3WBAA

Rice os3bglu6 e178q with covalent glucosyl moiety from p-nitrophenyl glucopyranoside.
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
478
structure length
478
Chain Sequence
b'GLTRGSFPEGFVFGTASAAYQYEGAVKEDGRGQTIWDTFAHTFGKITDFSNADVAVDQYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPYVTLYHWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNQPHTVAIQGYDAGLQAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKATQNGQLGIAFDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRFTADEAAVVKGALDFVGINHYTTYYTRHNNTNIIGTLLNNTLADTGTVSLPFKNGKPIGDRANSIWLYIVPRGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIKYHNDYLTNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSVQWFKALLKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucosidase 6
molecule tags Hydrolase
source organism Oryza sativa japonica group
publication title Enzymatic and structural characterization of hydrolysis of gibberellin A4 glucosyl ester by a rice beta-d-glucosidase
pubmed doi rcsb
total genus 193
structure length 478
sequence length 478
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wbaA00
1H3GA 3L4VA 2YDQA 1CXHA 4S3KA 1QNRA 2AMGA 2QMJA 1MQPA 1J0IA 4KRUA 4KGLA 2PC8A 1GOQA 3BAYA 3WY1A 1MFVA 3AS0A 4JKLA 2J8FA 2MANA 2AAAA 1GQLA 4PMRA 5AC4A 1UYQA 3WDJA 5C70A 2YL9A 4AD1A 2ZXBA 3BGAA 3N1AA 3ZIZA 1NP2A 4CD8A 1N82A 1EQPA 3GXIA 1W3LA 3S6TA 4J3SA 4MADA 1PPIA 4WIWA 1I75A 1JZ3A 3A6OA 3THDA 3W37A 1NQ6A 4EAMA 1H09A 3GDBA 4JIEA 3VINA 3BMVA 5E0FA 1AVAA 1J0HA 3K1DA 2CBUA 4W86A 1HVXA 1DWAM 2UY3A 4ACZA 1ZS2A 1TR1A 2XVNA 1JZ5A 2CXGA 1JZ7A 4UQCA 4BQ5A 3ARRA 1WDRA 4GZEA 5D8ZA 3OZOA 4KMQA 3NIYA 5BCAA 1B0IA 3ZOAA 3NDYA 4HU0A 3AZTA 3VVGA 1WZLA 2W63A 4R27A 4UZUA 2VX5A 1V02A 2GJXA 2WMIB 4H04A 5M17A 1R85A 3AXXA 3AICA 4J3UA 3U7VA 2XUCA 4M56A 2OYMA 3AS3A 3ZT7A 1BTCA 4BZYA 3L2MA 3SURA 1C90A 2J77A 1DWGM 4GO8A 4HMEA 4Q7NA 3ZJ7A 1VENA 5EFFA 2VX4A 1W2PA 3WD2A 1CLXA 5DT7A 1KQYA 2YDSA 1LG2A 3VX0A 3CHCA 3GH7A 3UG4A 1E6ZA 2PBOA 4Z2GA 2VC9A 3AHVA 1GJUA 1UD6A 2J47A 3VOCA 5M5DA 5HPCA 4ATLA 1WZMA 2X1IA 4JKKA 4NI3A 3D3AA 2W4XA 4D6IA 1QNSA 4BS0A 1E6PA 5A8QA 3BMWA 1F4AA 2DDXA 2V3FA 4AISA 4CKQA 2XFRA 1LWJA 1PIFA 3NDZA 1QI5A 3NSNA 3FY1A 5CG0A 2PWFA 1JXKA 1UH2A 5CSUA 1WPCA 1WDSA 3SCRA 4NF7A 3RM8A 1JG9A 1PIGA 1VIWA 3AZSA 5IDIA 4MAZA 2DPEA 1GOOA 1ZJAA 4P8XA 3GH5A 2J7DA 1LLOA 5LYRA 3KL5A 3S2CA 3WUFA 2V5CA 3VILA 4J3XA 2VURA 4WKAA 4M8UA 1EDQA 1NWRA 2GK1A 4AWEA 4PN2A 1E72M 1JD7A 1RH9A 1UR2A 3LPFA 4AZIA 3IANA 3AYSA 2QPUA 1CZ1A 1MQQA 2QHAA 3SUWA 1V6WA 2EPKX 4E8CA 2WVSA 2OSXA 1CXLA 4C7DA 2WCAA 3MV01 1SFSA 5EMYA 3RDKA 2BXYA 3IJ9A 5LA2A 3CMGA 4HU8A 3UR7A 1E4IA 1PX3A 2BVDA 1UD8A 3IAPA 2VZUA 1X6LA 3N15A 1M7XA 1R86A 1G94A 2YA1A 1E71M 4QAWA 4TVUA 1VBUA 2OSWA 1V6VA 2V3GA 4D6CA 2W61A 2CESA 2EJ1A 1JI2A 3GZAA 2JEQA 1LL7A 1ZJBA 2BXZA 4MB5A 2YDRA 4TTUA 2D23A 4FK9A 2JALA 3BLKA 5CPSA 4QFUA 3DYPA 5I3DA 1W3JA 2XTKA 3L4UA 2BV9A 3QHOA 1BVZA 2PB1A 4H8VA 1R8LA 4EKJA 1UKPA 3AYRA 2G3JA 3RCNA 1B2YA 3GBEA 4M80A 1US3A 4MAVA 4PMUA 3PZTA 4EK7A 1ZL1A 3WELA 2XVGA 1G1YA 3DHPA 1MW1A 3VD4A 4W5ZA 4P8UA 2OLHA 1IT0A 5A3HA 1OSEA 4MB4A 3WEOA 4ZE4A 2BFGA 4XV0A 1E4LA 2J7HA 2G3IA 1H2JA 4FMVA 3ZM8A 4ZENA 5BWFA 4DWSC 2E8ZA 3CHFA 1EXPA 4A3YA 3WQVA 3E1F1 4UOJA 1M53A 3UR8A 5I5RA 3W6LA 4A3HA 2ZUNA 4XB3A 2OWWA 3NSMA 2DSWA 1UKSA 2JEPA 5AY7A 2VQTA 3PN8A 3ZJ8A 2IXUA 2YLAA 3FAXA 1KCLA 4YHEA 4UQBA 5C8BB 5CLTA 1GOIA 2QLYA 4CVWA 2DT1A 4JFSA 3K8LA 3FAWA 4GZJA 4AC1X 3O9NA 2VZSA 3EYPA 4PMZA 2PF0A 4GQQA 5CZKA 2CPUA 2YL8A 3APGA 3CUGA 4WKHA 4IM4A 3CO4A 2QF8A 1MW0A 4PUDA 4P7LA 3SCPA 3VM5A 3CH9A 1E5NA 3L2LA 1ISWA 4CGTA 1JZ6A 3VIMA 3W29A 3WFZA 4HZ8A 2O9TA 3WDPP 2WNWA 1QNOA 5A6SA 4U2ZA 4N42A 3AROA 1E6RA 2DT3A 3W28A 1UHVA 5IHRA 5AYIA 2VQUA 4UTFA 1CPUA 3N18A 4CU8A 3ARUA 1R7OA 2QV4A 1W9PA 4D6HA 1J0YA 2J75A 1WDPA 2WSPA 1BGAA 2J78A 1J9YA 1E4MM 4DWSB 7CGTA 4OOZA 4NRRA 1B3VA 1WZKA 2WLZA 1KQZA 3D5HA 3VIIA 1E43A 2WHKA 4J27A 4KGJA 3DECA 4MJ4A 3N12A 1BLIA 5BROA 2EPNA 3BAWA 2WMGA 3EMQA 3LPOA 1CIUA 4CU6A 1V02E 3O2LA 4NSBA 5CLWA 3MUZ1 3WMCA 2GDVA 3K8KA 2Z1SA 3W25A 1EOKA 1C93A 1KBBA 1WZAA 3II1A 2CHNA 3PTMA 3ZO9A 2ZXQA 1TVNA 4CD5A 3OLIA 2VRJA 1GONA 2XM2A 1GJWA 7A3HA 1UA7A 3WD3A 2DSUA 5HOSA 1QHOA 3WNNA 1UD4A 3BCDA 4IPNB 1HF6A 4GI8A 3G6LA 2GJRA 5CPTA 2G8ZA 4H8HA 1CGWA 1EQCA 2FH8A 2IUZA 1HXJA 3PZGA 3MMWA 4CN4A 4TVCA 1Y7VA 1PX8A 1QNQA 4F66A 4QDMA 1PZ3A 4JFVA 1E6NA 4A4AA 3RM4A 1CXFA 4JFUA 1GUVA 4E4PA 2XFYA 2X05A 1VAHA 4P8VA 4WSKA 2WMJA 2YBTA 3SUVA 2DH2A 2VCCA 1AQ0A 4PMYA 3TTOA 3RIKA 2JIEA 4JHOA 5FOOA 1E56A 1OINA 3HU7A 2CEQA 2VCBA 4AZCB 3SCUA 1BYBA 1NWSA 2BHUA 2VT0A 4F9DA 2WVTA 1IV8A 1O7AA 1V08A 1BGGA 4W88A 4E8DA 4TTGA 3RILA 2DSKA 4D6JA 1ZU8A 3OGSA 4AIOA 1V3JA 1UWSA 3UEQA 1W1VA 3CZKA 4J28A 2JFEX 4AD5A 4UNIA 3I3BA 1QI3A 2BVTA 1JF5A 3PZNA 2WVVB 3VD7A 2VJXA 4Z2KA 1UG6A 1NP0A 1KB3A 1FH8A 4B3KA 5A2CA 1IZKA 2EPOA 3WEMA 4W85A 4AD0A 2CBIA 2WBKA 4U5IA 3ARSA 5BXPA 1DWFM 2OSYA 3NYDA 2DT2A 8A3HA 3WIJA 3VO0A 3AHTA 4UQAA 3AISA 3VNZA 4AYSA 2FHBA 3BC9A 2VUYA 5A6BD 3N04A 1EHNA 1LL6A 1ESWA 4GXPA 1E6QM 4MDOA 5FIPA 1W9BM 1EIBA 1HN1A 4AZ6A 2PWEA 3WH5A 1WKYA 1PEZA 4MB1A 5FKYA 2ZIDA 1HKIA 4UQEA 2D1ZA 5HPOA 4WF7A 4OBRA 1JNDA 6A3HA 1FH7A 5JIWA 2Y5EA 1BFNA 4D6FA 2W92A 4JZ5A 3EDJA 4W8BA 1XCXA 1W3HA 2VI0A 4HZ6A 4XX6A 5I2UA 1VJZA 1NOWA 1QVBA 4OKDA 3CUIA 4MPKA 1EGZA 3WENA 2WSKA 1JD9A 1JI1A 1QI0A 1ECEA 2G4FA 1J18A 3OG2A 3VGDA 1H1NA 2UY4A 1NH6A 2X0HA 4PCSA 1UUQA 1QI2A 2DIJA 3SCWA 1DEDA 3PZIA 1WNOA 2ZUMA 3AZRA 3WH9A 2WZIA 3EBVA 4TOQA 1VB9A 1C8YA 2HISA 3RPMA 1JYWA 5CSYA 3ARTA 3N9KA 1HJSA 2XGIA 3QHMA 1S46A 4JL1A 3U5UA 3MKKA 2VTFA 2CKRA 1HKKA 1BAGA 1LG1A 2WC7A 1L8NA 4X9YA 4W7WA 5A6AA 4KWUA 1B3ZA 5A8MA 3ZJ6A 1E3ZA 2W91A 1JIBA 2XIIA 3POCA 4W7VA 2CNCA 3N17A 3BSHA 1OD0A 1VFMA 1RPKA 2WPGA 3A4AA 3TTYA 3RM9A 3QHNA 3W4RA 2C8NA 1YQ2A 1PX4A 4W87A 5F7UA 3AMCA 3AXHA 4M82A 1JAEA 4MNJA 4UOQA 2RGMA 1W1TA 4MNMA 3RJYA 9CGTA 4BQ4A 5E09A 2BHZA 3WEZA 2GFTA 3OLDA 4PTXA 2ZX9A 3PBGA 3WH8A 3WNMA 2DEPA 3GXFA 1DP0A 4XUYA 2W66A 3KEHA 3BH4A 2YA2A 4B3LA 1B31A 1E5JA 2YJQA 1OBAA 1OCQA 5I79A 1ODUA 3WNOA 4KRTA 1W1YA 4ZE5A 4M24A 1C3FA 4U33A 6CGTA 4AIUA 3CTTA 2QPSA 4WLCA 3TP4A 5HNNA 4PTMA 2J79A 1HJUA 1J0JA 2WVVA 4MNKA 4UQDA 2ZUWA 1XH1A 3FHAA 4CU7A 4W93A 1TZ7A 2ZUTA 1OM0A 3WDQA 3WD4A 4M1RA 4DUVA 4V28A 2D22A 2CETA 1MFUA 1UKOA 2WCSA 1LQ0A 4D6DA 1GZJA 2XYLA 1J10A 5JBDA 5CPQA 1C92A 2XSAA 4RE2A 1SMDA 1E0VA 4H41A 4DWSD 3LPGA 2XPKA 2YBUA 4MNLA 4V2XA 3T2OA 1HT6A 2GDUA 2Z1KA 4LYPA 1BPLB 2XSBA 4HZ7A 3VDAA 2ZX6A 4TX8A 1MXGA 2WCGA 3POHA 4PTWA 4DWSA 2D20A 2VL4A 1JZ4A 1ZB5A 3OLEA 2WB5A 4N0RA 5C71A 3W82A 4LGXA 2UY5A 3ALFA 1UR1A 4OOUA 1BVNP 1KWKA 1GNXA 1JAKA 3I3EA 2YL6A 1CGVA 1CGTA 2VNCA 3UETA 3N13A 2GSJA 5E6ZA 1O6IA 2XWDA 4QLKA 3VTRA 1KXHA 1I1WA 3WBAA 3ZR6A 2NT0A 3THCA 4K68A 4DUWA 3ARWA 1HL9A 2E3ZA 3CHDA 2EXOA 1VF8A 1MW3A 2O9RA 4P7NA 2OYKA 4PSPA 1WAWA 3WF2A 2PWDA 1UWUA 1E15A 1TMQA 2X09A 5ABFB 1V0MA 2ZUSA 2A3CA 1U2YA 3WD1A 1V6UA 4HMCA 1GPFA 3SIMA 1OWQA 4HA1A 3K46A 1WDQA 4LQ1A 1UZ4A 3M7SA 2BY2A 3VIJA 4U31A 1J12A 3W81A 4PTVA 2XVKA 3NJ3A 2DIEA 5CGTA 2NT1A 2E8YA 2WMHA 1K9DA 1E40A 4UFJA 3PHAA 2Y4SA 1NOUA 1E70M 1B9ZA 2CIPA 1HP5A 4ZEPA 1XH2A 3VUPA 2CERA 4BQ3A 1K9EA 4CD6A 1XD1A 2V3EA 1DWHM 1UWQA 2VZOA 1Q6EA 4HOWA 3EDEA 2VCAA 4UFMA 5D9PA 3VDCA 3OGVA 4OZOA 1FA2A 3WH7A 4FLRA 2J25A 3MMDA 4GPNA 1OIFA 3ARPA 4JL2A 1BSIA 4GINA 3AMDA 4IISA 3T2QA 4GI6A 5A94A 2PWGA 4LXFA 5JIPA 1LL4A 1XV8A 1WP6A 2D3NA 3FNDA 4AEEA 5D4YA 2WWCA 2W5FA 3IJ8A 7TAAA 1W9DM 4B15A 4CD7A 1E55A 1JYNA 3RJXA 1NWTA 3TTQA 1XRVA 4AD2A 5GNYA 3ZQ9A 3AOFA 3BSGA 3GH4A 5DF0A 1E0WA 1L0PA 1PAMA 2QMKA 2WW5A 3GNRA 1W2VA 4J3VA 1FP8A 4ATDA 3SCQA 1CGYA 4AZ5A 3HN3A 1H0GA 3NCOA 1J11A 3MUIA 4KH2A 1V6YA 2J7BA 2ZWYA 1JYXA 1UH3A 2XFFA 2FGZA 3CPUA 3L4YA 2EO7A 2GK1B 2GUYA 4QP0A 3BLPX 3OB8A 3CZGA 3VU2A 1JGIA 4W8LA 3CBWA 2BHYA 2ZWZA 1KGXA 3QR3A 5LA0A 1E1FA 1W9UA 1XD0A 1V0KA 1W1PA 2E9MA 4MJ2A 3WDIA 3CZ8A 2Q8XA 2ZX5A 3UERA 5GNZA 3EMCA 3GXDA 4FLOA 1CECA 4M81A 5E0CA 3EDFA 1GOWA 4MTVA 3AI0A 1M03A 1RP9A 3W6MA 2OWXA 3B8SA 2J7GA 3W53A 2XVPA 1HIZA 1QHZA 4GIAA 4C7GA 2FHCA 3VGEA 2UWFA 1FHLA 4CCEA 5BXTA 2CCRA 4MB3A 4GO9A 1UR9A 3ALGA 1UR4A 1JDAA 1JZ2A 3CUFA 3SUSA 1OT1A 3MMUA 2O9PA 2A3EA 1SR0A 2DSVA 5IHSA 3CZLA 1TG7A 3TTSA 4D72A 1TCMA 4BF7A 3EDKA 4HP5A 3CUJA 2G41A 1EA9C 1G5AA 3TA9A 2VOTA 1K9TA 5D8WA 5M3WA 1NARA 2D2OA 4NRSA 4QCFA 4PMVA 2Y8KA 2ZXAA 2FH6A 1QBBA 5A6BA 1H41A 1ISXA 1DTUA 2JF7A 3T08A 1MQRA 2Y24A 3T2PA 2WMIA 1OGBA 5A6MA 1JYVA 3T0AA 1FP9A 1VEMA 4PSRA 5A8OA 3OLGA 4PMDA 3L4TA 5BRQA 4CD4A 4LYRA 3DC0A 1Z32X 2J4GA 3ARXA 4P8WA 3WF0A 3AIRA 4E2OA 3VNYA 4BA0A 1XGZA 1XYZA 2FGLA 3MSGA 1VJSA 4FLQA 4J3WA 1HJWA 3PZMA 3WNPA 4CCCA 1YHTA 5JUVA 4CN1A 1K9FA 3N11A 4JCMA 4W8AA 1WB0A 1GHSA 3IJ7A 2XIBA 4JFTA 4HMDA 3VX1A 4L4OA 3MUAA 1QI4A 5JBFA 4TUFA 3WNKA 1VFFA 3VIHA 4AD3A 1US2A 1QBAA 4XZWA 1E6XM 3U57A 2ZICA 4OJYA 1V3IA 3K4AA 1PZ2A 3L4WA 2ZX8A 4P7OA 2EEXA 5CJ5A 1JNEA 3T0DA 5I23A 3HMCA 3VIPA 3VPLA 1VRXA 1UD2A 1KFWA 1U33A 5LA1A 3WDHA 3GYCA 1CLVA 1A3HA 2WHLA 4OBSA 3AIQA 1MXDA 5I24A 1OD8A 2GJXB 1M04A 2W67A 1ODZA 3CUHA 4CCDA 1H4PA 1D3CA 1VFUA 3F5JA 3IAQA 1W32A 4YN5A 1HVQA 1AMYA 3LMYA 1EH9A 2DT0A 2E4TA 1DWIM 3UCQA 3WNLA 4AXNA 4AY1A 4QLLA 2VX6A 4H2CA 2DSZA 3T0BA 1V3MA 3CIVA 4Z2IA 2WAGA 1XYFA 5M03A 4AW7A 4W5UA 4UFHA 4ACZB 4URIA 4UR9A 1EHAA 1GOKA 4ML4A 5ECUA 2D0GA 4NZCA 4PMOA 2IXVA 4WJXA 2OWCA 5DEZA 2CYGA 1XSJA 1F4HA 1HL8A 1KXQA 1H11A 1XC6A 1C8QA 1ZBVA 2JIWA 2D24A 4XZBA 1XHGA 1ZBWA 1WCGA 1HKMA 3MSDA 3AXIA 5ABHA 3MANA 2F2HA 4PRWA 5ABEA 5I6SA 1B3XA 2WK2A 4YPJA 2YOCA 5ABFA 1V0LA 3KZSA 2F8QA 2DGAA 3CMJA 5IXEA 3A4XA 2J74A 5GQBA 2JF6A 3VDHA 1W9VA 4QLJA 4DM1A 1MW2A 1ITXA 3AIVA 1VEPA 1Q6GA 2YA0A 4UCFA 4QCEA 1G9HA 3VGBA 2TAAA 4AZHA 1C7SA 3J7HA 5AYBA 2VX7A 3VMOA 2J8GA 3B9AA 2C0HA 3KWXA 3MU7A 1CGUA 3AIWA 4X0NA 4UFLA 3PZQA 3VMPA 1KR1A 4W84A 4YHGA 1G01A 1KBKA 1J01A 3VGFA 2E9BA 5BXSA 2VZTA 3WUBA 5E70A 4BCEA 4JAWA 5CQ1A 4UFIA 1CGXA 2A3AA 5I78A 2O9OA 1FFQA 1XSIA 4ZXOA 4HPGA 1BYCA 3AS1A 2BNJA 3MUY1 3A47A 3PZOA 4CUCA 2ZX7A 3FW6A 3BAIA 4D1IA 2WLYA 1UH4A 2D0HA 4U5KA 3SUTA 3CZEA 3L4ZA 3WH6A 3AHXA 2PI6A 1E3XA 2YL5A 1J0KA 1FFRA 3WQ6A 4W7UA 1AQHA 3GNPA 2WWDA 3W26A 1CDGA 4RE3A 3W24A 3ZMRA 2HVMA 4TVDA 3A3HA 1V0NA 2XHYA 2XGBA 3VD9A 2WZHA 2V3DA 3CLWA 1P6WA 2J7FA 2E40A 3PTQA 4OUEA 3AFBA 5FL0A 3SCTA 1V03A 2BVYA 2G3MA 1CWYA 2VR4A 5A2BA 2VRKA 2VO5A 1AQMA 1R87A 4H7VA 1KGUA 1V3KA 2J62A 3U5YA 5A8PA 2WANA 3ZT5A 3MS8A 1W91A 2NW0A 1EO5A 4C7FA 4ACYA 1KXTA 3SCVA 5CGMA 4AZGA 1E9LA 4HOZA 4WK9A 2RGLA 3O6AA 3KL0A 1CENA 2X0YA 1CBGA 2VRQA 1OIMA 3GXMA 5DO8A 3MV11 2CHOA 1UQZA 2WHMA 4PUEA 2VVSA 5JBEA 3M6DA 4RL3A 3M07A 1GVIA 1UR8A 4F8XA 5BRPA 2UY2A 2F61A 4CN6A 2A3BA 1A47A 1UD3A 3AIEA 4MDPA 5BYWA 3TOPA 4AZBA 2J7EA 1UWIA 5GNXA 5FCZA 2D0FA 3CHEA 3BXWA 3ZSSA 1Q6CA 5GPRA 1HJQA 3VGGA 1C8XA 2O92A 3SCNA 2DH3A 1TVPA 1VBRA 4PEEA 3SCSA 3RMEA 1R7AA 1RD6A 1ITCA 5EFDA 2XG9A 2WC3A 3BAXA 4R5EA 3WFLA 5A6KA 1X6NA 2ZE0A 5KEZA 1QW9A 4U2YA 3ZJKA 5FD0A 3RO8A 1GQKA 3SUUA 1LWHA 4FF5A 1GQJA 5E6YA 2VZVA 1KXVA 4ATWA 4B16A 1XCWA 2X2YA 5A2AA 5D9NA 3F4VA 2GVYA 1CXKA 4DUXA 3AHZA 1OGSA 1JFHA 1NOFA 3WQ8A 1OGGA 3GNOA 3WL0A 2EQDA 5A95A 2XM1A 3ARVA 1DWJM 5A69A 1B3YA 3VKKA 4P7RA 1SMAA 1UR0A 1ISZA 3LPPA 1CNVA 2EPMX 5DMYA 1Q6DA 2JE8A 2YKKA 3ZR5A 2CKSA 4HOXA 4IUGA 3VMNA 5TD4A 3I3DA 1CXIA 2WYSA 1TA3B 5IFTA 4B9YA 5I77A 3WDRA 1QNPA 5CXPA 4F79A 1B1YA 3QOKA 4X0VA 3FXYA 1E73M 1Q6FA 5DFAA 3ZSTA 4DM2A 4EANA 3M46A 5D9OA 4IPLA 2EPLX 1ISYA 1JDCA 3WSUA 2A3HA 4ZXLA 1Q4NX 3NUKA 3W38A 2V5DA 4OIFA 3AMGA 1EDGA 5ABGA 1GORA 4TX6A 5HDRA 1HP4A 2OYLA 4AMCA 4HA4A 3F5LA 2BY3A 1UZ1A 1HX0A 1NM9A 4U3CA 4WSJA 3CZJA 1JDDA 3WF4A 1GVYA 4D6GA 4JCLA 5E9AA 2VMFA 2CBJA 2XVLA 4HTYA 1E6SM 1JXJA 3JUGA 4JHZA 4LYQA 3GBDA 3IK2A 1E0XA 1ZBKA 1UQYA 1GHRA 1GW1A 4GQRA 1GOMA 3VDBA 4UQ9A 5A1AA 1KR0A 3WUGA 4UOZA 3VIKA 3T09A 4JKMA 1QW8A 1ISVA 1IZJA 3G6MA 3WQ4A 2X8RA 4GZIA 3U7BA 2WVUA 1H5VA 2EBNA 1W3KA 1E4NA 2ZUVA 4AZCA 1TA3A 3PZ9A 1C91A 1JFXA 2YIHA 4ZFMA 1VFOA 1BHGA 4FLSA 3AMLA 1FOBA 5BXRA 1RP8A 3WMSA 1BYAA 3WD0A 3AIUA 1HKJA 2W62A 1PBGA 2WMKA 3W27A 1UWRA 2XJ7A 3OBAA 3K8MA 2YLLA 3DHUA 3AQUA 5IFPA 5FL1A 1JZ8A 2WKLA 1B90A 4UFKA 1UD5A 4HPHA 1M01A 3VIFA 1LJYA 3VGHA 1OB0A 3FHQA 3WKZA 2AOSA 1UOKA 3WBEA 1V3HA 3B9EA 4PBGA 1J0ZA 3WQWA 3EDDA 3AIBA 1B3WA 3VIOA 4D1JA 3ARYA 5HXMA 3UG5A 1CEOA 1MYRA 3WF1A 4HA3A 2J7CA 1BG9A 3MO4A 1D7FA 1EDTA 1H49A 1JF6A 4Y7EA 3PTKA 4RE4A 1UKTA 3BAJA 3WN6A 5A6LA 3W0KA 3K4DA 1E1EA 1WO2A 4PCTA 1H0IA 4EE9A 5DT5A 3AJ7A 3OIHA 3OGRA 1K6AA 3ARQA 4D6EA 2WZEA 2GJPA 5EBAA 4PMQA 1XSKA 1V3LA 3QOMA 4JFWA 4UZSA 1CXEA 3UESA 4CVUA 5EB8A 3VIGA 1KWGA 1BYDA 5I0DA 2ZUUA 4B9ZA 3AS2A 1BG4A 3PZVA 2XWEA 2CITA 4S3JA 3VM7A 2BS9A 1UKQA 4PYSA 1UA3A 1CYGA 1FHDA 4AD4A 1QOXA 3QGVA 1C7TA 2V38A 4GI9A 3PZUA 2ZOXA 3KE0A 1EOMA 3CGTA 3F5KA 3DYMA 3B9DA 4WKFA 1QPKA 2PBGA 1NWUA 1GQIA 1B30A 1MVYA 1HJXA 5HBFA 3NSXA 1GCYA 3KL3A 3HJEA 2B31A 2C7FA 1PJ9A 3VD3A 1BQCA 1I1XA 3WQ5A 3GTNA 3VD5A 3BAKA 4V27A 8CGTA 4M29A 1KGWA 4Q22A 3ZT6A 2PWHA 2BY0A 4J3TA 4L4PA 2DQXA 3BCFA 2BY1A 2WMFA 2E9LA 1JL8A 1XH0A 1BF2A 1VEOA 3SEPA 2NSXA 4LPCA 4Z2HA 1TUXA 3FN9A 1FH9A 1HJVA 3SCOA 2CBVA 3AMKA 3OA5A 5A8NA 4Z2JA 4GKLA 3WF3A 1QHPA 4J7RA 1MWOA 3WUEA 1EO7A 2E0PA 4AZ7A 5KZ6A 2WHJA 2D3LA 5D9MA 2Y8VA 1V6XA 4AIEA 2G3NA 1SYTA 4U3AA 3A4WA 4W89A 1CTNA 2WXDM 3GM8A 1D2KA 2VVNA 5A6JA 4BQ2A 1U30A 1WE5A 3DYOA 2WBGA 4P7QA 4PMXA 2FHFA 3ECQA 4PMNA 5AC5A 1TE1A 4F9JA 2FDMA 4LX4A 4AEFA 1DHKA 1G0CA 3WL1A 3OZPA 3EMZA 1TFVA 1HNYA 3AHYA 6TAAA 2WM0A 3WMBA 1LF1A 1W9XA 1X1NA 3ARZA 2ESCA 4Z2LA 4D71A 4H8UA 1ZBCA 1OT2A 3TONA 2ZXDA 2Y2WA 1UWTA 4TXEA 3L4XA 2WC4A 2VR5A 3UG3A 1KCKA 2WKGA
chains in the Genus database with same CATH superfamily
3L4VA 2YDQA 3G8EA 4Z1DA 2Z00A 3NTYA 3CHVA 1GOQA 1RBLA 3BAYA 1IXQA 2P76A 1MFVA 3AS0A 3IACA 4C6LA 2MANA 1W31A 2AAAA 1XP3A 1GQLA 5ECVA 1UYQA 1M65A 4AD1A 3ZIZA 4H6EA 3ZR4A 4HSOA 3S5ZA 2OCZA 3WMLA 1GG0A 1XYLA 2OJPA 1EC9A 1W3LA 5H2ZA 2Y7GA 1VHCA 1OFRA 3VI2A 4J1OA 5REQA 3VA8A 3QKEA 1NFGA 1I75A 3JVAA 1OABA 4GGBA 3TE9A 3WBXA 4UB9A 3GDBA 2RDTA 4ZB2A 3IJIA 2FZ8A 3BMVA 1ML1A 3G22A 1J2WA 1TV4A 4M5PA 5C7VA 3UJEA 1TR1A 4HKPA 4DZAA 3TAOA 1WDRA 3BLOA 1JULA 3FA4A 4GZEA 4F2UA 1WQ5A 6PTDA 1FWIC 3NIYA 5BCAA 1B0IA 2HXUA 2QCDB 4HU0A 4KCWA 4KEMA 3HZ3A 3DKJA 1AJ0A 3SY8A 2V63A 3WO8A 2NV1A 4IPJA 1KM4A 4UZUA 2QAFA 1CLKA 1R85A 3AICA 3R94A 2OYMA 3ZT7A 1BTCA 4BZYA 5FESA 4NT0A 3W6YA 1PO9A 4IIDA 3UCCA 4ROPA 4GO8A 6XIMA 1KFEA 5BU9A 1VENA 3G24A 2YDSA 3PWAA 3GH7A 3SRDA 3UPBA 3GNNA 3GXNA 3UGVA 2PA6A 3BQ6A 3GUGA 2J47A 3VOCA 1X8FA 3VNJA 5M5DA 4AY7A 3BTNA 4EXBA 4JKKA 4HNLA 4GNKB 2CLFA 4D6IA 4BS0A 4GABA 1I0DA 3B4YA 1KTCA 3M0XA 4BKNA 4CKQA 2E67A 3GXPA 1RVGA 1WAUA 4BR1A 2PU0A 4PFMA 1PVNA 4DVOA 1QI5A 1TIWA 4RK8A 1YXCA 3P8IA 4PL2A 3IV8A 4A2RA 1UUMA 2PTYA 1JXKA 4DAFA 3UXLA 3USBA 1WPCA 2OEJA 3PJWA 3SCRA 3T6CA 2PU1A 4NF7A 3LB0A 1TPUA 5IDIA 1GVFA 3L2IA 4MAZA 2P1FA 4P8XA 1ZSXA 3TNBA 3GH5A 4HPXA 1LLOA 3WQFA 1KTNA 2Y7FA 3Q65A 1F2JA 4NASA 3DX5A 4QS5A 2QCFA 2V5CA 4J3XA 4WKAA 1YNPA 1NWRA 3G18A 2GK1A 1E72M 1JD7A 3LPFA 4LEFA 3LU2A 2EG7A 4R7OA 2IW0A 4XVEA 5FAJA 2OSXA 1CXLA 3MZNA 4C7DA 3DH7A 1XS2A 1CB7B 3GC5A 3W2KA 4GQGA 1FXPA 3P61A 3IAPA 1QPOA 3RLHA 3N15A 1M7XA 1UBPC 3TFXA 3S1UA 2ACUA 2V3GA 3B05A 1FWHC 2JEQA 1XLCA 3P3BA 2IKJA 5EMLA 5KMYA 3GTHA 2YDRA 3GE7A 4J35A 3PS7A 3JW7A 3NO5A 2X1TA 2O7QA 1P5BA 4MOZA 2BV9A 3M6YA 3QHOA 1YMYA 2QAPA 1VBGA 5DELA 3AYRA 3GAKA 3RCNA 1US3A 3C56A 3PZTA 3LK6A 3ABRA 5I03A 1CB2A 1PCKA 2FYMA 2XVGA 3CQIA 1MW1A 1BF6A 4WDWA 1J2BA 3W1NA 3BJSA 4A8IA 5A3HA 4MB4A 2R82A 4LBUA 5CAHA 2BFGA 5EMJA 1EWEA 3AU2A 1OZQA 2YCEA 2J7HA 2G3IA 1PCWA 2NX9A 4DWSC 3W7NA 3HPAA 3CHFA 4A3YA 5EBUA 3NPWA 2CZ5A 4JHMA 4HSHA 3UF9A 3W6LA 5G2HA 2ZUNA 4A3HA 4IIEA 4JNYA 5AY7A 1P1MA 3PN8A 2XZ9A 2ISDA 2NXGA 3S8HA 5CBIA 4CVWA 4ZO6A 3DFSA 3P80A 4UTKA 2C1HA 1HTIA 3G0XA 4PMZA 2PF0A 4Q7BA 5CZKA 2YL8A 4E0CA 3QKZA 5FSEC 1PDZA 3D3FA 3CUGA 3CO4A 4L64A 2BWGA 3CT2A 4O0ZA 1AL7A 1A0DA 1ISWA 1GEQA 4ZQOA 3VIMA 1WKDA 4DI8A 1VFHA 1ZAHA 4X22A 3QC3A 4NIRA 7PTDA 2PF8A 3KVKA 4U2ZA 2YCJA 5HWNA 5HUOA 1T8XA 3UZWA 3IWPA 3LCFA 3W28A 3DI0A 5FI8A 3P82A 3LGEA 1LT7A 2OQLA 4PE8A 3N18A 3M4HA 3H53A 1R7OA 1H50A 1S5WA 1PV8A 1R38A 4ZB0A 1OFOA 2ACQA 2WSPA 2E6YA 2J78A 4X2RA 2VFIA 1B3VA 4Z1CA 3CM4A 2WLZA 5AFDA 3MI6A 3QQ0A 4AHOA 3D5HA 1B4KA 3IARA 4MJ4A 4AWTA 5RUBA 3UYIA 4DZIA 2OZ8A 2EPNA 4HHLA 3BAWA 3GLCA 1XLKA 4F3HA 4O13A 2QCCA 4KCUA 4GH3A 5CLWA 4PFHA 3S3GA 3QPZA 3WLKX 4Q8QA 1TPEA 3MUZ1 1DXFA 2GDVA 3GG8A 4Q8UA 2Z1SA 1KBBA 3MCNA 3PTMA 2ZXQA 1TVNA 3OLIA 4GIYA 1GONA 4UC5A 5DRIA 3G0SA 4P61A 4O14A 2IKIA 1OVDA 7A3HA 2GQ3A 3C0JA 2DSUA 7ODCA 5EYWA 4E8GA 5D02A 3BCDA 1NF7A 4GI8A 4PRTA 3A64A 2FPVA 1XIMA 4BWLC 1XWYA 2LLEA 4H8HA 1EQCA 2FH8A 3PZGA 3MMWA 4TVCA 3VZZA 4QDMA 3HG2A 1VD6A 2WZMA 3LCLA 4NUWA 1Y5WA 1D9EA 4ICMA 4JFUA 2XFYA 2ABBA 1VAHA 1VJIA 2FVMA 3HFYA 4REQA 2WO5A 4IUOA 2VGGA 3TTOA 2A0NA 1D8WA 1VPYA 2JIEA 1OINA 3HU7A 3TW6A 2VCBA 3AXKA 4HN4A 1BYBA 2VYOA 3R43A 3LCXA 1IV8A 4W88A 3NO1A 3M0YA 3GB6A 4TTGA 3RILA 2DSKA 4D6JA 3A9IA 4AHQA 4LWWA 2PDNA 1FBAA 3PTDA 3NZRA 4AD5A 1F6KA 1J6OA 3NQCA 3LRKA 3I3BA 3NL6A 2WVVB 2JKAA 3SR7A 3VD7A 4QG6A 4GY0A 1TV8A 4B3KA 5A2CA 1H7NA 4R34A 4LUSA 2EPOA 4W85A 2C16A 5F1VA 2CBIA 4RNFA 1M3UA 2GVJA 2C71A 1OG0A 3RCMA 3DEQA 8A3HA 3WIJA 3VO0A 4L5ZA 3LXBA 2G97A 2FHBA 3BC9A 2VUYA 5A6BD 1ZUAX 1EHNA 4Q6JA 2H90A 3D6NA 4R9XA 4MDOA 2A85A 2D1ZA 3DFHA 4LUTB 3G1AA 2FKPA 3GW3A 1IEQA 2W92A 4YVXA 4JZ5A 3S9IA 1J96A 1XCXA 1EYEA 1BD0A 3G3DA 1RJPA 1VJZA 5I2UA 1Q2RA 3DG3A 3W23A 1EEXA 1R0MA 3CUIA 1U1HA 1ZJIA 2WNZA 1HW6A 2WSKA 1Z7AA 1WKEA 1QI0A 2ISFA 1VCVA 1UWAA 1UUQA 3SCWA 1V8EA 4AAJA 1ONRA 1SO6A 1VFSA 1C8YA 3MYPA 4LJ3A 4BHYA 6REQB 2VTFA 4INFA 2JGQA 1WBJA 4H1ZA 3SRFA 4KWUA 5E0KA 4H7CA 3KS6A 3WLMA 5A8MA 4KESA 3ZJ6A 3HPZA 4W7VA 3E38A 3BSHA 3RM9A 3QHNA 2DZAA 4HA0A 1DQUA 5F7UA 2Q6ZA 3KRUA 4PBFA 3R0UA 4M82A 1JAEA 4ERAA 3I68A 2HROA 1NSJA 9CGTA 3CAKA 2BHZA 5E09A 2VEGA 3VOJA 2DVXA 1YBQB 2FB2A 4R33A 3UY7A 2GGGA 4DPQA 3KCLA 1JPMA 4A8NA 1SGJA 1KBJA 1QPNA 4O12A 5HJLA 5CH9A 1E5JA 5I79A 1OCQA 3HQOA 3WNOA 1TYGA 2AGTA 4KBXA 4ZE5A 4M24A 3MHUA 5HA7A 5DCBA 3E0LA 2J79A 2QJNA 4Q8PA 1F8IA 2H3DA 4UQDA 2GVEA 1ZJHA 1XH1A 4CU7A 3EA1A 1FXQA 1TZ7A 4I7UA 2ZUTA 3WDQA 1DKWA 3R8HA 2FTYA 1ZAIA 2RH9A 5JH1A 2CETA 1UKOA 4DELA 1JUEA 4OECA 2XYLA 1UB3A 3TCEA 4WDXA 4H41A 2BOEX 3LCIA 3R10A 3BW2A 3VOIA 4DWSD 3D47A 3LPGA 2VD8A 1XQKA 3T2OA 1VIZA 3N2CA 5D2YA 3MO7A 3UJ2A 4L6HA 3QW4B 3STPA 4A3QA 2QJIA 1WA3A 1I9CB 4GUIA 2KAUC 4PTWA 4DWSA 4AFYA 2YZ5A 2VL4A 3NURA 1ZB5A 3P6LA 3LX9A 1W56A 4N0RA 3S6OA 3W82A 5KITA 1M9HA 3MI2A 3ALFA 4S1FA 1UR1A 4OOUA 3E49A 1REQB 3S6DA 1CGVA 3ITLA 4IPPA 5E6ZA 2WZTA 2QCHA 4WY0F 2TODA 3WBAA 1RQHA 1DIEA 3TEVA 1VGAA 1DV7A 1IWAA 3THCA 2AAMA 5CGQA 3ARWA 3W7IA 4LTSA 1VHNA 2EXOA 4O4WA 3W7KA 2F6UA 3TZNA 1J5TA 2PWDA 4GE8A 2Q01A 4Q6XA 3LCWA 2A1YA 2I9UA 3WD1A 1SO5A 1UPPA 1GPFA 3SIMA 2HNEA 1OWQA 4F40A 1UZ4A 3EZ4A 3TC6A 4H9VA 2BY2A 3PSWA 4GGHA 4PA8A 2NXHA 3W81A 2RUSA 4Q4OA 2NT1A 3W7MA 3CQ0A 8XIMA 3EB3A 1E40A 1K9DA 2XGZA 2CIPA 3EKLA 1Q45A 3E3HA 4ZEPA 3LHZA 3G0UA 4H9XA 4CD6A 1XD1A 1F07A 3EDEA 4QSHA 3V0TA 3MI3A 1VFLA 1FA2A 1QCWA 3MMDA 1OIFA 4JL2A 3WLPA 2AKZA 4FX7A 4GI6A 3W2JA 5A94A 4LXFA 4GVHA 1XV8A 3KHDA 5AVNA 1WP6A 3FGCB 2OVLA 2D3NA 2WWCA 3IJ8A 4LC6A 2Y85A 5AZ0A 3WG6A 4O16A 1E55A 1WUFA 3TTQA 1SSDA 4H83A 2BLEA 1H7OA 4JTTA 1OX5A 3A4JA 3P5YA 5DF0A 1G69A 3CL8A 1QPRA 1FP8A 1PZ0A 3U4FA 4Y9OA 4AZ5A 4HYWA 3NO3A 3MZ2A 1H0GA 3NCOA 4Q4RA 1J11A 1FCUA 2CLLA 1JYXA 1A49A 2FGZA 3L4YA 1G7VA 4IIHA 4XK2A 3VKDA 3DN5A 4K38A 4GJIA 4FF7A 3IGUA 3CV2A 5FJJA 3DKLA 4B2DD 3V0UA 4I7WA 4MJ2A 2E9MA 2Q8XA 4S3AA 5CC5A 4IX2A 2NQHA 3UERA 3NZGA 4YVPA 3GXDA 4FB7A 3BK0A 1WOAA 1JCXA 3C0SA 4Q7IA 2QCGA 1M03A 5HQMA 1ZENA 4DO4A 1TSIA 4K8GA 3O07A 4MIMA 1QHZA 1S2VA 4C7GA 1FHLA 3LS9A 3W70A 4RJEA 4PUUA 4HU4A 1R9ZA 4C60A 4HJWA 4UWMA 1JDAA 1XXXA 2JKEA 3EXSA 2AL2B 3SUSA 3MMUA 1U5VA 3NZ1A 3OZYA 4IGHA 4RDZA 2A3EA 1EWDA 2JK2A 2ALRA 3CZLA 4IQEA 3TTSA 4D72A 1TCMA 4OHQA 3QLLA 3TA9A 3H7VA 5M3WA 1A5CA 4NRSA 2Y8KA 1J8VA 4LV9A 4ENLA 5A6BA 2BOGX 1XGEA 4CNUA 1V79A 1MQRA 3T2PA 4CD4A 1WUEA 3DC0A 2QCDA 2J4GA 3ARXA 2ZRZA 1ZY9A 3WF0A 1EEPA 2ZKMX 4BA0A 1QWGA 2RDUA 1Z69A 3W2UA 1R3TA 5JVLA 3WNPA 1YHTA 4LB3A 1R2RA 3AYTA 4QE4A 3N6QA 3RN6A 1UW9A 2HS8A 3QN3A 1QI4A 4TX9A 1GK8A 2AL2A 4AD3A 4TV5A 3PNZA 3PC0A 2XZ7A 3HPXA 3VE9A 3N2OA 4C6NA 2ZICA 4OJYA 4Q8MA 4P7OA 5CJ5A 4XKYB 2NV2A 1G67A 3VPLA 5C9ZA 3GHRA 3EAUA 1UD2A 2ICSA 1XISA 2Y70A 3S2NA 1EJUC 1I8JA 3LCHA 1P0NA 1B9BA 5K2ZA 2X1UA 5C9XA 3PPFA 5I3GA 2Z0IA 3VE7A 2GJXB 4XIAA 3V35A 1ZFJA 4AUBA 3FA3A 3UCQA 1GT8A 2E4TA 4AXNA 1XYMA 3BCJA 3URBA 4DJFC 3T0BA 3CIVA 4XZMX 2CLEA 1CW2A 4J2MA 4URIA 5ECUA 1TO3A 4DXXA 1XQLA 4NZCA 5DEZA 3TJIA 2CYGA 5F2IA 4DNHA 4HIBA 4XZIA 1HL8A 1JDFA 5FEXA 1JCJA 3OU8A 3H8AA 2YB1A 4XZBA 1O5KA 4XIMA 4G9PA 2PRLA 2V2CA 2VEPA 1LROA 1KM6A 2WK2A 1XCFA 2DGAA 5JXQA 3INPA 4GMEA 2J74A 2XN2A 4YTSA 3VNKA 1GTEA 2XDFA 5LNRA 4AVFA 2PD5A 3F7JA 2PFHA 2YA0A 4QCEA 1G9HA 3VGBA 1AD1A 4DBSA 3VOGA 3SRKA 3KWXA 3MU7A 3DFYA 2ADAA 3QY8A 3VMPA 3ITVA 1KR1A 4Z0SA 4Y9PA 4ZOEA 1SW3A 1M5WA 1N55A 3KTSA 4L6OA 4NHVA 4BCEA 3O15A 1MMFA 4E3TA 2A3AA 4BEQA 1XSIA 4HPGA 1BYCA 2VGFA 4PBEA 3PZOA 2Q8ZA 1X98A 3NQ7A 1JJKA 2FIQA 1OFEA 5I02A 3F03K 3WQ6A 3GNPA 2WWDA 4JTSA 2GZXA 4RE3A 4UUIA 3JRKA 2HVMA 1P0KA 2B4GA 1V0NA 2WZHA 3CLWA 3AXMA 4C65A 3PTQA 2J9ZA 4OUEA 4MYXA 5FL0A 4Q4KA 5BU6A 5CG7A 1TZZA 4XBSA 1W54A 3MBFA 4P2VA 1IEVA 3CIXA 1FY6A 1P0EA 3ZT5A 3MS8A 1W91A 4C7FA 1QATA 4US6A 3GU9A 3GVGA 3QGAC 1B54A 1XF0A 3SCVA 1BSLA 4JS3A 4A3RA 2X0YA 4FX8A 2EAWA 2V69A 2PD9A 1CI1A 4PUEA 3KBNA 1M7JA 2PDIA 2A7RA 4RL3A 3M07A 4J2PA 1RLDA 1GVIA 4JYFA 3IIOA 4FNSA 3S1VA 3TJXA 4IL2A 1MXSA 2A3BA 3PJXA 4MDPA 1TV2A 1UWIA 5GNXA 1KRBC 5FCZA 2CXEA 2ZZ5A 3L0GA 1EJVC 3HQNA 1Q6CA 4H7ZA 4L6DA 4N6EA 2DH3A 1TVPA 4YYCA 4ZCWA 2EKGA 4YYFA 1RD6A 3M0KA 4XWUA 3BAXA 1UP2A 6REQA 1EF3A 1X6NA 5F2GA 1OK4A 2ZQ0A 1Q6LA 3GQYA 3IUIA 4XBKA 4FF5A 2PLJA 4HD5A 1KXVA 2ZC1A 4I9TA 4B16A 1E0UA 5A2AA 3MB9A 3OVQA 1OFQA 4ZO8A 3TOYA 3AHZA 4ZSUA 3TROA 4MKVA 3W74A 3WQ8A 3GNOA 3WL0A 1TJ1A 4Y96A 3BWWA 5A95A 5EU9A 3ARVA 1YDVA 1NVMA 4FA3A 5A69A 3NQMA 4LVDA 4ONVA 3KOFA 4KEUA 1SMAA 3KHJA 1UR0A 3K1GA 1Q6DA 2JE8A 4I7VA 1OZMA 2CKSA 4IUGA 1UZHA 1K4GA 2WYSA 1DBTA 5IFTA 4QTGA 2ZRYA 3LENA 5I3JA 4F79A 1DJXA 4X0VA 4F0RA 1LORA 4S39A 2DZUA 1QU4A 1F3EA 3WLHA 5D9OA 3QPYA 5KZMA 4ORMA 3CUXA 4ZXLA 1Q4NX 3R6IA 2FFCA 4IIBA 3TWBA 3OPSA 1EDGA 1GORA 3QR0A 4TX6A 1UMYA 4L1WA 4LRSA 4HA4A 2BY3A 1HX0A 4HVXA 4U3CA 1JCYA 2NLIA 3TMLA 3WF4A 1GVYA 4JCLA 2EGZA 4MF4A 5E9AA 2D73A 3SGZA 3PY2A 3S1GA 3MP4A 1JXJA 4LYQA 3W83A 1E0XA 4XAZA 1ZBKA 3GU1A 1UQYA 1GW1A 4GQRA 2FZNA 1GOMA 1W3IA 3VIKA 2OX1A 3R8RA 4PR4A 4JKMA 3G6MA 3ATZA 3VNLA 4UMBA 3E2VA 4ILSA 1ONXA 1EFZA 3ERPA 3UXDA 4PB5A 3G77A 1TA3A 2VWSA 2NV9A 4EWND 1C91A 2L5HA 1JFXA 3S5YA 3B8IA 4Y9NA 2QCMA 1SFJA 1TPB1 3QTGA 2YB4A 3B8TA 5BXRA 1RP8A 1EC8A 3HOJA 5AYXA 3IVUA 3MHFA 4X3ZA 1ITUA 2X2GA 3P60A 4XVDA 2YLLA 1EJXC 3GR7A 3W7OA 2H3BA 4UFKA 3RNDA 3DFTA 3LCGA 5I3KA 1Y5XA 3VGHA 3SECA 3CC1A 4NNCA 2VC5A 3FHQA 2AOSA 4PBGA 3THQA 3TDFA 4EIVA 3T8LA 3LUTA 4D1JA 4G7FA 3ARYA 5HXMA 2HTMA 2Y5JA 3GHTA 4HA3A 1PL9A 2ZZ3A 4HNCA 5HMFA 4IH3A 1D7FA 2A7NA 3PTKA 5CSSA 3SDOA 1UKTA 4QG9A 4C6JA 1E1EA 1KRAC 1TPVA 4I90A 3EWWA 5DT5A 1AODA 1VFTA 3OIHA 1PWLA 1GKRA 3ARQA 2WZEA 4CNSA 5B7ZA 3HGSA 3PG8A 4DJED 2A4AA 5G1TA 3TR9A 5IBXC 4AQLA 2QV5A 1EP2A 4A2SA 3P67A 3PZVA 1MEWA 3UYCA 3WLNA 4S3JA 1DJWA 4PYSA 2EJAA 3QH2A 3MQTA 1QOXA 3EWZA 1C7TA 2V38A 3PZUA 2ZOXA 3KE0A 2I5IA 1SVDA 1MSSA 3B9DA 3VKBA 2XINA 2BGQA 3GUWA 3TQKA 3U0HA 3VFCA 3HJEA 2CFFA 1PJ9A 3VD3A 2PWVA 5IBXA 1BQCA 2H8XA 3M5VA 5J5DA 2BGSA 3ZT6A 2PWHA 2I7GA 2BY0A 1DVJA 3BCFA 3B04A 2WMFA 3H22A 1ALDA 5EMUA 3USZA 3TW9A 4Y8FA 2J27A 1ZQ5A 1W3TA 1TUXA 4E38A 4XD6A 3WQCA 4ZTYA 1PTDA 4JGDA 3CIWA 2QCLA 2Z27A 1F5ZA 1MWOA 1OF6A 4AZ7A 5F1UA 3ZLFA 1YIXA 4JX5A 2G3NA 1OCJA 3CV7A 4J40A 3NXFA 4JQ4A 1U1UA 3W7QA 3A3XA 5A6JA 3N4EA 3CQHA 4F9JA 2FDMA 4LX4A 3WL1A 1XLLA 3RUBL 2WM0A 1X1NA 3LLXA 2PDFA 1ZBCA 4MHBA 4FALA 4QQ3A 4CQBA 3APTA 1J6PA 1KCKA 4W5UA 1LTDA 3N3TA 4DZ5A 1CXHA 3QSRA 3WK0A 1TJPA 1S3TC 1P0BA 2R1KA 5C6MA 2GOUA 2X41A 2ZFAA 1IIGA 3N9SA 1A5UA 4PMRA 5AC4A 3NQAA 1GVQA 3TXZA 3TQVA 1SZRA 3E2QA 3RMJA 3N1AA 1H61A 1KW1A 1N82A 2HK0A 4MZYA 1EQPA 1XIEA 3GXIA 2PTWA 4J3SA 2ZTKA 4MADA 2GJNA 1PPIA 1LM1A 3A13A 3SGUA 2Z7GA 3NA8A 1JZ3A 3UZXA 1LOQA 1PB0A 1HQTA 2NLYA 2PS2A 2C19A 5HMDA 4RXGA 1P43A 3VINA 3OA3A 3LRMA 1DWAM 2PDYA 2UY3A 3O63A 3V5OA 1ZS2A 2XVNA 1JZ5A 2CXGA 1JZ7A 2CLMA 4BQ5A 3ARRA 1UP0A 4WGXA 1MUCA 4MYAA 5HWJA 1KLYA 3EA2A 4KIRA 2QT3A 1XFBA 4AB4A 1IT8A 3Q67A 1FWCC 2Z4GA 2W63A 1KFCA 4H04A 2C6QA 1C29A 3UGRA 2J13A 4J3UA 3AXXA 4AWUA 4LC8A 2D2JA 1OY0A 1J4EA 1C90A 1DWGM 3ZJ7A 4JPGA 1OYBA 4DEFA 3BL3A 5EFFA 1QNVA 3L67A 5DT7A 1RLCL 3VX0A 3CHCA 3MPGA 1B5TA 5DMLA 4JOMA 3CL7A 1AZ1A 4NJHA 4DLMA 3AHVA 5FSDC 1WXJA 1UD6A 3XIMA 4JTKA 3TA6A 4ATLA 2X1IA 1BEUA 4NI3A 4IZGA 1SJDA 1QNSA 5A8QA 1EGVA 1F4AA 1RCQA 2V3FA 4YTTA 3HV8A 1E0TA 1SW0A 2HWGA 4XZHA 1PIFA 2NWRA 3NDZA 1LWIA 3NG3A 5CG0A 3M0MA 3VZXA 3BE7A 5CSUA 4LW7A 2B7NA 3P0WA 3TLLA 1JG9A 1GOOA 1AD4A 2GQ9A 4HNUA 3NOYA 1OEPA 1JEZA 1VCGA 2PDJA 3C5QA 4AIBA 1BWLA 3LTYA 3NYZA 1ELSA 3S2CA 1YX1A 3MC5A 3WUFA 3VILA 4AWEA 2C1IA 3AYSA 2PTZA 2QHAA 4FXJA 2WVSA 3TN6A 2WCAA 3KOZA 4O15A 5EMYA 3L7RA 2FB3A 2NZLA 4O57A 3F4CA 1K02A 1JRBA 3MSRA 3UR7A 3B8VA 4DF1A 1E4IA 1PX3A 2V2DA 3KVLA 2VZUA 2F38A 4R3UA 3OJGA 3TUUA 3NVTA 4QAWA 4TVUA 2FMOA 1R47A 4GVIA 1K6WA 1V6VA 2CESA 2EJ1A 3W1PA 1LL7A 3ANVA 3W22A 1ZJBA 3SIZA 3ZVHA 1Y5VA 4ZQRA 5CPSA 2JALA 3GXTA 1I6NA 4PCNA 2X7VA 2XTKA 1XICA 3UW6A 5D09A 4H8VA 5F4SA 4FO4A 4FNRA 1B2YA 4M80A 5CSRA 1C8VA 1KM0A 5D30A 2R8WA 4MJMA 3S83A 5T9CE 1ZNNA 4JQ3A 1FCQA 1TPFA 3E0VA 3OEXA 4GXWA 1OSEA 3TSBA 4WR3A 3WEOA 2OQYA 1EF2A 4IJBA 1H2JA 4FMVA 4ZENA 3O06A 3O16A 3KM8A 2E8ZA 1FUYA 2FLIA 1M53A 3UR8A 5I5RA 1EUAA 5LIUX 3NSMA 3W1LA 1UKSA 3T4WA 2VQTA 2ONEA 3IK4A 4MY9A 3ZJ8A 1EC7A 3TN4A 2YLAA 4UQBA 1L6FA 2QJHA 1I45A 5CLTA 4LAMA 4I8YA 3REQA 3FAWA 1W3NA 4GZJA 4AC1X 4GHRA 4MFDA 4A29A 4GFSA 1RQEA 4UTJA 3APGA 4WKHA 4IM4A 1MW0A 2V81A 4O1BA 3STCA 3CH9A 1JZ6A 3W29A 1UP3A 3E0FA 4HZ8A 1RCXB 1OX6A 2ZYFA 4Q4SA 2D2HA 3N14A 4ADSA 2O9TA 4ZOAA 4KFPA 3WDPP 2DT3A 1GG1A 1TV7A 1CPUA 3LHTA 4HHPA 3PUDA 8RUCA 3ARUA 4JNZA 3SM0A 4B5XA 4LALA 3NL3A 4PH6A 1CT5A 1SJBA 1BGAA 4R7JA 4G6CA 2IQTA 1EUNA 2WQDA 4XUGA 1WZKA 4AXKA 3OTRA 1KFKA 4Q8NA 4KGJA 3N12A 1M68A 1DIOA 3QQWA 4HMNA 2Z2UA 2WJZA 3TSDA 3WLSA 2WMGA 3CYVA 3LPOA 1CIUA 2ZDRA 3SFKA 2E28A 1X38A 1FWWA 3HB9A 4GH1A 4AX6A 3UZYA 3SJ3A 1EOKA 1C93A 1WZAA 3C2FA 4HT3A 3ZWSA 1UOZA 4ADTA 5FJIA 4C5ZA 1V93A 1UA7A 3N29A 4YXGA 3WD3A 3VOFA 2HVOA 1RD5A 3G6LA 3QMSA 4RXFA 1IEWA 3LHWA 1LLWA 1CGWA 2QCNA 4JXCA 2IUZA 2R1NA 1HXJA 1UIPA 4CN4A 3H2EA 2HE5A 1PX8A 4AVNA 4NZ3A 4F66A 5G4WA 3VZYA 1Z9AA 4JFVA 1K7EA 1E6NA 2RKXA 4WSHA 4A4AA 3DUGA 1CXFA 1GUVA 4E4PA 2X05A 1R5YA 4P8VA 2HEJA 2YBTA 3BJTA 2DH2A 2VCCA 3E02A 3W84A 1AQ0A 2VDIA 3NAVA 2PP0A 4JHOA 3QYSA 3RGTA 3WLTA 2Z1XA 2NVDA 3LDVA 3SCUA 2BHUA 1KNWA 3VCNA 4PODA 2J66A 1O7AA 1V08A 5HQEA 2DVTA 1X6UA 3R25A 1GWJA 4JTGA 2H9AB 3WQOA 3QLDA 4XZNX 2W79A 3NM3A 4AIOA 4DLFA 4GY1A 1UWSA 3UEQA 1W1VA 1WKFA 3CZKA 5LHFA 2JFEX 2P3ZA 5U7SA 2BVTA 1F9CA 4F48A 1XLHA 3K4WA 3RX4A 1Q2SA 3DOPA 4Z2KA 1PHQA 1XUUA 2V0TA 1JCLA 1NP0A 1KB3A 4G7EB 1LZOA 1SZGA 1NTHA 1IZKA 1B3OA 3H23A 1T41A 1XUZA 2R14A 3AYVA 3H2OA 4GUGA 4M51A 2OSYA 3UZZA 2PPGA 3GFZA 3VNZA 1DJYA 1E6QM 5FIPA 3FJ4A 3M0ZA 2Y62A 2QDEA 5FKYA 4UQEA 4OBRA 3FEMA 2Y5EA 4D6FA 3EPMA 1W3HA 4DX3A 2PDQA 3ABSA 3DC8A 1NDWA 1FCBA 1JD9A 1JI1A 2G4FA 5M2FX 4IXHA 1B57A 1J18A 3OG2A 3VGDA 3AU6A 2UY4A 1XKYA 5DLCA 2X0HA 4PCSA 1T6MA 3U3HA 1W37A 2DIJA 1W8GA 4JTQA 4FOJA 1WNOA 3OBKA 2ZUMA 1L6WA 3AZRA 4UTHA 3WH9A 1C9WA 3EBVA 2HISA 3EXTA 4ZFCA 3QHMA 4JL1A 1YTEA 3CO8A 3MKKA 4QR6A 5FAGA 3KBMA 1HKKA 1P4CA 2ATSA 5LXXA 1L8NA 5BW6A 4W7WA 2PDHA 3MWCA 4LY8A 4W9TA 1E3ZA 2Z2AA 4BI6A 4H6QA 3GVRA 4XBJA 1FDZA 1OD0A 1VFMA 1RPKA 3TTYA 5LNVA 3W4RA 4IFKA 4W87A 1PX4A 1YQ2A 1Q8AA 2Y8UA 3PPGA 5K9CA 2F2KA 4GNJA 3E0IA 1I2QA 3PBYA 2RGMA 2E68A 4MNMA 1QRQA 2OTDA 3MKCA 3R58A 3GFYA 1NDVA 1M1BA 2DEPA 4MWAD 2ZE3A 2O4MA 4FNQA 4KFNA 4GVGA 1D7KA 4V15A 1TWZA 2Z6JA 5I3HA 2W66A 3BH4A 2YA2A 2DQWA 2XIJA 5TBOA 5AB3A 2YJQA 4KW2A 3QC0A 2XH2A 2OEMA 4KRTA 1W1YA 3JS3A 5FACA 3PG9A 2CZDA 1QK2A 2QPSA 3NEHA 4PTMA 3ES7A 1J0JA 4AC7C 3H4XA 5CPNA 1YPFA 3OZMA 2V8ZA 5F4WA 4CNOA 2DV0A 2F7FA 1OM0A 4YS1A 3KX6A 4IQDA 4M1RA 4ZTXA 1KM1A 5GVJA 2H9AA 2OFJA 3OOQA 1I4NA 1X8CA 1LUCA 3H2FA 1LQ0A 3OQ8A 1GZJA 1ONWA 1C92A 4QGCA 4RE2A 1SMDA 4K1GA 4JBRA 3IPWA 3SQSA 4PCFA 1IHIA 2DJLA 4MNLA 3L0KA 4MZ8A 2GDUA 4LYPA 3I7QA 1E51A 3FKKA 4H9UA 2IMRA 4HZ7A 1MXGA 3W7JA 1S1PA 3L66A 2D20A 3M64A 1Q85A 4QXIA 1TRDA 1JZ4A 1BRLA 1A50A 3ME3A 4HCDA 1HKVA 2QEZA 3THUA 4MUZA 4US5A 3F2DA 2W0UA 1O1HA 3WJYA 2AQOA 4I5RA 1RBOB 2CZEA 3CQJA 5HANA 3R7MA 3WQGA 3BPWA 3T78A 1I1WA 9RUBA 1XG4A 2NT0A 3GNDA 4DUWA 5AHMA 3KBWA 1PKYA 3DI1A 4KT2A 2E3ZA 3CHDA 1GEHA 3IVTA 4YNGA 1UWUA 1A5OC 1E15A 3HMJG 1V0MA 4J3ZA 3HURA 3LNPA 3C2YA 1KKRA 4KWSA 3C0QA 3GHUA 4IQLA 4RNIA 3ZVIA 1MEHA 1WDQA 1QR7A 4C6EA 1LBLA 1UR3M 3VIJA 4TMCA 2FPYA 4A8RA 1J12A 4XKMA 2BMBA 1LT8A 4EP8C 3NJ3A 2DIEA 5CGTA 3ITYA 3STEA 4AHPA 4XAGA 4UFJA 5FEZA 3PHAA 3GYEA 2Y4SA 1NOUA 3IJDA 1QASA 2NWSA 1OFBA 3MDWA 1R46A 4JICA 3PBWA 2V3EA 1G4SA 4LCSA 1W1B1 3VK5A 1UWQA 2ZVIA 2C14A 3ABOA 5D9PA 3W86A 1TKKA 3VDCA 3OGVA 4DYJA 4KWVA 4N4PA 3C8NA 4FLRA 5AHFA 3NXLA 1H7XA 4GPNA 3ARPA 3AAMA 4GINA 1G4TA 3N19B 5HWMA 1DQWA 5JIPA 4Q8WA 4ICNA 4LFYA 3KAOA 4GX8A 1OHLA 1W9DM 4CD7A 2G37A 3TJ4A 4AMAA 1XC4A 3VABA 1MUMA 3C3NA 4C5YA 2FDSA 3BLFA 4AD2A 2PAJA 1L0PA 1H7PA 4JTRA 1PAMA 3GNRA 4ATDA 4PZVA 1CGYA 3HN3A 3HQ1A 3EWDA 3G1YA 2AQWA 5CC7A 2XFFA 1AW5A 1Z42A 3GDRA 1DL3A 3UNDA 2YBVA 3NWRA 4I9AA 1XFCA 2ISVA 4C6BA 3DAQA 4NILA 3VU2A 3U2CA 1JGIA 5I09A 1AUSL 4Y6GA 2YXGA 3QR3A 1IIHA 3HIJA 5EL1A 4H2HA 1E1FA 1XD0A 1V0KA 1W1PA 1T0OA 5HQLA 3WLRA 4ZQNA 3EMCA 4HK6A 1VKFA 3EKGA 4YL2A 1CECA 3CK5A 3PBUA 3AI0A 2GVGA 1EJ7L 4D8AA 3ENLA 3PBVA 3B8SA 5K7JA 2NUYA 3DERA 2XVPA 2VHLA 4XKYA 1HIZA 4GIAA 3GC4A 2I56A 2FHCA 5DCDA 3VGEA 5G1MA 2UWFA 5BXTA 3CUZA 2QVHA 3UJRA 4MB3A 1DYSA 3TX9A 1JZ2A 2Y7DA 2YW3A 3W7LA 1IXOA 4IG2A 3TYEA 4DJEC 5D04C 4BF7A 1S2AA 3CUJA 4HP5A 3ITCA 1EA9C 1FCVA 1G5AA 2VOTA 3W7PA 5D8WA 2Q71A 4FPSA 4RV3A 1UBSA 2O7SA 4QCFA 2YR1A 3HV9A 2E1WA 1QBBA 4Y9MA 1H41A 1NU5A 1DTUA 2HBVA 2JF7A 3U4AA 4XG1A 3UP8A 3PJUA 3DDMA 3M44A 2Y24A 5FJTA 2WMIA 1JYVA 4LNCA 1VEMA 4DF0A 3OLGA 4HU3A 1KCZA 1S2WA 4DBDA 3MSGA 4FLQA 4L1XA 3O05A 3RX2A 1XPGA 4ZOBA 4KKXA 3LQLA 2P50A 2NX1A 4V33A 3T44A 3M47A 1WB0A 4HK7A 3PP7A 3IJ7A 4JFTA 3E5PA 3MUAA 4AX7A 5JBFA 4TUFA 1RPXA 3WNKA 3L23A 1XIDA 1US2A 4RDYA 1QBAA 4EPBC 2QS8A 3WJSA 4XZWA 4M6VA 3NQ6A 2ZX8A 3TNOA 2EEXA 1JNEA 2PGRA 1Q6RA 4LCRA 4NAFA 1XM3A 4GCAA 1VRDA 3TAKA 3OIXA 2EHHA 2OO0A 1OJXA 4F0MA 3AIQA 1U1JA 1MXDA 1OD8A 4LANA 4XSLA 2GPTA 1JR1A 1EPXA 1M04A 3CUHA 1V7AA 3SB0A 4PEKA 3RITA 2ACRA 4CCDA 1H4PA 4CCZA 3T0CA 1D3CA 1VFUA 2GGIA 1W32A 3TKFA 1K3UA 3EX6A 1DWIM 4AY1A 3QPEA 2I14A 4MFEA 3W3OA 1PHWA 1X7FA 1V3MA 4ZL1A 4RZ4A 4O8RA 3UVIA 2WAGA 1WV2A 1DHPA 1XYFA 5M03A 4UFHA 5EY5A 2WKJA 4IGNA 3UBPC 2WSYA 3TC3A 2ZC8A 1GOKA 2D0GA 3OVRA 3PBMA 4WUIA 2CLOA 1OK6A 3E12A 1UROA 3M5YA 1XC6A 3IIVA 4GX9A 2Y7EA 1FWNA 3KRZA 2F2HA 3LHUA 3ABXA 4PRWA 5I6SA 3U2ZA 1XLEA 1B3XA 4QNEA 2YOCA 4MZ1A 3STGA 1V0LA 3KZSA 5D2WA 1SSGA 3ZWTA 5HNUA 1YRRA 2SFPA 5DY3A 3VDHA 1W9VA 3QRHA 3AIVA 5KSWA 4O1AA 2TAAA 1C7SA 3J7HA 1E9ZB 2PDLA 3WK2A 4IMEA 2QGYA 2X42A 4UTWC 4Q4PA 1CGUA 1TMLA 5M1TA 3W85A 4UFLA 3PZQA 1S5MA 4LCQA 4W84A 1U22A 1KCXA 1KBKA 1PXGA 5TQLA 3GWQA 1J01A 4DYEA 5BXSA 3LEPA 2PTXA 2VZTA 1GYLA 4JAWA 5CQ1A 4UFIA 3BQ5A 3P8JA 5I78A 3TQ0A 1DIDA 1QAPA 3P5ZA 1ZP4A 2OEKA 1R3QA 4QRNA 2BNJA 3Q4DA 5BOEA 4B4HA 5KTLA 4CUCA 2ZX7A 2WLYA 1UH4A 3LQGA 2DP3A 4UTWA 2PI6A 3O0KA 1FFRA 5HMSA 2Z1BA 1THFD 4R88A 1O5QA 3W26A 1CDGA 4H8NA 3ZMRA 3U2EA 4LVGA 4TVDA 4ZB5A 2XHYA 4NI8A 2XGBA 3VD9A 3GDMA 2V3DA 3F4NA 1TE6A 3P14A 3W02A 2QGHA 1TVLA 3HO8A 1P48A 3SCTA 2BVYA 2VR4A 2VO5A 3K13A 1AQMA 4H7VA 4YTUA 1KGUA 5K9DA 1V3KA 3CJPA 5CCZA 2HQAA 5A8PA 4DXVA 1OYAA 4JTFA 3FK4A 4V1XA 4YWIA 4ACYA 4Q8VA 1YW1A 3GIPA 5LIKX 5CGMA 2POZA 3EX3A 3VNDA 5IM51 1CENA 3CPGA 3CTLA 4XZLX 3WFAA 1W0MA 2XN0A 2HZGA 1IF2A 4BY3A 1VYSX 1MDRA 5DRCA 2WHMA 4S23A 3M6DA 3UXKA 3W07A 2YX0A 3EA3A 4ERIA 2QKFA 2NUWA 4F8XA 3W71A 2UY2A 1UD3A 1W1ZA 2NQJA 2MUCA 4NG3A 5BYWA 2PCQA 4AZBA 2J7EA 2ZTJA 3CHEA 5CBJA 2PURA 3NQFA 3LV6A 2CZFA 3Q58A 1HJQA 2YSWA 1W5OA 1VBRA 1POKA 1R7AA 3QBUA 5EFDA 2WC3A 4GZ7A 5A6KA 1Z41A 5KEZA 3LBMA 4U2YA 3B0YA 5FD0A 3RO8A 5KETA 2VDGA 2VELA 4FR6A 3N6HA 3Q45A 3PM6A 4Q32A 1SO4A 1F61A 1ZALA 1CXKA 4DUXA 3LRLA 1OGSA 4ZA0A 1NOFA 3DIPA 2QQ6A 3KLKA 1RJQA 2DZXA 4RNHA 2CWNA 7XIMA 3N2XA 3VKKA 4P7RA 1ISZA 2Y63A 3LPPA 1CNVA 5DMYA 3HTWA 1FRBA 8TIMA 3GRIA 3VMNA 1NDYA 3I3DA 1RR2A 1P6BA 3CU2A 1TA3B 3BOFA 4JTJA 3DFOA 4GOAA 3G5EA 4XAPA 4W4QA 5AN7A 4S2CA 3B0UX 4H9YA 5DFAA 4DM2A 3N9RA 4EANA 3M46A 2ZZ1A 4DWDA 1JDCA 4JQ2A 3WSUA 2A3HA 3MP3A 5H8UA 1AW1A 3VCRA 3EOUA 5ABGA 5HDRA 5H8PA 4AMCA 1IR2A 4WCJA 3H70A 2PZ0A 3CZJA 1JDDA 4D6GA 5TAOA 5AC8A 3GO2A 2CBJA 2VENA 1VYRA 2XVLA 3M43A 1E6SM 4GIRA 3U9IA 1KO0A 4JHZA 3VNMA 1XKJA 4IMAA 2A6LA 1K8CA 1GHRA 4K1WA 3TYUA 4UQ9A 1S5VA 3TYAA 1MNSA 1EZ2A 3WUGA 3T09A 1BKSA 3KCJA 4RPPA 1QW8A 2WOQA 4XAFA 1D3HA 3H54A 4GZIA 3BICA 2AQVA 2EBNA 3V5FA 3NPUA 2PDUA 3S2MA 2ZUVA 3PZ9A 1XG3A 4NZ4A 3TN5A 4DUOA 1LCOA 2ISWA 4REQB 4ZFMA 4N2YA 1VFOA 1WDWA 4FLSA 3AMLA 3IJLA 3DESA 1BYAA 4GNVA 1A0EA 4DAIA 1PBGA 4MM1A 3OBAA 3B97A 3T81A 3AQUA 2B7OA 5FL1A 1JZ8A 2Y88A 3FS2A 4FI4A 3P7YA 3VIFA 1A4MA 3MCOA 8XIAA 4GUJA 3TU9A 2VFEA 3C6CA 2FVKA 4RCXA 2PSNA 3B4UA 1Q7MA 2QF7A 4ZODA 1P0DA 1UOKA 2CC0A 3VC6A 4V1YA 3U8GA 4M3PA 1V51A 3LZ3A 1RSCA 1ICQA 2J7CA 5MHBA 2QUVA 3QQ1A 3IJQA 4NKCA 2XIMA 4Y7EA 1PWMA 1Z8AA 3WN6A 4LBSA 3TWAA 1DJQA 4IMDA 3H4GA 1WO2A 3OO2A 3MVTA 1K6AA 2XH4A 3H6OA 4GYJA 3WCZA 1EJSC 3CASA 4Y90A 4PMQA 1XSKA 2UBPC 3OYXA 1WXZA 3QOMA 1CXEA 4JFWA 4H9ZA 1BYDA 5I0DA 3ONBA 3MA8A 1OC5A 4B9ZA 1BG4A 2XWEA 1UC4A 2VFGA 3NQDA 1J5SA 1UKQA 1UA3A 2A3LA 1FHDA 4NJJA 5JMUA 3QGVA 1RY8A 4HNTA 4XO7A 3HPSA 1EOMA 3CGTA 1MRQA 3EOSA 2OGYA 3F5KA 4WKFA 1XLBA 2PBGA 1K1DA 6ENLA 3FVDA 1HJXA 2C7FA 1ITQA 3OG3A 1ADDA 4C6FA 5AOUA 1I1XA 2BZNA 3VD5A 4M29A 3B8DA 4J3TA 3EWUA 3FA5A 2A5HA 1JL8A 4LAUA 2NSXA 3FN9A 1HJVA 3SCOA 1YDYA 2F84A 3OA5A 4Z2JA 3HM7A 4EF8A 2E0PA 5D9MA 1V6XA 1SYTA 1V77A 1TPC1 4OBTA 4ERGA 3DHFA 4A21A 3NEVA 4L1GA 1ONEA 4UR8A 3TLQA 3S47A 4BQ2A 1WE5A 4Q33A 3W76A 2FHFA 1OX4A 1POJA 1QK0A 4PMNA 1TE1A 5J5RA 4HQVA 1DHKA 1UMLA 3OZPA 3P2VA 1TFVA 1TQXA 1IZCA 2VP8A 1LF1A 1W9XA 3ARZA 3HG3A 5DXYA 1IXPA 4Y8EA 4TXEA 3L4XA 3CPRA 3VKCA 2VR5A 3UG3A 1XRTA 2OQHA 5AHIA 4K2SA 3TK7A 4MLJA 3ANUA 1SW7A 4NXSA 4S3KA 2QNEA 3UU0A 4L9YA 1QNRA 5KZDA 2QMJA 3HGRA 1J0IA 4KGLA 2PC8A 1Q13A 5HK4A 5IOBA 2GQAA 4UTMA 1YTDA 3WY1A 4JKLA 4L4LA 4LF1A 3IUDA 2OO6A 1ADOA 4NAFB 1RBAA 3WDJA 2C3ZA 5C70A 4K36A 3BGAA 1NP2A 2F6KA 1PSCA 4RNJA 2HVNA 1Z89A 3RPDA 1YPIA 3S6TA 1B4EA 3T42A 4D8ZA 1NQ6A 3UPWA 4EAMA 1H09A 4GBDA 4OE7A 3LA4A 4YJ5A 5HAOA 3CAWA 5E0FA 5G2IA 3QF0A 4EPDC 2CBUA 3WLOA 4W86A 3GNXA 1HVXA 1TZ9A 3RRAA 1FWEC 3F2CA 4UQCA 4ORIA 3E9AA 3GFXA 1VR6A 2A21A 3OZOA 3QZ6A 5HMEA 3ZOAA 9XIMA 5GJMA 3CEPA 1M6JA 3W1XA 4WDTA 1DIKA 2RDXA 3VVGA 1WZLA 4R27A 2DIKA 2PUZA 3NL2A 2VX5A 2WMIB 3ELFA 4ZO7A 2XUCA 4PCPA 3AS3A 3SW6A 3DCPA 3SQLA 3SURA 3PR2A 1G7UA 4Q7NA 3PVFA 1K8ZA 3NFUA 3WD2A 1KQYA 3JU2A 2C79A 3C52A 3WK1A 1I2PA 3UWVA 1E6ZA 2PBOA 4HNVA 4Z2GA 3DFQA 2VC9A 1ZP3A 4DO5A 4QJ4B 3KXQA 5HPCA 2ZRUA 3M0IA 4LY4A 1VS1A 3AALA 1JCMP 4O17A 1E6PA 1F6PA 2DDXA 2FZBA 4XD5A 4IL0A 1XINA 4AISA 1DJGA 1LWJA 3E2RA 3ORWA 2PWFA 3GIYA 2EF9A 4Q3MA 4DZHA 1RV8A 2QIIA 2ZDSA 3RM8A 3M0LA 1PIGA 4WEVX 4Q8TA 1Z44A 3O6YX 1ZJAA 1TQJA 2FTWA 3BG3A 1O94A 3V1HA 1KLZA 3GSMA 1RVKA 2REQA 3H2AA 3KL5A 1GTHA 4LAKA 4DB7A 2CLPA 4GWEA 2VURA 1QOPA 4IT1A 4AZIA 3IANA 2QPUA 1MQQA 4FIQA 4DNMA 1V6WA 1X96A 2QXWA 3MV01 2PEVA 2BXYA 4HU8A 2OPJA 4JEJA 5GJPA 2FZ9A 1LP6A 3W9ZA 4DJDD 1X6LA 1G94A 4QITA 2YA1A 3I6EA 1VBUA 2OSWA 3MTWA 3WLIA 3NGJA 2W61A 4D6CA 5LIWX 4DJFD 1PIIA 3GZAA 3PB0A 3UWQA 3CL6A 2BXZA 4Z42C 4MB5A 5K3VA 2Z6IA 1YKWA 4FK9A 2Y61A 4NU7A 4A22A 3DYPA 4F2BA 5I3DA 1W3JA 1W5MA 1BVZA 2PB1A 4EKJA 1R8LA 3KP0A 2QR6A 3GBEA 4MAVA 4EK7A 2B7QA 1FDJA 1TWIA 1ZL1A 3WELA 3DHPA 4C6IA 3LHYA 4W5ZA 2FZMA 1H60A 3H2CA 3H7UA 4OQVA 4PC8A 3PB2A 4XV0A 2G5WA 3CB3A 3CMFA 3BG5A 3T8QA 1E4LA 4PL1A 2QULA 5E9XA 1SR9A 5BWFA 3WYZA 1EXPA 5G1YA 3GVWA 4DIAA 5A6TC 4JQAA 5CPOA 3BG9A 4XB3A 5REQB 3QMRA 3MBDA 3NNTA 2JEPA 1WBHA 2ZZ6A 2OG9A 2PGFA 2TMDA 1NJJA 2IXUA 4RW5A 5D2VA 1KCLA 4YHEA 3R13A 4KWOA 5C8BB 3PF3A 1GOIA 4O0KA 4WQ6A 3M1ZA 4JFSA 4D2JA 1ZAJA 4IFRA 3KLLA 2QF8A 3VM5A 1SQ7A 1E5NA 3O3RA 4CGTA 3CEUA 5I06A 5CEWA 1HG3A 1TRIA 4MWAE 1PYMA 3QYQA 3KOYA 5FF4A 1QNOA 5A6SA 4N42A 3AROA 2BTMA 1E6RA 1Z6KA 4MLRA 1XDLA 5H91A 3S5SA 4CU8A 4NJIA 1YYAA 2Z1WA 3RRXA 3OBEA 4D6HA 1J0YA 2J75A 1BVWA 1E4MM 1IXNA 4OOZA 4NRRA 4GUHA 2XISA 3P74A 4UTLA 4JIQA 1KQZA 3VIIA 1E43A 1W5QA 2WHKA 3UJSA 4FAMA 1FKWA 3DECA 3F4DA 2DZTA 4IX0A 1BLIA 4YWSA 1TTQA 3B0PA 4KIEA 4CEXC 3RAOA 1LLZA 3EMQA 4C1LA 1LOSA 1P7TB 3CLMA 4CU6A 1V02E 4IIGA 4B5UA 3DGRA 4NSBA 1XDJA 2OOFA 2VWTA 1Q6QA 1XLDA 1R2TA 3KZPA 1JPIA 2CZVA 2YW4A 3K8KA 4H6KA 1I2RA 3H24A 2CLKA 2BBFA 2W27A 3BW4A 2CHNA 3ZO9A 1A5KC 3C2RA 1JDEA 2VRJA 2XM2A 1GKQA 2BXVA 4B4FA 3R2GA 1REQA 2ZRWA 2QJMA 1ZRQA 3WNNA 1UD4A 4IGSA 1OYCA 2GJRA 5CPTA 3KDNA 4O4VA 4Z1BA 1SO3A 2GDQA 5CZ0A 3W1RA 5K4XA 1Y7VA 1QNQA 4MMWA 4FNPA 3RM4A 1AG1O 4J9JA 2R94A 4GBUA 2WMJA 4U28A 3CWOX 4N9CA 2OB3A 3TCSA 3UR2A 3RO6A 3EEZA 5FOOA 2QPXA 2ZZ7A 2CEQA 3KVJA 1NWSA 3KP1A 4IWWA 4QS6A 3MCMA 1TPH1 1ZLPA 4N9BA 5G4EA 5AVHA 1BGGA 1RJRA 2UV8G 5FF2A 4KETA 3FIGA 1ZU8A 3QMTA 2J9YA 1FDYA 1V3JA 2C15A 4UNIA 2DW7A 3R8GA 1QI3A 1AH4A 1JF5A 3YPIA 4E4UA 3TV8A 1FWJC 3QY7A 2VJXA 1ME9A 1FH8A 2YCLB 3W7CA 1UUOA 3AWNA 1Q5MA 4JNMA 3P84A 1MDLA 2WBKA 1UJQA 3ARSA 5BXPA 1DWFM 2E5CA 2NQ9A 3ID7A 3NYDA 3LGDA 2HJPA 2DT2A 3AHTA 3BVJA 3IVSA 3S2LA 3OVPA 4GXPA 4KF1A 3EWCA 1HN1A 4EOUA 2PWEA 1WKYA 4O18A 4MB1A 1XIFA 4O0QA 3URNA 5HPOA 3G8RA 4WF7A 3UFYA 2GLKA 1FWSA 3TTEA 1FH7A 5JIWA 1BFNA 4NNBA 5DQPA 4W8BA 4QX4A 2VI0A 4B92A 4HZ6A 4XX6A 4FS9A 3W01A 3R4IA 3SY5A 1QVBA 5CPMA 4P5UA 4MPKA 3T7VA 4I8DA 4PTDA 9XIAA 3HFTA 1ECEA 3GS6A 4JYDA 1KFLA 5L9FA 3G1VA 4GQBA 3IGSA 1UC5A 3C86A 4O11A 5I7GA 1OC6A 2IPFA 4E6MA 3TW7A 3IS4A 2WZIA 4TOQA 1VB9A 4JTLA 1TWSA 1JYWA 4C6OA 5CSYA 1EP1A 4JY8A 3A22A 4BF9A 4JTHA 1S46A 2PDXA 1LOLA 4LEQA 4FXFA 3T40A 1BAGA 2Z7KA 1LG1A 2WC7A 2G3FA 3N6JA 5AYZA 2P88A 4AH7A 4ES4A 5A6AA 3UPMA 4TMBA 4BFAA 1B3ZA 2W91A 1JIBA 3POCA 4LS1A 4J5NA 3I6RA 3N17A 1IQ8A 4WZHA 2C8NA 3N34A 1K03A 2BX7A 2TSYA 1RZMA 3AMCA 4UOQA 1W1TA 1XRFA 3D46A 3IIZA 4XQ6A 3F2BA 3ATYA 4BQ4A 3WEZA 2GFTA 3WQDA 4NZ5A 4PTXA 3WH8A 3C4UA 1IT7A 3GXFA 4NY2A 4X61A 1Q65A 1TV3A 4XAYA 4DRSA 1BWKA 1F7BA 3KEHA 3C0LA 5AHLA 4B3LA 1B31A 4LUSB 2AGKA 1ODUA 2WNNA 4B90A 3G1RA 2PWUA 3OW1A 4G7EA 3CV6A 3ZZ1A 4WLCA 3TP4A 5HNNA 4JR5A 1F05A 2YCIX 4S38A 2WVVA 3KUMA 4MNKA 3JZEA 1MEIA 1M7OA 4GG9A 1S2TA 4MWAA 4DUVA 1HO4A 4GA8A 1Q7QA 4ZR8A 1FHUA 1NQKA 2D22A 3KS5A 5DBTA 2WCSA 4UCGA 2HBXA 5FF0A 5JBDA 5CPQA 2XSAA 4G1KA 3G1SA 4ICCX 2XPKA 2YBUA 4RX0A 3NQBA 4IMFA 3W7HA 3PUOA 5T8GA 3CV1A 3E5BA 2ZADA 4WOZA 1S5TA 4GISA 4S2BA 2Z1KA 1UZDA 2XSBA 4F0HA 3GG0A 2ZX6A 3KDOA 3W1TA 3RX3A 3PULA 1TX2A 1IWPA 4O1CA 2OKOA 2WB5A 3Q37A 3DFPA 2HSAA 4LGXA 2UY5A 3HPFA 3W1QA 5BOOA 1KWKA 3S0CA 4RE0A 2NQLA 4DJFA 1X7IA 1FKXA 1JAKA 1IYXA 3IGHX 1CGTA 2A79A 1YDNA 4Z17A 2VNCA 4M1BA 3UETA 1RUSA 4E2BA 2GSJA 5I3IA 1O6IA 2XWDA 3NR0A 2Z24A 1KXHA 4C6QA 2CLIA 2WV8A 2PDMA 1AJ2A 1K77A 1W5NA 1VF8A 3B9OA 1FWFC 2ABAA 1WAWA 2QUNA 1P6CA 2PGWA 1DXEA 4O8AA 2A3CA 1Y0EA 2PLMA 1PTGA 1V6UA 1EGMA 4HMCA 3DENA 2GGHA 3KCOA 4WY0A 4HA1A 3K46A 4LQ1A 4HYRA 3M7SA 3VXGA 4LH8A 2WPBA 2QJJA 5DN1A 4RLIA 3V7PA 4PTVA 4KQNA 3M5ZA 3PAJA 3TVAA 3GDTA 2WMHA 4IQJA 4YCOA 1E9YB 1LRTA 1B9ZA 3E96A 1HP5A 4OV9A 3VUPA 2CERA 1VQTA 4BQ3A 1K9EA 3BANA 3GIQA 4RZ5A 1Q6EA 4KEZA 4UFMA 3H26A 4OZOA 3RLVA 4MWAC 1V6TA 3R5EA 2WSRA 3R11A 1F74A 4NXKA 3F1QA 2HDJA 3VUSA 3ZS4A 3K5XA 5AYYA 3ZVHB 2W5FA 2RAGA 7TAAA 3KTCA 2BASA 3JR2A 4FXRA 4B15A 3DBNA 3GY1A 4O19A 3RJXA 4DI9A 1XRVA 5GNYA 4M7TA 4DO6A 3ZQ9A 3BSGA 1E0WA 2GWNA 5LZLA 3HJZA 4PRRA 2QMKA 3TJLA 1W2VA 5FEWA 1YNQA 2GSHA 1XIHA 1RALA 4KH2A 2NSOA 1V6YA 2J7BA 1UH3A 3BLEA 2IS7A 3WBWA 2I9EA 1LBMA 4QQUA 2R6OA 4HBKA 5XIMA 1VYPX 4QP0A 2NUXA 4BI5A 3OB8A 3LBOA 3CZGA 1Y8BA 4HHHA 3S1WA 4W8LA 2E6DA 3M41A 5LA0A 2BB0A 3W72A 2IQ0A 1E1CB 2YPIA 3LXCA 1DJHA 5HJXA 2V5BA 2QUTA 3OVGA 3QXBA 1EYWA 4NJGA 3WZ0E 2INZA 2HK1A 4M81A 5E0CA 1K7FA 4ZMGA 3EDFA 1GOWA 4MTVA 4MSSA 5HNRA 4M6QA 1GZ1A 3W6MA 4C6KA 3L5LA 3WK3A 1Q4WA 3LSBA 3ANYA 4TR9A 5AC7A 4CCEA 2IPGA 2CCRA 4ZSTA 4GO9A 1UR9A 2GYIA 4EAYA 1UR4A 3CUFA 2O9PA 4DJDA 4Z1AA 1SR0A 2J24A 3HGJA 2ZZ4A 2GL5A 1TG7A 6TIMA 3EDKA 4GD0A 3IRSA 4N9DA 4U10A 1K9TA 4JN7A 4FX6M 2D2OA 3MUXA 3L68A 3LLDA 1ISXA 3PSVA 3NL5A 2DZBA 1OGBA 3T0AA 2C18A 5CZJA 1FP9A 2GGEA 5A8OA 3TC7A 1Q3NA 4PMDA 4GFIA 1JCNA 4LYRA 4O54A 4O52A 1Z32X 4H9MA 1D8CA 4QIUA 3VNYA 1YADA 5BRBA 1XYZA 3VAVA 3PZMA 4RUBA 1T40A 4CN1A 4ZQCA 4JCMA 3QSTA 4W8AA 1NDZA 4NNAA 3UZ5A 4B5SA 3V1P