3WBDA

Crystal structure of anti-polysialic acid antibody single chain fv fragment (mab735) complexed with octasialic acid
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
231
Chain Sequence
SDVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLYWYLQKPGQSPKPLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCFQGTHVPYTFGGGTRLEGGSQIQLQQSGPELVRPGASVKISCKASGYTFTDYYIHWVKQRPGEGLEWIGWIYPGSGNTKYNEKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYFCARGGKFAMDYWGQGTSVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of anti-polysialic acid antibody single chain Fv fragment complexed with octasialic acid: insight into the binding preference for polysialic acid.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords single chain Fv fragment of mAb735
total genus 57
structure length 231
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wbdA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wbdA01
2VLJD 3F12A 2A6JB 2OP4L 4HF5L 4MA7H 1MPAL 2NR6C 3HNSL 3V0VB 2E27H 4XRCB 5J11B 1GGYA 3HRZA 3OKYA 4MXQD 1HSAB 3RTQB 4R26H 5DC0A 1FGVL 3Q6FB 2GAZA 5DYOA 1U8NA 2YUZA 2VERN 4Z7VE 2IH3B 1B2WH 1MJJA 1WIOA 1N59A 3AGVA 4LARL 5DJYA 3U0PB 1ZS8B 1JF6A 4KV5F 1KLGA 3MLYH 1JGDA 1GC1H 4FFZH 1HEZB 4J2XA 3QUZD 1UT9A 2JLLA 3ARDD 4JLRB 4KMLB 4YAQA 2HVJA 4CRPA 2HYMA 4P9HL 3UTPD 2HA1A 1MFNA 1E4XI 1BM3H 1H3WM 3DUSA 3MLRH 3TN0D 3MA7B 2DQFB 2OQJB 4KK9D 4K8RL 4M61A 1U8IB 1XR9A 1WFUA 2NY3C 1CT8A 3L3KB 4JANB 1K8IB 4JO2L 2DQTL 3IJHB 2ENSA 3DTXA 1A2YB 4XNYH 4Z7QE 1UZ8A 3N1PC 5KW9H 3MBEC 1H9VA 3ZKXC 3JTTA 1FL5A 1XGYL 1F3DJ 5SWZE 1K3IA 3U7AA 3LN5B 1JPSL 4WFEE 4HKZA 5DMJB 4U6HB 5JOFB 1FZJB 3IU3A 5D71H 5FYKU 4R6UA 3KG5A 4LIQH 4H5SA 1VENA 2BY1A 4QF1B 2BVTA 3MSPA 3QUZC 1TJGH 1JGVH 4NWUL 3O6KH 5JPNA 4KKCC 3MJ6A 3IKKA 3V8CA 2C3WA 3U0PA 3IDJA 1UCBL 1HILA 4HGKC 2XZQL 1QBLH 3PL6B 2E27L 4BFGA 5EU7C 2CXKA 4FZ8H 2VXSH 3MBED 3OKKA 3QCUL 3FOLB 4QXGL 1I1FA 3P4MA 1I8IB 4MXVE 1GAFH 3MJ7A 1YYLH 4P59L 4G8EA 5D7LA 1PFCA 3QFJE 2OYPA 4HSQA 4UINH 1HWGB 3FFCB 2CO6B 1EFXD 4OLYL 1CVSC 5TJWK 4HS8H 1AGDA 3W9DB 4DZBB 1CICB 5E2UL 1NUDA 5BXFB 4NQSB 3V4UL 1CFVH 2YUXA 4K2UH 5KTEL 4LLMA 15C8H 2WUBL 4ELME 4K3GA 1VADA 2X70A 1YN6B 3THMH 1RU9H 3ZHDA 3PWVA 4LL9A 2YMXL 3MJ8B 4MNQE 1SEQH 4ZFFB 1Z9OA 4ZQKA 3AS1A 5EO0B 5MHSD 1GXEA 3D3VB 4K7PY 4KROD 2W0FA 3W0WA 4GBXD 5FV1L 1HN1A 3AMKA 3MRRA 5EZIH 3V6OC 5JR1H 2R2HB 3DSFH 1OGAD 3MUJA 5C0EB 5T1MB 1QLFA 4U6YA 2MSPA 5L2KA 2YSSB 4DVRL 3PHQB 2Q6WA 5HGDB 1QFOA 1JNHB 2VUOA 3DX6A 1NBVL 1YEGH 3L3OB 3MV7E 1WBXA 1S7RA 2W0LA 1JTPA 3VD5A 2ARWA 4P3DA 2WNGA 4X6BB 3V7AE 2CGRH 3G04A 1G7MA 5D6DC 3VFVA 3DGCR 5SWZD 2R0LH 2PO6B 3MOBH 3GSRB 4OUOA 3RKDC 4XPGH 1YC8A 3TO4A 4MB5A 1C7SA 5EUOA 1DQJA 3BN9C 4QEGA 3QDME 4YFLF 2CD0A 1NCDH 3GI9L 3VRJA 1DUZB 2W0PA 2KKQA 4J3VA 3G08B 5FM8A 5HGHA 2CLRA 3KPMB 3LS5L 3VRIA 1I1RA 4TULL 4TTDD 5E2TL 1BFOA 5DURB 4QTHB 1S8DA 1UKQA 2FX7L 3PGFL 1FZMA 2XWJA 1DTUA 4KUCD 4MB4A 3BE1H 1KB9J 5I1AB 4AMKH 4KDTA 1G7PB 4AJ0A 1QSFA 1BVZA 1TZIB 1KJMA 4Y4HD 3SQBA 4HIIB 1NFKA 3U48A 3P30H 1BOGA 1Q9KA 4HLZH 4YE4L 1OW0C 5HI5D 3G04B 5DVLA 3MXVL 3UBXG 2I24N 2OL3L 4KZDH 4NNPL 4WUUE 4KQ4H 4XP5L 3HUJA 1QZ1A 2DM3A 2FO4B 2B2XH 4XGZB 4UNTA 1C08B 4L8BB 1EEQA 4L4TD 4EDWL 3C6SA 3M1BA 3WFEL 4P59H 4HULB 3TBWA 4U6HA 5CCKL 1ES0A 1KCVH 2AXFB 4GAFB 4JM2B 4MQSB 5IR1A 4GUPA 3T4YB 1T0NB 3QJFB 3QWOA 4TSBL 4PGEB 5IM7A 1P4IH 3LOWA 1L0XA 3O3DA 1CICC 5IFJA 1A7OH 1BVKA 1YMMB 2XN9E 3NZ8A 4Q9RH 2O61B 5HYJE 1JCKA 4P2RE 2H26B 4ONGL 1RFDH 4R7DA 4V1DB 3T0WA 3TLRA 3T0ED 3OPZL 1TVHB 1PX3A 1JZ4A 4LQFH 4XXCC 5EA0H 2ZWLT 4HD9A 4MDIB 1Q0XH 2VWEE 5D2LF 1GPOH 4YDKL 4CMMB 4U3HA 3UMTA 4YX2H 5AG9A 4R9HA 3LPFA 2CH8A 2AJVL 3KNBB 1I8IA 2BJML 4JVWA 5BOZG 4X98B 2GI7A 3TH2T 1W72H 3CPLA 1HHIA 2BOBB 4PJEB 4ZUWB 4BQ8A 1I9RH 1MHCB 3QQ3A 3QDJD 5CJOH 3GRWH 3FQRB 4QOKD 3CLEL 1F58H 3CFEA 4R8WL 3X14A 4L5FL 2Q8BL 5LGHL 4KZDL 1TCRB 4L8SA 1YUHA 2QADC 4L4TA 3QISA 3EHBC 1UXSB 5FDWA 3HZMA 3O6FA 3C60C 4APQD 3GMNA 3NIGF 1BZ7A 3IDGB 3OJVC 1A2YA 2OMNA 1NAKH 4S1QH 5ESQB 1G7LB 4MQTB 4Z76B 2YHGA 3RUGB 2I25N 1DDHA 4ZS7H 1A7OL 5DWUH 2OK0L 3O2WL 3O45A 2OBGA 4ALAH 1CWVA 5C6WH 5MENB 3S37L 2NY3B 4JZOA 3TBSA 2ZCLL 5GS1C 2AV7B 1LO3L 3FAWA 5HYFA 3RAJH 3EHBD 4BH7B 1CK0L 2XKUA 2GJ6E 1RZKC 1DQQA 3MRQA 1OSZA 2G60H 4Z9KB 5AD0A 1AJ7H 3S4SG 1CS6A 1XGTA 3Q5TA 5IEHA 1QRNB 1GGIL 1PQZA 3QUMA 4MCYA 3C2SA 3EO0A 5MEOB 2Z8WC 3V0WL 3L6FA 2E9BA 4Y5XA 1DN0B 5ESVA 2H8PA 3QG6A 3MRHA 1I9RL 5EZJB 3CSYA 1DBKH 3H9ZA 2NQCA 4PLKC 1S7QA 4OGAD 1CN4A 1JNNL 4Y4HC 5BVJA 1IC7H 5DWUL 1DSFL 4Y88A 5D7KD 2UZIL 1GGBL 5BRZA 4LLVB 5DGRA 4ODHH 1XIWB 3I6KB 1CGVA 2K9UA 4RISL 4WHCA 3ARFB 5TGBA 5IT2H 5IFHL 3L7FB 3QFDB 4JN2A 3FFDB 1VESA 2OTUA 1MFDL 3MNVB 1DZBA 4MJ6A 2GCYA 1FO0A 5IHLB 4F7EA 5JHDA 5I1DA 1QA9A 2YD6A 4K3EL 5GS0D 3BD4A 2FHCA 4LSRL 1OSZB 3V4UH 1RZIA 3QUZA 1FBIL 3STLB 1K2DB 4F37K 4RFNB 1FSKC 3QAZB 4YO0B 5T3XD 6FABL 2LAAA 3VW3H 1B9ZA 1DQJB 1IKFH 3JUZA 5T3XE 1IGIH 4XMKL 4S0TD 1GL4B 3SGKC 3O8XA 4FQHB 5LG1A 3BGAA 3RGVB 2Z91A 5FF6B 3RVVD 2BVEA 1J0HA 4PIRF 3QIWC 1Q94B 1G7HA 5JIPA 1YEEH 1VGEH 1LMKA 4XXDA 4ZO7A 1MWAA 3D0VB 3MTRA 2EYRB 1KCSL 5FUOL 5T1MA 3NFNA 3JUYA 4MXVF 5JIIA 2IF7A 4XCYB 4YQXL 4ZFOL 4DKEH 5L88L 3UTTA 1GIGL 4QHKJ 1F4YH 3RVXD 4ZAKC 4CU8A 3IXTA 1OP5H 1X4XA 2E7LC 5I8CB 3GSRA 1TZHA 4OZ4A 3JV6A 5DFTA 3N9GL 3TF7C 4YIQA 4WU7A 3VMOA 2IJ0C 4HAFA 4HK0A 1PG7L 2G2RA 2BCKA 5F1KC 1CK0H 4L4VE 2EECA 2X1XR 1A47A 1H0DA 1PD6A 3KYNA 3P4NB 2DQEL 4PRHD 3ZDXE 1N3NB 4DZ8A 1EFXA 1VHPA 1EXUB 1SM3H 4ISVB 4XP6L 4NT6A 5KZCD 4GBXC 4NFCA 2WUCL 4QY8A 4KGLA 5KOMC 2PUQT 3C09B 4KXZH 3MV9A 4CJ1A 4ODXB 3DURA 1YN6A 1Q72H 1I1YB 4XVUD 4KK5D 4YHOH 5D1XB 4KKCD 4O2FA 2X4UB 4MJIB 2HH0H 2YZ1A 1T1ZB 1D5BA 3KLAA 4YZFF 4UT9H 2FBOJ 2BSRA 3BWAA 2HTKC 3MOAL 4LAJH 4PB0H 4M6OL 3LHPH 5JLZB 3KYOA 3GM8A 1D5XA 2BNRE 1U2HA 3ULVD 4QXTB 4ZXBC 4JE4B 3O4LE 4WV1C 1I1FB 4QOKE 3U1SH 2V5TA 5I1IL 3IDNB 4AEEA 2XFXA 5JHLL 4YGVB 5GGTH 2P24B 4K71C 2PW2B 1QRNE 1WFTA 1QSFE 4FMKA 4JANA 2LVEA 3ULUH 1HE7A 4G9FD 5C09E 1TETH 4R7NA 2Z31A 4OLWL 1FG2A 4XCCL 3TO4D 2IAND 3QQ3B 4L3EE 1ZVSA 43C9B 4AIZB 1FSKB 3QAZC 2F74A 2NY4C 2AQ1A 1IL1A 2UYLA 4Z0XA 5FECB 3FB6A 3VXRD 1PKQA 4RMRA 2JE8A 5JPMB 5EG6C 2W9LA 4M7KL 3CH1A 5TDPA 1M7DB 1QPPA 4NNXA 2ZG1A 5HHOE 4F57L 4KUCF 2NY1C 1OVZA 1AFVH 4XCNB 4D0BA 1IBGH 3BQUC 1X7QA 4LCUB 1RI8A 1NCAH 2V6HA 2DQCL 4U1MA 4JQVC 5JUEL 1YMHA 3WN5A 4HAGA 2QHLA 4YXLL 5EUOB 3UZVB 2D7OA 2OTWB 4NPYA 3SJVD 4NC2B 3SY0A 1XEDA 4R4FL 4X5WB 1TZHB 4OZ4B 3L5HA 1FNLA 1JPGA 2QADB 4MAYD 1VERA 4R4BA 4DN4L 1N7ML 4RDQF 1S9XB 2R0LL 1P1ZB 5IR1B 4G6JH 4EUPB 4WFHE 2Z9TA 1EXUA 3QUXA 5JO5A 4QXTA 5I1EL 5J57B 5ADOH 2HJFB 1B0RA 1ETZB 4JFZH 1H8SA 2FJFB 4HGMA 1D5ZB 3MRJB 3DUUA 1DBMH 4Y5VC 4A2MA 2JELL 2C3VA 3VI3F 3TN0B 2BNRB 4XP9H 4BZ2H 4ZODA 1E28A 4Q9CA 5DRNB 5GZND 4MQXD 3HFML 3GSXA 4RMTA 1IVLA 2OK0H 3D2UD 4P2QB 3GMLA 4QT5A 3GSOA 4WO4A 1KIQB 4G42B 2GK0A 3DRQA 3IB4A 5DJXB 3JV0A 3QEHB 1KJMB 3VH8G 4QRSB 3WIIH 3C09C 4XCYA 3WO4C 3DX9B 3GBLA 4G8IB 3C5ZB 1SJHB 1TZIA 5J4MA 4OZIE 2QV2A 1T5WA 3V7AG 4LQFL 1TVBA 5AEAA 3W81A 5E9DB 4G8GD 2VITA 3SE4A 5CEZE 1RSFA 1A14L 1JPTH 5TDNB 1HCFX 2BVPA 5HGBB 1VGKA 2O5YL 4PJFB 3AY4C 1FAKT 4O4YL 4CW1B 5JA8B 3LD8B 3AC0A 3W5NA 5SX5H 1IGFH 5F7YC 3IT8D 2APBA 2L4OA 4JZNB 4X4XB 1D9KA 3FO1B 3N0PB 3BEWB 4JY6B 3VXSB 1F6AB 1W0WA 5D1QA 3HTLX 2VB5A 3VGAC 5LXGL 2LU4A 5E2VH 5FYLL 3GMLB 2EXWC 4IIQA 4UV4H 4KJQD 1ZT1A 3L7EB 1WIPA 2D7NA 3LB6C 2FECI 1KCUL 2PCPA 5IEKB 4XXCA 1LO2H 3CH8A 3SN6N 3QG7L 3QQ9D 3SDYH 3L7FA 3QFDA 2ITCA 5JW5B 2C7UA 1OGAE 3ZT6A 4NQTA 1H3VA 1L6XA 3WIHH 3FO9A 1NAMB 5E03A 4U1JA 1PEZA 5IKCB 1EFQA 3KXFD 3BEVB 5DVOA 1K8DA 3T0VA 3S35X 3BQUB 1F2XK 1C1EL 1KACB 4KRPD 2NY6C 2VDPH 3RL2A 1U8LA 1SVZA 4NUJA 3RL1A 4KTDL 4Z7VA 3TNMA 4HUXB 5EC2B 2XWBA 4IJ3B 3FCTA 3S34H 1NFDE 4U1NA 1MCQA 2R1YB 1SY6A 1MHHB 2Y06H 3JBG7 4ZOAA 1QRNA 3CLFH 4L9LB 3FTGB 4WNQA 4XP5H 2QLVB 4GRMB 3RUGF 4CU7A 3MXVH 1K5NB 1I7RA 1S7TB 4WGWB 1WSST 2R56L 4NNPH 4LVHB 2A6DA 2FECL 1NKRA 3F7VB 5F9AC 1KFAH 2B1AH 5I30L 5ID1B 3OJDB 3ARTA 1FE8L 4NIKB 5EOTB 1NPUA 4NSKB 4XNMB 3IDJB 1DLFL 1UC6A 4LEOA 4GW5A 4Y4KA 4JFFA 5C6TL 2NTFA 3GHBL 4XC3H 1MLBA 4N1EA 2FH6A 1XH3B 5TFSL 3DNKA 5KN5A 1X5GA 2X4QB 4Y7MA 2CUHA 3DMMD 2X9YA 4HIXH 1HHHB 1A4JB 5F88A 5E8DH 2EDYA 2VAJA 1BQSA 1TNNA 3UPAA 3TPUB 3QQ4A 1CCZA 4N90E 3TH3T 4OF5A 2CRIA 4U6VL 3CFJB 5EN2A 1RK0B 4C55A 5IFAL 2FH8A 4NQEA 3KYOB 4N8VG 5MP6H 1Q9OB 5ITBL 1OTSD 5CLTA 2BRRH 4HHAB 3QP3A 5I1HH 5FHBL 4HPOL 4DOHE 1LE5B 4NHCH 5F8RC 1S7SB 2KZWA 1JV5A 3H42L 4O02H 1NMBH 5DQJB 2OR7A 3WMSA 2FEDC 4K55A 4R7DB 5ANME 2GSGA 3VWKC 3BD3A 1R3LA 3DMMC 3CVHH 4U1KB 5FXCH 5L7XH 1YNLH 3O3DB 4M6MH 3WS3B 1KF9B 1KENH 4ETQB 1QRND 3KJ4C 1WJ3A 2QQKH 5I2IA 1FZKB 4W6XB 4P3CH 1HZHH 3H0TB 2DBLL 5J1AA 5D8JL 2IFGA 3OJDA 2GTWB 4PV8B 3UJIH 4D3CL 5JMRA 4YHLH 1RVFL 2VO5A 4PRBB 3V7MA 4JZJB 3VWJC 2C9AA 1JPFA 4LIQL 2YEZB 4UBDD 4WHDA 3MZTA 3ZDXF 5C0GB 3VD3A 3NFSL 4Y4KD 2P1YA 3D69B 3WL9B 3BWUC 4NQCA 3RHWK 5HHOB 1RJCA 4NHCL 2YUWA 4X98A 4ERSL 3RWCA 3I02B 1FNGB 5I0DA 4NRXB 1DVFC 4P48A 4F8TA 4X4YA 3RTQC 5FYKH 5CEZH 3HCVB 2I9TB 4YPGA 3V6ZA 4WUKH 2OZ4A 3ZKMC 3FRUA 3QIWD 1QACA 3JZ7A 1JGLH 4HBCH 3S3SA 2VUYA 4WW1A 5CEXB 1Z2KA 4Y1AA 3VDAA 1KSRA 3B9AA 4YEFA 4I0PB 1FVDA 2J1KA 4PB9L 3V6BR 4M1CC 4P4KA 3U83A 1XGUB 3MV01 4LP5A 1DP0A 1YNLL 1PAMA 5J3HC 1MOEA 3DRTB 5B22A 1F2QA 4WI9A 3R1GL 3A6BH 5MEQB 3MLSL 5D2NA 3IU4H 3WBDA 4Q0XH 1YEHH 4FXGB 1WBXB 1TTUA 3VCLB 5ELIA 4R2GC 2VLLA 5EU3B 3T0XA 4EVNA 1UWGL 2YSSA 1E4WL 2DQDH 4FQIL 4JFED 1UXWA 4MD4A 1EJOL 1A6AA 1BHGA 5C0BA 4NQDD 5F97E 3SDXF 5I1GL 1OAKH 2X4SB 5DK2A 2W60B 3VH8B 1RZFH 1G6RA 3GNML 5BO1L 5IBTH 1MNUH 2R1YA 2VZTA 3RIAK 3SDCA 1B88A 1KCKA 3ECBA 1J05A 2XN9B 3UYRL 2DYPD 1T2QH 1MLCB 3S96B 3L1OH 4CVWA 3N9GH 4J8RA 2ESVD 4RCAA 2F19H 2EYTA 3L5JA 1KV3A 1MEXL 3HMWH 3L3IA 1W8NA 5EB9A 4J3XA 5DK0B 1CDHA 3T04D 3VRIB 1NMAL 2HH0L 4HIEA 3NTCL 1OWRM 4JKPH 1BF8A 5D5MA 5EZLA 3QJHB 4J7RA 2W0FB 3W0WB 1T04B 2OXGA 5BV7L 5M94B 1HHJA 4FA8A 1FL3A 3HI6L 1IEAB 3UO1H 1LK3L 4OKVA 2QHRL 2EEBA 4FQXA 3FOLA 4X8JA 3QRFM 3LH2L 1FFOA 3GO1L 1IGFL 1UENA 1G7MB 4JZJC 3VWJB 2AK4A 3WDHA 1IGIL 4FQXC 4M6NL 4JFDE 3UTQA 4WWKB 3H3PL 2CIKA 3QCVL 1F42A 1XGRB 1ZV5A 1ZA6A 1KLFA 3NIFE 4MJ5A 5HDLA 3QUXD 4G6JL 2H1PL 2X4NA 3VDCA 3O6FB 4EUPG 4N0CC 3IJYB 4MSWB 4JFPB 3QDGB 5C0BD 4ELKA 2JF1A 3ARBA 4U7MA 4ZFFA 3BUTA 1UZ8B 4UDUA 1YJDL 4YQXH 4R3SB 3KPOA 5DRXA 2YD4A 3VE0B 4XCNA 4X9HA 4NRYB 2WUCH 1J1PL 2PO6C 4TULH 4DJMA 4JFOB 1AFVL 4D0CA 2IH1B 5I2IB 2FYYA 1IAII 4ZS7L 1NGQL 4KAQH 2F54B 5ANMB 2VIRA 4G8FB 1I3RA 3EJYC 4LVEA 3KPQB 5F7DA 2VYRE 2Z8VC 2J8HA 3T0BA 2AJSH 3I2CL 5MHSE 5ISZB 4NQCB 4QLRA 5F6IB 4YHKL 2BXYA 4Z7QF 1J7VR 2MQCA 1MFCL 2BSTB 5BQ7B 1W0VA 4OF8A 4PJIB 2F8VA 5KJRL 2FJFA 5HHPB 4JPWL 2A1WH 4UOW0 5HYJD 1B0RB 4KRNA 4XRCA 1NGZA 1UH4A 3ARBB 3U1SL 3QNXB 4LBEB 4NN5B 1T6VN 2XXCB 4X5XB 3KPTA 4I5BA 3C5SB 1Q38A 4YBHA 4RWYL 3C5SA 4I9WD 3B9KC 1S9YA 2R0ZH 2FRGP 1EEYA 2E9WA 4X7TA 2VABB 1BX2A 2YPLD 1K4DA 1CZ8H 4XB7A 3HI1A 3O9WD 1RD6A 1NCDL 1T89A 5KSBB 1U8JB 4LCCB 1KJ3L 1YEKL 2AJZB 3PIQB 4NO3A 3SOBH 5ERWB 2NY5H 3CXHJ 3V4VH 5J1SC 5EOQL 1Q9OA 2Y07L 1CLCA 3VD7A 4NZTH 4DOHB 2EE9A 2DD8L 5HHXL 3RUGE 4HS8L 4JFYB 4FQQA 2GEEA 4LLDA 4ZAKD 4L4JA 1S9WB 3LH2H 3S5LG 3BP6A 5EULV 3LPGA 4OLXL 1MSPA 3HZKB 1DEEA 2QQLL 5C0IB 4JQVA 4R0LA 1KTLB 1EH9A 2HG5B 3SCMC 1ZGLM 3WFHA 2GK2A 3VI4E 3DO7A 2WBJA 1P7HL 3N1FC 1KEMH 3NABL 1LEKB 2QQKL 2M8XA 4XT1C 1JZ6A 1GHFH 3NCCB 2R0ZL 3RX5A 3P40A 4TYUA 1SEQL 1R3KA 2R39A 2DKSA 1M1SA 4LHUA 2BSSA 3LN4A 3GBMH 4ELKB 1U3YA 2K7PA 2BVOA 1OTTC 1P4LA 1RUKH 4U6TA 4NKOB 2BVOB 4XCEA 3EZ8A 2P8MA 3MCKB 5C08E 3UJJH 2ITCB 5JW5A 5I30H 4LSQL 5IHUL 3TJEH 4NZJA 4TVSa 1AO7E 1U91B 3FFCD 3N50A 3F6IA 1F90H 4YZFE 1MJ8H 1N4XH 5GRJH 4CW1A 1B4JL 1GOHA 3I9GL 3FCTB 4I3RL 3U4AA 2OR9L 3L1OL 4P23C 2Z35A 5FO9B 1P53A 3QT2A 3HAEG 1YEJH 4CADB 3NPZB 4HFUH 1AR1D 1OGTB 1RZ7H 4NZDA 4X8JB 4GJTB 1ZOXA 2QR0B 3MRGA 1QLEH 2Y9RT 3VXPA 2R8SH 1FN4A 5GGRA 3ZTJG 3ROLB 3GB7B 3KXFB 2V9RA 4NT6B 4XCFH 4BFIA 3GJFA 5CLWA 3OGCB 1FORL 5GS2D 3FRUB 5E8EB 2DD8H 1L7IH 5IVZA 1OM3L 5A16B 1WBYA 5C0FA 4DKFL 1URLA 3GGWA 4OSUL 5J6GB 2C3VB 3HG1E 4PB9H 5DK0A 4AZ8A 3PGCB 1KFAL 2B1AL 1J12A 2FJGB 1G9NL 4ODSL 2D0GA 1I4FB 4YHOL 3WFBH 1FVCB 2DLGA 1HWHB 1LP9F 1WICA 3D87B 3BT2L 5E2VL 1FYTD 5CD5D 2VL5B 5C0AD 2YD5A 3KJ6H 3MNZA 4F7MA 1JWMB 2M1KA 2RHEA 4AH2B 5C0CB 1AI1L 3RI5F 4FQIH 4DGYH 2R8SL 3DUUB 1BOYA 1EJOH 3KLDA 4K8RC 1HQRB 4QTIL 4C4KO 2J5LB 2WBJC 2HG5A 4K3EH 4ODVH 1YEHL 3S9DB 2FL5A 5TDPB 5BRZD 2WZPD 1YECL 2XG4A 3TT3L 4Y19D 5FKAA 5CZVL 3GSUA 4QF1A 2F5BH 3V5HB 5ALBH 3WLWD 3CAFA 3S4SB 5C2BL 1T1XA 2JJSC 3D39E 4GH7B 3JTTB 2KDGA 4KKBD 4Z7OE 1DQML 1HNGA 1GHFL 4NKQB 3QIWA 1CFQA 4PRPD 2P7TA 1DDHB 4X9IA 2GITA 3SO5A 1WAAE 5GXBB 1BZ7B 3HI1B 2B4CC 5E2TH 2EICA 1OAYH 3KAAA 1U8KB 1NJ9B 5HSFA 3DBXA 4EI6A 2EC9T 2YA1A 4IS6B 2DQIL 3HC3L 3LQZB 1DBKL 3C8KA 1SMAA 4HWNA 3KPQA 3V0WH 5FV2A 3NACH 1PJ9A 4GG8A 4XNZC 5TE7L 1ZLUH 4NC1E 4PJ5B 4ZNEA 5DQDH 2IBGA 1TXKA 3MUZ1 5FOBB 1N7MH 5B21A 1T20B 3MXWL 1JF5A 5HD8D 5DR5H 2XFXB 3NIGE 3Q1SL 3WFZA 1D6VL 4YHLL 5KSVB 4Y5YA 1OP9A 1IGJB 4PJ7B 4P4RA 4DVRH 2ZUTA 3N06B 1FZKA 3WS3A 1KJ2B 3MR9A 5KVGL 1IC7L 5IB3A 3MLYL 3MRKA 3NCFB 1QBBA 3B8SA 4LARH 1YYMH 3JVGC 3IDIB 4JZOB 3TBSB 2F54A 2ZZUT 4K07A 4GT7A 5ALBL 4OF6A 2J4WH 1ODAA 1QBMH 3MOQA 2FB4L 3QFJB 4DN3L 1BIHA 5TH2A 3D25A 4XMLL 3LEXB 3QI9D 4PRHA 3EIFA 3LV3B 5T1LB 4M93C 1HOCA 4YIQB 3QZWG 3SGEI 3BEVA 5I1CH 4OD2B 2BRRL 3QJFA 3QWOB 2XI9A 1MRDL 3JWOL 3ARBC 4CL7A 4LCYA 4I0PD 4WW2A 1NDGA 3LKNB 3T3PF 3QDGE 3D0LA 1CL7I 3A0OA 3BZ4B 2P43B 4Z7UF 3IETA 4MXWL 3PWPA 5IJKA 3GSUB 1JRHI 1N6VA 4D3CH 4QOKB 1KELL 5E5MB 3SDDB 3RX8A 3CFEB 1KCRL 5ITFB 3ZDYE 1N5YH 3EOAB 3CFDA 5EOTA 5F70A 1K3ZA 3BZEA 4UILH 2PXYB 2OR9H 4XNUL 4LEOB 3E0GA 5FYLE 3ECBB 5HPMB 2OL3H 5C71A 4TRPL 4PJDF 3SDYL 4W6WB 4U1SB 1XGUA 2F5BL 3PF2A 4G3YL 5JW4N 5HDBF 4EEEA 2YRPA 3IJSA 1Y0LA 3S5LA 1C16B 2ICES 1U2CA 3DXAA 4HMEA 1RIHL 1FGVH 5HHVH 5GS0L 5J8OA 4JG0H 4PLJD 2R9HD 4OCXL 1IGMH 4K71B 1H3GA 1E4XL 3TNMB 3ZTJH 1Y6MR 2BVPB 4J4PA 2XICA 1N2RB 5HGBA 1NEUA 5T1KB 5KSAB 1XCQB 5LCVL 2H2PC 3GM0A 5DJ6B 4H20L 4I4WA 4HJJL 1G7QB 1D3CA 2I60H 3M17A 3PABB 4NO0A 2VR5A 2CIIA 35C8H 1MI5B 1CFSB 4LHUG 5LBSL 1NLDH 2Y25A 4J4PC 4Z5RA 1PG7W 1W72L 2EC9U 1JPTL 2N7BA 4UUJB 5C6TH 1GPOL 4OQTH 1NGXB 1DBAH 1CI5A 3NFNB 1UEMA 4P5TA 2C7UB 1FPTL 1NSNL 1WEJL 2APWA 2DI9A 4HV8A 3UJJL 1P2CB 3PWPD 4WTWA 5GGSA 4GW4A 1KCSH 3T0EB 1KGCD 4ZPTB 1INQA 1RUKL 4G5ZH 1TFHA 1ZEAL 5IQ9B 1C12B 5L9DH 2VKWA 4U7KA 1E4JA 4UILL 4XNUH 2FDBP 4JRXE 5E8PA 1KB9K 1F5WA 3P0YH 4X0KA 1DSFH 1AE6L 3DV4A 4LCIH 1MHPH 5K9JH 2X4RA 1SMOA 3ALXA 4NO0B 4OGYL 1G0DA 1Z0MA 3VFWB 3SCMA 4UIKH 1JRHH 2D7PA 2CLVB 3OAZK 3W9EB 4KK9C 1S7XA 4NRZA 4JCLA 3BH8B 2ESVE 1CBVL 2WW8A 1T22B 3LB6D 3FB5A 5J56B 5DZOA 4N5UA 1AGDB 2DYPA 1ZGLB 3JWOH 1MRDH 4TUJB 2O26U 4KU1A 5IEHB 5D93B 1O7SA 3QDJE 2BSTA 2HFEB 3GMPA 5E6IA 1AJ7L 1A64A 1AO7A 4OGAC 2ZOKA 5GGRY 3MNWB 1SEBB 2YK1L 1ADQH 1QFPA 4P4RB 5B3JF 2J4WL 4CNIB 2VLMD 3BX7C 3OKDB 3RAJL 4BUGA 4P2QA 1F3RB 1JZ5A 4WO4B 1Y18A 3LRHA 3CXDH 5C86A 1M05A 4OCRL 5LGJB 1KEML 2YEZA 1KENL 3BGMA 4GW5B 4W4OC 3UP1A 4O9HL 2XTJD 4NQEE 3ULSB 4N0YL 3D39A 2E7MA 4EI5D 3SHSA 4R3SA 3SGKA 3KWWB 1LEGA 4X6FA 1KULA 5E8OA 4KPHH 1KIUA 3FZUD 1NSNH 1WEJH 2VLKB 2AEWA 4PGJA 5CEZL 5HYQB 2QKIB 4BZYA 4NKIL 4ODTH 1RUMH 1JPGB 2XA8L 3LKSA 3MRIB 1DQQB 2X4QA 4FP8L 4NM8H 5B8CA 3IJHA 5SWSA 4QWWD 3X14B 1GOGA 4TSCH 4QKXB 3FB8B 4ODVL 5JIHA 1Y6NR 1EHNA 2GJ6A 2OTWA 2EZ0C 4CAGA 1RPQA 2P5WE 1SVCP 3EOBA 2FNBA 3UTQB 1ZHNB 3C6LD 1XCTB 3K8KA 3QQNA 4RISH 1T6WA 3S7GA 1MAJA 5D4QA 1NLBL 5I1LB 2DJSA 4MJ4A 4AM0A 3ZYIA 4EDXB 5DD5H 4LDLB 1T0MA 5IB5B 3K4AA 3RRQA 1HIMH 4UT9L 2R4RL 4U1JB 3B2VH 1J1PH 3SO3C 5E6ID 4F9LC 5I71B 4F57H 4YX2L 6CGTA 4WFFE 1RK1A 4CDHA 4PUBL 4Z0XB 1FPTH 4FABH 4RQQB 3PP3K 1HHHA 4PY8J 4H1LB 3UCRA 4WFGE 4WDIB 5J7CC 3HZYA 1F4HA 4FFYH 4ZUTA 5F89A 1MCLA 4AH2A 1KNOA 1RUAL 1MIMH 5IVNA 4IMLB 3BP5A 1E6JH 3QHFL 3IDYB 2OZ4L 3BQUA 1HXYA 2DLTA 5HHNA 5I6XB 2H32A 5LGHH 4F3FB 5IM7B 3L95A 4PGEA 3S98A 2FO1A 4XVTH 3PE9A 5TQ0H 5HYJA 1F97A 4IHOB 1G0XA 4U31A 4X4XA 3HLAB 1KCLA 1XMWA 4KVNL 3WFEH 4N0UE 1UB5B 1KN4L 2UVFA 1R3IH 3CUPB 4OIIL 3KPRE 1KIRB 3ET9F 4CBPA 4KJPD 5FF6A 4YXHL 3HR5B 3P4OB 4DCQA 5CEYA 4H0GA 2ATPB 2P8PA 5F7NC 3O8XB 2AK4E 1H5BC 3S4SA 4OFKA 1J86A 2FB4H 3OAUH 1R24A 5GRVK 1X5LA 2NLJB 1MAML 4P4KB 2YKLH 1AQDB 5DJYB 5CFHA 1WCBA 5IV2B 5CBEA 1KIQA 3MODH 3VXUE 3IRPX 1QFHA 3IVKA 2J88H 3B2VL 5J13C 2Z35B 1A3RL 5FYLD 2G9HA 3FO2A 4WENB 3ZYJA 5DJCB 4RFEB 4NP4H 1DE4A 1RJYA 1XGQB 5T1KA 3P73B 2YPVL 1JNHA 4OZIB 3SJVE 5D7IA 3JWDC 3BAEH 5LAXA 1GZPB 4PJXB 4ZYKB 3ARGA 4QHUA 3VFWA 1ND0A 5JMOC 2PXYC 4FQLL 2NPLX 3OX8A 3HUJB 5FDYA 4P46B 4IIQC 1V7ML 2BNQE 2WBJD 5C1MB 1IQDA 3QUXB 5E6ZA 5JO5B 2CDGA 1YZZA 4J3SA 2CDGB 4DTGH 2NY3D 4CVZA 2FX9H 4FTVB 4Q7DA 3HAEH 5HPMA 5I73C 4PJDE 2OLDA 1XGPA 1JGUH 3FO1A 4GW1B 4JJ5B 4YDLC 2C1PA 4OZHA 1D9KC 4XWOC 5C0BB 3VXSE 3CSYB 1FRGH 1RJZA 4HV8B 1MI5E 5KS9B 3S36H 3SBWA 5F96H 3MUHL 1F3JB 4OZHE 5IT2L 3MLWL 1G7HB 1HKLH 3HZYB 1V8HA 4GQPH 4J3WA 4PJCE 3ZKNC 4MVBC 3H0TA 2E8YA 1M4KA 1J8KA 5IBTL 5DJCA 5IV2A 5D2NB 2EDWA 1HQ4A 2AV1A 3KS0H 1FFQA 4X7DC 1N8ZB 4OFPA 3SE9H 3DIFB 3MV8B 5KVDH 1KPRB 5GGUA 2MCPL 4YHYB 5IVXE 1OAQH 2AJXL 4Y8AA 1U8HB 1TNMA 35C8L 4NPYB 1P7KB 1IAOB 2WLZA 3GSNB 1CGTA 2X89D 3MGOA 4BSVA 1CE1L 3VGFA 2VR9A 3ILQD 4OF0A 2NW3B 4PGCB 4Z77A 3JVGA 3IDYC 5GRYA 3WFDL 1BVLA 5B8CB 3D5OF 5I1HL 3AAZA 2ZCHH 2VDNL 3IDNA 1T7YA 5D2LA 3QEQA 3QIBC 1RVFH 4X9GA 1OAYL 3IDGA 2BSSB 1G9MC 2EIEA 3C5ZC 2DQIH 1OARH 2C5DC 5L2JA 3U7YH 2Z31B 2FIKB 3RVTC 1MCWM 5D7LE 4ZO8A 1OF2A 3FQXB 4FQPA 5JNYB 1TITA 4TPRL 1R5IB 1S7WB 1A4KB 4KI5F 1VFMA 4N8CL 4WDIA 1RZJH 3EBAA 5F7LB 1ONQA 3B9KB 4X8XA 4RQQA 4D9LL 4JFZL 1OTTD 2CMRH 3SKNB 2VIRB 1FH5H 3DV6A 1INDH 4IMKC 1DBML 3DXAD 1EBPA 3QEGH 3FN3A 5C0AE 1CDUA 1BFVH 3KNBA 4GKSB 4P3WA 1QFUH 1AGBB 3QBTB 3NFSH 5AD0B 4ZAKB 3V79C 1JJUA 1U6AL 2ENYA 1WT5A 5IG7B 1KTKE 3SPVA 3MJ7B 1CLOH 2B1HL 3G5XA 4XVJH 3MRPB 3O4OB 3KPPB 2ARJA 3KYKL 2APVA 2XWBB 4EN3A 3CU1A 2HLFD 4EN3B 4PRIA 1XCTA 1ZT7A 4XP4H 4XWOD 2MNUA 1T1XB 3O6ML 2OMBA 1BVKB 2O61A 4YBLC 1OAXL 1CGYA 5ESQA 2AERT 2H26A 3QUXC 3RUGA 4PRNB 1CTNA 4O9HH 1JTTA 2W92A 1GH7A 1H8NA 2HVKB 2YMXH 2OJZH 3BPOC 3NAAH 5I73B 3GMNB 1X5HA 2BVQB 2VDMH 3REVA 5T33H 4ZPTA 1LEIB 3GBNH 5DR5L 5E8OB 5ESAA 1FFOB 3PUCA 2BCKB 3LN9A 3STZB 3NPSC 4G8GB 5HJ3A 1U8QB 4HKXB 4XGZA 4XZUB 3E8UH 4BUHA 3MRDA 3CLEH 3PL6C 2BHYA 4ONHB 5FAAA 3TYGL 1LK2A 2AK1L 1VB9A 1D5IL 3HZVA 4GXUM 4PJXE 3IDXH 1XZ0B 3O6FC 1MHPL 3WHE1 3C08L 3H3BC 3ARBD 4JY6A 3QEQB 1RZ7L 3K46A 2VDPL 5DMGD 5C0JA 5IJVB 3MROB 4WTXA 3TCLB 3Q6GH 1QNZL 3HNTL 2DYPB 1ZGLA 2M2DA 4L8SC 2V17H 1OTUC 1A7QH 5EWIL 3FHAA 4JO1L 5A16A 5FO7A 4QNPE 4YK4C 4Y2DA 5E94B 4RWHA 3OXRA 4KQ4L 4PG9B 5INCB 1YJDC 4N9GB 1H3XA 3CMOL 5FCUL 4EQ2A 5I76A 5F9DC 1Q9LA 2AW2A 4ZPVA 4WWID 4BQBA 3DV4B 4ODSH 1JWMA 4M5ZH 4G9FB 2QQQA 3WE6A 3U2SB 2ADFL 4Z8FL 5I8CA 3BVNB 2WINB 3RPKA 2R1WB 1KJ2L 2VDOL 2ZOLB 3KPRB 2HT3C 4RSVA 1YNTA 1VCAA 4GAJL 4OQ1A 1GRWA 1WWAX 1IM9D 3KHOA 4GRLB 5ENWB 3D39D 1MQKL 3ARGB 1HK6A 1TQBB 1AI1H 3L3OA 5IMKA 3RIFK 5TQ0L 1E4WH 3STZA 5E8NA 1FNAA 1NUNB 3BZ4A 5F71A 1GGUA 5T5NF 5HBBA 2HFTA 1CFTB 5T5FL 1MQ8A 1BFVL 2EE6A 4I0CC 1BREA 5I15H 4LCYB 5E8EA 2Y07H 5GJSH 4Y16C 1XGTB 1UZ6E 2FCBA 4JFXB 5E95B 4O2EA 4HX1A 5IB4A 4I3RH 3BHBB 1E4XH 1I7TA 5GHWH 4P2OC 3GJEA 3OZ9H 1N0XL 3I85A 3W11C 2DTSA 4C59B 4YPGB 4BK5A 4JHWL 2D03L 1REIA 1SHMA 4ONGH 3FN9A 1N26A 1LILA 5JDJA 4OTXH 2V17L 5FM5M 5IB3B 4LGPB 2OJEA 5KOVC 3WS6A 5CJQH 3D69A 5KG9B 3FFDA 3IJSB 4ZAKA 4IRJD 4BELD 5ICYB 2P4AB 3MUY1 1KTDA 2C3HA 3CK0H 3WNPA 2F53B 4U7SA 5KJRH 4BH7A 6FABH 4JY5H 1XZ0A 3EKCA 3EGSA 1FC2D 2VLLB 1HXYB 3OKKB 4WY7L 5T1DL 3SDAB 2JJTA 2PO6A 2DJUA 3ULUE 5E2JA 5JXAL 5DQDL 3BZEB 1MFCH 3VXNA 2VLKE 1I75A 5ESVB 4P5TD 5I19H 2CKBH 4WI4A 3T3PE 1X5YA 2VLRB 1CLYL 3OB8A 3UJIL 1MCDA 1RK1B 1UG9A 5HHQB 4DN3H 3GRWA 3PWUA 1M7IB 4M3KB 2BDNL 4XHJD 2DL9A 5B3NA 4H26A 1BF2A 4S11A 4W4NA 3MLWH 2W59A 5IB5A 5B4MC 3HB3C 1ZLSH 3LV3A 5T1LA 3SGEH 2B7DT 4GRLC 1SQ2N 2EIDA 2EDRA 4O5LH 1L0QA 5FA4B 2R1XB 2R15A 3WSQH 3G5YA 1UKTA 2DB8A 5F9OL 1OP5K 1ZVHA 2D31B 2HVJB 4G6AC 3EDFA 3QQ4B 1S7VA 2ZNXA 4S1SL 1WZMA 4P23D 5IK3A 4Y16B 2NXYC 2R0WL 3H3KA 4DFHA 5HHME 1A7QL 2NY7L 3TC9A 5JXAH 2IEPA 4HFWB 4MNGB 1F13A 3UJTL 4JN1L 5FYJL 3C6LC 1IGTA 4KKAC 4OFVA 5D1ZD 3UEZA 1AO7D 4E5XB 3UTTE 3MA9H 2VLKA 4IRJA 4HGWB 4C56D 4JFDD 2ADIB 1NGZB 3U79A 4KHXH 5EH1A 3ARGC 1Z9SA 3ES6B 5E1AA 1IGJA 1LK3H 1QSEE 2QTEA 3DSFL 3HC3H 4MA8H 2WBWB 1MCNA 3AU1A 4F33B 3QDGA 2XZCL 32C2A 3B83A 4I48B 3WNMA 4UT7H 3RVWC 3SKUD 3QH3A 4W4OA 1J1OH 2ITDB 2AEPH 4PJIE 1TJIH 4PY8I 3NCJL 1FYTA 1OF2B 5CGYC 5F72S 5KVEH 1MJ8L 3HHRB 2IPUG 4L8DB 4KVCL 3V5KB 2F8OA 2OM5A 2WWKO 3FT2A 3O6LH 4WEBH 2Y23A 3MRCB 5AG8A 3QHTC 1FVCA 1IQWL 4LVHC 3C60B 4JFEE 1MCEA 5DUBB 1INQB 2R69H 4M7LH 3RL2B 5I8OH 2IADA 3A67H 1JGEA 3GK8L 4HWBH 1C08A 3N1QC 1KN4H 3QXAA 1WGOA 4YWGL 1EHLL 3BO8B 1WAAF 5GGTL 5DGQA 3A6CH 4H0HB 4PGCA 4NHUA 4Z77B 1RZKH 5TDOB 4G9DB 1QD0A 4YAQB 5CWSB 2PTTB 1U3HB 3TPUA 4DUXA 4BSVB 4K3JL 4FQHA 1AC0A 4OF3A 3S37H 4M93B 1FN4B 5GGRB 3OKMA 4PJ5D 1S3KL 3LQMA 1RZ8B 3BPOB 4P9MH 4FXLA 1E6JL 3QHFH 4UQ3B 1IFHL 3D85B 1EA9C 1K2DA 4OTXL 3TZVD 3WFBL 3P0VH 4K7PX 1C12A 5I1CL 3S96A 2AQ3A 2XZZA 4X5LA 4OCLC 5D1QB 3GIVA 4JRYA 2P48B 3F7VA 3RTQA 3C9NA 3CUPA 1X4YA 3T0EE 2H32H 4X4ZA 2XG5A 4JN2B 4JPKL 2X4RB 3ALWA 3HE7C 3HNSH 3LSOA 2LTQC 5F1IB 4QHLA 1HH6A 4P57A 4LQ1A 3VXUD 1QKZL 1TJIL 4Q9BA 1FL3B 2V7HA 1P4IL 1IARB 2YS4A 3NCJH 3KS0J 4TSBH 3RWJA 4NWTH 3VXMB 5F93C 3QCVH 5KVGH 1YPZA 4PD4K 1EEZB 1WV7T 2K3TA 2V2XB 3MCLL 4NUJB 5TF1L 2VITB 1A9EA 1ZA3B 3L3DA 3VWJA 1HCVA 2W9EL 1FFNB 1T89C 4K8RD 1PYWA 3Q5OA 1GZPA 5C07D 3MRHB 3P3YA 5D1XD 4ZDHA 3EFDL 4EBQH 1ZGLP 3KDMA 5AWNH 3JTSA 5B38G 4EI5C 5IB4B 2CLRB 3KPMA 5E99H 1CICA 4JG0L 1HXMA 3VG0L 3E8UL 4XHJC 4NZTL 5BV7B 4JRXD 3STBA 4I77L 1HHGA 3GSNL 3B9EA 2XYCA 2EXYC 4YHNB 4Z7WE 4NBZB 2CKBB 5CP7A 5DJAB 2X7LA 2B39A 3FHQA 4JREB 4XP1H 3BE1L 4NDMB 3GIVB 4JRYB 3QI9A 5JUEH 1LP9E 2JJVA 4G7VL 4LCCA 1HDMB 3PL6A 4PRAA 2EIZA 4XI5D 2P8PB 2A73A 4JKLA 1BX2B 5JORB 3IDIA 1TQBC 2EIBA 3DGGB 4M4RA 7CGTA 3KPNA 5DD6A 5T1KD 3X17A 3NZHL 2VABA 5L2KB 1TTGA 2V5YA 3ABZA 5DHYA 3I75A 2XQBH 4WFFD 5IJKC 2VJXA 2ZCHL 3VXQA 1CLYH 2A1WL 5F1IA 1MF2L 5HDBE 5K59E 2UVEA 5HYQA 1FRGL 1OPGH 3QHZL 4OCSH 2D7TL 3GI9H 2G5BB 3KPLB 2Q86B 4GBXB 4NZUL 2Q3AA 4IRSA 2E9IA 3HNVH 1TCRA 4PJ9D 3DO7B 4XI5C 5GJSL 5H94B 5FHBH 4RBPH 3MREA 1W0VB 1MJ7H 2WWKT 2X4TB 2FR4B 2DQJL 3I3EA 2H8PB 3Q48A 4KK8C 4H5SB 1YDPB 5BXFA 4L8CB 1ED3B 5TF0A 3G9VA 3A6OA 3R8BB 5K9OB 1FZOA 4WI2A 4O58H 1K9TA 5DQJA 1FV1A 3MPCA 1P4BL 1FVEA 4R96B 4N0FB 2R1XA 4M7ZB 5C0AB 2GKIA 1WUNT 4JZJA 4QGTA 1N0XH 1Y6KR 3Q6FA 5ERWA 4NO0D 1CU4L 2X89A 2ZSWB 2NXZD 2R56H 1U8JA 4PBXA 4WWKD 5C2UB 4XAWL 3SO3B 3C60A 4XNQB 3RY4A 5IGXH 3E6FA 4UT6L 3HE7B 2LTQB 3MRLB 4EUPA 3BN9D 1CGWA 1PSKL 5MEND 3V6FB 3WFDH 5I75B 3GIZL 2DDQH 1JUFA 4PJCA 3C8KB 1U95B 4HEPG 3LMJH 3LN5A 3V52H 1HQRA 3QIBA 1OAZH 1UXSA 4WU5A 3GHEL 2VZ1A 2DAVA 5SV3A 4QRRB 1RULL 2D3VA 3MRNA 1FHGA 3U9UA 4OCXH 1LO0H 4GMTH 2WIMA 2BHZA 5HYIA 1VFOA 1DQMH 4K94C 3T08A 5EZOH 3WKMH 4QY8B 4WWKC 5HGAB 1J8HE 2O5YH 3CDYA 1S7TA 3HC4L 3AROA 3FB7B 1NGXA 1T7VA 4W81A 3H7BA 3MMEA 4L9LC 1CIDA 1ZKAA 2UYLB 3IFLH 3U4BL 1VPOL 2C1OB 4ZTPL 3GMOA 1F8TL 1MIEL 4NBXB 1L4IA 5D5MB 5EO9B 3MV11 1S78C 4NQDB 3FMGL 4JQIL 3QUYD 3UPRB 2PYFB 4NRYA 4LF3A 3P0VL 2IH1A 3ULUF 1XT5A 5D93C 1FCGA 4IBLT 4NKDA 2PW1B 1O7VA 4LHJB 1ACZA 4RAVA 1J18A 2NY2B 1PKQE 4NRZB 1I9JH 1KT2A 2I60L 1OAZL 3CGTA 2EKJA 4KHXL 4JEGB 4NCC1 3WNLA 3QNYB 4UDTB 1ZA6B 5DF0A 3TO4B 3TBYB 3BP4B 3HNVL 4JB9L 2VXVH 2VQUA 4PBWD 3VXME 1IM3A 2ZUWA 3VXTA 3TCXA 1PSKH 2EIZB 3ILQC 1OT1A 1BMGA 3IF1A 1ZT1B 1A3LL 3QIUB 1OSPL 5FEBA 4O2FB 1A22B 4LSTL 1F4XL 4R26L 3OTTA 1IZJA 2E6PA 3QIBD 2JIXD 2BNQD 2PF6A 1P2CA 1UH3A 5GGSB 4WGVB 1FC1A 1QBML 1QQDB 2GW5A 3PHQA 4MA7L 4WEBL 4G3YH 3MCKA 1UADC 5IB1A 4TOYL 2F53A 3F7RA 3MUGB 3VFPB 4P2RA 4LVOB 1K8DB 3DYOA 4WW1B 3BN3B 1QO3A 3MLZL 4XC1L 4QGYA 1HQ4B 1P4BH 3E3QC 4D9QE 3LD8C 3CLFL 1ZHKB 1YNKL 2GQHA 5EIIB 1AHWB 1BOGB 3I50H 3L5WB 3RGHA 4Y5YC 1I9JL 1Z0NA 4X80L 4G6FD 3QRGL 5KANG 1JHLH 2B5IB 3UPRA 1A6PA 3FONB 1MJUL 3HCVA 5KANI 1WZKA 2I9TA 4GG6B 3BD5A 2DQUH 4HEME 5TE7H 3RWCB 2ICEB 1PY4A 3MLSH 4CVZB 4NRXA 4LLDB 4PJ8A 25C8L 4HUWB 3GSOB 4YFEA 2Q7YA 4GXUN 3ROLA 2JB5L 1MFAL 3VRJB 4H8WC 1EV2E 2EYRA 1E0OB 2IFFL 2XOTA 4D9LH 3T0DA 3HAEA 5AYUH 5EZIL 2VDLH 2WK2A 3PHSA 4HKJB 5IFHH 4PJ7A 5CIPH 4BQ6A 1MHEA 5TE4L 3OKLA 4TUKH 1DBJL 1DL7H 2YBRA 3OXRB 3TIDA 3IS1X 4LSUL 1BD2D 5C09D 5MEQA 2XZQH 3TJHC 3CDGB 2NY0D 1TMCB 1EEYB 1QSVA 5I16A 2PETA 2HN7B 1EZVX 4R0LC 3PDDA 3DRTA 5T3XH 5EO9A 1QLRA 4UAOB 4JZNA 4DUWA 2WLYA 5JXED 1FNHA 1U93A 4LOUD 3OXSA 1UGNA 1T2XA 4XNQA 2XY2A 1E4KC 4PRIB 5H8DA 4NKDB 3V4VL 4OD2A 2YRZA 2EH8L 1JV5B 1B90A 3ARFD 5E99L 4X9BA 5IVXF 3KPPA 2ATKB 3QIUC 2CDEB 5SX4I 3VFMA 4OV5A 4PREB 4N68A 1S9VA 5D7LD 1U8IA 1XR9B 1JHLL 3R06A 2Q20A 4X7EC 3UBXA 1D5ZA 2MCPH 4ZMAT 2CRYA 1NC2D 3HZMB 3GO1H 3DHMA 1FZOB 5IBLD 3KR3H 3DVNA 4E42A 3BJ91 1KN2L 4PGBA 5DMKA 4PTUB 4U1IB 1FYTB 5B8CC 4RWYH 2YRLA 4PJ8D 4QT5B 2NNAA 3BT2H 4M6ML 3QCTH 2A0LD 2X4OA 3I84A 1BBJB 2Z92A 2ZUXA 4OI9A 5DQ9B 4D0CB 1U8QA 4RX4D 5DRNA 2KQNA 4PRBA 2DM2A 2XKNB 1KBGH 3QDAA 4NCC2 1N59B 2ICWI 3QXDA 3KPOB 5DRXB 2GTWA 5AYUL 4I3GA 3RGVD 3SBWC 3DLQR 1U8NB 4WFED 3SKMB 1LDPH 3OMZA 3B9DA 3SKMA 3QPXL 2WIIB 4LLYB 5L8KB 4I2XE 1BGXL 3MBXL 3VXUA 3BPCB 3H9SA 2NCMA 3P77A 4G8GE 2NX5D 3NVQA 4WJ5A 2IAMD 5EU6A 1K85A 2EE3A 5IG7A 2VXVL 4QHKI 1RUML 2XA8H 4XMPL 1KG0A 4IOFD 1WZ1L 1AGBA 1OL0A 4WIQA 1RIVH 3BDYH 4F58L 5L2KD 1ZANL 1PW3A 4HUXA 5H2BA 3HE7A 2CIKB 4K23H 1MHHA 2PKDA 3RL1B 2HKHH 3PJSA 3DVNB 4E42B 1WVZA 1EK3A 3TWCL 5JXEA 5D1XA 3HS0A 2VLME 2FJGA 4DEPB 4S10A 3GSVB 5GIRA 3NN8A 4GS7B 3DETD 5HHVL 4Y2OA 1CICD 1VDGA 3FQUA 3VFMB 3GGWB 4JKPL 4YWGH 1EHLH 1T7WA 4Q0XL 5KSUB 2IG2H 4YDKH 4AEIH 1A6VH 3PWUB 4K94H 2CLZA 1PKQB 1NH6A 4HBQA 4HXBL 4ZUVA 1NC2A 1JPSH 4OSUH 5ANMA 3RJDA 1WFNA 1MCWW 1XGYH 3LKPA 1R3HB 2AABH 5CGTA 3S88H 3RBSA 1CXFA 5I74C 3KPNB 5DD6B 4UV4L 4JFOA 1MH5B 5EPMB 1XH3A 3K0WA 4F8QA 2BVYA 2AEPL 5D1ZA 4WU7B 2HFGH 5SWSE 5FO9A 4D8PA 2BNQB 5CSZA 3CPLB 4G6MH 4HCRL 4BKLA 3MA9L 3DXAE 4YC2C 5EBGA 1O0VA 5CCKH 1DVFA 1SEBA 4NN6C 4PJAA 1BJ1H 4EXKA 1SJEB 4E0RA 2DQDL 4P46A 2NX5A 1GGTA 2YD8A 1HI6A 4YNYA 4WO4C 5DUML 4L9LA 4XMPH 3EOTH 1QEWB 1PLGH 3NCYS 3HE6B 2DQGH 1JYVA 1NANI 5C0DB 2NYYC 3O9WB 4PJFF 5DDHB 2HLFC 1AKJD 4QYOA 4C56B 3QI9B 2VTFA 3ZKXB 1I9IH 4Y4FC 1F8TH 3WIIL 1YMMA 3NZ8B 5EBWA 5IESL 4GW1A 4WI3A 3T0AA 1DBBH 5EIIA 3L3HA 5DVNA 4ZSOA 2AV1B 2D2OA 4KUZH 3B43A 4QRQA 2WAHA 3NABH 2HT4D 4LGRB 4N0UB 1I8KB 3VWKA 4HIEB 1P69B 4HLJA 1G1CA 4FG6C 5E8NB 5MERA 3TO4C 1Z9LA 3DX8A 5DI8B 1CFTA 4MXWH 2YK1H 4N5EC 5DI8A 2GHWB 3VFUB 1PYWB 5IVOA 4LNRA 4P5KB 3C2AL 1WBZB 3MLTB 5DVKA 1J0YA 4ODWB 4WY7H 3S35L 2OL3A 3NCEB 1N4XL 5GRJL 5ENWA 4MCZA 4NM8L 3EYQC 3MOBL 4BFBD 3M8OH 2X4SA 4ZD3L 5C70A 4QXWA 3RTQD 3TNNA 3FT4B 1XIWC 5F9JA 5TF1H 1I7ZB 5EUOF 2Q3ZA 4N0RA 3ELAT 1G7IB 1MCOH 3BJLA 3WUWB 3AU1B 4FQ2L 5IMLB 3IFOB 5EO1A 5IESH 4AIXA 4CMHB 4JKWA 5ISZD 2BOCB 3U7YL 4U1MB 5I1DB 3MLZH 3ROOB 3ZE0E 1PZ5B 1UM6L 1JVKA 1KXQE 2QEJA 1KLUA 1SJHA 1OQOA 4NNXB 2P45B 2WANA 2Y36L 3C5ZA 2VR4A 4JHWH 5SWZB 2X41A 3IAPA 3GI8H 3O11A 4ZFZA 1OCWH 4JDVB 3CSPA 4Y4FA 3WL9A 4DN4H 3VGEA 4DTGL 1S7SA 1UB6A 3EOAA 1QBAA 1RIUH 4O2CA 2WP3O 3TN0A 1B6DA 1EMTL 3QI9C 2PW2A 4IM8A 3OAYH 1NCWH 3FN0L 5C9JA 2VXSL 4PJHB 2EKSA 4FFVD 4WU5B 1P5VA 3HC0A 3MRCA 2ZCKL 2HJFA 3OG6B 5J13B 3GMRA 4U1LA 1H3PH 3W5MA 2HVKA 5JLZA 2AAVA 5IW6A 5I1KH 3T65B 3VJ6A 3O2DA 5JQ6H 3WE6B 1JTOA 5CZVH 1L7TH 4A6YB 1ACYH 4UTBL 2X4UA 2CKBL 4XNMA 1FNEA 4ZPVB 3AM8A 3H2WA 3UC0H 5JOPE 4ZUWA 4OZFH 1AXTH 3RDTD 4IRSD 4MD0B 4U2ZA 2LV4A 1WTLA 4HG4K 3TVMD 1KTDB 3BIKA 4DVBB 3BIKB 4X6EB 1FIGL 1Q0YL 3EJZC 4MA3A 2ZUYA 3EOYG 2AK1H 3ZHLA 3H9SB 1EMTH 3BPCA 3CK0L 4H20H 1RUPL 1NCBL 3BPNC 4E41D 1EFXB 1X9QA 2YPVH 4RGMC 4LLQB 5DRWA 4CMHC 1YY9D 5DEFB 5D1XC 4HXAH 3RWFB 3FMGH 3SKOA 2DLIA 4NQXB 5FYKD 3K7UA 3DVFA 2R0WH 4NWTL 4GG6F 4WUUD 2A9NL 5HYSB 2NNAB 4ZFGH 4BYHA 5DJZB 3BHBA 2X4PA 4KH2A 2VZVA 4LSTH 4UDUB 4H8WH 3OKDA 3ESVF 3O8XD 1U42A 1HH9B 3MACL 4KTEL 4CVUA 3S8WA 3AVEA 3FT3B 3WYRA 1KIPA 3VXMD 2J6EH 1JI1A 5DRZB 4I3SL 3CDCA 5FYJE 1H8OA 5JW3H 5T5NG 5KG9A 2QQNL 1YY8B 2PO6D 5EZOL 3ULSA 2Y7QB 5C08D 1AC6A 1J1OL 3CD4A 5FGCB 2NW3A 5A2IH 1UM4H 2MTPA 2FZ3A 4J23A 4WEMB 3T2OA 2ZUSA 5I66A 2XQYK 3BW9A 1EAJA 4OIBA 2JK5B 4LSVL 2FBJL 4F58H 3EGSB 4ZD3H 5KSBF 2ZOLA 3SCMB 4LSPH 2XA3A 1F6AA 5FIEA 2CKBA 5CP7B 4AQOA 1AXTL 4QNPF 1U92B 4GRMA 4JFXA 3M17B 1U36A 1CXHA 5GS3A 4B50A 1QHOA 1NKOA 4RGNB 2UWEE 3ROOA 1N3NA 4H8WL 1HSAA 4I8DA 1NMCC 3ME0A 4PTTB 4ETYA 1BBDL 1DCLA 1AY1H 5E4EB 4X6DA 3F12B 4M1GH 2VN7A 1C16A 7FABL 4P23A 4Q6IB 2A77L 1N5YL 2D7MA 2JJTC 1OARL 3SDXB 2AEQL 3FQXA 3JV6B 5E8PB 1RUQL 2QSTA 5D1QC 4NN6B 1EO7A 1QSFD 3M8OL 5D5MF 4ONHA 1RIUL 1OTSC 4JFDA 4PS4L 1GGCL 4TNVF 3IDXL 4M9PA 1S7RB 4Q2ZA 1CFBA 3MLUL 4ODWA 3UZEA 4X99B 1P5UA 3WD5L 1IC4H 3BGFC 5E5MA 1RJYB 1XGQA 1AGEB 4L8BA 4EVNB 4OZIA 5FFLA 5IVXA 1TETL 3BISA 4X4MA 5I15L 3EO0B 4G6KH 3BKCL 5F9OH 3QRGH 2G75B 2Y36H 2NZIA 4ZXBA 2BNUB 2VLRD 4OT1H 2XNAA 5D96C 3BXNB 2ED8A 3B2UD 5D7IE 4KV5E 1UQSB 2A0LC 1Q9WB 2BMKA 1BFOB 2Z31D 4Y4KC 4OCRH 1QSED 1WC7A 1DJSA 5HJ3B 1N2RA 4B7IA 4UNUA 4TQEL 1P9MA 3N85H 1MFAH 5TGBB 4RRPA 5IMLA 1CR9L 1M7DA 1Q1JL 4C56E 2FWOB 1KIPB 2IFFH 1Z5LB 3V2AR 1MCSA 1Y0LB 4OFYD 5DUBA 4LLVA 3JXAA 3QDJB 5EN2B 1YEDA 3UTSE 2DICA 2Q76B 2RFXA 3PDOA 1CE6B 4F3FA 3C2AH 1H15B 1ONQB 1UM5H 3OV6A 1MNUL 2AP2A 4M8QB 3MRDB 4MCZB 4PRIE 4YDJB 2H32B 5F3HB 4NQXA 4LCWA 5A2LH 1EHXA 3S36X 5CEZD 4TVPL 4HQQH 2W9EH 3HZKA 4ALAL 1IMHC 1AE6H 1MQKH 4QOKA 5IF0A 5K9JL 5AZ2L 3SE8L 1PQZB 1LO3H 4POZC 4P2OA 1DL7L 4U1GC 2ICWJ 3WIFB 1YC7A 3D3VA 3FB7A 1YJDH 2H2SD 1NBQA 3NBNA 1LGVA 5FA3A 5J3HD 1A02N 5HVHC 3GKZA 1HINH 5AZEH 1JP5A 4ZS6C 3RPIB 1G6RL 3FZUC 2DQGL 1I1AB 4PJBB 2VDKH 3RP1A 5KSBA 3TT3H 1JYWA 3AS0A 5C07A 4GMSH 1RFDL 5DXWA 1IFHH 5IW6B 3T1FB 1B0GA 2ZG3A 5LQBH 3BSZL 3S34L 1G9NC 5CJ5A 4KMQA 5J12B 3RY6C 3P9MB 5AAWA 5GS0C 4ELMF 5HI4C 4YPJA 3GDBA 5IMOB 4HQQL 1FZJA 3I6GA 4YHYC 5CP3H 3DYMA 3BAEL 4UU9B 1VFUA 2VZOA 5IW1A 2J8UA 1ROWA 3TZVC 1OLZA 3BGFB 1B4JH 4HH9A 5IGXL 1JPST 5A2FA 3AAZB 3C6SB 4AQ1B 2HAZA 1ITBB 4Z8FH 1BVLB 3K1KC 5IEKA 1M05B 5EFIB 4XPHL 5EU4A 2P7TB 4IJ3C 3E1F1 4JFFB 3FQTA 5A43C 4L1HA 1FV1B 1PEWA 2ERJC 4DQOH 1F45A 2X4OB 4YDVA 4JPVL 3JV4A 1HKFA 3VFOA 2Z8RA 4WW2F 4ENEC 4HIIA 3VXRE 4PTUA 5JQ6L 2W1NA 3O6LL 3MYJA 1NC2B 3ARRA 2X6MA 4M7JH 1EGJL 5BJTB 1ZLWH 3MFGB 4XVSH 3PGDB 3AS2A 4LVNB 5FGCE 4HT1L 2OJEB 1JHTA 5GJTH 1DE4B 4K7FA 5IWLC 2OQJA 3WLBA 4Z7VB 2NMSA 4PJDA 3R4DA 3BH8A 3QQ9C 1F11A 3IVKB 3KXFA 4QRRD 3FQWA 4NO5A 4ZXBB 3BMVA 3GI8L 4UOJA 4FTVA 2IAMB 2AABL 5EUKB 5IFJB 1UH2A 1A1OB 4Z7NE 2FL5B 2B2XL 5HI3C 3UPCA 4G42A 4NZRL 4GUPB 3T4YA 3P4NA 3G5ZA 3IAGC 5HHQA 2V9QA 4AEIL 1CR9H 1G0YR 1IC5L 1T66C 3GBNL 4E41B 1QLFB 4U6YB 5D2NE 1UJ3B 3C60D 3RU8H 5DTFB 2D0HA 4IRSC 4APQC 4B7LA 3BRFA 4UV7L 2NYYD 3B3IB 4KKLD 3MO1A 2E6JA 1BLNA 2YZ8A 4PBVC 4P2QE 1LO0L 1P7QA 4ACPA 4OIIH 2Z93A 5BRZE 4MHHI 5FGRA 4B0MM 4TUOB 5L9DL 5CZXC 1CYGA 3F7PC 3TEUA 4PJXF 5KSBE 4FRWA 4YJZL 3QDJA 3MJ9A 4ESKA 1KPUB 2AKRB 4JM4L 4R4NC 1FL6B 2Q76A 3PDOB 1ADQL 1JZ7A 4WRLA 2GYSA 4OLUL 4R0LB 3D3VE 2P5EE 3U0WH 5LWYH 4NQSA 5KZCB 2OSLB 4I4WB 5DUMH 5IFAH 1AP2B 1AP2A 5DSCA 1R0AL 4JO2H 1T1YB 4YHKH 4HZAA 4Y1AE 2EDJA 4GRWH 1KBGL 1T21A 2MMXA 5C0JB 5BW7C 4KAQL 1DUZA 3WXWH 5IJVA 1WITA 4HJJH 3BXNA 3TP4A 5K9QI 3INUH 1A5FH 3C9NB 3O0RL 1PX4A 1QQDA 1A6WH 3QUYA 1VKXA 1SYVB 1WTGT 3DROB 3MODL 4XHQA 1ZE3C 3VFOB 2GTZB 1BEYL 1SJVA 2Z93B 1KC5H 5HGDA 2RQ8A 1FFRA 1BIIA 5DD3L 3LQAC 1J1XH 4LASH 4MJ6B 4MJID 1IC5H 5DMGC 1MHEB 4WHTB 1KB5B 3CFCH 4PP2A 2Q6WB 2BFVL 3UDWA 5DRZA 5JZ7C 4GAGH 5D72H 4XH2A 4U2YA 1WF5A 4X99A 4P49A 1CFNB 2R2HA 4QXUH 5LWYL 4FQQB 4Y8DC 1CD9B 3JWNC 3L95B 3RWHB 2YN5A 3IGAB 1RZFL 5BO1H 3TFKD 5ID0B 1Z6JT 5BS0B 1IAMA 4G6FB 3SY0B 1L9NA 3MA7A 1TPXB 1CFSA 4NGHH 4DKDC 5IQ7H 4XBEL 4OGYH 1I3GH 4GSDH 3S88L 3OF6A 1J0IA 3KYMA 2ARJB 3MR9B 2XQYG 1QEWA 3GKWL 1WFOA 4MQXC 3RPIA 4KKLC 3U46B 1AHWC 3X3FL 5HXMA 4K94L 2B4CL 3MGTA 3RZWA 1Q1JH 4JRYE 4ZG1A 5JPMA 3WJLA 5GGVH 4OI8A 4I48A 3BPLC 3DVGB 2Z4QB 4P2OB 1A6VL 2IC2A 3TBTA 1LEGB 4X6FB 4D2NA 3PIQA 4NO3B 3P77B 3ARSA 3B5HA 1J8HB 3B9VA 4Y4FD 4HKXA 2ID5A 4TSAH 3VFGH 1QUNA 2Y7QA 5H35A 2XACC 4QRRE 5DC4B 5FOBA 1NFIA 3SDCC 4YDJA 4PJEA 5FUCE 2IQ9L 3IFNL 3OAYK 1RV6X 2EH7H 3IFPA 1A6TA 3AXLA 1ES0B 3S37X 1YEJL 5GRZA 5T3ZH 3SGJA 3VFNA 4OAWA 3BP7A 5C8JA 3DTXB 3L3GB 1FL5B 4HK3N 4NZUH 1G7JA 4NKIH 4ODTL 4UQ2A 3BGMB 3FQUB 5IW3A 3RNQB 4JFEA 2GITB 1GZQB 4IRJC 1EZVY 1MEXH 3B6SB 1T1ZA 1Z3GL 3X12B 3HS0B 5DHVH 4UAOC 4ZXBD 1T04A 4ZTPH 4A2LA 3QNZB 3PGFH 1NC4A 3V6OA 5F7DB 5SWZA 3MV9B 4I9WE 1BECA 4JDZB 4M00A 1QR1B 1G7PA 2P44B 2V5MA 1BQHG 1QTYT 5I16B 4KJYB 3DIFA 4PR5B 5DD5L 1QSEA 3OKNA 2K7QA 1MCPL 1QOKA 3PWJA 5FYLH 2BXZA 4NSKA 3ZE0F 3ZE1F 4Z7UE 1UVQB 1QFWM 4QRTB 4XVJL 4MQ7A 4LSSL 3TN0C 1IC1A 2X05A 1OTUD 4JG1L 4KDWA 4K7PL 2ERJB 2ILLA 2V9TA 1H3UA 3QXWA 3LRSB 1UXWB 4YLQT 3BFOA 2ED7A 3OJMB 5F6IC 2OZ4H 2H3NA 3CCHA 5EC2A 1I8LA 2Z0BA 5HGGS 4UIKL 4UNVA 3KVQA 3EYFA 4ODHL 3HC0B 3WS6C 4OCYL 3CIQA 3RNKB 3TT1L 3HPLA 4V2CB 2EYSA 4XX1G 5C08A 4WUKL 4KJWD 4YHNA 4KXZI 1G9ML 1BIIB 2X44D 3IKCA 4ENED 5DMIL 4O58L 5E70A 1JZ3A 3FO2B 4Q6YA 1F4AA 1H5BB 5DEZA 4MDJA 3QJHA 3ZLQC 1WCBB 3U82B 1P7KA 2DQJH 5K9KB 3O11B 3ARWA 3VXPB 4S1RH 1MI5A 1BZ9B 3TJHD 4PYHA 1NMBL 4DW2L 4PRHB 3NA9L 3V4PH 3S3JA 4M62L 2L0DA 2BK8A 2AJSL 3I2CH 4P9ML 3U4EB 1OB1B 2A83A 3G6AB 3RA7H 2APXA 3CCHB 4JO4L 2G5BA 2EH7L 1BWMA 1G6RB 4PG2A 3ZO0A 1K4CB 2VLJB 3FT4A 4R97B 2YWYA 5EO1B 4HDIB 3ULVH 2PYEA 4XCEB 3FT3A 5C92A 4OJFL 2HJLA 3NIFF 2HTLD 2DM4A 4XC1H 4G5ZL 2W0KA 4HCRA 2FJHB 4ZOEA 2AI0L 5H37H 4E9LA 1C5DA 1FFPB 1MFEH 1TVBB 5DJ8A 1L7TL 3TA3C 3LEXA 1VFAA 1NGWA 4G8IA 4PV9B 2WM0A 2D03H 5KS9F 4MAYA 3KPSD 1BZ9A 3PWLB 1E6OL 2OXHA 3OZ9L 3U9PL 4LLAA 3TESA 4GG8B 2F19L 3AREB 2DKMA 4PGZA 4PGDA 1J0KA 2R29L 3W9DA 3DOSA 4DZBA 5CBAB 2QSVA 1E27B 3BI9X 1TJHL 4AG4L 4X6DE 4UINL 1MRCL 3IDMB 2JB6A 3OKOA 1UA6L 3WHXA 3O9WC 2RR3A 1S5HA 4OLXH 4HUUB 4AENA 1K8IA 1RUPH 1ORQB 4HH8A 4PRDB 5L8LB 5TPWH 2NW2B 3U9UB 5EIQA 5DO2D 4GKOA 2H2SC 3O41A 4QRRA 2DWEA 2UZXB 2H9GA 2P46B 3ZMRA 4PJHE 4Q58C 1SYSA 5C09B 1WLHA 3MOAH 4PB0L 1FGNH 1V05A 3VXTB 3T65A 3MLPA 3R1GH 3MQIA 3MRMA 3MLXL 4NN7B 4QRPD 1M6OB 3LZFL 3L9RA 4OB5L 4KVCH 3CFCL 1N5AB 4WV1A 3LSOB 1J1XL 4ZOCA 4NKOA 1XF5A 2IH3A 4S2SA 2VDML 3CX2A 5CSGA 3MYJB 3UAJD 2V7NA 2OCFD 3QEUB 5HHNB 3Q6GL 3D85D 1TDQA 2VQ1A 3LPWA 1KB5H 5GSRB 1QSEB 2ZJSL 4H25B 4F7TB 3DWTA 1NEZG 1R3HA 1RZKL 4EN3C 3TO2B 5E0QA 3O3AB 3LKOB 3EZJB 5D1QD 5FK9A 1IT9L 5IB2B 2C3XA 4LSRH 1D5IH 5F7HA 3NA9H 4U1NB 1TVDA 3OR7A 2ICWB 4YBQC 2CJUH 3ORJA 2ADJB 5TDOA 1CD1A 4GMSL 3MREB 1U8LB 3BZFB 3NTCH 4UIMB 5HGAA 5ACMA 2XWJB 3HUJF 1CT8B 1U8PA 5IVZB 5SWQB 2DQHL 2JKXA 3AFLA 3WDIA 1GGCH 4JFPA 1JBJA 5ID1A 3C5ZD 4DGIH 2QJDA 4PUBH 5IROC 5JHDD 1FNEB 3KYAA 3WUWA 2X4NB 5C07B 1XF5B 4IMKA 1QVOA 2HFFA 1KN2H 1JGDB 3O6MH 4YHIB 4YXKL 2VXQL 3OHXB 1M6OA 5KN5B 3PV7A 3ZKQD 5H35B 4F7TA 1XF3B 1D5BB 3UYOD 2I5YL 4P4KD 2N1KA 2BP3A 3MGOB 3DX6B 1MCJA 3QDMD 2V7NB 2QSCH 2XY1A 4P5KA 5HVFB 2NW2A 1IEAA 4OLUH 5A3IC 1U58B 2XKSA 2D7TH 1MAKA 4OQTA 3ARPA 5CKAA 3BZFA 4UIMA 4HFWA 5DO2C 4EIGB 1K5NA 1ZT4A 4ZFOA 1HXMB 2DJ4A 1BQHA 4HUWA 1C5CH 3T2NL 1OAQL 3BIBX 3QPQD 4GRWB 5I75C 1ED3A 4CNIA 1LEKA 4R2GD 5KS9A 3RZCB 4LCIL 4NYLA 2KBGA 4NJ9H 4JHAH 1T4KB 3QO0B 2NZ9C 3RDTA 2VDQH 5GS2H 1BFTA 2FLRT 2FYYB 1MVUA 2VZ3A 4HWZB 1S8DB 3U30C 3RGVC 3V5DB 3TVMA 3D9AL 3CXDL 5MI0C 4C58B 2NY2D 2WMPA 5D96B 5EOCJ 5F1NB 2W9DL 1NBZB 1NMCB 2VISA 3VXOA 4B41A 4XPAH 5CD3B 4Z7OF 1FP5A 5BVPL 3Q3GB 5MENE 4NC0B 4Q6IC 1JWSA 3I3BA 5DHYB 1OCWL 5DJ0A 4JY5L 5FB8A 3ZKMD 3NCBB 4BKLB 4OZGA 2X5PA 4WHYH 5T1DH 1ZLVH 2PXYA 1OB1A 4MGXA 3RKPA 3BIAX 1F4WL 4HS3B 1RZJL 4LSVH 2ZUQB 4QXGH 1AKJB 1DEEB 1S9XA 2L7UA 4HFUL 3EFFB 4LCWE 1RAMA 4J1UB 1U3HC 4HKJA 2DTML 2MHAB 1A7NL 4FZ8L 5IUSA 4MXQC 2YKLL 3HMXH 2C26A 4M6AA 5I76B 2AJ3B 1R3KB 2VXTH 3F5WB 3TIEB 2O5XL 4K9EH 4PG9A 2DQHH 5KAQF 3IKCB 1BAFL 3BH9B 3ZE1E 2R0KH 4FXKB 5DFVD 3MRFA 4HXBH 4WI5A 3RDTB 1L7IL 3CFBA 4KFZC 1CDCA 2BC4B 3F6LA 4G80A 1FL6A 4NQCD 4M48L 5EC1B 3P9LB 4QRSA 5KSAA 1C5DB 1CLZL 2XV6B 4U33A 4OD1L 1T03H 2HMIC 3HZVB 2H6PB 1YPZB 2F54D 4NQVB 1AHWA 3WXVL 5BCAA 3GEWB 2IQ9H 1QR4A 1F4WH 1BQHB 4JO4H 1A6AB 4RMVA 5EU6B 2HT2D 4OGXH 1AD0A 3MRNB 4Y5YB 5T3ZE 1YPZE 1EAPA 1OY3B 2QHRH 4OM1L 4I3SH 5MEOA 1IGCL 4GAGL 2UY7A 1GJIA 3GJFH 5DHVA 3W0WE 4Y1AD 4ONOA 2UUDK 3UXFA 5H37G 4DUVA 2DLFH 4Z7NF 3G6DH 5J0BA 5E08H 4P99A 4EDXA 5T3XL 5KS9E 5FECA 1A3LH 1MCKA 3WNKA 4G8FA 1I3RB 5GSVB 2D31A 4TRPH 1WWWX 1X5ZA 4MWFA 3PDGA 3T2PA 1S7VB 2XTLA 4GSDL 4PJDB 5T3ZL 3W0WD 1U8KA 3NCMA 4NHUB 3V95A 4HHAA 5EWIH 2BDNH 5FYKL 1OD7A 3D6GA 1UA6H 5GISH 2JB6B 3OKOB 43CAA 3PWJB 4F9LA 2ZPKL 4HIJB 4NQDA 3VW3L 1JZ8A 4N0CD 1NBYB 3AM8C 5TPWL 2X10A 4NQEB 3RHWF 2OR8A 5LCVH 1DANU 3OR7B 4ISVA 4NP4L 1L0YA 3CFJA 3LCYA 5KVFH 2VLRA 3ARYA 3SDCD 1YDPA 3D2UA 4L4TB 4DW2H 3OF6D 1ITCA 3ARED 1KJ2H 3ULUC 2IBZY 3OR6B 8CGTA 2X4TA 4RGND 4S1SH 5E9DE 3BUYA 3LRSA 3B6SA 5EFIA 5D8JH 3CDGA 3EYOB 3X3FH 1CGSH 2I07A 4KI5C 5FUOH 32C2B 3QG7H 4TVPD 4U3XA 1B3JA 4TNWF 4OZFG 1ACYL 3RJQB 1CXEA 4AY0A 3SDDD 4S2SB 1U9KA 2VDRH 1LE9A 3K8LA 5GSVA 1YEDB 2VOTA 2VDLL 4X83A 1D5XB 1HHJB 3MNZB 3MFFA 4BH8A 4I2XA 1OW0A 1SY6L 4XX1E 5I1GH 4RFOL 1KCVL 4AK1A 5E2WH 2RBLA 4RAUA 2H6PA 4G6KL 4MNHB 4Y4HA 3W2DH 1OLLA 1GVIA 3GIZH 3LQZA 4M7ZC 2CLVA 3W9EA 5L2KE 3E6FB 1UZ6F 4Y5XC 4FFVC 3U0WL 1MJUH 1IC4L 3CVIH 4IOFC 5FO8B 5E6YA 4M62H 1OAUL 2HT3D 2DL2A 4O2CB 4YHMH 4HX1B 4EBQL 2HRPL 2F15A 3GJEB 4LPWA 3IGAA 4XPTL 1I7TB 3UX9B 2W9DH 9CGTA 2AJ3A 1FLRH 2BZDA 2WV3A 5DD3H 1MCPH 4TTGA 4Z7WA 5TE6H 5E00B 4BFIB 1NFDA 4L8CA 2DMCA 2NY4D 4KK6C 3JTSB 5CJQL 3IS0X 5K93A 4GW4B 1DN2A 1NAML 1JWUB 3UO1L 3EFFA 1ZTXH 2VDRL 1RZGB 4PP2B 5DZLA 3CFBB 2Q87A 5JW3L 1RJZB 5HHMB 2MJWA 4LSUH 2IANA 3GHBH 3JWDL 4XC3L 3PWPE 4KI1A 4MS8C 2RIKA 1ORSB 4DQOL 4QRPA 2EO9A 1Q9KB 2PR4H 1IKNC 3WEXB 1U91A 3MV7D 2J12B 3W39B 3O3UN 4JVPA 4J3UA 3TBTB 4X7SL 2DMKA 3DETC 3KPLA 2LABA 1DUYB 4JG1H 3STLA 4AT6A 1B0WA 4NQVA 2MKWA 2X1WL 2VISB 3REWA 4QHNA 1RULH 1XCQA 2YOCA 3G6AA 5K33A 1BFSA 3L6FB 4PJ8B 4EI5A 5ITBH 3HUJE 2PW1A 4P5TC 3KYMB 1FCCA 3V8OA 4MJ2A 4U0RB 2B20A 2JIXB 4O00A 4JREC 4GG6A 2GFBA 3IDUA 4UQ3A 3PGCA 2X7LB 2QADD 2BX5A 1VKXB 4H1LG 4NDMA 1FNGA 2YXFA 1HHGB 5BRZB 4QRUB 4LVNC 4RNRA 1OGAA 2E9JA 2W38A 5CINH 3H7BB 3MMEB 4R4ND 2Y4SA 5F1NA 4TUOA 2V2WB 2A74A 4FFWC 3RNKA 3ZKSD 3MNVA 4K2UL 5DJ2A 3NFPB 2EYSB 1FYTE 1OHQA 2IADB 2BY3A 3O2DH 4HS6B 4PRPA 2VZSA 1A6WL 3BPLB 4P46C 3MCG1 1P1ZA 4PJCB 4OCNC 4L4VB 4YGAB 4A6YH 1LO5B 1YUHB 4FQJH 2E3VA 2EZ0D 1HSBB 2Q1EA 4RGNC 4ZFOB 3HG1D 3KHQA 3MV7A 4DFIA 3RWGA 2HJKB 3K81A 3GJFK 4G6AD 1HI6B 4YNYB 4LKXB 3EJYD 1SBSL 3IYLW 3ETBF 3SEPA 3F7YB 3GSQA 3CVIL 4MAYC 4DKAA 5L6YL 3GK8H 1WISA 4IEFB 3FOMA 4NQDE 5INCA 4RMUA 1A1NA 2R69L 3EO9L 5F96L 5SWQA 5FO7B 3EYVA 2XN9D 1X7QB 2CUIA 3A67L 4LCUA 1JFQH 3MGTB 4F80A 1XR8B 5DK3A 2J2ZA 2R23B 2XPGA 5F8QC 4ETQA 2P5WA 1RJLB 4IOSD 5F7EH 1MFEL 4NYLB 3VI3E 1R3LB 3UAJC 3SE3C 3KPSA 2NLJA 2RCSH 5IHBA 4C4KT 2P5EB 1A7PL 1RQ5A 3OL2A 1J88A 4F2MA 2CLZB 3WIHA 4H25A 2QQLH 4K8RH 1YEFH 1U58A 2E7BA 3FB8A 2I9LB 3ZZ1A 1JHTB 5H94A 5BS0D 3ARUA 1WT5C 2AJZA 2P24A 5E7FA 3F58H 4IDLA 3LKSB 3MRIA 1RK0A 4JM2D 4Z7UA 5IW1B 3QIBB 1T83C 3L3GA 3WD5H 3MBXH 4XTRD 2ADGA 4F9PA 1I7RB 3MLUH 4MVBD 2MCG1 4OFDA 3P0GB 1S9YB 4XPFL 4WI6A 3VXNB 5E2WL 5HYSA 1UACL 2IGFL 3JV4B 5I1IH 4M61B 4RGNE 3RWEB 2VLRE 3K8MA 4LBEA 4ZUSB 4MJIA 5MEPB 4M7LT 5CJXA 3QB7C 3RIAF 2A38A 2I5YH 4OZGF 2X9WA 3KLAB 3SDAD 2VSCA 5F3BB 2ZSWA 3K2UH 4NOFA 4D0DB 1QFWH 4MX7A 3TT1H 4JQXA 3MRBB 4P2CG 4HG4J 1MCOL 3EUUA 5AZ2H 5C0AA 3SE8H 4D0BB 4OCYH 5ICYA 4TOYH 1FVEB 3ZHKA 3DVIA 2ARJQ 2AVGA 2JJSA 5I8KL 1VACA 3CZFB 1K6QL 3RA7L 4I77H 4IRZL 4FG6D 4CMMA 4J12A 5BZDA 3VG0H 1XF2A 4PJFA 3T8XB 2FEEL 2WWMD 3O3AA 1MRFH 2X2YA 1TQCC 2FHBA 2Q8AL 2LU3A 2P8LA 5KSAD 3ISWA 3ALPA 3ZKND 2O93L 2FSEB 1BQUA 2Y06L 3BKMH 2CDEA 4QHMA 3H9HA 3GMRB 3HN3A 4EZMA 5BS0A 4ZS6D 1JNLH 3F5WA 4TQEH 3TIEA 4UU9A 1X6LA 2AXFA 3IJYA 4JM2A 4MSWA 5DK2B 2EO1A 1JMXA 5T3ZD 1M7IA 1BLNB 2WWMC 2YPKA 5GS1A 5DA4A 5IROA 3KLSA 3RU8L 5DJ2B 5CS7A 4MAYB 3D0VA 4LKCB 3PXHA 3OB0K 5C0EA 4UB0L 5FM5O 3DGGA 2G9HB 2R2EB 2FO4A 2GTZA 4ORGB 4YBLB 3M45A 3F7QA 1DFBH 2DS4A 2KZ1B 5TQ2H 3CXHK 3VXRB 4KRLB 5F7EL 5EU7E 1DLHA 2VSDA 3OG4B 1MJ7L 2QBWA 1PVHA 4LPTA 4YHZH 4IOIA 5ILTL 2P5EA 2YBRB 2AXHA 5AZEL 1PKOA 3QFJD 5GPRA 4X5WA 4WUUB 1S5HB 3G6JF 4X7FC 5JOPD 4KRPB 4XCFL 1VEMA 3Q3GA 1T83A 5GGUB 4YO0A 3HE6D 1UKSA 4MDJB 5CHNA 2VH5L 3ILPB 2FATL 4S1DD 5CWSA 4N9OB 3RQ3A 2DQTH 5GZNC 5KBNC 2EDOA 2A83B 1QA9B 3F58L 2ZPKH 5I6XC 3T0EC 1JZ2A 1NUFA 1UB5A 1NC4D 3LEVH 5CZXD 4PJ9C 2GSIB 4LCWB 2BY2A 2C1PB 4CVXA 4D9QD 1P6AB 1VEOA 5IP4A 1U8MA 3FT2B 2VRAA 3OKEB 3RWJB 3QZWB 1ORSA 3LZFH 2LAGB 4MLSA 4PJBE 4HDIA 4QHLB 3VXRA 5AUMA 1JYNA 1HILB 2X1PA 4P2QD 3I6LD 3EDKA 5GGSY 2A6IA 1Z5LA 3HPLB 2LE9A 2FEDD 3QULA 1EPFA