2ZXBA 1WE5A 1XGZA 3UESA 3PTQA 2FGZA 1ODUA 1JXJA 2CERA 1GHSA 1FP9A 3UCQA 1VJZA 1H11A 1W9DM 1PBGA 3ZM8A 3MUAA 1C92A 3AZSA 3WL0A 1VFMA 2UY3A 1H1NA 1X1NA 5JBEA 1GORA 3WMSA 3WNKA 4FLSA 3FHQA 3PZMA 5EFDA 5A2CA 3IANA 4ZE4A 3AMDA 3MO4A 5A8OA 1V3HA 4P8UA 3ZMRA 2J7FA 4UNIA 3ARXA 3AOFA 3NUKA 5CZKA 2DIEA 4PCTA 1G9HA 4J3XA 1UA7A 5FCZA 3SCTA 1LL4A 4HPHA 3PZNA 4MTVA 2VCBA 1JZ6A 1VBUA 4AD5A 1OBAA 4MB1A 4R27A 2Y5EA 3AMLA 5ABFB 2WHKA 5FD0A 1H2JA 2V3GA 4LYQA 2OWCA 2O9PA 2VTFA 4W8BA 2ZUWA 4FK9A 5I0DA 1MXDA 1WZKA 4M29A 2X2YA 1UH2A 3ZJ8A 5LA1A 1C8QA 1CBGA 2YA2A 3DC0A 3WH9A 3AXIA 1DP0A 2F61A 3RPMA 2ZUSA 2WC7A 4M8UA 3VIGA 3VIOA 4J28A 9CGTA 5JBDA 3K1DA 3WDRA 3CUJA 2G41A 3OLIA 1BVZA 4EAMA 1AQ0A 1TVPA 4E8CA 5CGMA 2PBGA 1OCQA 5IXEA 2VX5A 2XSBA 3S2CA 4ACZA 3QHOA 3AHVA 3VDAA 5A3HA 1WCGA 1GQIA 1E5JA 3GZAA 4HTYA 2WMIB 3QHMA 4YHEA 4GKLA 4IM4A 3CHDA 3GDBA 4OOUA 4AC1X 2XFRA 3MUZ1 1UUQA 2J7CA 1VFOA 6TAAA 2EPMX 2BS9A 2XYLA 4AEEA 3AI0A 5M03A 2ZX9A 1OT2A 1E9LA 2WCSA 4QCEA 1RP9A 1JD9A 3U5YA 2GJRA 3ARVA 3WMBA 4ZENA 1CZ1A 3WFZA 1E72M 2VR5A 4JCLA 1JG9A 2BV9A 4HZ7A 2CESA 3AHZA 3WELA 5AYIA 5E0CA 3I3BA 6CGTA 3VX1A 1XYZA 3L2LA 3VD4A 1EH9A 1HN1A 4TVUA 1UD5A 4UTFA 1E6PA 1SR0A 4JL1A 1GJUA 2WAGA 3CUFA 2WSPA 3WNOA 3OLEA 3W53A 2WVSA 4MJ2A 4WSKA 3SCVA 5HXMA 2GUYA 3GNOA 2VX6A 2OYMA 3MUY1 5E6ZA 2DEPA 1RD6A 3CHEA 4CU7A 3WQ5A 2PB1A 5BRPA 2VRQA 3U5UA 1VJSA 4P7RA 1KGXA 3AS3A 2GJPA 3WH5A 1BG4A 4QLLA 5JBFA 1C90A 1QVBA 1KXHA 3IAQA 3OBAA 2WSKA 5CGTA 2OLHA 4AD1A 1K6AA 5A8MA 4PMXA 2OYKA 3A4XA 1RPKA 2DQXA 3POCA 4B16A 3UG5A 4J27A 2XUCA 5AYBA 5FIPA 5ABEA 1BGGA 5C8BB 4U3CA 3LMYA 2BNJA 3AMGA 3T0DA 1J9YA 1FA2A 2A3EA 3SUUA 1OGSA 2J25A 1JDAA 3B8SA 3G6MA 5DFAA 1PX4A 3KL3A 5BXPA 1UR2A 1XH1A 3GNPA 4S3KA 3EDJA 5GPRA 3BAXA 4X9YA 3TTSA 3T0BA 4ATWA 2CHNA 1W1VA 3MSDA 2GK1A 4QP0A 4J3TA 4FF5A 2BHUA 1QBBA 3T0AA 1E6SM 2WNWA 1M04A 4W84A 2BVTA 4KGLA 4ATLA 2Z1SA 1BGAA 4RL3A 4V28A 1BYCA 3AYSA 2BY1A 3WNNA 4JAWA 4M24A 3AS2A 1VFUA 2DT0A 1B0IA 1C8XA 8CGTA 4MNLA 3OGRA 3TTYA 5E9AA 3OGSA 1ITCA 1NWUA 2C7FA 4PSPA 3WF3A 2DSZA 2OSWA 2QPUA 1CECA 4D6DA 3GH5A 2VRKA 3W28A 3W27A 5HOSA 5AY7A 2PC8A 2PF0A 2WWDA 1D7FA 3VNZA 1QBAA 1JL8A 1QI3A 4U5KA 4QLJA 3KL0A 1VEMA 1XYFA 4H8UA 1BSIA 1TMQA 2J78A 2VZSA 1NWTA 5GNZA 1K9DA 2UY5A 2JEPA 3WQWA 1B3ZA 1MW1A 4W7VA 3VGEA 1O6IA 2WYSA 3BLKA 3UETA 2PWGA 1JZ5A 3VDCA 4F79A 2J74A 1XCWA 3CH9A 4ACZB 5BXSA 4CKQA 3CHFA 1BF2A 3RM4A 1PZ3A 1H5VA 3WF1A 1V6WA 3K4AA 2YDSA 3TONA 3A4AA 3NIYA 3PZGA 5A1AA 1HKKA 1JNDA 1JF5A 2VUYA 1G1YA 3N17A 3N9KA 1TVNA 4LXFA 1W2VA 3ZSSA 1MYRA 1NOUA 3W82A 4ATDA 4WJXA 1EDQA 2WK2A 3AIRA 4W7UA 1CXKA 2VRJA 3FXYA 3VVGA 1EQCA 3TTQA 1DWHM 1E4NA 1JFHA 2BVDA 1CIUA 2F2HA 2V5CA 2PWEA 4D71A 2W91A 1UWIA 2BHZA 1OINA 1XD0A 1S46A 1PAMA 5TD4A 2CITA 2CNCA 2WHJA 1DWIM 1F4AA 2PI6A 1JD7A 1TCMA 1WDPA 4D6FA 4PMQA 4QFUA 4A4AA 3A47A 2XGBA 3F5KA 1JIBA 1LG1A 2YL8A 4N42A 2XWDA 2NT0A 1NWRA 1B90A 4Y7EA 3RCNA 3D5HA 4AD0A 4OJYA 3MANA 2X8RA 4MAVA 4X0NA 1CTNA 4UFJA 3BAWA 3BMVA 2D20A 2EPLX 4S3JA 1HJUA 3WD4A 2HVMA 4PTWA 5C71A 2IXUA 2YJQA 3GXMA 1UQZA 1V3LA 1OD0A 4HP5A 1ZBCA 4UCFA 4OBSA 4P8WA 2GVYA 5C70A 1E6ZA 2DSUA 1ISVA 4ML4A 1QNPA 2VC9A 1A47A 3N12A 3SCPA 3OLDA 4AIEA 2ZE0A 1GW1A 4GZJA 3MMUA 1TR1A 1M03A 4WF7A 2VZTA 3CGTA 3BMWA 4J3WA 3VGHA 3ECQA 3NYDA 1TZ7A 4PMRA 3WENA 1ISXA 2ZUUA 2VCCA 1JAKA 4BQ5A 4UFLA 3IK2A 4P7OA 3SIMA 2YKKA 2CCRA 1UQYA 1WZMA 1UYQA 1KBKA 3AISA 4GPNA 1UHVA 1HIZA 2W61A 1E71M 2YLAA 1HJVA 1NWSA 5FL1A 4XX6A 5HBFA 4D6IA 1US3A 2E9LA 3BC9A 1Q6EA 1BPLB 3AJ7A 3NSXA 5DO8A 3PZ9A 4H7VA 4W93A 3GNRA 2J47A 4C7FA 2G3NA 3UG4A 1KR1A 1JDCA 4DUXA 1HJWA 1E15A 4HA1A 1V0LA 1J18A 4D6EA 3SCNA 4OBRA 1J0KA 1SMDA 3G6LA 3F5JA 2RGMA 2CHOA 1NH6A 1E6XM 4AZCA 2ZX5A 3GXIA 5A6BA 4R5EA 3MU7A 1UKSA 1LWJA 4NF7A 5ECUA 2WMHA 3M6DA 3VDBA 3WIJA 5EB8A 5CPQA 1AMYA 1B30A 3WMCA 4AEFA 2CBJA 3CZ8A 3CTTA 4TVCA 4OZOA 4TVDA 1FHLA 1UR8A 3W26A 3WF2A 1FH9A 3O9NA 1R8LA 1UD8A 2D3NA 2DDXA 4D1JA 1IZKA 4B15A 3T09A 3EDDA 2FDMA 2ZX8A 4U5IA 4UQCA 1UD4A 3VIFA 4UFIA 4DWSD 1B3WA 3FN9A 2W67A 4MDPA 1L8NA 1ZBKA 1JYXA 4MB4A 1AVAA 2VO5A 1JZ3A 5M5DA 1IT0A 3HN3A 3WN6A 4CGTA 4F9JA 4DM2A 5LYRA 4HA3A 5DT7A 2O92A 4M1RA 1CPUA 4HMDA 1CXIA 2UWFA 3BCFA 3VGFA 1Q6DA 3ARRA 1UR9A 1KB3A 1B3XA 2XVNA 4XB3A 1HXJA 1US2A 3AQUA 2CXGA 4PTMA 4H2CA 2PWDA 4ZXOA 1WAWA 1C91A 1DWJM 3PBGA 4PN2A 4CCEA 4GI6A 4W8LA 4JFSA 3OZPA 2NW0A 3DHUA 1OIFA 4KMQA 1C93A 5HDRA 3VILA 2WMJA 1E5NA 1GONA 2WCAA 1U33A 1WKYA 3GBDA 2XWEA 4H04A 3BXWA 3WKZA 3M7SA 3WD0A 4FLOA 4IPLA 2CKRA 4AD3A 3K46A 1K9FA 1W9PA 3S6TA 1E4LA 1XV8A 3BAKA 5AC5A 1EO5A 1MFVA 3KZSA 4V27A 3SUTA 2J7EA 3PZTA 2UY2A 4Z2LA 4WSJA 1C7TA 3WNMA 1L0PA 3KWXA 3VPLA 1MW3A 1GOKA 1ECEA 2ZIDA 2DT1A 1DWAM 1TE1A 1W1YA 3T2PA 4A3HA 3AHTA 3EBVA 3PZIA 1HP5A 3FNDA 5I79A 3W24A 4FLRA 3ARZA 4GZEA 1XD1A 3RJYA 4UOZA 3AIEA 4JZ5A 1KQYA 1EDTA 3PZQA 3L4XA 4JFVA 3AS1A 4D72A 3VD9A 4AYSA 3PN8A 5CG0A 3JUGA 2V3DA 2WVVA 2CKSA 4W88A 1V0MA 5A69A 2EJ1A 5A8NA 1UG6A 2BFGA 4TTGA 1GPFA 3WH8A 1C7SA 1QI4A 3ZJ6A 4BQ3A 3VDHA 3RO8A 4AD2A 4K68A 1BG9A 3TTOA 1E4IA 5A6SA 2YDQA 3DHPA 1ZJBA 3K4DA 1SMAA 4NI3A 3VIJA 4UZUA 1TFVA 4PSRA 1VFFA 1BFNA 3MMDA 2ZICA 1BHGA 2WMKA 3EDKA 3POHA 4PRWA 4RE2A 1V08A 3F4VA 1DTUA 2EXOA 5HPCA 3L2MA 2ZX6A 3CLWA 3UEQA 1GCYA 3VMNA 1PPIA 1EXPA 2W92A 2ZUVA 2ZXQA 1EGZA 4E2OA 4OOZA 2AOSA 3WQ4A 1E40A 5I3DA 5I78A 2WVTA 4AZCB 3O2LA 5A6KA 3T2QA 2ZX7A 4UFMA 4M81A 3BCDA 1QOXA 2EEXA 4H8VA 1OIMA 3VTRA 3W6MA 4XZWA 2BY3A 1J11A 2QV4A 2Q8XA 3WNLA 1W32A 2WWCA 3CZEA 3AMKA 3UR8A 1NM9A 5KZ6A 3AIVA 3EDEA 4B9YA 3D3AA 5A2AA 3KL5A 2YOCA 1F4HA 2A3CA 2JF6A 1BQCA 4HOZA 4V2XA 2VCAA 2J7HA 1MQRA 1V3JA 4BF7A 3OGVA 4GI8A 1ZBWA 3A6OA 1MW2A 2DT3A 2E4TA 2V38A 2WVUA 4UZSA 4PTXA 2WCGA 2X0HA 1JZ4A 4GQRA 4BZYA 3WUEA 1CGTA 1BYBA 5ABHA 5DT5A 4KH2A 4H41A 2XFFA 3EMQA 1UKPA 4CCDA 4B9ZA 1QI0A 2DH2A 3VMPA 3TP4A 1G5AA 4GO9A 1LF1A 4W7WA 2DSWA 4GI9A 4UQDA 4DM1A 4TX6A 2VQUA 3MKKA 5A6BD 4C7DA 1WDRA 2VI0A 4KRUA 1FP8A 5KEZA 4L4OA 4AIUA 2JE8A 1XH0A 2HISA 3L4TA 3SURA 1H09A 4WK9A 3VKKA 4AZ5A 1ODZA 3VD3A 1H49A 4A3YA 1JDDA 2YIHA 3ARTA 1R7OA 2XTKA 3CZJA 3WUGA 5LA2A 3AXHA 1GNXA 2VZVA 5A6LA 1KXTA 4QDMA 4PMZA 1OSEA 1HL8A 5BWFA 5I23A 3CBWA 3FHAA 5BXTA 3PZUA 1ZU8A 4TUFA 4JHZA 2E40A 3O6AA 3VM7A 3IAPA 1V03A 1JZ2A 2JF7A 3N18A 4M56A 5FL0A 3ZJKA 4P7LA 1AQMA 3VIHA 3WDHA 3AFBA 5A94A 3FY1A 2DGAA 2BXYA 2CYGA 3BSHA 4M82A 3CMGA 1E55A 3CHCA 4B3LA 1JNEA 5D8ZA 4JIEA 1ISYA 3BGAA 1H41A 1UA3A 3QOMA 3K8LA 1B3YA 3U7VA 2D0FA 1OB0A 2EPOA 3RILA 2J7DA 1J01A 2CIPA 3QR3A 1PIGA 4BA0A 1ZS2A 1W1TA 1GOOA 5BXRA 2CPUA 4AMCA 2E8ZA 4AZIA 2WM0A 4P7NA 2YL9A 1MVYA 4EKJA 3UG3A 3VD5A 1HJXA 5D9NA 3ALFA 2WVVB 4W5ZA 3VM5A 1SYTA 2YDRA 1Y7VA 2D1ZA 1WPCA 3WEOA 2EO7A 1UR1A 1JZ7A 1HVXA 2DT2A 4KRTA 3N15A 2UY4A 1M53A 1W3KA 2EBNA 1X6NA 2XSAA 1H3GA 1UH4A 3IJ7A 2CBUA 1UD2A 1E6QM 5FOOA 1QHPA 1GQJA 3K8MA 4GINA 5CLWA 1QNRA 2CETA 5A2BA 2W4XA 1W91A 2XGIA 1UR4A 2ZOXA 4PMUA 1QPKA 2WZIA 4KWUA 1FH7A 1RH9A 3VUPA 1W2PA 3OG2A 1QNOA 1CLVA 3ZT5A 2VZUA 3HJEA 4XV0A 1WDSA 4D6GA 4F9DA 1LLOA 1Q4NX 1OT1A 2PWHA 3UERA 4U2YA 4Z2IA 1E0VA 3BSGA 4HMEA 3AYRA 4JFTA 4NRSA 3WQ8A 3U57A 3LPFA 3EMZA 4AD4A 3VO0A 5BYWA 3WBAA 1W9BM 3OLGA 4J3SA 3SUSA 1I1WA 4TTUA 1CXEA 1U30A 2NSXA 1QHOA 1WB0A 5D4YA 5I6SA 2WC4A 3VINA 1J0YA 2BY0A 4X0VA 2DSVA 2O9TA 2G8ZA 3WEZA 2XM1A 2EPKX 4CN4A 2JIEA 3WDPP 5I77A 3WBEA 3LPGA 2WPGA 3WFLA 3DYMA 2X1IA 2W63A 1JYVA 3QOKA 5CQ1A 2VURA 1LL7A 3NSNA 3CZLA 3ZT7A 3AS0A 3F5LA 4JHOA 5CLTA 3RM8A 1UR0A 4MJ4A 4PBGA 1HF6A 1FOBA 3N1AA 5EBAA 3DYPA 1Z32X 1ITXA 1XH2A 3WNPA 1JI1A 4PCSA 5AC4A 2FHBA 1SFSA 4ZFMA 4U33A 2G4FA 4CN1A 2BXZA 1J0HA 2DSKA 1ESWA 1E56A 1BYDA 4ZXLA 3THCA 1VRXA 1CLXA 1WP6A 1UKTA 5CXPA 4PUEA 4D6HA 4Z2JA 5GQBA 4E4PA 2WMFA 1WDQA 4UFKA 2EPNA 4EK7A 1YQ2A 1LL6A 1OGGA 1J0IA 3ZIZA 2D0GA 4JKMA 2G3MA 2WKGA 2TAAA 2BHYA 1UD3A 3WQ6A 2ZWYA 1K9EA 2WZEA 3ARUA 1C8YA 2ZXAA 3FAWA 4QLKA 7A3HA 1DHKA 3ARSA 3WD3A 2QMKA 3VD7A 1OD8A 2NT1A 2WW5A 2Y8VA 2YBTA 4LGXA 4PMYA 5EMYA 3VGBA 1LJYA 1HNYA 1GOMA 2O9RA 5HPOA 4MADA 5DEZA 1CEOA 2W66A 4N0RA 3SEPA 4CD4A 3M07A 2WBKA 3GXDA 2F8QA 4HU0A 2XHYA 4U2ZA 4AZHA 7CGTA 2B31A 4XUYA 5CPTA 4LYRA 1W3LA 1XCXA 1WO2A 3BLPX 1K9TA 2V3FA 5A6AA 1D3CA 5M17A 4BQ4A 3AIQA 4JFUA 1V3MA 2A3AA 4UQEA 1TG7A 3W6LA 2DH3A 4JL2A 3RIKA 5CJ5A 2E3ZA 1NARA 1KXQA 4L4PA 2GJXA 3CMJA 3U7BA 2CEQA 2D24A 1E43A 2WZHA 4QCFA 4JCMA 3WQVA 4AWEA 4PUDA 5A8PA 2JALA 2ZXDA 4J3VA 4GIAA 1BVNP 2D22A 2GDUA 2Z1KA 3VIKA 3SCOA 1KWKA 1E3ZA 2YL5A 1TUXA 1G94A 3ZOAA 3RDKA 4UQBA 4CN6A 2E9BA 3ZSTA 2GSJA 1E0XA 4KGJA 4NRRA 1BAGA 4DUVA 3WDJA 1E3XA 4LQ1A 4RE4A 3WUFA 2YL6A 3QHNA 1UWSA 3NDZA 5LA0A 1QI2A 1CGVA 1E1EA 2V5DA 4EANA 4RE3A 1GQKA 3PTKA 3AIWA 3VX0A 1FHDA 1J12A 4PTVA 3WD1A 1XSJA 1UWQA 1ZJAA 5M3WA 2ZUTA 3QGVA 2FGLA 1QNSA 3GM8A 3B9DA 3T2OA 3A3HA 3L4UA 1E0WA 2J7BA 4MPKA 2WB5A 2VVNA 3ALGA 3M46A 4WKHA 4JKKA 1BYAA 4ACYA 3CZGA 1UZ1A 4PMVA 1EHNA 3A4WA 1XHGA 5E70A 1XSKA 3GXFA 2IXVA 1UH3A 4WKAA 4U3AA 2D23A 1YHTA 4UR9A 4AXNA 1JFXA 4W85A 3W81A 2Y2WA 4HMCA 2ZUMA 4MNJA 4W89A 7TAAA 1NOFA 2J8GA 2PWFA 1KQZA 3VOCA 3N13A 2VMFA 2JFEX 3AMCA 4PMOA 2BVYA 4IISA 4AY1A 3EDFA 3N11A 5A6JA 4NSBA 3WF0A 3OB8A 1CYGA 1E4MM 1KGWA 4YHGA 1CENA 5IHSA 4HOXA 1JYWA 1KGUA 5F7UA 4ZE5A 3AHXA 3W4RA 3BAJA 4F8XA 1WZAA 4YN5A 1HJQA 2VX7A 1NOWA 3AHYA 4ZEPA 1W9VA 2A3HA 2J8FA 4JKLA 8A3HA 3W0KA 1JYNA 3PZVA 1HJSA 3B9AA 5D8WA
chains in the Genus database with same CATH superfamily
2E8YA 1I75A 3WLQA 1KWGA 2OGJA 4F2TA 1XLKA 6XIAA 1A3HA 3EWWA 2OWXA 1XRFA 4DJFA 1CGYA 3ITGA 1EP2A 4EF9A 4B5NA 1W1B1 3SADA 3B3DA 1JI2A 2WSYA 1HKIA 2YW4A 3DENA 4CD6A 2DZPA 4O57A 1MUMA 3O16A 1B31A 1CDGA 1Q65A 5FKYA 3O1NA 5I2UA 4R34A 2WHLA 3KE0A 4P8XA 3GU1A 2VJXA 4AISA 4RLIA 1MFUA 1NAL1 3M0MA 2ZA2A 1THFD 4Q7NA 4ZOAA 4E8GA 3MTWA 4KEMA 4XAZA 3DH7A 2PTWA 4L7ZA 3DIPA 4TV5A 3EX4A 2ESCA 2FPYA 3BQ5A 3VNMA 5T9BG 3HQNA 1XLDA 5ABGA 4M19A 7REQA 4NX5A 2VC7A 2A3LA 3CYJA 4XZIA 4IQLA 4HA4A 3W1AA 3EXRA 1UZDA 4JIHA 4ILSA 2H8ZA 3ZJ7A 3GHSA 1HKJA 4CLMA 2XG9A 4ZVJA 4DWSA 2GFTA 1QW8A 2DZXA 3TJXA 5C9RA 5I5RA 3CMFA 1H7RA 3AZTA 4DI8A 4F40A 2OQYA 1DV7A 4EPKA 4FX7A 3A3XA 3WUBA 1X1OA 3LM3A 3TYBA 1HKMA 1K8YA 2PDKA 2X7VA 3ONBA 4H8HA 4GQQA 1CXFA 4W87A 3W74A 2DW6A 1GKRA 2Y4SA 1ISWA 4RPPA 3C2VA 1MRAA 4HHHA 2WC3A 3ARQA 2Z29A 3NXFA 3W7MA 3INPA 1G01A 5XIMA 4GYJA 4CU8A 1XLFA 1S2UA 5DCDA 3QYSA 1PTGA 1MW0A 4V1XA 1LUCA 3KOZA 3KLLA 1L9WA 1PIFA 2DIJA 1W0MA 4Z2GA 2W79A 1HO4A 4ZBCA 2YLLA 1BXCA 1R3VA 3VYLA 2MNRA 3L9CA 4FMVA 4POCA 4ROPA 3QV8A 1XUUA 1UZ4A 1E6NA 2E6FA 3L4WA 3WSUA 4HK5A 1VJIA 3SGUA 1EPVA 2OWWA 1V6VA 5EPDA 1PX3A 2V3EA 3QQ0A 3PULA 4HPGA 2G3IA 4DJED 1IIHA 3NZGA 1QNQA 1KFWA 3ZR4A 1FCQA 3KUMA 1EJUC 3M44A 1Q6GA 4CD8A 3GH4A 3GYCA 1EIBA 1GJWA 3AXKA 4GHRA 5JU6A 2PSNA 3KOYA 3OZOA 2JEQA 1JAEA 4NG3A 1L6WA 3CV7A 2RH9A 2XJ7A 1KLZA 1QO5A 4QE5A 3SCWA 5ABFA 1EFZA 1EOKA 4WHBA 2D3LA 4Q8QA 1UOKA 3M0VA 3W71A 1QOQA 4JEJA 3E74A 3N14A 2Y70A 4HYVA 2E0PA 1SZGA 4NJKA 3V1HA 1FVPA 2FH6A 1OWQA 3TMLA 4US5D 4FOJA 2EQDA 4B5UA 3NSMA 1YBQB 3W75A 1TWDA 1S3TC 2GSHA 2OYLA 4WQ6A 4XVDA 4R9OA 4DPPA 1VEOA 1BTCA 5BOOA 2XVPA 3SECA 2AKMA 3IARA 2WBGA 3FEQA 3WLHA 1P0KA 3L4YA 3NM1A 5KMYA 3NQMA 3RJXA 4LVFA 1CNVA 5BRQA 5KZMA 4ERAA 1OQFA 1KM3A 3A4JA 2JKPA 1KLYA 1QAPA 3S83A 4G7EA 3W2MA 5LZLA 4Q4KA 3W25A 2HROA 5FI8A 4N2YA 3SUWA 5IFPA 2PAJA 4LS2A 3NQDA 5H2ZA 1W3HA 4YTRA 2POTA 5FJTA 2FZ8A 2Y8KA 2D0HA 3RN6A 1RBLA 1BKHA 1R87A 4BCEA 3P93A 3FYYA 2C8NA 4YWSA 1Y5VA 1CWYA 3E1F1 4B92A 3LA4A 1KXVA 3MWCA 1XBVA 5LNWA 2PDUA 4EXBA 2PLKA 1V0NA 3PJUA 1IZJA 4CD5A 1GYNA 1B1YA 6PTDA 3LXAA 4CNUA 3PFMA 3C2YA 5E09A 3GC4A 3AICA 4HJWA 4AZ6A 1NQ6A 1PL9A 2ZZ5A 4DVOA 2P3ZA 5D33A 2ZXBA 1BSLA 3GR8A 3WX7A 3RMJA 1OABA 3USBA 1P7TA 4EPEC 3FK4A 4KCUA 1FP9A 3UCQA 1VBHA 1W9DM 4ZSUA 2ZZ6A 3ZM8A 2PGRA 1C92A 3QPZA 1IT8A 2YFOA 4KESA 2RUSA 3WNKA 3FHQA 3TYCA 3IWPA 1LBLA 3N4FA 5EGRA 3CQIA 4EP8C 1LZOA 2OKOA 4AX6A 3SGGA 5A8OA 3PVFA 3ANVA 3E2QA 4M6QA 3AOFA 5AVHA 3TWBA 5CZKA 2YXXA 3G22A 3CL8A 1ZHAA 3W85A 2FGBA 1AH3A 3W1TA 2TYSA 4Y8FA 4MB1A 1V7YA 3NURA 5BOEA 3PTDA 2CLMA 2I56A 3R58A 4IG2B 1R3YA 5A8GA 3RAOA 1MXDA 4GCXA 2YA2A 3AXIA 1KCZA 2F61A 1OYAA 4L56A 3RPMA 4D2JA 2GLKA 1A50A 1H7PA 1V8EA 2HRWA 1OC5A 3VIGA 1EC9A 4J28A 1J4EA 4M6VA 4S3FA 4F3HA 1R6WA 2D2JA 3E5BA 3QRHA 2PBGA 1VHNA 3WBWA 2OT0A 5A3HA 1DL3A 3SY5A 1WCGA 4PUMA 1E5JA 3GZAA 3QHMA 4GKLA 3R43A 4IM4A 3MCOA 1RQHA 1OFBA 2PRMA 5FF0A 3S4TA 1V77A 1VYRA 2XFRA 3MUZ1 3QTPA 2J7CA 4LU0A 4ZL1A 4KT2A 4K3ZA 1U5VA 6TAAA 4HNOA 4DZIA 2BSLA 2J27A 1F3WA 1T5AA 2ZX9A 2XGZA 1RP9A 1JD9A 3PAJA 3PB0A 4GY0A 3ARVA 3WFZA 1OX4A 2BV9A 3RRAA 2CESA 3AHZA 3WELA 3CL7A 2BODX 1AODA 2WJZA 3MP4A 3N3MA 3RCMA 1XYZA 3L2LA 1W3NA 3VD4A 2GQAA 2O7SA 3W7IA 4UTFA 4DO4A 4V15A 3S1UA 3HG2A 2DQWA 1J6PA 1Q5MA 3TV8A 4DBDA 4DXKA 1GJUA 2FZMA 4K8EA 5D2WA 4HU4A 3G0UA 4YL2A 3WNOA 4J3ZA 4I6KA 3KBNA 4WSKA 5HXMA 3MJMA 4DZ5A 4GQ0A 3I65A 2OYMA 3REQB 1RVGA 3NQEA 4LUJA 4QDWA 5E6ZA 5LGZA 1TPH1 2ISWA 1EC8A 3LXBA 4CU7A 3G77A 4XKMA 2EG6A 4H2HA 1G4EA 3KHDA 3U5UA 1U22A 2E68A 1VZWA 4P7RA 3R7MA 3UZ5A 2GJPA 5JBFA 1C90A 3OBAA 5T9CE 5F4XA 1BVWA 1VPXA 1X98A 1RPKA 3POCA 2XUCA 2ISVA 5ABEA 5C8BB 4C5ZA 1VFSA 1AL7A 2ACRA 5I06A 2J25A 2WO5A 5DFAA 3QR1A 3FEMA 1UR2A 2VEFA 2VEPA 3D46A 3TYUA 3B0XA 4ATWA 3RITA 3A13A 3GU2A 4KFOA 1W1VA 3MSDA 2FJKA 4J3TA 4FF5A 4JN6A 5D05A 4EPBC 1QFEA 3T0AA 2WNNA 5FSEC 3R0UA 1TJ0A 1E6SM 4KGLA 3GO2A 4ATLA 3GAKA 3U6WA 2DZAA 1TELA 4F2UA 3ITCA 3AYSA 4DXXA 2BY1A 3BJSA 4M24A 2DT0A 3H70A 4P5UA 2PEVA 2PWUA 3TTYA 3CYVA 3BCJA 3I10A 1QRQA 1L6GA 1Z48A 3EWYA 1SZFA 4BF9A 4CNSA 2VRKA 3OU8A 3W28A 5HOSA 4OBTA 3VNZA 3MZ2A 2FB3A 3CXOA 1XDJA 2J78A 2VZSA 5HMDA 5EY5A 1K9DA 1KM2A 4JTGA 1FDZA 4E3VA 3KOWA 1O6IA 2WYSA 3BLKA 2HZGA 3UETA 2PWGA 3ATZA 3VDCA 4F79A 3DESA 2J74A 4PTDA 1WX0A 1FCVA 3CHFA 3UA3A 2PPGA 1PZ3A 4LAOA 1V6WA 2R1MA 2ZZ4A 2YDSA 3NIYA 4C1NB 1JNDA 2VD9A 1DJZA 2VUYA 4I6VA 1W2VA 1I45A 3W82A 5B7YA 3DN5A 2PUZA 3GXTA 5DMNA 4ATDA 1EDQA 3GFXA 4RKAA 2NVDA 3R94A 2WZTA 3N25A 4BWLA 2HVNA 1DWHM 4MOZA 4IMFA 2VXNA 4IOTA 4D71A 1UWIA 4IHCA 4DXVA 1YPFA 1PAMA 5CKSA 1DWIM 4S1FA 3CWOX 4QFUA 1WXYA 3WG6A 3F5KA 3W1NA 3RCYA 5CCZA 4X60A 4LF2A 2R8WA 1QO2A 1TPDA 2XWDA 3R11A 1PE1A 4Y7EA 3CTLA 1PZ1A 2VGFA 4MAVA 4X0NA 3Q94A 4JS3A 3BAWA 2EPLX 3C8NA 3TSMA 2YXGA 5A5WA 1F76A 3PY2A 4I7UA 3LEPA 3GXMA 4FNTA 1MEWA 3LSBA 1ZBCA 1H1ZA 4OBSA 2Z0IA 6TIMA 1VBJA 5C70A 2DSUA 2VGBA 2QV5A 2QDGA 2QCMA 3OLDA 2ZE0A 1GW1A 3MMUA 1TR1A 2P5NA 1M03A 1X8CA 2I5GA 4WF7A 3NA8A 3NQ2A 2VZTA 3W1RA 3BMWA 3CGTA 3VGHA 1FWEC 4ZO7A 1RR2A 1ISXA 1S1PA 2ZUUA 2VCCA 3WJSA 4UFLA 1YNPA 4X22A 3FIGA 3K5XA 1YPXA 4TMBA 1PV8A 3P80A 4UC5A 1L8PA 1WZMA 2CHRA 3H4XA 4GPNA 3NZQA 2YGYA 4XIMA 5LIYX 1HJVA 3A9IA 1Q6OA 1LDCA 3N6QA 2VKZG 5HBFA 4A29A 2E9LA 3DKJA 1Q6EA 1BPLB 3NSXA 3URBA 3GNRA 3UVAA 4C7FA 2GOKA 4J2MA 3O6DA 4DUXA 5EMJA 3EKZA 1RLDA 3P84A 1QMLA 4M6UA 2WJFA 1SMDA 2PDPA 1TZZA 1JCNA 1NH6A 1ZJIA 3OW1A 4JTUA 3LENA 1T8QA 4Q7IA 1UW9A 2ATSA 4HQVA 4R5EA 3TC3A 3UR5A 5ECUA 4HYRA 3VDBA 3SR7A 5H8PA 3DBPA 2DJLA 2V82A 2DVUA 5CPQA 4Y2WA 1X1ZA 4NUWA 5IBXC 1R9XA 1RCXB 1POKA 3BWWA 1R8LA 4IMCA 1VGAA 4L64A 2C18A 3H23A 3TW7A 1RHCA 3KHJA 3VIFA 4UFIA 3PWIA 1B3WA 1TTJA 4MDPA 3T7VA 1F3TA 4EWJA 4LOCA 4F9JA 4ZQCA 4DM2A 2A4AA 4GUJA 1TV2A 2NUYA 3BJTA 3ARRA 1ZCCA 2C1HA 2OKTA 4O18A 2HE8A 3QGAC 4XB3A 4O8RA 5HANA 3ABQA 2V2DA 4CCEA 3QN3A 1QK2A 3VOGA 1FWFC 1C93A 3WK0A 3W3OA 3H4GA 3VILA 1GONA 5DANA 1PVNA 2XWEA 3WD0A 3ZVHA 3MCMA 5FEWA 1IEXA 3K46A 5B80A 4TIMA 5G4WA 1W9PA 1E4LA 4PR4A 3BAKA 3S47A 4PE8A 5KETA 1A5BA 2V63A 4YCOA 2QULA 2PP0A 4WSJA 3M5YA 3T4CA 5CSSA 3KWXA 3VPLA 1MW3A 4UTKA 4KS0A 3DFTA 4AFYA 3T2PA 3AYTA 2P3EA 3EBVA 2FZBA 3MQTA 3E12A 3CWNA 1PKLA 4FO4A 1Q2SA 2QQ6A 4GZEA 1HO1A 3UJ2A 1QCWA 5F4WA 4BF5A 1KRBC 1KQYA 1LRNA 3LGGA 1EDTA 3OIXA 3G3MA 4D72A 3VD9A 3AUOA 4M51A 2ISDA 4AYSA 1EWEA 1XJBA 1ZAIA 5CBBA 4QBXA 4BI6A 5CG0A 4AIBA 2WVVA 4KQNA 5A69A 2EJ1A 3L66A 1UG6A 2BFGA 1RZMA 2IPGA 1T99A 1BG9A 3NPVA 1LBMA 2PDLA 4ORIA 3DHPA 4EIVA 1REQB 3HIJA 1DVJA 4C6BA 1UC5A 4GX9A 6ALDA 4AWSA 3B05A 4PSRA 1BFNA 1U5JA 4PB5A 3NO1A 3MMDA 1TTPA 2ZICA 3EDKA 1ONXA 1V5XA 4RXGA 1UJQA 4M5PA 3F4VA 2HSAA 4FPSA 5A6TC 1XGEA 2X0SA 5EU9A 2OEJA 1FCUA 2A6NA 3PUOA 2ZXQA 2QCCA 3NPUA 4E2OA 5C0QA 2AOSA 1VS1A 3WQ4A 3H26A 3SZ8A 2WVTA 3O2LA 4D8ZA 2ZX7A 4RNHA 2EEXA 1M65A 4H8VA 3U4AA 3EKGA 1OIMA 3UYIA 2QUMA 4MWAC 4HTBA 4XZWA 2WWCA 3CZEA 3UR8A 3ZS4A 1NM9A 3KS5A 3I7RA 3LHZA 3D3AA 1W17A 1LQAA 5A2AA 3NQGA 2JF6A 4X61A 4V2XA 3UPBA 1XLAA 2J7HA 4JTAA 4BF7A 1KM0A 1TV8A 4B2DD 2QS8A 1BXNA 1MW2A 2DT3A 1NEYA 4PTXA 4UIOA 4FXJA 1O5QA 4HNNA 1E9IA 7TIMA 1JZ4A 3BW3A 3A5FA 4BZYA 2XFFA 2Y89A 3EMQA 1ZCOA 1UKPA 3LLFA 3QSTA 5LIUX 1JCJA 1YKWA 3VMPA 1G5AA 2GGIA 1LF1A 4W7WA 4DM1A 2A1YA 2ABBA 3QKZA 2E25A 3QW3A 3TN4A 1FP8A 5I03A 4L4OA 2JE8A 1XH0A 2HISA 3L4TA 3QF0A 3BLFA 2PDIA 3VKKA 3TAKA 3TW9A 4JQ3A 2ZZ2A 3MKVA 1KFJA 4FA3A 3GVRA 3HPXA 4FIRA 2NLYA 4GUIA 1R7OA 2XTKA 3LOTA 4WOZA 3AXHA 5CZ0A 3RNDA 2VZVA 4IIBA 1Q8JA 2OEMA 2GVEA 4PMZA 1OSEA 1HL8A 5BWFA 5I23A 2HEJA 4RDVA 4H9ZA 1A0DA 3B0PA 3C3NA 3PZUA 1P0BA 4RZ6A 4JHZA 1X8FA 4OFCA 4LUSB 3JVAA 3V16A 1W8SA 3AFBA 1WDDA 4PA8A 2BXYA 3IV8A 2VDIA 1H1YA 1XPGA 4XAGA 4JYDA 3F4WA 3PPCA 2YBVA 2VP8A 3EWZA 5D8ZA 2WNQA 4X63A 3R1ZA 3TDFA 1KTNA 1H41A 1UA3A 1D9EA 4YJ5A 4GJIA 1OB0A 1M41A 4QISA 5DCEA 1Y65A 1XYCA 4BA0A 1ZS2A 1W1TA 1WOAA 5BXRA 3FVMA 1XYLA 3MHGA 2WM0A 2ALRA 4P7NA 2YL9A 3KBVA 1BRLA 3RHGA 3UG3A 3S9IA 2Y8UA 1HGWA 4KFPA 3GD6A 4W5ZA 4N9EA 1T7LA 3GVGA 1SYTA 3H2CA 4D8LA 3W07A 1UR1A 4ZO6A 1OC7A 2DT2A 3BPWA 3PUEA 3VKDA 3N15A 2UY4A 3DFPA 1M53A 1W3KA 3IJ7A 3TYEA 2RDTA 3NM3A 3G1DA 2P76A 4QGCA 1AA1B 3ZLFA 1GQJA 5A2BA 4KIRA 3DBNA 2CZFA 3EPMA 1V93A 3WJYA 4PMUA 4UBPC 1QPKA 2P88A 3M0YA 3PK7A 4KWUA 5HAOA 3TOYA 4NZ5A 1SUXA 1QNOA 3LLDA 2DUXA 1K03A 2VZUA 3HJEA 4PCNA 3E9AA 1LLOA 4AX7A 1Q4NX 1EA0A 2OJPA 1OT1A 2J24A 4O1EA 3OVRA 4Q32A 1K7XA 3BSGA 1DJWA 3N34A 4KIEA 4O50A 1K6WA 3WLIA 3QV9A 5MKGA 1GQNA 1OHLA 4AD4A 3TR9A 5BYWA 2GSEA 1ZJHA 3TYZA 1GZGA 4TTUA 3PJTA 2F9RA 1QHOA 4DBUA 3HOJA 1VR6A 2NQZA 3WEZA 2EPKX 4L65A 4CN4A 4XZMX 1FXQA 5T26A 3CV1A 2A85A 3WBEA 3KVMA 1X6UA 3WFLA 3TMQA 1EUAA 2NWSA 3UPMA 2IQDA 2VURA 3NQAA 3CZLA 5BNKA 1L6FA 3AS0A 1KD0A 4JHOA 3VKAA 2FLIA 3SSZA 2CLPA 4MJ4A 4C65A 6XIMA 3NFUA 4AMAA 4O0QA 3GYEA 1R3TA 4HNVA 5EMLA 3EX6A 4IT1A 4FI4A 2VGIA 3LCFA 2F6XA 4NNAA 4DJDD 4CN1A 4FHAA 2ZFAA 1ESWA 3OYZA 3AUJA 5HJYA 1VRXA 4JQ2A 3GUGA 2E6DA 1VP5A 4GJJA 3ICJA 2E5BA 2ZDRA 4Z2JA 1ENUA 5GJMA 1W5MA 4E4PA 2WMFA 1KBLA 2Z27A 3T42A 4JNMA 3W7LA 3L5AA 1OGGA 3ZIZA 1A5KC 4A8RA 3H7RA 4ADUA 4E0CA 2Q3RA 4JTKA 3V1PA 3QXBA 5I3JA 3TQKA 1TRIA 3GHTA 4N9BA 4QG9A 1KKRA 3ARUA 1C8YA 4ICMA 7A3HA 1PWLA 1I2NA 1TJ1A 3QBUA 3WD3A 1NTHA 1XRSA 5LXXA 3GG0A 4FSAA 4BEUA 5C6MA 2QUNA 1GOMA 3P3BA 4IH3A 1V51A 2W66A 1CT5A 3M7WA 1YTKA 1DQXA 4CD4A 4AHPA 3BV4A 3L5LA 4HU0A 3W84A 1XCFA 3IGUA 3QMSA 4HNLA 4O11A 4XUYA 4LYRA 3RLHA 3FA3A 4R3UA 1LUCB 1TPFA 1FDYA 1K9TA 4BQ4A 2G3FA 4KWVA 1V4YA 1XKJA 3KLKA 3FSTA 2H3BA 5CJ5A 4L4PA 5LSMA 3IPWA 1YDOA 3U7BA 4CNNA 2E5DA 2CEQA 2D24A 1SU5A 4XG1A 1DIEA 4QCFA 3HV8A 4JCMA 4AWEA 4UTHA 1SZRA 1BVNP 4YWIA 3VIKA 1KWKA 1E3ZA 4I9TA 3L2IA 1G94A 3ZOAA 3LCIA 4CN6A 3CWHA 1E0XA 4DUVA 5AVNA 1Q13A 3WUFA 5PTDA 1AFSA 2PRLA 3VNKA 4DLFA 1HUVA 4PRRA 3FX4A 1UWSA 2OFJA 5LA0A 5FAGA 4E38A 2V5DA 4H4IA 3VX0A 3B9NA 3T4WA 3UZZA 3H7VA 1E9ZB 4H83A 1B9BA 3B9DA 3BO9A 3A3HA 3UXLA 3N9RA 3L4UA 1E0WA 2VVNA 3ALGA 3M46A 4GLEA 4JKKA 2P0OA 4DYJA 3M5ZA 4PMVA 1XHGA 4NIRA 4GFSA 3GXFA 5EL1A 3NQ8A 4HCHA 2VFIA 3PBYA 1WKDA 1J5TA 3B8UA 2ACQA 2IKIA 2HDJA 3LRKA 2OX4A 2PDBA 7TAAA 5RUBA 3E49A 5CC7A 2J8GA 3VOCA 2VMFA 3GR4A 4IJRA 2FDSA 4IISA 2TMDA 3M0KA 4ZR8A 3RK8A 1B4EA 3OB8A 4ZZ9A 1CENA 4Q4MA 4IFRA 4HK7A 1I4NA 5FESA 2YSWA 4F8XA 3VABA 3LTPA 3KVLA 3AHYA 3GDLA 1IWBA 4JKLA 3W0KA 4C6DA 2VELA 4ES4A 4J7RA 4UMCA 4FX6M 2W0UA 2Y24A 4F0SA 3ABZA 2AGKA 4QRNA 3SUVA 5G4HC 4FP1A 3O15A 5JH1A 1GOIA 3SCUA 4CVWA 4OUIA 2AMXA 5HR6A 1XLIA 1KNWA 3UY7A 2D69A 3BAYA 1O1HA 3L4VA 1DEDA 1VIWA 2X41A 3L68A 1A5SA 3V36A 2QW5A 1XC6A 3TOPA 2CZEA 1ZBVA 1XSIA 3WLRA 1JUEA 4F66A 3GFYA 4MPQA 1XRVA 1YBQA 3DECA 2MANA 1H0IA 2WKLA 2XVGA 2YA1A 2Z1VA 1A5AA 4O14A 2XM2A 4JGDA 4IICA 7ENLA 4ORMA 1H7NA 1ZSXA 4XD5A 4AF0B 4LY4A 4GNJA 3SQLA 2WQPA 2B7OA 2ZA3A 4HZ6A 2XSXA 3BH4A 1ZENA 2VVSA 4MF4A 1I1XA 3E0LA 1W37A 3GTNA 1OCNA 2GJXB 4DUWA 1NFGA 1JZ8A 1R3SA 4PMNA 3ZQ9A 2CLFA 4E2VA 2J7GA 5D03A 3HMCA 5FACA 2QDHA 3MZNA 4IQDA 5D32A 1UKOA 1GOXA 1QATA 4IF2A 4JYFA 5FJPA 1N82A 5I24A 5KZEA 2NQ5A 4LNYA 3W7HA 3VK5A 1Z41A 1Q6CA 3EA1A 3FAXA 1X96A 1VCVA 2QF8A 4DWSC 4J3UA 4YYFA 2QCDB 3W7OA 3UXDA 1RP8A 2WLZA 3MSGA 1KW1A 4C6LA 3MUIA 1W5PA 2V5LA 1GOWA 5IHRA 2DIKA 2X0YA 2TRSA 2X05A 4AH7A 2X42A 1IV8A 2IPJA 1M9HA 3W38A 2QPSA 1J10A 5CPOA 3CQHA 1F6YA 2CLHA 4TX8A 1KBBA 1V0KA 3G18A 5AYYA 3PFRA 1TV3A 3IJ9A 1DE5A 1U1UA 2Y5JA 1GUVA 3W2NA 4IP7A 4W8AA 1ZB5A 1EIXA 3W29A 3SJ3A 1AQHA 3W22A 4GG9A 4PEEA 4DAFA 2CBIA 2XIIA 2QLYA 4HK6A 1DXEA 2FTYA 3W1MA 4ERIA 1CGWA 4MVAA 1JGIA 1CGXA 2RGLA 1JUKA 2ZWZA 3G1RA 1W9XA 3UXIA 2XZ9A 1H50A 1GTEA 2INZA 3STFA 3MW7A 1EOMA 2VGGA 4MWAE 5JIPA 4F0HA 2ZRUA 4IPNB 4Z2HA 5JUVA 1QI5A 1EQPA 4Z1AA 3JZEA 4O16A 3A21A 1XDMA 3TH6A 3HG5A 2CZDA 1XIDA 4MWAB 3G1VA 1MDRA 2QJIA 4B5TA 1EWDA 1YIXA 1ZL1A 2G3JA 3AU2A 3ANYA 1W3JA 2YB1A 1RVKA 4W86A 1HT6A 2J75A 5G1MA 3PTMA 2DZVA 1MQPA 4DRSA 1V6TA 4ZB2A 4IG2A 2WOQA 4LY8A 4AC7C 1A0EA 1A53A 1K8XA 3O3RA 1R7AA 4QSFA 4ALDA 1MWOA 1ZPTA 3IJ8A 1EA9C 1A5NC 4K38A 4GX8A 3H2NA 2I57A 2PCEA 2FQIA 5LIWX 2CW6A 3V4BA 1F73A 4D6JA 3SCSA 3ZR6A 2W5FA 4D1IA 2BXVA 1MQQA 3TA9A 2E9MA 5CPSA 1Q6FA 3WH7A 2QVHA 4PTNA 1MNSA 4AZ7A 2VFDA 4IFKA 4NAEB 2HE5A 1N8IA 1Y5WA 4UMBA 2WANA 1GVIA 2BZNA 3NZRA 4H01A 1TPVA 3BLLA 5H6HA 2FFIA 1RA0A 3U48A 1JQXA 2BOFX 3CT7A 4DJFD 4B90A 4HN4A 4BR1A 5C2GA 4GUFA 3BICA 2J77A 2A3BA 1KO0A 1BEUA 4FS9A 3N2CA 4L6DA 5AFDA 3PANA 2J6XA 1FFRA 4CUCA 4DNHA 3UBPC 5HNNA 3PNZA 4AZBA 1D2KA 3PHAA 1M7JA 4TQTA 3U2OA 4HZMA 2WJEA 1JF6A 2B81A 3WDIA 1TA3B 1V02E 4MDOA 4UQAA 1Q6LA 1J96A 2V81A 3KAOA 3LPOA 3W83A 3PZOA 4XZ9A 2X1RA 1R9ZA 3W7GA 1MO0A 2NXGA 1KR0A 3E0FA 4MGGA 2PDFA 2NQJA 1D3GA 1HL9A 5FF4A 2QGYA 4NJIA 3REQA 4NAFB 3Q4DA 2C0HA 2VX4A 5I02A 1UROA 3P0XA 5DF0A 2PDWA 3VNYA 5GNYA 1EYWA 9XIMA 3UWVA 3NQVA 3C5QA 1QW9A 1H7WA 4OUEA 3LK6A 1KCLA 1W9UA 3P14A 1M7XA 2VT0A 4J9JA 2XN0A 2A79A 2GGJA 3L0GA 3M41A 3E2VA 3DYOA 3IUIA 4HHMA 4WKFA 3WD2A 2FYMA 3ZFHA 1JXKA 4GZ7A 1E70M 4OTKA 1XGZA 4PUJA 3UESA 1ODUA 4YXGA 3QZAA 3TROA 2CERA 2QPXA 3IJDA 1TWZA 2XINA 1OVDA 3LBCA 3MC5A 3W02A 1XFBA 2OLAA 4UTLA 1VFMA 1H1NA 4JXCA 5D04C 3WMSA 3CAWA 3LY0A 3T55A 3B40A 1GVSA 2XIMA 4RZ4A 3M4HA 4ZE4A 2WV8A 4L80A 4WX2A 3IGSA 3AMDA 1V3HA 4P8UA 3ZMRA 5AHLA 2J7FA 3ARXA 3PP7A 1YMYA 1CLKA 2PLMA 1RQBA 3KTXA 2DIEA 1TPB1 1ONRA 1E0UA 4J3XA 3KOXA 1SZNA 1LL4A 3GG1A 4ICCX 3PZNA 4HPHA 4MTVA 3DCPA 1JZ6A 4MYXA 5D2VA 3AMLA 4PGLA 4IFOA 1GG0A 3WLJA 2V3GA 1GK8A 4LYQA 2VTFA 4W8BA 1B3OA 5CSRA 5H8UA 2YR1A 3BQ6A 1WZKA 2X2YA 5LA1A 3R8HA 1C8QA 1CBGA 1WYIA 1B54A 3DC0A 4U28A 4GK8A 4UXDA 4M8UA 3A12A 9CGTA 3STEA 4Q33A 2O55A 3WDRA 3LD5A 3BUVA 2PC4A 2JK2A 3URAA 5IXEA 2QCEA 2VX5A 2XSBA 3S2CA 4FXFA 1NFBA 3UQNA 2ZVIA 2OODA 2WMIB 4YHEA 3TVAA 1JDFA 4IPIA 3NPWA 3CHDA 4LAMA 4OOUA 4AC1X 3QC3A 4MZ1A 4YVPA 1UUQA 2BGSA 3B4YA 5AYZA 3TE9A 3ZWSA 4DF0A 1VFOA 2EPMX 2JGQA 2BS9A 1I2OA 1TTQA 3EXTA 4HNCA 4BEQA 3V7PA 3RFAA 3U5YA 2GJRA 1DYSA 2GJLA 4CEXC 4PCPA 3W00A 1CZ1A 1AW2A 3ABXA 1JG9A 4C6QA 3G1HA 3B04A 5AYIA 1H63A 2NSOA 2QUUA 1RJRA 2GUBA 3VX1A 1NQKA 1HN1A 4TVUA 3KTCA 2HS8A 4JL1A 2PLCA 3GU9A 5BZAA 4Z1BA 1U1JA 5DELA 3OBKA 5C2XA 4QROA 3SCVA 1VLWA 1Z44A 5E9XA 1RA5A 3JS3A 4AHQA 1TVLA 3QPEA 3CHEA 2ZYFA 2DZBA 2PB1A 1NDYA 5BRPA 1FXPA 3SBFA 2ZDSA 3Q2DA 1KXHA 3TYDA 5J8LA 2Z1XA 3MPGA 1WAUA 2EGZA 4PMXA 2OYKA 2INFA 4B16A 2C15A 4AUBA 4J27A 3W7QA 3VNLA 3I68A 1F7BA 5HA7A 2A5HA 3OVPA 3SUUA 1F05A 3OPSA 3B8SA 4RW5A 1PX4A 1HFBA 4GE8A 3NZ1A 1JR1A 4GWEA 1XH1A 2IPWA 2ADAA 3EDJA 3KDOA 3H53A 3TTSA 3T0BA 4GNKB 1QOPA 3IIOA 3CU2A 2CHNA 4IX0A 2GK1A 3BL3A 1OFDA 1FKXA 1W56A 4C6OA 1JPHA 1QBBA 2RDUA 2VOMA 3GIPA 4PUWA 1P48A 3L67A 4W84A 3GZ3A 3QSRA 1G4PA 4V28A 2OR2A 3ONCA 4O17A 4JAWA 4V33A 1VFUA 1EYEA 2Z1WA 3EX2A 1KM6A 4F0LA 4GY1A 1C8XA 5K4ZA 3ZVHB 3OGRA 1AMKA 4C6PA 2REQB 1FWCC 3OGSA 4JIQA 1NWUA 2C7FA 2DZSA 3WF3A 3W87A 1TJRA 5FJUA 4D6DA 2Z28A 3G1XA 4AAJA 1CCWB 3W27A 4PL2A 2PF0A 4MZYA 2Q8ZA 3B4UA 2G5WA 3QY8A 1QI3A 4U5KA 1IQ8A 3DERA 3KL0A 4IGNA 3RX3A 2VEMA 1BSIA 4DAIA 2V6AA 4LB4A 3VKJA 1OFAA 4S23A 4I3GA 5IRPA 2UY5A 1B3ZA 4FNQA 1MW1A 2HTMA 4W7VA 4B91A 3S3GA 4NI8A 3G1AA 2FZ9A 3VOFA 2QGHA 1JZ5A 4Y8EA 1I8JA 4UTIA 5D30A 3GUWA 2ON3A 3WF1A 5BOFA 3PZGA 5A1AA 3S46A 4DYEA 3MHUA 1XYBA 3HFTA 1G1YA 4WDUA 2XU2A 1TVNA 1OC6A 4LXFA 1VFLA 1NOUA 2GOUA 2BOGX 3NQBA 1J5SA 3C0LA 1LT7A 3LNMA 3I4EA 3R79A 5HQLA 5F1UA 3GXPA 4W7UA 2PCQA 4HNTA 2OZTA 3TN6A 3VVGA 4ICNA 1CIUA 5HK4A 2PWEA 3VE9A 4XQ6A 2FVKA 4KCWA 3EPOA 2CNCA 2WHJA 4LV9A 3PM6A 3GG7A 4L9YA 5JVLA 1QNVA 2QDEA 1TCMA 1OF8A 1WDPA 4A4AA 3DI0A 1IEWA 4JTFA 2VENA 1ITUA 1JVNA 2IMRA 1LG1A 2YL8A 3ITOA 2G0WA 4O1CA 4QTGA 4EAYA 4XD6A 3RCNA 4AD0A 2QF7A 5KTLA 3MANA 1WQ5A 2D20A 3CQJA 5K9CA 3M5VA 2HVMA 4PTWA 4F4RA 1Q66A 2BWGA 4OV4A 1S5WA 1UQZA 1WXJA 2NZLA 2YYUA 5D38A 1ISVA 1XIHA 2YZRA 1AW1A 5KZDA 3FJNA 5IOBA 3SCPA 4HU3A 2O56A 3MYPA 4AIEA 1YYAA 3DGBA 2DU2A 2QAFA 3SRKA 5FSDC 3LRLA 4J3WA 2BB0A 4RDZA 3ECQA 3GNDA 3FXGA 4YTUA 3DUGA 4BQ5A 3F4DA 4R33A 4JDBA 3GW3A 4P7OA 1L6YA 4ZA0A 2VYOA 1REQA 4Q8OA 3AISA 4O15A 5JH2A 4AYGA 2F7FA 4XX6A 1XISA 2ZBTA 2GL5A 3BC9A 3AJ7A 1EL3A 3BLIA 3QPYA 3HGSA 4H7VA 4W93A 3A5VA 1XQLA 2J47A 1R38A 3V5CA 4QXIA 1MRQA 5G2WA 4EWND 4BFAA 1SR9A 1JDCA 3ZLGA 5LNUA 1SZEA 3WQEA 3SFWA 4KWWA 1J18A 1ZNNA 4D6EA 1DJXA 2RDWA 2DY3A 4OBRA 3F5JA 3RF9A 2CHOA 4GKTA 3GXIA 5A6BA 2YYTA 1XP3A 1LWJA 4NF7A 3P67A 4O53A 3T8LA 2YFNA 4UCGA 1LOSA 2YCLB 4X2RA 1AMYA 3EOEA 2JGYA 3CZ8A 1OEPA 5GVJA 1Q7MA 1A49A 1FWIC 4OZOA 1FHLA 3O9NA 3VZYA 1UD8A 3RX2A 4D1JA 4N4QA 2FDMA 4ZQPA 4U5IA 4X2PA 5DY2A 1UD4A 3TA6A 4C90A 3UXAA 3EGJA 3LQGA 1JYXA 4MB4A 1JZ3A 1OG6A 4YTQA 4XTIA 3NQFA 3GTIA 3WN6A 7PTDA 1OFOA 1XUZA 2PODA 4HA3A 5DT7A 2ZZ3A 1CXIA 2UWFA 3BCFA 3VGFA 1Q6DA 1FUYA 1X39A 1B3XA 2J9YA 3C2OA 2XVNA 3TC6A 3AQUA 4QR6A 1XIGA 1VRDA 1OX5A 2VD8A 4PN2A 1C91A 4S3BA 5K3VA 4HN8A 2E6YA 4W8LA 1XR2A 4JFSA 3OZPA 3DHUA 1OIFA 4KMQA 5G2HA 3O7UA 2VEGA 1Q45A 1N55A 3R8RA 3GBDA 3ISIX 3IRDA 3RUBL 4YLWA 3UCDA 2XIQA 1K9FA 2OZ0A 1I2RA 2DUAA 5U4NA 3EWBX 1UB3A 1BWLA 4LUSA 3SUTA 2J7EA 3PZTA 4Y96A 3AU6A 1LT8A 3QQWA 2E1DA 3O8AA 3ABSA 3KM8A 4NJJA 3WNMA 1P5BA 4QITA 2CLLA 1Q85A 5EKYA 2HVOA 1L0PA 1J6OA 2QUTA 3S5ZA 5K9XA 4KPLA 5MKGB 3S1WA 1XIEA 4A3HA 1YDVA 3W2UA 3PZIA 1HP5A 2Q71A 3UA4A 2V5BA 4FLRA 2XN1A 3ARZA 3DAQA 3W86A 4QQ3A 4QG6A 4KW2A 2Z24A 3AIEA 3DFNA 3BW4A 3MVIA 4DJEC 4JFVA 1EF2A 4S3EA 3E6EA 3NXLA 4HIBA 3WLSA 2QJHA 4LBUA 3QTGA 2CKSA 2I5QA 4O10A 3CQKA 1Y0EA 4WUIA 4FAMA 1G6CA 4TTGA 1D8CA 4W9TA 2H8XA 3FYPA 4K68A 4AD2A 1D3HA 3T07A 5A6SA 4GABA 1ZJBA 4KF1A 1SMAA 4NI3A 3VIJA 3RLGA 3CB3A 1VFFA 2Q09A 1LTDA 2YCKX 4CQ9A 5CC3A 3POHA 3BG5A 4RE2A 1V08A 2C79A 2NLIA 3U2CA 5HPCA 3L2MA 2ZX6A 3M43A 3CLWA 5CGQA 1GCYA 3VMNA 1PPIA 1F2JA 4FF7A 2ZUVA 2YPIA 4WDXA 3LI1A 1KM5A 5I3KA 5HWJA 3UFYA 3C86A 5I3DA 3W23A 5FEXA 5I78A 4QJ1A 4AZCB 1YTEA 2RAGA 3T2QA 2PDJA 4TU1A 4UFMA 3OA3A 4M81A 3BCDA 3QH2A 3VTRA 2OCZA 4IP4A 2Q8XA 1GKPA 2JKAA 2OX1A 2X1SA 3NDOA 3FKKA 3S42A 3C56A 4B9YA 4PEKA 4NVTA 3KL5A 3VCNA 1F4HA 4S3AA 2IPFA 2J8TA 2QAPA 1XXXA 4ZQOA 3EWXA 1ZBWA 2E4TA 2WVUA 1ZP3A 4LWWA 4UZSA 2Y85A 1RALA 2PE4A 1ZALA 1IZCA 2XISA 3B06A 4GQRA 3WUEA 1CGTA 3CUZA 4GCAA 1H60A 2OLSA 3XISA 2OXNA 1QI0A 1OYCA 1KFCA 3WLNA 2I14A 4GO9A 3KP0A 3QM3A 4HYWA 3BV7A 1PYMA 5F2MA 5LXEA 2V0TA 3NOEA 3SURA 1H09A 5C54A 3BOXA 1ZUAX 2IS7A 4Q6JA 1KKOA 1QPQA 1Y8BA 4H3DA 3ZLHA 1JDDA 4QM1A 3ARTA 5F4SA 3WUGA 1ME7A 1EEXA 1PDZA 4HMNA 3W9ZA 4XKYB 3VNJA 3LHTA 5DQPA 1P0NA 3O6AA 3UJFA 3BLOA 8XIAA 1JZ2A 1FWDC 1SO4A 3N18A 4JTSA 3ZJKA 4P7LA 3IGXA 3VIHA 2B7QA 2PDHA 3A23A 2DGAA 4S3GA 3BSHA 4OU1A 2DVXA 3FLUA 3CHCA 3QV7A 1JNEA 5GJPA 4KCVA 1YPIA 1EB3A 2Z2BA 1GVOA 1ISYA 1PIIA 3SQMA 4IGSA 1TV5A 3QOMA 1P4CA 3SGZA 1B3YA 2IQ0A 2D0FA 3RILA 3W1XA 2CIPA 4DEFA 1WXZA 1Z7AA 1PIGA 3QW4B 2Y5SA 4NZ4A 3WFAA 2CPUA 4AMCA 2ALDA 3I4KA 1MVYA 3VD5A 1HJXA 5D9NA 5HINA 3ALFA 3VM5A 2YDRA 2QVNA 1Y7VA 4LAKA 4QEEA 1TPUA 2YCIX 3W01A 4TMCA 4KRTA 4LUTA 4PUUA 3OJGA 1X6NA 1VFTA 3WYZA 4Q4QA 4O1DA 4Z42C 1ICSA 2CBUA 4TR9A 3U8GA 1Q7QA 1E6QM 2HQAA 2IKJA 1QNRA 5H1WA 1KBJA 3W70A 4DF2A 1W91A 2XGIA 3W7NA 3PPHA 4S3CA 4J5NA 1RAKA 2XH7A 2FTPA 1RH9A 2NV1A 3KRZA 1CLVA 3ZT5A 2ZADA 4D6GA 2EG7A 1MEHA 4F9DA 4NZFA 5HNUA 4GACA 1NVMA 1QDSA 3MCNA 5H91A 5E1QA 3UERA 1K8ZA 4U2YA 2ZC8A 3KFTA 4WDWA 2EHHA 5FJJA 4JFTA 3SJNA 4ZO9A 4AHOA 3L0NA 1H7OA 5D2YA 4PCFA 4J3SA 2OOFA 3LDVA 3A64A 3LTYA 3M64A 2OGYA 1CXEA 4MLJA 1QR7A 1DOSA 3T44A 4IXXA 4XO7A 4WGHA 4ZODA 5D4YA 3ABRA 1J0YA 4X0VA 4CNTA 3PJXA 4LVBA 3SI9A 2O9TA 2G8ZA 3L12A 4LAZA 4RNIA 2NXHA 4Q8TA 1IXNA 4MKNA 3LPGA 2WPGA 2PDNA 5TBOA 2X1IA 3ITYA 4MY8A 2W63A 1JYVA 3QOKA 2NXIA 3MUXA 1N7KA 3HBLA 2BTMA 4FX8A 3TUUA 3ZT7A 2FVLA 3S5SA 1YLVA 1LYXA 1IGSA 4PBGA 1AK5A 5EBAA 1ITXA 2AGTA 1LBFA 3UW6A 4PCSA 2R6OA 1DJGA 1SFSA 1A5CA 4XIAA 2BXZA 1FWRA 3PAOA 1E56A 1BYDA 4K8HA 1SO3A 1CLXA 1WP6A 4PUEA 4I7VA 3MBDA 2FJUB 5GQBA 3QJAA 3M0ZA 2UBPC 4EK7A 1YQ2A 5IBXA 1TX0A 4JTCA 3VUSA 3VNIA 5GJNA 1PTDA 4JKMA 2G3MA 1WV2A 2WKGA 2BHYA 4CQAA 1YDYA 5EBUA 3WQ6A 3KCOA 4BHYA 4QLKA 3FAWA 2PDXA 1PUDA 4N9CA 3WQDA 1SO5A 1OD8A 2WW5A 4IXHA 4LGXA 2Z1BA 4PMYA 3VGBA 1LJYA 3P7YA 3GKFA 5HPOA 4MADA 2Y1HA 1CEOA 4TO8A 1Z69A 2QZRA 1R2SA 1YW1A 2WBKA 4IIFA 1LOLA 1PZ0A 4YVXA 4K7VA 3TCEA 4U2ZA 4JDYA 4MFDA 2VFHA 3PWAA 4UWMA 7CGTA 1PDYA 2CFFA 1W3LA 4AF0A 3G2GA 3KBMA 1XCXA 4XD3A 3BLPX 2V3FA 4IGMA 4JFUA 1V3MA 1TG7A 3W6LA 4R9XA 3W1LA 3T05A 4JL2A 1ONEA 3RIKA 4B4FA 2E3ZA 4XUGA 3U9IA 4LALA 2GJXA 1E43A 4HHPA 4NXSA 1QPRA 4L9ZA 4KEZA 3ATYA 3C0SA 5A8PA 2JALA 4MJMA 1JCYA 1Q7ZA 3MSRA 5F2GA 2GDUA 2Z1KA 3TKFA 1PXGA 3B0VC 1TUXA 1TB3A 3HV9A 3SN1A 3QR0A 3UCCA 3PJWA 3ZSTA 4PUKA 4B5XA 2GSJA 2ATMA 1QWKA 1BAGA 5TF0A 3VXGA 4RE4A 2QCDA 3WJXA 2YL6A 4Q8NA 1QI2A 1E1EA 1GQKA 3PTKA 4XK2A 5CZTA 1QK0A 4G1NA 3MHFA 1UWQA 3TJLA 5M3WA 2ZUTA 3EB3A 3P5ZA 3PBWA 2ZC1A 3WBXA 3LI0A 1F5ZA 3OG3A 5DXYA 2J7BA 1N8FA 1RSCA 3QC0A 4ASTA 4HA0A 4ZQMA 1UZ1A 4KRZA 4E4UA 4NASA 5E70A 1EJRC 1XSKA 3D3FA 3TC7A 1UH3A 1I0BA 3DHDA 4WKAA 2PF8A 3HM7A 3KBSA 5TIMA 2DW7A 4GJ1A 1DJHA 2D23A 2R1PA 4AXNA 4F0KA 2PTYA 1JFXA 5CBIA 3F4NA 4MNJA 4LCQA 4IFKB 4W89A 3UWZA 2CXEA 3M1ZA 6ENLA 3N13A 2BVYA 2O4QA 1OCJA 3N11A 1AUSL 2P50A 4NSBA 3WF0A 3ZXWA 5A6JA 2PD9A 1E4MM 3N6JA 1FCBA 1KGWA 2ZCGA 2DVTA 4HOXA 1Z42A 1JYWA 5F7UA 3BAJA 3PSWA 3P8IA 3M6YA 4YN5A 3C0JA 1HJQA 3H22A 1NOWA 3TN5A 3WQGA 3E5PA 4MWAA 8A3HA 3PZVA 4RV8A 1T0OA 1FBAA 3IGHX 4FXSA 3L4ZA 2NWRA 4G2DA 1VAHA 4NY2A 3NL6A 2QMJA 1NP0A 2CC0A 1GPWA 1BXBA 4PH6A 4DY1A 4WLCA 5D9MA 2O0TA 1V3IA 4YTTA 1LLWA 1XL9A 3SCRA 3APGA 3DGRA 2Q8LA 1M1BA 1JULA 4MY1A 2WMGA 1IEVA 2XDFA 4UOJA 3W72A 8XIMA 3K8KA 2OO0A 3OVQA 3MJYA 3GTHA 3DHFA 4HOWA 2OOGA 3FW6A 4WY0F 1O1ZA 2FH8A 4WOQA 1NF0A 3HZ3A 1P6WA 4PYSA 1SJAA 3BAIA 3QLDA 3N6HA 1QPNA 1EGVA 1H61A 2DP3A 4NAEA 2GJNA 4QDPA 1IEQA 2OG9A 1KCXA 3ZO9A 3K13A 4O1BA 4UR7A 1CI1A 3UT0A 4JX4A 2VWSA 3V0TA 5FEPA 2IUZA 3BJFA 1CGUA 1TWWA 1DQWA 1NF7A 3ARPA 1KCKA 5T91A 4WJ8A 3QGKC 2P8BA 1AJ2A 5HATA 2W62A 1VB9A 2OSXA 4GD0A 3H2EA 4URIA 1T41A 1LWHA 1X6LA 4HPNA 1WA3A 4LX4A 1EBHA 1PX8A 2VFGA 1HX0A 4YMZA 5D09A 4K7YA 3CIVA 2YA0A 3N04A 5CSUA 1CXHA 3VDGA 1GQLA 1TA3A 1BLIA 1MMFA 4FOKA 1Q3NA 2YBUA 4EE9A 3TAOA 3WLLA 2VZOA 1C3FA 1TIMA 2FHCA 3DI1A 1I2QA 4GYKA 3EX3A 4OVXA 1EF3A 2ACUA 1VENA 3EYPA 5AHNA 4A2SA 3TSBA 2OZ3A 5CSYA 2AMGA 3RO6A 3EEGA 3IVSA 3L7RA 3TK7A 1XF0A 1V02A 3W7KA 3MV11 1QHZA 4NAFA 2VFEA 5BROA 1MDLA 2ACSA 1RK6A 3TR2A 4K39A 4GC4A 3B9EA 4P7QA 3CPUA 1WBHA 3II1A 4XO6A 1G7UA 3K2GA 2PTZA 2V9DA 4MLRA 2RHGA 4JEQA 1V6UA 1JGMA 1OGBA 1UD6A 5D2TA 2BLEA 2OZ8A 1R85A 4C6FA 1EO7A 4YVVA 5DMYA 4D6CA 1MXGA 1M3UA 4PRTA 1B2YA 2TODA 4HGXA 4PMDA 2WXDM 2D2OA 2ISSA 4KKXA 3LS9A 1R2TA 4PFHA 1I0DA 4AW7A 4ECLA 3RM9A 3RMEA 5BCAA 3CZKA 4HZ8A 4CD7A 1V6XA 5AHFA 2CLKA 1FH8A 5A6MA 3BMXA 4NJGA 4IMAA 4R88A 3SRDA 1UCWA 3AZRA 5KITA 3P61A 1E73M 3P2VA 3RLVA 3L65A 3UWQA 1EJTC 3SY1A 3BVJA 1TZ9A 1C29A 3TJIA 3MS8A 4UTTC 2OB3A 1LP6A 4RXFA 1UP3A 3EMCA 3FGCB 5E6YA 4C6EA 3LN3A 4WIWA 3R12A 4H6EA 4HHLA 1DWFM 1ME9A 5D9OA 4JTTA 4CCZA 4Z2KA 1VD6A 4O8AA 4JQAA 3C6CA 1VF8A 4E8DA 4KCTA 1ADDA 2GQ8A 2H9AB 3NG3A 4O12A 3H12A 1JCTA 1J0ZA 1VFHA 3L23A 2F6UA 4GI4A 4YYCA 2TSYA 2XVKA 4AIOA 3NDYA 3AROA 4KEUA 4XZNX 4AZGA 3KTSA 4YIWA 2I5IA 1LROA 3GK0A 1B9ZA 3GBEA 4FALA 3J7HA 5AC7A 1UWRA 1IHIA 2ZZ7A 4UR8A 5M2FX 1F6KA 3CUHA 1PCWA 2VOTA 1BF6A 2WSRA 1UASA 1GGOA 1U1HA 2GGHA 2WMIA 1VCGA 4M6PA 2NQHA 3UY8A 1VIZA 3GE7A 1UBSA 5HWNA 1OYBA 4RZBA 3D0CA 2V5JA 3AIUA 3R6IA 1ML1A 3A9BA 3LHYA 2DORA 5DRCA 4MB5A 1F3EA 4U10A 3S1GA 2ZRXA 4U4MA 3W76A 3WDQA 3G0XA 2GK1B 3CV6A 3MI6A 1TMLA 1V6YA 3CUIA 5J5RA 1LRTA 1VLIA 2XFWA 2J66A 3WK1A 4I5XA 5BU9A 1VH7A 1WZLA 3KEHA 3OHIA 5JIWA 1QXLA 4NYUA 4S38A 3THDA 2B4GA 3NCOA 3VIMA 4UQ9A 4C7GA 3VKBA 3WK3A 4GXPA 2XPKA 3ZYZA 3G1SA 3AIBA 1WBJA 3GC5A 1GHRA 3FKRA 1GZJA 4ZTYA 4A8NA 2RFGA 1GOQA 1OG0A 4GO8A 4LV4A 5EFFA 3WEMA 4MHBA 2F38A 1OFPA 4CCCA 1RXOB 4NZCA 3O0KA 4Z1YA 1LOQA 3UP8A 9XIAA 1FRBA 3E2RA 2H6RA 3DFSA 3I7SA 4LC6A 2WM1A 2IKGA 1EDGA 3KW3A 3ARWA 3GLCA 1SJCA 4PUNA 3VA8A 1SW0A 3RG6A 1EJXC 2IW0A 2J79A 1NY1A 3NO5A 1H7XA 1OADA 2GWNA 1WE5A 1X7FA 1O5XA 3N29A 1RBAA 3PTQA 1XX1A 2FGZA 4WEVX 1BTMA 1JXJA 2F6KA 1VJZA 4IQJA 1PBGA 4QEHA 4FOUA 4UUIA 4L1WA 2Z2AA 3WL0A 2UY3A 3C4UA 5CPLA 5JBEA 1GORA 1YE6A 4FLSA 2E09A 2R94A 4JX6A 3PZMA 1FKWA 4NHVA 3TFCA 3C2RA 4IL2A 3IANA 3ELFA 3MO4A 1VPYA 3A3WA 5E93A 1I60A 3KOFA 4UNIA 1Q6RA 3UWYA 1A80A 2QCLA 2MUCA 1RD5A 4PCTA 2GGGA 3STCA 4ZOCA 1G9HA 1H5YA 4LRSA 2Q02A 1UA7A 5FCZA 1FWBC 4WD0A 2REQA 2NX3A 3GS6A 3VI2A 1ICPA 2VCBA 4AD5A 1YRRA 4HCLA 1OBAA 4N6EA 3V75A 1E51A 2V69A 1JPIA 2WHKA 1XBZA 4A3RA 1F3XA 2O9PA 4A3QA 4Y90A 2XH4A 1GVFA 3ZJ8A 1UH2A 3MB9A 1XICA 4IMGA 1NDZA 6REQB 2ZUSA 2D2HA 3IRSA 4H00A 4DF1A 4EACA 3UJEA 3HPSA 2QT3A 4H9XA 3MDWA 1GVQA 3CUJA 2AKZA 3D47A 4NX0A 2G41A 3OLIA 1BVZA 4EAMA 1OCQA 4RCXA 4GMEA 3SFKA 3N2TA 3AHVA 1FHUA 1KTBA 2HWGA 1GQIA 1R5YA 1DJIA 2DJXA 3DU0A 3EA2A 3LXCA 1VKFA 3NVTA 2W9MA 1RJPA 1MUCA 5DRIA 1TV7A 3CAKA 4AEEA 3VAVA 3AI0A 1S5NA 4DO7A 1OT2A 2BVWA 4DBSA 2WCSA 4QCEA 4GGHA 2XZ7A 4MSSA 3WMBA 4ZENA 3ZWTA 1AD1A 5AC8A 3AWNA 2E7FA 3SSJA 1A3XA 1KV5A 3UJRA 3O05A 1POJA 2CWNA 4AG0A 5G1YA 2GVLA 2GQ9A 4N4PA 3F03K 1E6PA 4BJHA 3R10A 5HQEA 2PZ0A 5ENLA 3CUFA 4C91A 2WSPA 2CZVA 2VC6A 1K77A 4JQ4A 3W53A 4K6AA 2WVSA 4MJ2A 4RW3A 4WXYA 2VX6A 1GTHA 3T1GA 1SGJA 1O12A 4Y9PA 1ECQA 2DEPA 1RD6A 2PURA 3WQ5A 5DX7A 3CK5A 1W54A 4L1XA 3STPA 2VRQA 1HW6A 2GWGA 1VJSA 1KGXA 3AS3A 2Y0FA 4QLLA 2PTXA 3IAQA 4GH1A 3MMTA 4XBJA 2WSKA 5CGTA 2OLHA 4Q8MA 4DJDC 1DIDA 5HNTA 4DQWA 3WMLA 2DQXA 3S9YA 5AYBA 5FIPA 1BWVA 3AALA 1BGGA 1XINA 4U3CA 5XINA 4H9MA 2BNJA 3AMGA 1J9YA 3M16A 3RX4A 5G4EA 1TV4A 1JDAA 5F2LA 3G6MA 1LQ2A 4DNMA 1TPC1 3GNPA 3DX5A 1W1ZA 1TX2A 1XLEA 3BAXA 4X9YA 1XBXA 4L4LA 1EJ7L 1OY0A 2OQHA 4JTLA 2BHUA 3KRSA 1F8MA 3N9SA 4D9PA 1HG3A 3I6RA 3SAZA 4GIEA 3IEBA 4GYFA 2WNWA 1M04A 2Z1SA 2V30A 1BGAA 1BYCA 4J40A 3WNNA 4J1OA 2KX9A 3LV6A 1F61A 3AS2A 1K1DA 1KFKA 1IE7C 5FJOA 4GUHA 3FA4A 8CGTA 4MNLA 4JQ1A 2H3DA 1DXIA 1CECA 1WUFA 3GH5A 2YCLA 1UWAA 5AY7A 1RQEA 1O5RA 2PC8A 2ZVRA 4LFYA 2WWDA 4HPJA 4NZ1A 4GYPA 1QBAA 4Y9AA 1W3TA 1P6BA 4QLJA 3ERPA 1XYFA 4H8UA 1CX9A 1TMQA 4HSNA 4CQDA 5LHFA 2VC5A 3CIXA 5K4XA 3K30A 3VGEA 3W6YA 3S6DA 3H24A 3HQOA 5E0KA 1SFLA 3WO8A 4ACZB 4MM1A 1BF2A 3RM4A 5CH9A 3KS6A 2Z25A 5SWUA 4ZFCA 3A4AA 3DG6A 1TUFA 1YDNA 3N17A 1MYRA 1XKYA 1A4LA 5DLCA 1MSSA 4WJXA 2P8CA 4IJBA 4DBEA 5DXXA 2X30A 4LSBA 1B57A 3W7EA 3AIRA 3H7UA 1CXKA 2EJAA 3DG7A 3TFXA 3TTQA 4B4HA 1E4NA 1JFHA 3KP1A 2F2HA 3H21A 3LBOA 1O95A 1DBTA 1D7KA 1T6MA 2W91A 2ABAA 3D6NA 3SW6A 1TMHA 1F4AA 4H6QA 2XH2A 4D6FA 4PMQA 5K2ZA 3A47A 4DPQA 4NNBA 3QMRA 4LS1A 4N42A 3B8TA 3SN4A 1L2QA 1NWRA 1B90A 4ZB5A 3D5HA 3MYOA 4GVGA 4WXZA 2X8RA 1AW5A 1CTNA 4UFJA 1N2VA 4S3JA 2W3ZA 1D8WA 4JN7A 3K4WA 3M0XA 1PB0A 1V3LA 2PS2A 4HP5A 4UCFA 4PBEA 2AAMA 2DZTA 4P8WA 2GVYA 5BU6A 4ML4A 4IP5A 1QNPA 3GIYA 5REQA 1P1MA 3BG3A 3HA1A 4PC8A 1K3UA 1XLLA 3THAA 3WLTA 1U83A 5H8MA 3NYDA 3NL3A 3GQYA 4QNEA 4AY8A 5G1TA 2I1OA 1JEZA 2D2GA 3CAVA 3GNNA 1QJWA 1RV8A 1KV8A 2YKKA 2CCRA 3BURA 3RLUA 1UQYA 1XYMA 3Q65A 4NNCA 1VHCA 1UYQA 1KBKA 1V79A 1UHVA 1HIZA 1W1A1 2J9XA 2W61A 4WY0B 1NWSA 5FL1A 1S5TA 4K36A 4D6IA 1US3A 2ZTKA 3IIPA 3PG8A 3PZ9A 1G4TA 2EPHA 3GNXA 2G3NA 1IYXA 1SM9A 3UG4A 2G96A 3F7JA 3JZUA 1JCXA 1E15A 2HK1A 4HA1A 1V0LA 3EB4A 2PP3A 4PB4A 3NPXA 1J0KA 4NT0A 3G6LA 1E6XM 2Z00A 1MNZA 1XBYA 4AZCA 3HF3A 1RY0A 3AO0A 3MU7A 1UKSA 2WMHA 3M6DA 4UTUA 5C5YA 3GDMA 3WIJA 5EB8A 1B30A 3WMCA 5EYWA 2CBJA 2B0MA 1SW7A 3H54A 1HL2A 4PFMA 2BBFA 3W26A 4X9SA 3SDOA 3FCPA 4ML9A 4JTIA 3BZJA 3WQOA 4B15A 3G5EA 1B5TA 3QVQA 2HNHA 1EXBA 2C0AA 4R7JA 4AY7A 3FN9A 2W67A 5FAJA 1ZBKA 1AVAA 1W3IA 2VO5A 1OK6A 5M5DA 1IT0A 4O54A 4G5DA 3R89A 1XLBA 1UUOA 5LYRA 3HMJ