3WBDA

Crystal structure of anti-polysialic acid antibody single chain fv fragment (mab735) complexed with octasialic acid
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
231
Chain Sequence
b'SDVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLYWYLQKPGQSPKPLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCFQGTHVPYTFGGGTRLEGGSQIQLQQSGPELVRPGASVKISCKASGYTFTDYYIHWVKQRPGEGLEWIGWIYPGSGNTKYNEKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYFCARGGKFAMDYWGQGTSVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords single chain Fv fragment of mAb735
publication title Crystal structure of anti-polysialic acid antibody single chain Fv fragment complexed with octasialic acid: insight into the binding preference for polysialic acid.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 57
structure length 231
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wbdA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wbdA01
1FAKT 1J0IA 2CXKA 4DN4H 3B8SA 2OR7A 3RX8A 4M43H 3VWJD 3W39A 3UBXG 3FAWA 4Z95H 1MPAL 5B8CC 6FABH 3NH7H 4FMKA 2LU4A 3ARVA 5FIEA 5MERB 2W91A 3T0EE 1CD0A 2PYFA 3U0TB 4DKDC 4Y7MA 1JGUH 5DMKA 3P3YA 1EERB 4PUBH 2DI7A 3VI3F 2AEQH 3GNMH 1CN4A 1CXFA 4ZAKD 3KLHC 1BBJB 1U6AL 2NLJA 1LD9B 2YK1H 4OD2B 1OT2A 3A67L 4NDMA 3VXRA 3VXSA 4GRWE 4KTYA 4KUZH 4PRIA 1T1YB 4GW5B 2HG5B 4YIQA 4NSKB 4JO2H 2AABH 5FF6B 1YUHA 3P9LB 4GAJL 5DMGC 2F5AH 2IBBA 3BZDA 5ENWA 5I1DB 3BRDA 5FUZH 5L0QC 4S1RL 1NC4B 2OTWB 1DBBL 3H8NA 4FABH 5GJSL 2ZOKB 4RZCA 1LDSA 1WLHA 3LRSA 4JREB 3HPLA 1CZ8L 3SDDD 3NN8A 2KZWA 4JHZA 4MSWB 1IGTB 3SN6N 7FABH 4Y5XB 4LCCC 5I8KL 4OLUL 3IJYB 4D0DB 4EIGB 4NKDB 3RNKB 3UDWC 3RZCA 2PXYA 1KG0A 3S4SG 3OMZA 1J8HB 2R0LL 5IQ7L 3RAJH 3LEVH 4HIEB 2H32B 1NL0L 1FBIL 4QWWC 4K8RC 3QP3A 3OSKA 4NRZB 1QFHA 3MLZL 4RMQA 3T4YA 3GMPA 4OSUH 3RBSA 3BT2L 4GXVL 5E95B 1U8JB 2DBJA 3BWUC 3IF1B 3R8BB 4PRPB 3NACL 3SCMD 5L6YH 1UZ8B 3RTQA 5JUEH 4K7PH 4TUOB 1IGYA 5E24E 5CINH 4Z77A 3MROA 2FL5A 4NQDE 1MRCH 1NAKH 4EDXA 3HC0B 1Q94B 4D0BA 1JZ3A 1LEGB 5JLZA 3IFOB 5J9PB 1FNEA 3PDGA 5D5MB 4WWKA 3TN0B 2QQLL 1CDCA 2GJ6A 1DBJH 4ZUSB 3FMGL 4RX4D 1PYWB 4JN1H 3TFKD 1TVBA 1RUKH 3OAUL 4R4FH 4X5WA 4BUHA 2E6JA 1T5XA 1V05A 4EI5B 4OI7A 3ZE2F 3IXAA 4JKKA 5JDJA 3FRUA 3CNKA 3BP4A 3SE9L 2FBJL 4G7YL 5KVEL 1GGCH 1UFUA 3UROR 2FO4A 4NQTA 3AM8A 3EO9H 1QO3A 2P5EE 3MRPA 4W4OC 4N1EA 4D8PA 1C12A 3RVVC 3JWNC 3TBSB 4HUVB 1RK0A 2HVJA 3VWKB 4RMVA 1CGYA 3PWPA 3QDJA 4M6NH 4WDIA 5KSAB 4G3YH 1AGFA 3L3OB 3T0ED 2YXMA 1TNMA 2AKRA 3HUJE 4H25B 4AT6B 4WENB 3S96A 2WWMC 3ECBA 2WM0A 3HG1D 2ZG3A 3WXVL 5I71B 5D2NB 3E6HA 1N3NB 1XGRB 3WUWB 3W9DB 2IANA 4W6YB 4HS8L 3L5XL 3KPQB 1MCEA 1UM6H 2DBLH 4ODVL 1M7IA 2VZVA 4ZSOE 2NY3B 2XZCH 5I15H 4Y19E 2ZP0T 2P24A 5MEQA 4OF7A 4OCXL 4LBEB 5FOBB 4LRIA 4P3CH 5CILL 5DA4A 2ADFH 4ZOAA 4YWGL 3W2DL 2CD0A 2IQ9L 4BSWA 4MLIA 2ZSVA 5DJCA 5EG6C 3TT3H 1MLBA 1F3JA 2HJLA 1U8LB 5HI5D 4YNYA 3VFVA 4PP2B 3C6LA 3EO1A 2QJDA 3C5ZD 5I30L 3NIDE 3OJDB 2O5YL 5DJAA 1C1EH 4KI5C 1S7TB 5FDWB 5HHOD 1I9IL 3VFRB 5CFHA 1IARB 3ZHLA 5F6IB 1HQ4A 4DQOH 4KKAC 4IRZH 1GZPA 4HUWB 5HHXH 5BMFL 1JBJA 3DURA 1T66C 2DAVA 2R56L 5C0GB 1H3GA 1KCRL 4XGZA 3U83A 1WJ3A 1AO7E 5TDPB 4MVBD 4AY0A 4Y4HD 2R23A 4Q2ZA 1AHWA 2A2QT 3D0VA 5FYJH 2QQQA 4DZ8B 1WWWX 2IGFH 3PG2A 1BFVL 3TO4D 1AFVH 2B4CC 1LO3H 3JWDH 1OAUL 1TJGH 3VGFA 1AJ7L 5LBSL 4FZEL 3CIQA 2DTML 2WMPA 3MBED 1NQBA 1NSNH 3ALWA 3NFNB 2VXTH 3L3JA 3GMNB 4R7DB 3O6FA 1UYWL 2YA1A 1QG3A 3WO4C 1T1WB 2EH8L 4F15C 5GGUA 5E94A 4NFBA 4I8DA 3MODH 3OKNB 3KJ4B 1I3GL 3EO0B 4DFIA 4Z7WF 5GISL 1E27B 4MA7H 1N6QL 3IRZA 2ICWJ 4MD4B 5JQ6H 2R39A 1YNLL 5BXFA 2BSRA 3HMXH 4JPKH 4U3HA 4E42B 3EYVB 4CVWA 1FIGH 5EU7E 3CX5J 1Y0LB 1PFCA 2Z31A 3NZ8A 1QP1A 4LLUA 5E9DB 1W0WA 1CDJA 1RULH 2N7BA 1HSAB 4PJ7A 4PGZA 3ZO0A 1KJMA 1NCAH 3C5SB 2VWEE 3CFJB 1R3IL 2FZ3B 4DOHB 1E28A 5EORH 4UIKH 4HWBH 3UDWA 4BQ9A 4KC3B 1T1ZB 2P5ED 2P7TA 1EHXA 2UY7A 3VG0H 1EDQA 3FQRA 3LS5H 2VRAA 3KYNA 1M6OB 2DKMA 1U3JA 2ITCA 5GS2D 1MVFA 2BMKA 3QQ9C 4Z7VF 5ID0B 4KMQA 3RBGA 1E6JL 5D1ZC 5F70A 1YQVH 1MF2L 3GSWA 1Q9LB 3RJDA 2FD6H 2Y7QA 4GKZA 1FNAA 4AMKH 3VXQA 1I8KB 3ZKXB 3EOTH 2F58H 1ACZA 1C5CH 3SJVD 32C2A 1KTDA 3WFBL 2A0LC 4LCUA 3FB7B 3VXOA 2G75B 3LD8B 4I13B 4Y19D 2X4PA 1CFQA 4HBCL 5JPNA 5CKGA 2V5RA 3PQYE 5LKNA 1A47A 1JPTH 5B39B 5EUOF 4WO4D 5I1HH 4ZAKC 3GMMA 4Q9QL 4AZ8A 3I2CH 2J12B 4NP4L 1OWWA 1IM9B 2XNAA 4FQIH 1FAIL 1ZWIB 1T1XA 2OI9C 4S1DD 2I24N 2DOCA 1B6UA 3OKKB 4JM2B 1JN6B 4R7NA 4J4PC 1HH9B 3C60C 4FQHA 4DGIH 3U36B 2AERT 4ZG1A 3S37H 5I0DA 3HS0B 3OKEA 5DI8B 5FEBA 1HSBB 3G5VB 5ERWB 3QDHA 2CLZA 3PL6B 4W4OA 5FYLL 1AO7D 1KB5A 3BSZL 4KGJA 3TVMB 3WNMA 3QUYA 1GPOH 2EO1A 1FNFA 3VFTB 4PJIB 5AG8A 1ZSDA 5T1DL 3RVTC 1DBML 4XWOD 4C57C 5KVDH 1QSZA 4GMTH 1BF2A 4OQTH 2R8SH 4FFVD 4ZFZA 3U0PB 4AENA 3HA0A 4XVJH 4OM0H 4G43B 4MXVE 3ARFD 5DUPL 2OR9H 4TNVF 2HFFB 3QIBD 4L3EA 1KJ2L 3HZKB 1D6EA 5I75B 5EU6D 2GCYB 3B9KC 3U7YL 1T0NB 4IIQB 3T2NH 5DWUH 1P6FA 2GAZA 4ODXB 3RUGA 4YHLL 4ODBD 4JY4A 5GZNC 2VLRB 2AI0H 3QEUB 1MY7A 5DUMH 3CMGA 15C8H 5GPRA 3PUCA 5CD5C 5DHYA 3OR7A 1BPVA 1RI8A 1T6VN 3ULVH 4CUCA 4LKXB 3MRCB 2X42A 3O0RH 4OI9A 1EAPA 3HZYA 1FPTL 4PJ9D 3ARYA 4R2GB 2OTPA 3OB8A 2BNRD 4YDKH 3MRBB 4LKCA 4YE4L 2B8OT 1GHFL 1E6OL 5D7IE 3IU4H 3LDBB 4HLZH 1X5XA 4RMUA 4OD3L 3BJ91 3PP4L 5H94A 2DQUH 4N0CD 2JIXD 4IS6A 4JRXE 4F8QA 2KDGA 1CG9A 5DEGB 4KWUA 4CMMB 5CSZB 1I7RA 4OGZA 1WK0A 1J11A 1ULVA 2FJHA 2UWEE 3GBLA 3REWB 5E00B 4HJGB 2O5XH 35C8H 2F53E 5EO9B 2VR5A 1R3JB 1VEOA 2QQKL 1SEQL 3U0WH 2GFBB 3B6SB 3GHEL 2AXGB 1MHCB 4QRRE 5JO5A 1YA5A 3RWDB 1R24B 4ZTOH 3DUUA 5T3ZL 4V1DA 4R4NC 4UQ3B 3TH3T 2NY1B 3B5GA 1CGWA 2AGJL 4PRAB 3AXLB 2WIIB 2DWEB 2Y23A 4NO5B 1NANI 2AJXL 4DK6A 3KS0J 1FVCB 2JJUA 3MRDB 1VADB 1B3JA 4XC3L 3PQYD 4PJBE 4CAGA 5D2LB 5IROC 1BQHB 3C8DA 4J3OC 2CK0H 4S11A 3ARTA 5JHLL 3ULVD 1NBVL 1UJ3B 2EDHA 2HVKA 2HJFB 3DVGA 3ARXA 2NY7H 3VU2A 1WFUA 3BN9D 4HXAH 3FOLB 4OIAA 3G5YA 1ACYL 4P9MH 1BGXH 4JREC 1BJ1J 4TNWK 3X3FL 3WV0A 1ZT1B 2Q6WB 2M1KA 4G9FA 3RWHB 2LAGB 4HWEH 1XF4B 3B9VA 5EO1A 5ISZB 3C5ZC 4Y5XC 4JFFA 2Y06L 4ODUA 1VACA 1GJIA 3HC4L 3H9HB 4KQ3L 2PETA 4JAMB 1G6RA 1MH5B 4NIKB 4OZFA 5HY9A 4CADA 2C1OA 4GKSB 1C5BL 2D0GA 3A6CL 3VFUA 1N2RB 2FNBA 5D1ZA 2DJ4A 1WC7A 4MNGE 3WHXB 2R1WA 1LEKA 2Q3ZA 1A3QA 4UDTA 4TUKH 4JDVA 5IUSA 4P5MB 1BZ9B 1A1NB 2FEDD 5IFJB 2PW1B 1MRDL 3GZKA 2VITA 2PR4L 3MNZA 4GAYB 4JQIH 3T8XA 1Q72H 1CXIA 4YJZL 3U2SB 5HVGB 4RAVA 4YPGA 4ZS6D 1G7IB 1YYML 1YEDB 3VFOB 1T7XA 3OV6A 1J05B 2JCCF 43CAB 2F5BL 3SDCB 2UY6A 4F7TB 3WCYA 2IAMA 2G5BB 3O3BA 4POUB 3IAQA 4BFEA 1X5FA 3MBEC 4X6CA 4OZGE 3BQUD 1CFTA 2VDPL 1NAMB 5IBLC 5JR1H 1IC4L 3D85A 2E7MA 2M8XA 4B0MM 1RAMA 4AK1A 2DI8A 1NGPH 2P1YA 2ATPB 3FQNB 1SYSA 4J4PA 4CU8A 3C60A 1BZQK 4TSAL 5F89B 3QHFH 3DV6A 4I3RL 4YDVB 4EI5C 2BVQA 3MOQA 5CBAB 3C6SB 3UTTA 3MLWL 3L5HA 3PWNB 4NQSB 3D25A 4NC0B 4RWYL 1TPXB 4JRXD 2ZCLL 5HBBA 3RY5A 2AK4E 2HFEB 1RJZB 2JJTC 1X5YA 1OAXL 1EHLL 1MCHA 2F53D 4WIQA 2BVOB 1UB5B 4YH6A 2C3XA 3BD5A 3TIDA 1JWSA 4ENED 3D9AL 4QRRD 4EXKA 4NT6B 4NQEB 2H6PB 3GSOB 1PBYA 4XNMB 4LRNL 1RK1A 3IDGB 3WL9B 3JVGC 4K07A 3FO9A 5KJRH 1G9NH 5I71C 4IRJD 5D2NC 3BGMA 5EBWA 1CGSL 5EZLB 1K8DA 3ZE1E 4I0PB 4OKVA 2B2XH 3N0PB 4JHBA 4OKDA 2VXUL 2VDLL 3BZFB 5B4MD 5JHDA 5DYOA 4P4RB 1JHKL 3B9KA 3JWOH 4I77H 4LSPL 3TBWB 4AG4L 1IZKA 3BD4A 3JWDC 2F8VA 3QQ3A 5CP7B 5K93A 4K94H 1DBAH 1K5NB 4TULH 3DX7B 2OQJA 4YHKL 1NAMH 3ARPA 5BO1L 1YEJH 4PYGA 4PP1D 3Q5OA 5DFTA 1KENL 1QKZL 5I66A 1AGDA 4NQCB 1CICC 2UYLB 3CUPB 3QG6A 4PBWD 3A0OA 4U2YA 5DQ9A 3EFDL 3RWCB 1U8KB 4RGNE 5CIPB 1OP5K 4HHAB 5CEYA 4ODSH 1LP9F 1RZJH 3HI6L 1NANH 4CU7A 1IT9H 4M02A 3IAPA 3MCKA 3PABB 5JOEA 4D9RE 2VDKL 4WFFE 4HF5H 3MA7B 2R2BB 2WANA 4ZPVA 5F6IC 4L9LA 2CJUL 3V6ZB 4WW2A 2Y07H 1R0AH 3X13B 3X14A 2HMID 4AIZA 1XH3A 4ZS7H 3DV4B 5IB1A 4QTIL 5KAQF 1VEPA 4YZFF 4G80B 4ZFGL 4EN3D 4PB0H 3QJFB 1MFBL 5DJYB 2E27H 3GRWH 1CE6B 3U0TA 5CJ8A 4HUXB 3HE6D 4KUCF 1RZKH 4HWZB 3R06B 3B9AA 3TA3D 4YEEA 1K6QH 1WBZB 4QXGL 1KJ3H 1W72B 2H2SD 4C4KT 4GRMB 4Z7UB 1LD9A 2MHAB 2ITDB 4OD2A 4FFVC 5FHBL 5C7XH 3ARGB 1T1YA 3CZJA 1NEUA 2YA2A 3HI5H 2A9MH 2HG5A 4GW5A 1E4WH 4NSKA 1X5LA 4HKXB 3P9LA 3QIBC 3ESVF 4FQCL 5CIPH 3SBWA 4PJXF 3KJ4C 4POZD 5ITBL 4OUUB 1B0GB 2HKFL 5I1DA 2EDQA 2OTWA 1NLDH 2UV3A 2VLME 5HHQB 1EBPA 1S7QB 2ZCHH 4WHDA 3UXFA 4OFIA 1YNTB 4MQXD 3W9EA 3BIBX 4MSWA 4PJ9C 5GXBB 1IGTA 3MLUL 3PWVB 4R8WL 3IJYA 5I1GL 3ARSA 4D0DA 2AK4D 4NKDA 1EEZB 3RNKA 1JK8B 3B8YA 3WFHB 3LN4B 5GSRB 5DA0B 2VXVL 5E8DH 1J8HA 4K7PY 2QADB 4N0CC 1OAQL 2OBGA 4HIEA 2H32A 3KPLB 3L5WB 4IDLA 5CJOH 1N64L 4PRDB 4NKOA 1MAJA 2X70B 3E0GA 3MRHB 5A40E 1E4KC 3O2VH 1IKNC 5KN5B 4GG8B 4NRZA 1W72H 3Q48A 3IU3B 2PYEE 3QDGE 3DRQA 3UO1H 2FWOA 4WY7H 3QWOB 1DLFH 1X44A 3ZKXC 5FHAH 1U8JA 3VFNB 2D4DA 1F4XH 1L7IL 1FQ9C 2DWDB 4C56D 2BVEA 2HT4C 3MR9B 4PV9B 5IP4A 2DLTA 3IF1A 3QHTC 5GGTH 1T20A 1I9EA 4TUOA 4WI7A 3LD8C 2EXWC 5FUCE 4KROD 1PG7X 5GJTL 3V8OA 3H3PH 5I73C 3HC0A 1NBYB 1Q94A 4FQJH 4JJHA 1LEGA 3GI9H 1IKFL 3VI3E 5J9PA 4RAHA 4P46B 1RIUL 4M1CD 5D5MA 3V4PH 5K9QG 3TN0A 2EXYD 3BDBA 4ONOA 5F72S 5T1LB 2DRUA 1F3DH 1JPGB 4F58H 4CGTA 2Y4SA 3QO0B 4KKLC 1PYWA 3NVQA 1NFDA 5T1MB 5IVZA 3UTSB 3ULVC 1YECL 4D9RD 3V2AR 4EI5A 3S37X 1J1PL 5F8QC 5F6HJ 5ADOH 1F6AB 3BN9C 4HG4J 3FKUS 4UNTA 2Q8BH 4HH9B 2YMXH 1DBKH 2JJTA 3PL6C 4O02H 5MEND 4HQQH 4ZOCA 1DQJB 3TBSA 4YHOL 3TVMC 5T5FH 4LVEA 3VWKA 1Z3GH 4X83A 3BE1L 4ZUUB 5KSAA 1D6VL 3L3OA 1VKXA 4HXBL 1NCCL 3BKCH 4CKVX 4X7EC 1MREH 4UNVA 1MELA 1N3NA 1XGRA 2VB5A 3WUWA 3W9DA 1X4YA 1VGEL 2GSGB 3KPQA 5L2KE 1A14H 3P11H 1V8HA 2HFGH 3DWTA 4N1CA 4IIQC 2ZUUA 4LPWA 1FNGA 2I60H 2J8UA 3VD3A 3RWGB 3O2DH 4LBEA 5FOBA 1A6VH 2W0PA 3QUMH 1BVKB 5FYKH 3EOBB 3P40A 4EDWH 2YPLE 1YEGH 4HAGA 2WUBL 3EYSH 2GQHA 1U8LA 4LVOB 1P53A 2W9DL 3QDMB 4PP2A 4HMEA 4PLJD 4R6UA 2VLMD 4YDIH 5HHME 2WLYA 3OJDA 4PRHB 2VAAB 3DRTA 5IVOA 1YEHH 3MJ9A 3BQUC 4XCCL 1S7TA 4ELME 5FDWA 4LMQI 3LDBC 3FT2B 1CL7I 3ROLB 4QXUL 1UCBL 5AAWA 4TSCL 43C9B 2J5LC 1XCQB 4HUWA 3TIEB 1RUPL 4HFWB 4X6FB 2VR9A 3QI9B 2MSPA 3AREB 3B9DA 4JZJC 5TDPA 3D3VD 1MRFH 1FC1A 1FNSL 1KPRB 2X2YA 1F90L 1YZZA 3ZE2E 2V6HA 3GSQB 1L9NA 1S78D 1DQDH 4AQ1B 1EO8L 4DZ8A 1FFOB 1FL6A 5CUSL 1MI5B 3QDGD 3TO2A 4HD9A 4NUJB 5JOPE 2PKDA 4J6RL 3V6FA 4L4TB 3SE4C 5J1AB 4P23B 1FV1A 2Q20A 3DLQR 3MRFB 1OW0A 1MCPH 4TVSa 4QY8B 3HCVB 2NY1C 1KEGL 4RFNB 2ESVB 5L2JB 5MEOB 4UT9H 1ZV5A 3NFNA 4JVUA 5C09D 1FZKB 3RRQA 1EA9C 1OP5H 3ZKND 2NMSA 4LEXH 1OTTD 4IRJC 1T1WA 2W0KA 4M5ZH 3KPSD 3B43A 5B4MC 5CZXC 4DVBB 3OKNA 4BK5A 3MLVL 1E27A 2AVGA 4QYOB 1X4XA 4MD4A 1SYVB 1PVHA 5EZJA 5IF0B 2NY6B 5F7WC 3KNBB 4UV4L 4WFEE 4E42A 3EYVA 4PP1C 1I9JL 1KCUH 4KV5F 1Y0LA 4E41B 5E9DA 3C08L 3O8XD 2KH2B 5GS0L 5HYSG 4H20L 3C5SA 4P2RB 3FN0H 4YFLI 4MNQB 3O81A 2I26N 2FZ3A 4MJ6B 3OF6D 4JE4B 3ZE0E 3IDJB 3MXVL 3NIFF 2ORBL 3HC3L 1T1ZA 4GAFB 4PJEE 2X1QA 2EDBA 1YEEH 4NBYB 4FRWA 1M6OA 3G6AA 2EC8A 2MKWA 1ZLSL 4G6MH 5BQ7A 3IRPX 4D94A 5ID0A 4L4VB 5DVKA 3DX8B 2CSPA 4NZTH 2NY4D 3H7BB 5DD3H 1Q9LA 5CLTA 1F58H 5EU5B 2PUQT 5DK0B 5EBMB 2FLBT 1I8KA 3NPSB 4EN3C 5DTFB 3STZB 1KYOK 2J88H 4F7EB 2MQCA 1IGFL 5L2KD 4FQXD 2A9NL 4ZUTB 3PF2A 2NNAB 3QT2A 2J4WH 3FB7A 5GHWH 2W9EH 2ADGB 3CXDH 2EE6A 5FUOL 1C16B 1MWAH 4X6DE 1JF5A 3FN9A 3C9NB 1G9NC 4PLOB 3SDCC 4Q9RH 1KF9B 3BWAB 1WWAX 2JJVA 1MFAL 5HGBB 1UCTA 3DO3A 2YPLD 3JWOC 3ILPB 4LIQL 4LSVH 1IM9A 4K94C 1BX2B 2A6IB 1ZWIA 1M1SA 1PEZA 1P7QB 1IEBB 3UPRB 5HHMD 3CMOH 4NM4H 5GGVL 3OKKA 3K81A 4H0HB 1JN6A 4JM2A 2BSED 1RIHH 4RDQG 4XP1H 1HH9A 1VCAA 4POZC 1I4FB 2CO6B 2IH1B 3TPUB 3CDFA 3U36A 4Z7WE 2GK0A 5I18L 3QHZH 5DRXB 2GKIA 2NY2B 3HS0A 5DI8A 3G5VA 5ERWA 2BSTB 4KJPC 4LOUD 1SMOA 1CS6A 1RZJC 1JPSL 2P49B 4XCNB 4BM7A 1SBSH 2YXFA 3PL6A 5JQHC 4GXUN 4U7KA 2IFFL 4BH8B 1Z9OA 2JKXA 1I3RA 4ZNEE 3T0XA 3TYGH 4PJIA 4AM0A 5B3JE 2DQIL 3E1F1 3OX8A 1JFQH 3BKYH 4HT1L 2DLEA 3AY4A 4OI8A 1GAFL 3TWCH 4PLNC 4PJGB 3U0PA 1CL7H 3V5DB 3MUGB 4G43A 4BZYA 3QISA 3KPOB 2HWZH 3SKUD 3L7FB 2HFFA 4I0PC 5BW7C 1HZHH 1NMBH 4PJCF 3HZKA 1RZKC 2GCYA 3TV3L 1T0NA 4IIQA 5DGRA 5KS9B 4ODXA 1IEAB 5JW4M 2YWZA 2YRZA 1TDQA 2VLRA 3QEUA 4J23A 1LQSR 4DZBB 3T0EB 4MB5A 3ET9F 3QXUA 4LKXA 5AWNL 4KROC 5EWIL 4WFED 4OBRA 1MUJB 4MXWL 2GSIB 5IMMB 2A6KB 3UJTH 3MRBA 4ORGB 1IAOB 1F8TL 1A5FL 1WIOA 4M1CC 4PRNB 1LHZA 2N7AA 1EX0A 4HWUA 1N7MH 2X6MA 1QYGH 3V4UH 3T0AA 5LWYH 5DEGA 2VXSH 1PJ9A 1J1OH 5CSZA 3RVWD 5E00A 5AEAA 4FFYL 4HJGA 4YO0B 1H8OA 2FSEA 2VE6B 5EO9A 2DDQL 1R3JA 1RZFH 2FEEL 3LKPB 1R3HA 1JZ7A 3B6SA 4RGOL 1T03L 1CLYL 1MHCA 4U3CA 1Q9KB 1IBGL 1OPGL 2CR3A 1YJDL 3RWDA 1U3HB 2BFVL 2FX7L 4CJ0A 2V9TA 2XOTA 3MGOB 1CBVL 3DBXA 1KGCE 3AXLA 2WIIA 2DWEA 4F3FB 3QUXD 4OTXH 1MCQA 1FVCA 3MRDA 3LZFH 1CK0L 3TZVD 2BOCB 5D2LA 1ZT7B 4DVRH 1BQHA 4WUKL 2E8YA 1KBGH 2O5ZH 3DROB 3TO4B 1PDKA 1UJ3A 4OB5H 4WEBL 1KLFA 2HJFA 1RUAL 3FCTA 3VXUE 1OARH 4JPVL 3NCJH 1M05B 2IALB 5GRJH 1UH3A 3FOLA 4LQFH 2DLFH 1A6WL 1IAIH 2JLLA 4M93B 3LQMA 2ZUQB 2CXGA 4NQDB 2Q6WA 4LFHG 3RWHA 2P8MB 1EXUB 1XF4A 3VXMD 3BMWA 3GJFB 5ISZA 4EQ3A 1PZ5B 4HCRH 1GC1L 1S3KH 2FECI 4NKMB 1BMGA 5C0EB 4JAMA 1MH5A 1NUDA 1BAFH 2VDOL 3MRJA 1A1OB 2QADC 1HINH 3LAFA 4NO0D 1N0XL 1N2RA 2AEPH 3RU8L 2LE9A 3WHXA 1FLRH 1A7RH 5DT1L 1MFDL 4K3EL 5K9QI 4P5MA 3CU1A 1A7PL 1BZ9A 4NNXB 4QXWA 4G6KL 1A1NA 5FGBA 5T3XL 4M1GL 5IFJA 2PW1A 5F7NC 3FFCE 4GAYA 5DO2D 3VH8G 4J3SA 3O9WB 4XAKE 5GRUL 1S78C 5I1AB 4XNYH 3L3IB 3U2SA 4S1QH 1V7ML 3WLWD 3QSKB 1YEDA 5CBEB 3VFOA 1NGWB 43CAA 2AJYH 4TSBL 2FB4L 5FGRA 3ZDZF 4F7TA 1ZTXH 2G5BA 3Q1SL 2GITB 3HMWH 2X1WL 4EI6B 3TBVB 4Y4FB 2P4AB 3ZKNC 4HPOL 4P46C 1QFWI 3GSXB 1I1RA 1OTTC 2YOCA 4XVSL 5SWQB 2YN5A 1BM3H 2A1WH 2DD8H 3LPWA 3CD4A 1NGQL 5IG7B 4UTBH 5F9WB 3L3KB 5CBAA 3C6SA 4N9OB 3IDXL 3VDAA 3MLTB 2OS7A 1X5ZA 1P84J 3MRKB 4QOKB 4GH7B 3MA9L 4KDVA 3FHAA 4P59H 2DMKA 2HFEA 1RJZA 4FS0A 4HK3J 4XMLH 4MJID 5EC1B 1DQTA 3MOBH 4XRCA 3QFJE 2BVOA 1UB5A 4I4WA 1WAAA 5E8PB 4TTDC 5TE4L 3GHBH 1TJIL 1XIWB 3WJJC 4JFQB 4YBLB 1UWGH 4NT6A 4O58H 4NQEA 1JI1A 1YPZB 4U1IB 1HXMA 3QAZC 2V17H 2AQ1A 3IDGA 4N0UE 3WL9A 1CF8H 3VFGL 1MNUH 3GRWA 3O3DB 4QRPE 5C0ND 4JZNB 5EZLA 4I0PA 3JTTB 4RFEB 5ILTL 1BD2B 3BZFA 2DKSA 4P4RA 4PJHB 1QRNE 3TBWA 5CP7A 5J57B 1K5NA 2AS5M 1KB9J 4PGCB 5KANG 1SM3L 3SDXB 4FQXC 4NQCA 3EGSB 2Q86B 4FQ2H 1RU9H 5JXEC 1PX3A 2UYLA 1OP9A 4U2ZA 4LPTA 1U8KA 3D39B 4YHMH 3ARFB 5CIPA 3DUSA 5IGXL 5C0CA 4ETYA 5F1KC 4RBPK 4BFGA 3SEPA 1KELL 5FM5O 3PABA 1QSFE 2V2WB 3B3IB 3MA7A 2R2BA 2CRYA 3UZEA 1P5VA 2N4IA 4N0YL 2WP3T 5T33H 3X13A 4HV8B 3MV9B 2BK8A 4WUUD 2CKBB 3DV4A 1HEZB 1JE6A 2EYRB 2ZUTA 5I1CH 1UEMA 4NKQB 4R26H 2I25N 1P9MC 4G80A 1AXSB 1OGAE 4K9EL 3QJFA 5DJYA 1IGIH 1CE6A 1KXQE 2ARJB 5IBTH 4XBEL 3GB7B 3L3GB 3G6DL 3QCVH 5IVXE 4HUXA 3DXAD 4PY8I 1B88A 4HWZA 3BESR 3R06A 4D3CH 3L1OH 4ETQB 5HVFB 4K8RL 4XAKD 3IKKA 4OCSL 3KYOB 1WBZA 1W72A 1Q0XH 1UA6H 1YMME 4GRMA 4Z7UA 5J12B 2MHAA 4G8FA 2ITDA 4WU7B 4Z0BL 1HIMH 3ZT6A 5IFAH 2AEWA 3WUZA 3ARGA 3DYMA 2LU7A 4L8CB 5GGTA 1FL3B 1UM4L 1EFXD 5A16B 3MLXH 1DUZB 1P4BL 2JJWA 4KRNA 1CU4H 2EKJA 2NY6C 5IWLC 3GEWB 3EYOB 5HHQA 3H3KA 3VMOA 4NBXB 1S7QA 1D9KB 2PTUA 4MQTB 1PG7W 2CKBH 3CPLB 2BJMH 4LVNC 1X5GA 3N1QC 5C0JB 5A1AA 4JKLA 1RJLB 3PWVA 5EB9A 1G7LB 2C26A 3NZHL 3H2WA 3CVHB 5E1HB 4XPGL 1EEZA 1NUFA 2FRGP 1QBLH 1JK8A 3CX2A 3ALPA 3WFHA 3LN4A 5GSRA 2XN9E 2YKLL 5CZVL 4TOYH 1QSEB 4X6EB 5I9QC 3L5WA 5T3ZE 5DURD 4PRDA 3WMSA 1OSPL 3SDAD 2NY0B 3UTZB 5KN5A 4GG8A 2W92A 1H8SA 3RVWC 3B2VH 3IU3A 2HAZA 3RKPA 5HSFA 4QRPD 5I8OH 3QWOA 4ZOEA 1VFBB 2OP4L 4YZFE 4LCWE 5HI3D 5EDXA 4HC1L 1U92A 2DWDA 4L29B 3MR9A 4PV9A 4KK5C 3S35H 3RL2B 1LDPL 5AG9A 1A9EB 3MSPA 4XB8A 3FJTA 3I9GH 4N1HB 1S9XA 4L1DA 4ISVB 2XG5A 1NBYA 1KNOB 5HXMA 1WFNA 1I1AD 2XA8L 4LASL 5T1LA 3O2DA 4QHMB 5DRZB 2XA3A 2GJZB 2E7BA 3QO0A 3A6BL 2HKHH 1ZMYA 1UT9A 5T1MA 4LSRL 4GS7B 4TPRH 3WNLA 1RFDL 3UTSA 3ULUH 5C08B 2XRAL 5EFIB 1QSFD 1N4XH 2MPAL 3LS4H 4PJXE 3GI8L 3NCCB 3E8UL 5D1XB 3FB8B 4O00A 2YD6A 7CGTA 2NY2C 1G7PB 1CWVA 4HH9A 5FKPA 4YXHH 1X6LA 1HHIB 3HZVB 3QDAA 5HYSB 4M7LL 3LQAL 1DQJA 2JELL 3S36H 3EAKA 1OSZB 4ERSL 5JW4Q 5DMIL 2HH0H 2R0ZH 5D7IB 2X9WA 4LVHB 2R15A 3WJJA 1YQ2A 5BS0E 3GGWB 3LKNB 1T0PB 3B5HA 5FB8B 4XVTH 1QHOA 5H2BA 2B4CL 2GSGA 3BDYL 2DQFB 5ICXB 1A7NH 1HKLH 1TQBC 3ZKSD 1S7RB 4G9DB 3RWGA 1I8MB 5DO2C 3R1GL 1D5IH 4IM8A 4PJ7F 5D72H 5F96H 3EOBA 2WBJD 5JXEA 3HE7B 3WLWC 3O4LE 5DFVD 2NXYD 4X8XA 3H7LA 5F7YC 4KY1L 2W9LA 1RURH 3QDMA 1F97A 4WCYH 1TTGA 4XNZB 1MIEH 4PRHA 1BREA 2VXQL 3M45A 2LV4A 3G6JB 3FT2A 3SKMB 4PJBB 4TRPL 4G8GA 1WSST 4QTHB 5JZ7D 5HYJA 3QPQD 43C9A 2NX5D 4HFWA 3QI9A 4KVNL 3AREA 5E6ID 1JGEB 5I74B 5FM5M 1P9MA 3QCTH 2DQGH 2OZ4A 4Y5YA 4EBQL 5T3ZD 1KPRA 2KQMA 2ZJSL 1FRGH 3GSQA 4QF1A 3C2SA 4TUJB 4C54A 4ELKB 1FFOA 3BKMH 3V6OC 5E2TL 3KPRB 1CFBA 4NUJA 1LVEA 4L4TA 5J1AA 1WT5C 4P23A 1U3HC 3MRFA 1G84A 4LCWD 5JIHA 4P2QA 4QRUB 2JF1A 2XICA 5LCVL 3HCVA 5SWSE 5L2JA 5MEOA 3K8MA 4QNPF 2X4OA 4OCRH 2DJUA 5CJBA 3T04D 1URLA 2DQCL 3MV01 1FZKA 2P8PB 4KUCD 4MA3B 3VMPA 3T0WA 1U9KA 2EIZB 4RBPH 4MNGB 5LJYH 4DKEH 1U58B 3JV6B 4DVBA 3QNZA 4OZHF 3HE6B 1MCWW 2YPVH 4QYOA 1SYVA 5IF0A 5DUBB 3KNBA 1FYTD 4HIIB 4LSQL 3WKMH 2MCPH 3H9SB 4UBDD 5FYJU 4E41A 3KWWB 2H1PL 5D1QB 4M93C 1CE1L 3MFGB 5ANME 5HVHC 2IPTL 4P2RA 5C8JB 4MNQA 4RGMC 4MJ6A 1MJ7L 5KSUA 1ONQB 4BUGA 4NZUH 2JJSA 1Z2KA 4ODWB 4XPTH 3MRMB 4L8BA 1QFWM 2BY2A 1ADQL 3LKQB 3MBXL 5KW9H 1JNLH 3RWFB 1L7TL 1U8MB 3QIWB 1C5DA 3DX8A 4UB0L 3RUGF 1V7NL 1R5IB 3F7PC 3SDDA 1LO4H 5EZOH 5EU5A 5DK0A 5EBMA 2VAJA 2OK0L 5IW6A 1CGVA 5DTFA 3STZA 3BKJH 4F7EA 4XH2B 4QXTB 4ZUTA 4PJ5E 4JO4L 1F4WH 4LSTH 2ADGA 3LV3B 5IKCA 2D03L 1C16A 4FXKB 5EA0H 3UYPA 2DQTL 3IDYB 4LARH 3C9NA 1GVIA 3ARDD 5C9KA 1OGTB 3BWAA 2ZUYA 4Y0GA 4XPHH 3H0TB 3O4LD 2IWGA 3ILPA 4W4NA 3ZYJA 4OV5B 2A6IA 4Y4FC 4N68A 2AEQL 1EIBA 4UT7H 1P7QA 4P49A 3BRFA 5BVJB 1IEBA 3UPRA 4NPYA 1T7ZA 3EFFB 4KTEH 3SCMA 3MOAH 2IH1A 2X1OA 3TPUA 2BVUA 5A2KH 2QQNL 1FH5L 5C0AE 5DRXA 4JO1H 4I2XE 1QLEL 2BSTA 1JMXA 4MJ5B 2B1HL 5D8JL 2V2XB 3E3QE 4XCNA 4A6YB 5F1OB 3GO1L 4BH8A 4HIXH 3BP6B 2WK2A 4IRSB 3AUVA 3DX9B 4RGNB 3RDTD 1OD9A 1Y18B 1EUTA 4K2UL 5DEFB 3MRGB 4GQ9L 3CH1B 1XIWC 3U1SL 4PJGA 4JFDE 5I16A 3O6LL 3TT1H 3MUGA 4F9LC 2Q3AA 4ZYKB 4OUOA 5DS8B 3DVIA 3L7FA 1Y6MR 3INUL 4NJAL 2VDNH 1UACL 1NBZA 5DLMH 1IEAA 3VH8B 4X5LA 5MI0B 2N56A 4OLWH 3KG5A 2X4NB 4DZBA 3EHBD 3JV4B 4OFYA 3T0EA 2R69H 1OVZA 2DQDL 4EOWH 5CCKH 3W0WE 2OL3B 1GOGA 1J1XL 1QLRB 4FTVE 1MUJA 1NCNA 2GSIA 5IMMA 2A6KA 4PJAB 4ORGA 1IAOA 1MRCL 1B90A 1ED3A 1JGDB 3V7AE 1KCSH 4PRNA 1JUFB 1W8OA 5TFSH 3LEYL 3IFLH 4OT1H 1JYVA 3KPMA 3QNYB 1BBDL 1NJ9B 2WQ8A 3QUZD 4JFZL 5E2VL 3OPZH 1MCOH 4CN4A 3PJSB 3O41B 3MGTB 1M7XA 3A6OA 3CFIC 2VISB 2VE6A 4HCRA 4Z78B 3LKPA 4O4YH 3V6OA 2IBZY 5F7EL 1RUQL 4G7VL 1Q9KA 1HCVA 3WXWL 1U3HA 4CVZB 3EO9L 4X6CF 1CDHA 4WV1C 6CGTA 1T7VA 4U6VL 3MGOA 5DHXB 3TPKA 2DS4A 4PJ5D 3EZJB 5GGQL 4F3FA 1IGMH 2XQBL 2Z4QB 3P0YH 4P5TC 5J12C 1DVFD 4Y4HA 2I27N 3BPOB 1T89C 2CR6A 3MZGB 3E2HB 1X7QB 1XGYH 1AKJD 4P9HL 3DNKA 4NN6B 1MCWM 4P2OB 2ILLA 3DROA 4N5ED 1YC8A 3TO4A 3PE9A 2PYEB 2NY5C 2CGRH 1B4RA 2R0WH 3JV0A 4PJCE 2DBLL 3UTPE 1K8IB 2QR0B 1M05A 2IALA 5FO7B 4Z9KB 5ALCH 4XX1E 5AYUL 2R2HB 5DFVC 1D9KC 2H45A 2NXYC 4O51B 2CK2A 3WS3B 1U8NB 2FDBP 5J13B 5C0AD 4NQDA 2EE3A 1GCFA 1T2QL 2P8MA 1GGBL 1EXUA 3GJFA 4Z8FH 1LO0L 1I1FA 1PZ5A 2R0KL 2DQJH 3ULUC 5IMLB 5C0EA 5KSBE 1FO0H 3O6MH 4FQQB 1C1EL 3QPQC 2EDJA 3N9GL 2H3NB 5C6TL 3ARBD 2Y1VA 4KDTA 5L7XL 4URTB 4UNUA 2PO6D 4JO3H 2YC1A 2FX8H 4H88H 3PP3K 4XMPH 2VN7A 2AJSL 4IRZL 4NNXA 3QG7L 4O9HH 5HDBE 2EDKA 5E8OA 1A7OL 1KEMH 4HKJB 3O9WA 1UXSA 3L3IA 3GBMH 3MJ6A 3DVNB 4K71B 5CBEA 3SO5A 3VGAB 4H8WL 5FYJL 1NGWA 3BVNB 2E6PA 3W11C 1AP2B 3JWDL 4KVCH 5CHNA 1N5YH 3HUJA 4HGMA 2GITA 2GYSA 4U1MB 3TBVA 1NCWH 4Y4FA 1OWRM 4XXDB 1OAKL 3W0WD 3GSXA 2J8OA 3PDOB 1UKQA 5SWQA 5C6PB 5HPOA 1T5WB 1NSNL 2VXTL 4CVUA 3SHSA 1TENA 2IMNA 5IG7A 4GS7C 2DM2A 3T65B 3W81A 1DZBA 5DDHB 4KRMB 4YEFA 4Y2DD 3NA9H 3L3KA 4ZSOA 4P4KD 4Y19A 1HXYB 1MOEA 5IHUH 2VUOA 3SGEI 1EFQA 1I85C 1Q1JL 2GW5A 2X4TA 5CEXB 4UBDC 2P5WB 3G5XB 3HMXL 4JPKL 4ZD3H 4ODTL 5L9DH 1YY9D 4LDOB 5EOCH 3DETD 5D93B 4JGMA 2C4XA 3O3UN 4LVHC 4ELMB 4JFQA 1NCAL 5ID1B 1YPZA 4LAQL 4U1IA 4XAWL 1VGKB 1ODAA 4HWBL 5KBNC 4Q0XH 5TE7H 2OMNA 3O3DA 4JZNA 1NCDH 3F62A 3JTTA 4BH7B 2DM4A 4RFEA 1BD2A 1CGXA 1MHPL 3T2PA 4OZIB 4PJHA 2BNQE 5BRZB 2QSCL 1K4CB 4R97B 5DHVA 4U1JA 1B0RB 3N1MC 4PGCA 1GXEA 4S2SA 3I50L 3TGXA 4FXGB 4NUGL 1KYOJ 3EGSA 4IBLT 1DSFL 2Q86A 1CLZH 3GUTA 4XP4H 4XHQA 3WFDL 3HE7C 3MLYH 3SKOB 3DMMB 1IFHL 4LHUD 3UTPD 4H26A 1V3LA 1JPFB 3ARFA 3SGDI 4YFDB 2GEEA 4XNZC 1PG7L 4S1SH 3DUHA 2V2WA 3B3IA 1JYNA 1DL7H 1KN2L 3VRJB 1PKQE 3CLFL 4NO3B 5EU4B 3MXWL 2Y36L 4HV8A 3MV9A 2JB5L 2CKBA 4QKXB 5JMOC 4LU5H 1RVFH 1RIVL 3SDYH 2EYRA 3U48A 5CGYC 1H0DB 1AXSA 1JNNL 2BSSB 1U95B 3MNVB 4LLYB 5C0FB 2ARJA 3GB7A 3L3GA 2AP2A 5HGAA 2VZ3A 2EDNA 3TESA 5D7LE 2PYFB 3BAEH 5HGHA 3UZVB 3KYOA 5D5MF 3GM0A 4PJEB 3UZQA 3S3JA 4PS4L 1FGVL 5E5UB 5C9JA 2UZXB 1GOFA 3SO3B 4KRPD 1WITA 4PREB 3EOAB 4XPBH 3V0WH 4PRIE 1T89A 5KVDL 4GMTL 1B0WA 1MVUA 4PTTB 4OQTL 2R8SL 4L8CA 2I5YH 4NDMB 4XVJL 4IEFB 4OM0L 1FL3A 5A16A 1DUZA 4X7TB 2ARJQ 4X7SH 4YIQB 3S9DB 4NZRL 2FHFA 5IR1B 3MLRH 4X6DB 3CPLA 3MZTA 2IBGA 15C8L 1R3LA 5C0JA 3PQYA 3ULVL 1RJLA 4JCLA 2E7LC 1G7LA 2VDQH 3NN8B 3Q5TA 3CVHA 2P48B 2A38A 2E6QA 1ZVHA 3O0RL 1A3LL 2R9HC 1HHHB 3CSYA 1SJHB 2V5MA 3ORJA 1QSEA 4X6EA 2HTKC 4BZ2H 1ZHKB 1KG0B 1QA9B 5ACZB 5DXWA 1MPAH 4KZEH 5BVPL 4TYUA 4AIXA 4ESKA 1OCWL 2BY0A 5IJKC 4KK8D 1VESA 2HRPH 3H9ZA 4XPFL 1U2CA 5C0BD 1A9BB 2VSCA 3M07A 3VXTB 4L29A 4ZODA 4DAGL 2BNQD 1Q9OB 3NCYS 2O5XL 3CK0H 3RL2A 9CGTA 4TVPH 4KJYA 1NKRA 4IDJL 1U6AH 3U0WL 4MLSA 4K3DL 2XZQL 3A67H 3IDYC 3KR3H 1XZ0B 4ISVA 1JF1A 1NC2D 1KNOA 1KCKA 1IGYB 4KKCD 4Z77B 2A77L 4GAJH 2FL5B 5E56A 3LN5B 3UMTA 3ILQD 3HN3A 2R1YA 2CRIA 2YSSA 4QHMA 5DRZA 2GJZA 5JLZB 4S1RH 1Z9MA 1DE4B 4JRYE 1DBBH 4LHJB 2ZCKL 1OLZA 4BQ8A 4WWKB 1AY1L 4N5EC 5C08A 1QNZL 5EFIA 5J7CC 1IMHC 2CK0L 1KOAA 1BQSA 1CZ8H 3PP3H 4ZFOL 5D1XA 3FB8A 1I85A 4OGAD 3I6KB 1G7PA 3LCYA 2YPKA 5I8KH 5H37G 4G6AC 3I3DA 1HHIA 5HYSA 2Z92B 3EJZD 1OSZA 4IRSC 2R0LH 3QDJE 1D5BB 3SKNB 5T3XE 5IQ7H 5D7IA 3SGDH 5IB5A 1NL0H 1O5DT 4D8PB 1C12B 3GGWA 4HWEL 3LKNA 2Y5TB 2ATKB 4L4JA 5FB8A 3MLZH 1P6AB 4CL7A 2ENSA 1H3XA 3S96B 2DQFA 3BT2H 5KTEH 4GXVH 5ICXA 2CKNA 3VXRD 3ZYIA 3VXSD 2PTVA 5L8KB 5EIVA 3LHPL 4PRID 4JHAL 1S7RA 4G9DA 4JKPL 4TUKL 2P47B 3HNSL 1M7IB 3ARRA 1Q0YL 3DIFB 2NW3B 4PD4K 5MI0C 2XTJB 1JZ4A 4Y8DC 3MV8B 4ZFFB 4QRRA 3HE7A 4LF3B 1Q72L 5TQ0H 3BZEB 3MJ8A 1YNKH 4X5XA 1I1YB 2QQLH 3RFZC 2XV6B 4Y4KB 4DGYL 3FMGH 1MLBB 4ZUWB 1JJUA 3WHE1 1H3TA 3OAUH 3G6JA 3WYRA 3SKMA 1JRHL 2HTLD 3EO1B 4PJBA 4QTHA 3HLAB 1HHGB 5DJAB 3SQBA 2EEDA 3RZCD 3RVUD 3RY6A 5JR1L 2PXYD 3SE9H 1NGPL 2FBJH 5KVEH 2HLFD 1D5MB 3VXUB 1HQ4B 1JGEA 4P4KC 1UQSB 4M7ZC 1TJHH 4OAWA 5C0IB 2P45B 4JN2B 1FSKC 5C3LD 4EJ1C 4PBXA 4ELKA 1YEKL 5CS7A 5FYKU 2NXZB 1FL5B 5GGSB 3EUUA 3RKDD 3KPRA 2R23B 5I6XC 3FZUD 4NNPL 5IFHL 5DD1L 1BF8A 4ZXBB 4QRUA 3U30B 4WFGE 4XI5D 4PJFE 3MJ7B 4P3DA 3RTQD 2D4FA 4MDIB 3T4AA 5MP6L 4HS8H 1FP5A 3CFCL 2EDFA 4ODVH 3P30L 3MJGX 3NFPA 1BEYL 3WJLC 2Q7YB 4JM2F 5DVNA 2EIZA 4ZNCD 1KC5L 3BPOC 4MNGA 3ZKMC 1J18A 1R5WB 3E2HC 1U58A 3JV6A 4OCXH 2RFXB 4NN6C 5BZDA 5CILH 3HE6A 4M00A 4DKFL 5CD3A 1GSMA 2GJ6D 4YWGH 3W2DH 4OZ4A 2IQ9H 2B2XL 3SY0B 5L88L 3FFCB 1DCLA 5DUBA 3BUTA 4G6FB 3JWOL 4JRYD 3RPIB 1MHHB 4RA0C 4HIIA 4XVUD 5EBGA 1DBAL 4CW1B 2WZPD 1U42A 1NAML 2JK5A 5I30H 5D1QA 2FBOJ 1E0OB 2O5YH 4PJIF 3OGOE 3QXTA 3B9EA 2DYPD 4MAUL 5FM8A 4MZ2A 5C8JA 3LKSB 1WUNT 1I9IH 3NZ8B 1KN4L 1PEWA 1KJMB 4ODWA 5BMFH 4BZ1H 2R56H 4MNHB 4Y88A 3SPVA 5E08L 4ODSL 5CWSB 3QDJD 3PWPD 1KCRH 1RZJL 3LKQA 2P7TB 1BOYA 1U8MA 3QIWA 3RWFA 2EDXA 4Z7OF 5HPMB 1XGPA 4WTWA 1R5IA 4BFBD 5IJKA 1BFVH 2SEBA 2IAND 2DKUA 5KZCD 4J3WA 4XH2A 3D6GA 2C9AA 3GSWB 2CH8A 4QXTA 2AK4A 4GKZB 1AJ7H 4FZEH 1ES0B 5BV7H 3LV3A 5FKAB 4FXKA 1HILB 4HFUL 3V0VB 3F58L 5J6HB 3VGAC 3QFJB 1ERNA 1TETL 5C92A 1RZKL 2ZUXA 1UYWH 5SV4A 3H0TA 2EH8H 4LDEB 5TQ2H 4NHUB 25C8H 3H3BC 1JCKA 4PJ8B 4OV5A 3RA7L 4IOFC 4QNPE 1I3GH 2F54E 5GISH 3C6LD 1KJ3L 5BVJA 4Q6IC 3K1DA 2AJ3B 1HYSC 1YNLH 5C7XL 1T83C 2AJUL 1QRNB 3EFFA 2ADJB 3T08A 2OCFD 5HYEA 3RIFK 3ARQA 2G60L 4X4MA 4OZHE 3IETB 5J8OA 4R7NB 1QBML 4MJ5A 1R3IH 1J7VR 4XBGA 5CSBA 1MAMH 4KKNA 4XX1G 5F1IB 4A6YA 2H26B 2QBWA 1KT2B 3RVXD 3P4MA 5TPWL 2GT9B 3BP6A 2KL6A 3DX9A 2CLZB 5D93C 1F02I 4GXUM 1AXIB 1Y18A 5DEFA 2P8LB 4MCZB 4OFDA 2UZYB 4JJ5B 3C8KB 1MQKL 3CH1A 5D2LF 4P2YA 1E6JH 4ZYKA 2NZIA 4ZDHB 4CVXA 1IRAY 4WFGD 5DS8A 1XR9A 4LP5A 4ZFZB 4AENB 1EMTL 1K3IA 1TITA 4P2CG 3O6FD 3HAEG 1OGAB 4R97C 5FFLA 3VH8A 1PAMA 1QPPA 5DMGD 4HBCH 2X4NA 4JG0L 4X9BA 5IVXB 3UJJL 4Y5VB 4H1LB 1KJ2B 1DLFL 4JY4B 4Q9QH 1FC2D 4NP4H 3DMMC 2OL3A 3G04B 1FAIH 2RGSA 3PWLB 1DFBL 3L7EB 3OKMA 2Z31D 4PJAA 5C0DB 1YMMB 4KI5E 4NBZB 2FATL 1OAYL 1JGDA 5DK3A 3S5LG 3MYJA 5SWZE 1CXEA 1JUFA 4FQJL 4XT1C 3QNYA 2ADIB 1NJ9A 4JANB 1H8NA 5ITFB 1KB5H 1FLTX 3O41A 1IGCH 3WBDA 4IS6B 3MGTA 5KOVC 5FYLH 3BSZH 2VISA 3DO7B 3ME0A 2ZUWA 3WDIA 1FYHB 1ZA6B 2UVEA 1AR2A 5T1DH 1DBMH 3EJZC 4BKLB 3DYPA 2EEAA 4CVZA 1F5WA 3F7RA 3FO1B 4ZO6A 3RI5K 3HRZB 2XN9B 2EIEA 3SO3C 1KJ2H 3MLSL 2WUCL 4RSVA 4NRXB 3U7YH 1OP3K 3V79C 1FORL 3BKCL 4LL9A 4FFWC 4YHLH 1X7QA 3H42H 4KFZC 4P2OA 3AB0C 2PYEA 2V5YA 2F54D 1TIUA 1F2XK 1N26A 1U0QA 5L8LB 4JY6A 1WVZA 3FTGA 4PGJA 1K8IA 4OD1L 1U91B 5FO7A 1FPTH 1U8OB 1ZGLP 1OB1A 4E9LA 4YE4H 1GHFH 1E6OH 4O51A 3K2UH 3DOSA 3QUML 5HI4D 1WAAF 4OD3H 1ZE3C 4UV7L 3PP4H 2R1XB 3G5YB 3TCLB 1YEGL 4JFFE 2AXHA 2IG2H 5IMLA 3RVVD 4G9FB 4FA8A 2APWA 2Z93B 3QUYD 4GMSL 4FQQA 4J2XA 5ELIA 2H3NA 3TH4T 1KSRA 3RVUC 2WWMD 5HY9B 3G9VA 2QQKH 2C1OB 3ZHDA 3O8XA 1J5OL 1HK6A 3GHEH 5I76B 5I1KL 4HKJA 3OF6A 4L3ED 4HJJL 4GSDH 4JGJA 5JDSB 5E4IA 2AGJH 1UWXK 4YC2B 3DVNA 5IHZB 1FFNA 2AJXH 2HJKB 4G8EB 3BVNA 1GYAA 2VKXA 1H3PL 4XC3H 2AXFB 3QUKB 4RMRA 3E6FB 5BS0B 4U1MA 5E1AA 1ZAGA 4GRLB 2EZ0C 1NUNB 1A1MA 4XXDA 5JHLH 3LQZB 1NBVH 3O3BB 3PDOA 1T5WA 2HT3C 5L2KA 2FX9L 12E8L 1DEDA 1CFNB 3HHRB 4BQBA 3WS6A 3D85B 3T65A 4WWKC 1AE6L 5BZWB 4M5ZL 1ACYH 1EVTC 1HXYA 3X3FH 4KKAD 5CP3A 1XF5B 4TN9A 1T66D 4XVUC 5CEXA 4Z6AT 2P5WA 2R2EB 3DV6B 3BN3B 2YPLA 2VZUA 3G5XA 2Y06H 2EYSB 5K9OB 2I9TA 3HC4H 3D25B 4QRTA 4KQ3H 2D3VA 4M6ML 3PGFL 5FECB 3U7WL 1RD6A 3OZ9L 5D7JB 2X4RB 4Z7UF 1C5BH 3EYUH 3A6CH 5J6GB 2O93L 3AM8C 4ELMA 4H0IA 4JHWL 5EOTA 4YQXL 4UILL 5ID1A 1FNLA 4V1DD 1VGKA 5F7FA 1S5IH 2QTEA 2LTQB 2OTUA 4BH7A 2PR4H 4G8IA 4KHXL 3D18B 4OZIA 5LXGH 4TNWF 2CDEB 1NGXB 4G6ML 1K4CA 4UIMA 1B0RA 1DQML 1YYMH 4NZTL 5ECJE 1O7SA 5DYOB 2K3TA 4FXGA 2AK1L 1F58L 4KPHH 3O6KL 3QQ3B 1BP3B 2XTJC 2C1PB 2ICES 3GFUA 4XP5H 4NRYB 3UC0L 4U31A 3SKOA 3DMMA 4B5EA 2ID5A 2B7DT 1AGDB 4LRIC 2VDPH 3NGBB 1JPFA 5SWSB 1MWAL 3PXJA 3QULB 1S7VB 4Y4KC 1EZVY 4WRLA 4CDGC 4LHQB 4R3SB 3P0GB 3AGVA 4Q9RL 4Z7NF 3C6LC 4I3RH 4JFFD 4NO3A 5EU4A 3MLWH 4YDJB 4RWYH 5DRNA 5I1JL 2ZCLH 3N06B 2VLJE 1TZGL 4NM4L 1H9VA 4WW2B 4F37K 1H0DA 5ICZB 5D1ZD 3X11B 1OAXH 1XH3B 3MNVA 2BSSA 1I7UB 5IB1B 5C2BL 1ZHBB 1NEZG 3RVXC 2NXZC 3D9AH 1P7HL 3HPJB 1INEL 5F1SA 1AHWC 5IT2L 1SBSL 1JWMB 4LRNH 1EK3A 2A0LD 4ZXBC 1VSCA 4J3VA 3U30C 3IDUA 1BQUA 4PJEA 5HJ3B 1CGSH 3HG1E 2VXUH 2VDLH 4PREA 4F33B 1JFQL 1C08B 3EOAA 4LSPH 4AG4H 4YX2L 1ORQB 4NKIL 2IAMD 1OTSC 4C4KO 4LGRB 3OKOB 4PTTA 4YHKH 1T2XA 3HNTL 1NH6A 5F7MC 5BO1H 3HI1B 2DQHH 1QKZH 2YUVA 4X7TA 5BV7C 3O6FC 5K59E 2J6EL 4CN1A 1WEJL 4J4PD 3C60D 5IR1A 4BA8A 3EFDH 4BK4A 4GW4B 1INDH 4X6DA 2VUYA 1F6FB 3FT3A 3STLB 2PNDA 3UTTD 3VG9B 3HI6H 3LPFA 4J3XA 3RQ3A 2VABA 2VDKH 3TP4A 1A4KB 2Z31C 3PXHA 3WO3B 1OT1A 1JZ6A 2CJUH 2W60B 5H37H 3W9EB 4NHCL 4X4ZA 5HHOE 5E8EA 5E6YA 1HHHA 1J8HE 3N1FC 1SJHA 4QTIH 3RVTD 2DM7A 5I8CB 4ZFGH 5F7KC 1ZHKA 1QA9A 5ACZA 1MFBH 1MAKA 1OP3H 1CT8A 1X5HA 4RISL 4NZDA 5AZ2L 4DFHA 3NAAL 1QYGL 5F44A 3C87A 4NKOB 4AEIL 5BOZG 4I2XB 1YC7A 1A9BA 5JHDD 4GOSA 5J11C 3VXTA 3B9KD 1Q9OA 4PRPE 1ZHNB 4HPYH 3DRQB 4M9PA 2FWOB 4QXGH 5GZND 5F21B 1L4IA 4ZNEA 5FHBH 2W59A 5CD5D 1WFOA 1XZ0A 4XP9L 1FGNL 1T20B 2PO6B 3ZZ1A 3CXHJ 1O7VA 4JFDB 1T4KB 3T09A 3LN5A 3MC0A 4FQCH 4WTXA 4AJ0A 4PJ8C 3OKDB 5ITBH 1PSKL 2EIDA 2HKFH 4U1GB 1KCVL 1DE4A 4JFYB 3S97C 4KKBC 3RGVB 1RJYB 1A6AB 4JLRB 4MAYB 2RQ8A 1NFDB 3BPLC 5IVZB 3MYZA 3WDHA 3I6KA 3MLUH 2VLJD 4UAOB 4R8WH 1HE7A 2W38A 5I1GH 3ZTNH 3NCJL 2Z92A 1HCFX 3NMEA 5HI4C 2H32H 4FTVB 1IAIL 2VXVH 4GUPA 1UWXH 1DEEB 1D5BA 3SKNA 4K55A 1N64H 2Y5TA 2XKUA 4R4ND 3QUYC 2FJGB 2ATKA 5D2NE 1N5AB 3FQWB 1D5XB 5FYJE 1VKXB 2CDFB 1N6VA 2DQEL 3FFDB 4UINL 1FFRA 3KGRA 4DTGL 4LEOB 3VI4F 3IKCB 1L7IH 3QEGL 2AEPL 2R29L 3MLPA 4W68A 3SJVE 3DI3B 2J3SA 1T04A 2E9JA 5HHVL 3DIFA 2CUMA 4GJTB 5DJZB 2NW3A 5GJTH 2IQAB 1FDLH 3MV8A 4ZFFA 2X89A 1FNGB 2J8UB 1JGLL 1NC4D 4LF3A 1IKFH 1U8HA 4QCIB 4XNYL 3BZEA 2IADA 1RIUH 1IJ9A 4Z76B 3ZDXF 1I1YA 1NGYB 4Y4KA 4KK9C 4ZMAT 4JQXA 4N8CL 4ZUWA 4OIIH 5AYQA 2K7PA 5TH2B 5DZOA 4OF3A 4LK4A 4KTDH 1YECH 1KTKE 3HLAA 1ZS8B 3DRTB 1HHGA 4IOSD 4Y89A 3OKLB 1VFMA 3NA4A 1J1PH 2ICCA 1J8HD 1D5MA 3HFML 3VXUA 5IEKB 4HKBB 4DWHA 1UQSA 2QHRL 4YHIB 4UTBL 3GMQB 5KVGL 5C0IA 4YHOH 4WTZG 4JN2A 4LSSL 2COQA 2GI7A 3BE1H 3MX0A 1D6VH 1FL5A 1ZLUK 5EOQL 1Z9SA 5GGSA 5E99L 4HXBH 1NCCH 3NIGF 1WCBB 1A4JB 1WV7T 4HUUB 3IGAB 4P59L 4U1SB 5HHPB 1LK3L 1FL6B 3MREA 4ZXBA 4XMLL 4ACPA 4PRPD 3TCXA 3TO2B 3MJ7A 5KSBB 1VGEH 2DF3A 1RZ8B 4MDIA 3V6FB 5HYQB 1FV1B 1JMZA 1REIA 2BDNL 5JA8B 5D6DC 3WSQH 1KIRB 2Q7YA 3BIAX 2CRZA 5HD8D 3TNNB 1UWGL 2OLDA 4NJ9H 1A3RL 2V17L 1R5WA 4H5SB 3L3HB 5EU6E 2RFXA 5IBLD 5LQBH 4ONHB 3TN0D 3HAEB 2AJVL 3SY0A 2XPGB 4WWID 5GGSY 3FFCA 2WUBH 1E4JA 3W82A 3RPIA 1MHHA 4K7FB 2CMRL 3LH2L 2W9DH 4Y16B 3MJ9H 5C07B 3SQOH 4CW1A 3F8UB 5E9DE 3T3PF 4Q97A 4EI5D 5EZJB 3THML 5TDOB 1A02N 3S6CA 2VZOA 3ROOB 2BNRE 4DOHE 3LKSA 5ETUA 4QXUH 4PJGF 4TSCH 4Z0XA 3S5LB 4K23L 4OM1L 1TFHA 3AAZB 4E5XB 4I3SL 1KXTB 4ONFH 4MNHA 1KACB 3VWKD 4M5YL 5CWSA 1MIMH 5KSAD 1IGJB 5I19L 1RUML 2YD7A 1FNSH 1F90H 5HPMA 3SE3C 3QEHB 5KS9F 3GDBA 3G6AB 4YFLF 1EO8H 1I8LC 3OAYK 1QFPA 3TJEL 1MJ8L 5CUSH 5BQ7B 5FYJD 2VDRL 3CFDB 4YUEL 1UENA 4XNUH 4U6YB 1ES0A 1MFCL 2NY3D 5FKAA 1CVRA 3HAEH 1HILA 3TBYB 3V0VA 3HZMB 1P4LA 2APXA 3QFJA 5J6HA 3QCVL 1FCCA 1CICD 3MRNB 3NFSH 4C83B 4OLVH 3L1OL 2WBWB 2AEIT 4O2EB 3SDAA 4NHUA 4GRLC 4N0UA 4PJ8A 2MCG1 4PV8B 3MLVH 1BFTA 1Q0XL 2IAMC 2E3VA 1PZUB 2AJ3A 4QRSA 1BZ7B 4JM4L 3ULVE 4UV4H 1QRNA 4OLZL 2FEEI 2ADJA 4LLAA 1I9JH 4OIBA 2APFA 1XGQB 1NUGA 3L95B 3WIIL 1TNNA 3J8F7 5E2UL 4UTAL 3IETA 4LDLB 1F00I 5GS0H 1JNJA 4H20H 3P0VL 4AL8H 4UOW1 3VW3H 3V7MA 4I18B 3T0VA 2QSQA 5F1IA 2GK0B 2H26A 3MXVH 3I6LE 2ORBH 4PR5B 1KT2A 3T3MF 2GT9A 5FA3B 4RNRB 5D7JC 4YGVB 2P8LA 1ZLSH 4MCZA 4GAGL 4JJ5A 3C8KA 1I3RB 4AM0B 5FCUL 3OX8B 3PHSA 3BI9X 4ZDHA 4YK4C 5DD0L 2LTQC 3L6FA 1IGFH 4MS8C 2A9NH 3UJIL 1H3VA 2DB8A 4U1LB 1OGAA 5HDQL 2VLRE 1S7UB 5FUOH 2V2TB 1IC5H 4H0GA 4F7MA 5GRWA 3C2AL 1JWUB 3ZT7A 3N1GC 2C4FT 4OLYL 5K33A 4L8DB 5IVXA 2C5DC 3GMLB 4H1LA 4Y5VA 1KJ2A 4L3CB 3P4OB 5D7LB 4LIQH 4NGHL 3WFCL 3TF7C 3G04A 2C3VA 1X9QA 3PWLA 3L7EA 1KIPB 5D71L 1IZJA 3NGBC 2NY5L 5E9DD 3VCLA 5C0DA 1YMMA 3S3SA 4JFHE 3KLSA 4OCWL 1S7WA 2X4UB 1DANU 4RAUA 3U4AA 4ODHL 1OAZH 2YWYA 5GSVB 1KFAL 3GKWL 4LP4A 4J7RA 2ADIA 5C70A 5I18H 4JANA 5ITFA 3QXDB 3QNXB 1TTUA 4NQXB 4TPRL 4R4BA 4NN5B 3V52L 2VZ1A 4L9LC 2ICWI 2IFFH 4OCYL 4OFVA 4WW2C 3DO7A 3ES6B 1ZA6A 4KJQC 5HGGS 3NCMA 4YXLL 1GAFH 2FSEB 4BKLA 2CO7B 3HNVH 4I1NB 1R3HB 4PG2A 2HT4D 3FO1A 4FQ1L 3HRZA 2XN9A 2EXWD 5IV2B 5D6DA 5E6IA 2R0ZL 3WFEL 2R4SH 4NRXA 5D2LE 3DBXB 3TV3H 3TC9A 1Z0MA 1PD6A 2CLRB 5IQ9B 1IM9D 5K9JH 1HNGA 5JA9A 3TNMB 4KKLD 1DQLH 2VH5H 4RWHA 1I7TB 2BOBA 5INCB 5AWNH 4JM2D 5EIQA 1U91A 5EWIH 3SBWC 1ND0B 2DMBA 4HIJA 1U8OA 2OXHA 3FCTB 4HK3N 4MXWH 2QKIA 2DTSA 2D7TL 3NIDF 3VG9C 1F8TH 5D72L 1A5FH 5DD6A 5CKAA 1CLOL 1ZLUH 2R1XA 5ISZE 3TCLA 5ESQB 1YPZF 3PL6D 3I6LD 4EIZC 2OXGA 3TVMD 2Z93A 2VKWA 5KG9B 2VR4A 1MIEL 3HB3D 2YS4A 3KHOA 3Q6GL 1T80A 4PJHF 4FFYH 1CFSB 5EO0A 3SE3A 3MRJB 2DDQH 1I8LA 3SDXF 4RGOH 1T03H 1R6VA 1GGIL 2ZWLT 3BXNB 5I76A 1OPGH 1P1ZB 4CJ1A 1YJDH 3FONB 4F80A 1YEFL 2BFVH 2FX7H 5D9SB 3BP5B 1NEZB 5JDSA 5KVFL 4U6HB 3G5ZB 3OGCB 5IHZA 1KJVB 2VLRD 2FGZA 5J3HC 4JR9L 2HJKA 4G8EA 3IFPB 3QRGL 4K7PX 2AXFA 3VFPB 3QUKA 3E6FA 4UT6H 5BS0A 4WUKH 3D2UB 4GRLA 4WFHE 3LQZA 1H5BA 1CXLA 4R2GD 2ICWB 1RPQA 4YDLB 4HKZB 5HD8C 4WEBH 5FO8A 2X09A 3I02A 4JFHD 3VGDA 4QGTA 4JPVH 1CFNA 2E7CA 4WI4A 3S98A 5BZWA 3TN0C 2LQRA 5CJQL 4M3JA 1A6WH 5J0BA 3R4DA 4MAYC 3RWEB 3DHJA 3ARDA 4S10A 5DJ0B 3PHQB 2Q8AH 4OGYH 1XF5A 3OAYH 4LAJH 3LIZL 5D6CB 2R2EA 3HKFA 3O4LA 5JOFB 5LGJB 4UAOC 1GC1H 2EYSA 5K9OA 5FECA 2A6JA 2VDOH 4NFDA 1VB9A 5IB3B 2HN7A 5D7JA 1W8NA 2X4RA 5LAXB 1MCFA 2YD9A 4UDUA 5J6GA 1AGEB 1CTNA 5F9DC 1N0XH 4QLRA 4NQEE 3QIUB 3RU8H 4KAQL 2P42B 4XRCB 1VPOL 5KOMC 3VWKC 5DT1H 1MFDH 3HRPA 2NY1D 4I4WB 4K3EH 5KSAC 1A7PH 5D4QA 4G6KH 4M1GH 5I1LB 1EHAA 1HXMB 5IM7B 3D18A 5GRUH 1W0YT 2CDEA 1NGXA 2IC2A 1JNLL 3QWQB 5B8CB 1V7MH 3UYRL 1WWCA 1DTUA 2AQ2A 5CZXD 2OR8A 4NNYB 4C56E 4TSBH 2FB4H 5EZOL 4NQCE 4ORZC 4GKNB 2C1PA 5EN2A 5BOPA 4LPYA 3Q1SH 4NRYA 2NY3C 3ULUF 4XCEB 2ARWA 3ZLQC 3EJYC 2ERJB 4HPOH 4HH8A 5SWSA 5I1EL 4PJFB 4XVSH 5GRVK 2H2PC 3QULA 1S7VA 3RL1B 4HS3B 4R3SA 1RMFH 3WD5L 1VHPA 1I9RL 1NGQH 3KVQA 1MCSA 4NM8H 1MCCA 2OSLA 3DUSB 5C0CB 5ISZD 3T1FB 3T2QA 3IDXH 4N90D 4YDJA 5T1KB 1J12A 4UT7L 5K9KB 3K8LA 3MA9H 2ED8A 2BY1A 4U0QB 1G7JB 5ICZA 1UZ6F 3X11A 1N8ZA 3MOAL 2APTA 1I7UA 4JFEB 1QD0A 4F57L 1ZHBA 4U1HB 5AD0B 5MENE 3BJLA 5E8NB 1JP5A 1TJIH 3HPJA 4MXQD 1JWMA 4Q74A 3IDIB 3VFGH 3QUZA 2VLKB 5HJ3A 3V4VL 4Z7UE 4KQ4L 4F33A 5ILTH 4YBHA 3SDCD 3QPXH 1C08A 1UC6A 3VFSA 1OW0C 3V6BR 1ORQA 3MCLH 3OKOA 5DEZA 2ZOLB 4G8FB 1I8IB 1SM3H 4RIRB 4HBQA 3Q0HA 4WFHD 1GGYA 3HI1A 2KKQA 4DN3L 3K4DA 3KXFB 1SEBB 4GBXB 1XT5A 1KTLA 1LE9B 1MY5A 3GSNL 4O2CA 3SOBL 4GW4A 5IGXH 4G5ZL 3RHWK 3PWUB 4APQB 4M8VA 3MQIA 3STLA 5D7IF 2R69L 1KELH 3GMOA 1DVFA 2VSDA 4KJPD 4EOWL 1A4KA 4N0YH 1UEYA 2W60A 3P4NB 1JV5B 5DF0A 1A2YB 3IS1X 4G42B 4AEHL 2RBLA 4CRPA 5GS0C 1CTOA 4Z7NE 5I8CA 5C1MB 2FGWH 4K9EH 4M61A 5TFSL 4NQED 1GIGL 3S3PA 5DJ6B 1S9YB 3D3VE 1DANT 1VERA 3G6DH 5C0AA 3BGAA 4I2XA 1MCOL 3U4BH 4I0PD 3NTCL 4F7PB 4GG6E 1XGUB 4LLWA 5IK3B 1ZHNA 4J12A 4OCSH 1VDGA 2MWCA 1LE5B 4N8VG 4Z0BH 1U92B 2IJ0C 4NQCD 3OG4B 3G6JF 2PO6A 4PJBF 2XZZA 4FG6D 2B20A 5C09E 1ORSB 4JFDA 1T4KA 3CVIL 3ABZA 1S9XB 2EC9U 3OKDA 4RDQF 1MSPA 1P4BH 3KPSE 4JFYA 5FYKE 5JW4N 3RGVA 4AYFA 3BYTA 1RJYA 2GUOB 1A6AA 3CGTA 1I7ZB 4NWTL 4JLRA 4MAYA 3QXWA 5A2IH 1XGTA 4WI8A 3B2UD 4JM2C 2CGRL 2VQ1B 3NZHH 4I18C 1HHKB 4XPGH 1UWEH 4FTVA 5ALCL 4QGYA 1DEEA 5FKPB 4IJ3B 2YKLH 5CZVH 2B0SL 1F42A 4HS6B 5SWZB 1IL1B 1KXVC 1TZHA 1JNHA 2FJGA 2XXCB 3HB3C 1SJVA 2VQUA 3QR2A 1N5AA 3GSRA 3FQWA 1D5XA 1FN4B 3AY4C 5DJ8B 2CDFA 3D5OF 3FFDA 3X12A 1GOHA 2NW2B 5DD5L 1FO0L 4NFCA 4PTUB 3O6ML 2OP4H 4LEOA 3IKCA 2G5RA 4V2CB 3ARGD 5IW3A 5H2BB 2FX8L 1LDPH 3WEXB 3QCUH 2YD8A 4WJ5A 5DJZA 3QQ4B 2IQAA 5I75C 1DR9A 3BP7B 4JFPB 4PJDB 4XB7A 1BJ1H 2XA8H 1SJEB 4QCIA 2CLVB 3F6IA 4N0RA 4Z76A 4Y8AA 4LASH 1NGYA 3A6BH 2R4RL 4FQLL 4LSRH 2MNUA 4FP8L 3W5NA 3PGDB 5TH2A 4ONGL 1RFDH 3S34L 4R2GC 4TQEL 2AJZB 2XRAH 2MPAH 1ZS8A 2WIMA 3GI8H 3OKLA 3E8UH 4JDTL 2ZKHL 1T3FB 4G8GB 5BCAA 2QADD 5AZEL 5HYJB 3VD9A 5IEKA 4HKBA 1ITBB 4HG4K 4YHIA 4M7LH 4NN5C 3LQAH 3LMJL 3GMQA 2JELH 4ERSH 3NA9L 5DMIH 2L7JA 4KHTH 1RZ7L 1MI5E 4Y5YB 5BJTA 4HGWB 1WCBA 4HUUA 1A4JA 5A43C 4L4TE 4QF1B 3IGAA 1AGBB 1QFUL 1ZK9A 3I3EA 4U1SA 5CEZH 5HHPA 4M9OA 4JPWH 1UB6B 2ESVE 3ULSB 3K8KA 1CIUA 5JW4R 4B7IA 5KSBA 1RZ8A 2B4CH 3D69A 5HYQA 2NZ9C 4P2QB 4YXKL 1G7HB 1JHLH 1KIRA 1YJDC 3TNNA 4X6BB 3FRPG 1B2WL 5EBLB 2X4OB 2IFGA 1LWRA 4H5SA 4YLQT 3L3HA 4QRQB 3QEQE 1KLGB 3IDNB 4P46D 3VWJB 5F7HA 1DQQB 4ONHA 1ZLWK 3HAEA 5T1LD 3KYMA 1X5AA 1FG2A 2XPGA 4MD0B 5FYKD 4K7FA 3UTSD 2HLAB 3QNZB 4Y16A 5C07A 4E41E 3KLAB 1UJ3C 2H41A 5TDOA 2VXQH 3ROOA 1H15A 3I3BA 4ZAKB 4TRPH 2PF6A 4XP4L 1XEDA 2X1PA 3MLYL 1AGCB 2J2ZA 3S5LA 1MCIA 2OI9B 2E8ZA 3AAZA 4E5XA 3D1MC 1S7XA 2OZ4H 1CFVL 5M94B 3O11A 2AV1B 3AS2A 5KSUB 4KVNH 4L3AA 4TTDD 1IGJA 1OTUC 4HUMB 4S1SL 4EBQH 4L4VE 1ZEAL 4HJ0C 4PFEA 2ZJSH 1JGVH 3QEHA 3GJFK 4L8BB 4QHNB 1GC1C 2BY3A 3BZ4B 4M7KH 4IHOB 1G9MH 5E2TH 3WNNA 1C5DB 1DDHB 3CFDA 4LU5L 4M3KB 5F6HI 1F45A 3U4EB 5DVLA 3SDDB 1FFQA 2J8HA 5LCVH 4LMQE 5IW6B 1I3VA 4U6YA 5FGBC 3TBYA 3HZMA 4PJAF 4MXQC 1SY6L 1UM5L 3NIGE 3O3EB 5D96B 1BVLB 3MRNA 4C83A 5JXED 3FOMB 5IKCB 4O2EA 1EJOL 1G7QB 4PPTA 4FHBD 4PV8A 3QDMD 3LB6C 4RFOH 1NPUA 2NTFA 1NFKA 3ZL4L 3QQNA 4PRHD 2EH7L 1BZ7A 3D87B 4XPBL 4LSQH 2ZNXA 4FQPA 2JTDA 3WIHL 1XGQA 5F7DB 3L95A 2H1PH 4W81A 3ZSTA 2I5YL 3ZMRA 5DVOA 3OXRA 4NPYB 1CE1H 3SCMB 2IPTH 3U9UA 3UAJC 3QI9D 1MJ7H 4I18A 4RCAA 1XFPA 4O5LL 4PR5A 2WAHA 4HDIB 1I3UA 2D31B 2K7QA 1TPXC 3VXME 5FA3A 4RNRA 3OR6B 2YD4A 4YGVA 1CQYA 4IMLB 4M48L 4U7MA 4NQVB 3MBXH 1IC1A 1MI5D 4D9LL 3O3AA 1L7TH 4PJGE 4M7JL 5AUMB 4JEGB 3QIUC 2V9QA 4L4TD 4UB0H 3P4LA 4P23D 1V7NH 1PKQA 2EDTA 3BEVB 4KZDL 2ESVD 1AXTL 2OK0H 4U49A 3C09B 4V2BA 5I16B 5GGVY 1MEXL 4J1UA 4BZ2L 4JO4H 5TDNB 5KS9E 4U1LA 2D03H 4KZEL 1S7UA 2V2TA 2DQTH 3CLEL 5ALBL 1JWUA 3QEQD 4Z7VE 5TE6L 4JB9H 1NBZB 4L8DA 1H3UA 2HRPL 1A8JH 3GMLA 2N1KA 4L3CA 3BPCB 3P4OA 2ENYA 2NY6D 3N85H 5D7LA 3CK0L 2ERJC 4TVPL 1KIPA 4E41D 4FG6C 4JFOB 1NLBH 3HG1B 3KR3L 4KI1A 4N0FA 2X4UA 5B38A 4P2RD 4MNQD 5GSVA 2H8PB 3F7VB 4RRPG 5D7SL 2QQNH 4N9GB 2B39A 5E0QA 1ED3B 1FH5H 5EUOE 4GRWB 3SGJA 2A73A 1QLEH 3QXDA 2DJSA 3DGGB 2Q76B 3QNXA 2B1HH 3ETBF 4NQXA 5D8JH 3ZTJG 2EC9T 3KPMB 4JVWA 4D2NA 4OV6F 3GO1H 3B2UC 3LY6A 4XPAL 4L4VD 3PIQB 2QLVB 2DL9A 2EKSB 2VDML 1CR9L 1UADC 3V6OE 3ES6A 2F19L 3BW9B 4K2UH 1QEWB 3MUY1 4MJIE 4GQ9H 3U1SH 1B4JL 3C5ZB 3CDGB 3TM6A 3O6LH 1MLCB 4KK5D 4M1DL 3T3ME 5DK2B 4K9EC 2Y6SC 5HHOB 2VZTA 4YHZH 1FNHA 5IV2A 1HNFA 1CD8A 3GSVB 3INUH 4NJAH 1UACH 4DKAA 2VO5A 4OZIE 2CLRA 1QQDA 5IQ9A 3IT8D 4LLQB 4DGVH 4ZPTB 4JRWA 4NCC1 3WIFA 5JTWA 1NMAH 3OB0K 4Y4HB 1P7QD 3ARGC 3TNMA 2DQDH 2D7PA 5KTEL 2UZIH 4YAQB 5F9OL 4GBXC 5INCA 1I7TA 5IOPB 1J1XH 1ND0A 2DLIA 4XWGH 4GRWH 3O45B 4OLXL 3WLBB 4APQC 3K80A 1NGZB 4U6XB 2NY2D 4ELMF 2W07A 3MBEB 5ESQA 3LEYH 5TQ0L 3DJ9A 1BBDH 1YNKL 4UQ2B 3JBG7 4JFZH 1FZMB 5T5NG 5E2VH 2Z8RA 4NOFA 1Y6NR 1WIUA 1I1FB 4BSVB 1NCTA 4JRYA 4OZIF 5F7UA 1CGUA 4WUUE 1CFSA 4HZLB 2GTZB 3U79A 1YYLL 5F7EH 1RUQH 3EYFA 3BGFB 3BXNA 4G7VH 4UOJA 4Z5RB 3WXWH 2DYPA 1P1ZA 1EJ6A 2YC1B 3AS3A 3FONA 1IQWL 1ZLWH 2BRRL 4ZUVA 5D9SA 5FCSH 2FR4B 5EU3B 3BP5A 1NEZA 4U6VH 1SBBA 3DXAE 3BX7C 2YUWA 4U6HA 1TJHL 3G5ZA 5E8OB 4XCFL 5GGQH 4D9QE 3OGCA 3O2WL 4XHJC 2DIBA 1KJVA 2XQBH 5JNYB 1UXSB 1W0VB 4OFYD 2P5EB 3IFPA 3VFPA 4X80L 4P9HH 3D2UA 4WEMB 1LMKA 2ICWA 5ESVB 5CHNB 1Z0NA 2LVEA 3HUJB 4HKZA 4J3TA 2A6DB 3MV7E 1F11A 2XKSA 1DUYB 1UKSA 3MUJA 1PW3A 3K46A 5AYUH 3SJVB 3RWEA 2B1AL 1T6WA 5DJ0A 3PHQA 3GJFH 1CICB 1T2QH 4OF8A 1X5JA 4QOKE 3PV6B 5D6CA 1GGBH 5KSVB 2EDLA 4ZSOB 2ZUSA 1LO0H 4Y19B 5LGJA 5JOFA 2R0KH 2EDOA 2HFTA 3ZE0F 2WWKO 1ZANL 5JIIA 2F74B 2X4TB 4WO4B 3SKJL 5IB3A 4PJEF 4UMGA 5F9AC 4CBPA 5LAXA 3V8CA 5E2WL 3WKNA 4IJ3C 5C6TH 1AGEA 3N9GH 3BD3A 5L7XH 1AQKL 1YPZE 3QIUA 3STBA 1U3HD 1NCUA 5HTSA 3LQAC 2AJSH 4XC1L 4JKMA 3QG7H 4BZ1L 1LNUB 2EIBA 5I1LA 1BD2E 1A7OH 5IM7A 4JG1L 2MQ0A 4PJHE 2OJEB 2G2RB 1TXKA 2IH3B 5GS2H 2KPNA 1EGJL 3BIKB 5B8CA 5E4EB 3SDXE 4H8WH 4NNYA 4X6DF 1EGJA 1AO7B 1BQLL 4G6JL 4OCLC 5DHVB 4U1JB 4GKNA 1QTYT 4S2SB 4L8SB 4N8VB 4LCIH 2VC2L 2X9XA 4R0LB 1YDPB 4XCEA 1OAKH 3ESUF 3D39E 1XF2B 1BLNA 5BV7L 4PJFA 3FHQA 3GUTB 4P48A 5EZIL 3RL1A 4HS3A 4M4RA 1P69B 3PGCB 3S88L 4NQDD 2AQ3A 2OJZL 3LRHA 4H26B 4LVOC 1AD9B 2JCCE 1JYWA 2GHWB 5TQ2L 4M62L 3T1FA 25C8L 3QIBB 2FHBA 5EU6B 3MV9E 5T1KA 4YGAB 5K9KA 1Q1JH 1MHEB 4ODTH 1G7JA 1P84K 4YBQC 1YEIH 4DW2H 1A0QL 4JFEA 2Z35B 3OBAA 4LLDB 5EH1A 3QI9C 3AREC 1J0JA 1WBXB 1G1CA 4U1HA 5E70A 5AD0A 1ZGLB 5E8NA 5B3JF 1OL0A 4PJ9B 4Y5YC 4LCCA 4W6WB 2BNRB 3Q6FB 4LAQH 3NCEB 3O9WD 4XAWH 4HW6A 1MAML 5F71A 3IDIA 3WN5B 1NCBH 5HGAB 2VLKA 4WHYG 2WLZA 4D9QD 5DHVH 3AMLA 2JIXB 1MHPH 4P23C 1G9MC 1HOCA 3BH8B 5HGHB 2QSCH 3IVKB 4RFNC 2X9YA 3UYOD 4YR6A 5C9JB 3I50H 2ZOLA 4HUNB 1I8IA 5H35B 3QWRA 4RIRA 4Y4FD 4NUGH 1KB9K 1U3ZA 3VWJC 4CNIB 3L5IA 1DSFH 3KXFA 5JW3H 1MVUB 1SEBA 2GJJA 4GBXA 3WFDH 3MV7D 1VFOA 1IC7L 1LE9A 1INQB 1IFHH 3QO1A 1IAKB 4UUJB 5E5RB 4MB3A 4MJ2A 4KMTL 3KJ6L 3BO8A 4PRBB 1J88A 4B53A 4HGKC 3PWUA 4APQA 1FHGA 3GIZL 5I73B 1PG7H 1WZKA 5IMOB 2NTSP 4QOKD 1KN2H 3ULUE 3DYOA 3CLFH 3MXWH 3P4NA 1JV5A 1R3LB 2Y36H 1A2YA 3PQYB 5FO9B 4G42A 2JB5H 2F54A 2XTLA 4U1NB 5ABDE 1QSEE 2EICA 1RIVH 4HSQA 4U33A 5GRXG 1CD1B 4M03A 3MACL 1XIWD 2JJSC 2NX5E 4C59B 1JNNH 3CSYB 1LP9E 5HHNB 1N59B 1QFWH 4K3JL 5DJ6A 1S9YA 2XWTB 1CIDA 3VFWA 4XCYB 3FO2B 2YN3A 4OZHA 2Z0BA 5F3BB 1WISA 4MDJB 1KB5L 3OB0H 4WTZA 1BD2D 1IGCL 3O4OB 5D70L 5DR5L 1UZ6E 1X5KA 4F7PA 3G08B 3IFNL 2BC4B 1XGUA 3SDDC 2D0FA 5IK3A 1LE5A 1TVHA 1AR1D 1IVLA 3NPSC 1FGVH 1NFIB 4PS4H 4X7DC 4R90L 4PB9H 1JRHI 1X6NA 5D96C 4KJYB 4HC1A 1A6UL 2XI9A 4K3GA 1ORSA 4M6OL 3D0LB 4X99A 3P73B 1JF1B 3D39D 1KPVB 1CVSC 1QBBA 4CN6A 4NZRH 5JPMB 2VTFA 2GUOA 2R1YB 2YSSB 5C08E 1I7ZA 3FO0H 4P3WA 1K9TA 5IB4A 2RIKA 5JXAL 4JY5L 3H42L 1FYTE 2VIRB 3MV9D 3CVHH 4NOBA 1RZIA 3F7YA 1ZA3B 3SCMC 4GQPH 2VQ1A 3OJ2C 5IW1B 1RV6X 1F4YL 4XNQA 2D7QA 1HHKA 1A3LH 2PW2B 3UBXI 3LEXB 4ZFOB 1MFEH 4B41A 5I2IB 2YPKB 3K2UL 3BHBB 3BQUB 4OGXH 1PQZB 2AXJA 4LGPB 4HS6A 5SWZA 1IL1A 1OY3B 1SVZA 4NC1C 3IXTB 2J5LB 2IG2L 2DIAA 2VMFA 3CSPA 3M8OL 5CMAB 5CSGA 3TFKC 5MEPB 5BVPH 5IB5B