3WBEA

Rice os3bglu6 beta-glucosidase e178q mutant in a covalent complex with glc from ga4ge.
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
478
structure length
478
Chain Sequence
b'GLTRGSFPEGFVFGTASAAYQYEGAVKEDGRGQTIWDTFAHTFGKITDFSNADVAVDQYHRFEEDIQLMADMGMDAYRFSIAWSRIYPNGVGQVNQAGIDHYNKLIDALLAKGIQPYVTLYHWDLPQALEDKYKGWLDRQIVDDFAAYAETCFREFGDRVKHWITLNQPHTVAIQGYDAGLQAPGRCSVLLHLYCKAGNSGTEPYVVAHHFILAHAAAASIYRTKYKATQNGQLGIAFDVMWFEPMSNTTIDIEAAKRAQEFQLGWFADPFFFGDYPATMRARVGERLPRFTADEAAVVKGALDFVGINHYTTYYTRHNNTNIIGTLLNNTLADTGTVSLPFKNGKPIGDRANSIWLYIVPRGMRSLMNYVKERYNSPPVYITENGMDDSNNPFISIKDALKDSKRIKYHNDYLTNLAASIKEDGCDVRGYFAWSLLDNWEWAAGYSSRFGLYFVDYKDNLKRYPKNSVQWFKALLKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-glucosidase 6
publication title Enzymatic and structural characterization of hydrolysis of gibberellin A4 glucosyl ester by a rice beta-d-glucosidase
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Hydrolase
total genus 200
structure length 478
sequence length 478
ec nomenclature ec 3.2.1.21: Beta-glucosidase.
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wbeA00
4HP5A 3ARTA 3TTOA 4PMYA 3WDJA 4ACYA 2X8RA 3I3BA 1E15A 1ZL1A 4B9YA 4DWSB 1I1WA 1W1VA 3J7HA 5CPTA 1JD7A 2PWDA 3VU2A 3SCRA 4WLCA 4PN2A 4PRWA 2DGAA 4P7RA 1UH4A 3WUEA 2PF0A 3RM8A 4DWSA 2EXOA 1J10A 7CGTA 4TTGA 2CHNA 1HJWA 1TVPA 2EPMX 3OLGA 3PZOA 2YDQA 3EYPA 4F66A 1Q6GA 2E8ZA 3EDFA 5A1AA 3AS2A 2WZHA 1JYNA 5A2CA 1JG9A 1W91A 4HZ8A 2XIBA 3IJ9A 4UQ9A 2D24A 3ARRA 1KXVA 1CGYA 2JALA 3VGHA 2Z1SA 1QNPA 1HKIA 5HXMA 4HU0A 4ZENA 2CNCA 1BFNA 4LGXA 1HXJA 3B9DA 2WC4A 4MJ2A 3ZJ6A 4XV0A 2D20A 4J7RA 4M8UA 2V3EA 3BAWA 3KL3A 6TAAA 1W1YA 3QOMA 3F5LA 1NP2A 1IV8A 1GNXA 5D9OA 1MFUA 4AZCB 3N1AA 2J8GA 2J7EA 2XVGA 4QLKA 4ACZA 1X6NA 3PZGA 1UYQA 4BZYA 1ZS2A 4UOQA 3ZT5A 4RE4A 3ZOAA 8A3HA 4D6CA 3A4XA 4AZCA 2OYMA 1QNQA 2J25A 3SUSA 1V0LA 4JFVA 2ZX8A 1MXGA 4MAZA 1UR0A 3AXHA 4CU6A 1GCYA 1LG1A 1WCGA 2YDRA 3N13A 4AIEA 1PIFA 1PX4A 1GQIA 1OBAA 4D6JA 1ZJBA 4YPJA 1BQCA 2W91A 5A2AA 1EDGA 1LLOA 3ECQA 1J0JA 3W81A 4UQCA 4AC1X 3AS3A 2EPKX 5JUVA 3W24A 3CMJA 1OIMA 2QF8A 4JKLA 5D8WA 1CXEA 5E9AA 1J01A 4AZBA 3BLKA 1H41A 4W89A 3AYRA 3WEZA 4J28A 1LJYA 1MVYA 3AIVA 4AEFA 4A3YA 1NM9A 2D0GA 3T2OA 1WO2A 1VENA 3HJEA 4HZ7A 3A6OA 3MSGA 5I78A 1UQYA 3AMLA 4CN6A 1PAMA 4LQ1A 1OB0A 4JHZA 1UZ1A 3RO8A 1BYAA 8CGTA 2YIHA 5CQ1A 5I3DA 1E70M 2EBNA 1TMQA 3N15A 1W3JA 1HT6A 2J75A 2D0HA 1OGGA 4EKJA 5ABHA 3GXMA 1WDSA 1C8QA 1PZ3A 1QNRA 1FHLA 4JCLA 3VKKA 4L4OA 2WVUA 2D3NA 2CCRA 3UEQA 2GJPA 1XH0A 4NZCA 5A6MA 2EPNA 2GUYA 1FH8A 5CZKA 3OGRA 3CO4A 2WVSA 3IAQA 4XX6A 1A3HA 2XFRA 1EA9C 4HU8A 4Q22A 3DHPA 2JF6A 2B31A 3N11A 5M3WA 4M80A 4HA1A 1ITCA 1WNOA 2WB5A 1Q6FA 4LYPA 3MKKA 5CXPA 3PZMA 2ZXDA 2JIEA 1K9EA 2DQXA 2OWCA 4HTYA 3VGDA 1NWRA 2WHMA 3GH5A 3PZUA 1MW0A 5A95A 3UERA 4AZ7A 3PTKA 3WDHA 1QI5A 2VCAA 4W5UA 1HN1A 4EAMA 1GW1A 1C90A 3WNOA 1E73M 3DYMA 3GXFA 3I3DA 5HOSA 3U7BA 1H0IA 1NWSA 2NSXA 3AIRA 4DM1A 4CVWA 1A47A 5BCAA 1AQHA 1XD0A 1E43A 3UR8A 3GZAA 2F61A 1D2KA 3POCA 1C8YA 2J8FA 2X05A 1JAEA 2BY3A 4FMVA 5FL0A 1JZ5A 5CLTA 4J3TA 3TTQA 4UFIA 2VL4A 2VO5A 2VI0A 3M07A 3QR3A 2XVNA 4D1IA 1UWTA 4L4PA 1Z32X 2YL5A 3LPGA 3SUVA 1FFRA 1FP8A 1EHNA 3GBDA 4U5KA 4P7LA 4AD1A 3GNPA 1K6AA 2IXVA 3VOCA 1E0VA 1KCLA 4OBRA 4WSKA 1E72M 4AYSA 1XYZA 3VINA 5DO8A 1E4NA 2JEPA 2NW0A 4RE2A 1OGSA 2VVSA 5F7UA 4ZE4A 4QLJA 3K46A 1UOKA 2QMJA 5DT7A 3UG3A 1E3XA 3VGBA 2PWFA 3VNYA 1BAGA 3LMYA 3AIQA 1CEOA 4JCMA 4Z2KA 1R87A 1UHVA 1U30A 3IAPA 1UA7A 1CGXA 1BGGA 3AZRA 1XYFA 3MUZ1 5C8BB 1FA2A 2BY0A 2CKSA 4U2YA 2WM0A 4GO9A 5GNZA 3N18A 1KWKA 2G3MA 3FW6A 2WWCA 1E9LA 3KL0A 1GHRA 4W8AA 1W3KA 4AZ6A 2PBOA 2WHLA 3UCQA 3K8LA 2YLLA 4PCTA 5DFAA 5AC4A 3W82A 4DUXA 1PPIA 1V6YA 1B3YA 3VIKA 3F5KA 4W84A 1H11A 1OINA 4YHGA 2CHOA 3BMVA 2WPGA 5A6LA 2YL9A 5E70A 3AQUA 4QAWA 1G94A 2WWDA 2ZUSA 3VIJA 1DWIM 4PMZA 4H2CA 3OLDA 1F4HA 4UZSA 1LL4A 1PBGA 2GJXB 2V5DA 4NI3A 2C8NA 2DSZA 4YN5A 4HOWA 1NQ6A 1LL6A 4ZXLA 4WSJA 2A3EA 2XIIA 2GJXA 1UR4A 4UQEA 3SUWA 1J9YA 5EBAA 1E6QM 1V3JA 1V6XA 1SR0A 1E6ZA 4E4PA 3NDYA 2WBKA 1TA3B 1NWTA 3L4TA 2Y8VA 4UQAA 3WD2A 1E3ZA 1VIWA 3MMDA 4WIWA 4PYSA 4S3KA 4W8BA 4CCCA 1MW2A 3WUGA 4FLQA 1TA3A 2A3AA 4FF5A 3OZPA 2W67A 1PJ9A 1E0WA 4GZJA 5DEZA 1L8NA 3ZMRA 3S6TA 2CEQA 1O6IA 3SEPA 3VD4A 1V3IA 1KB3A 2ZXBA 3AS0A 4JL2A 2OYKA 2VVNA 1VF8A 3L4WA 2J7DA 2VZSA 1C8XA 1OT2A 3FNDA 3AXXA 1VFOA 1UG6A 5ECUA 3F4VA 3WL0A 3CHEA 4RE3A 1AVAA 1KXHA 2WVTA 3WY1A 4E8DA 3THDA 1H0GA 2UY5A 3CZKA 3PTMA 1VB9A 4H04A 3PZTA 3WL1A 2WNWA 3N9KA 3ARVA 2YA1A 1EQCA 2XGBA 5LA0A 3OB8A 1JZ3A 2DSKA 1EDTA 1WKYA 2G3JA 1U2YA 5CPSA 4DWSC 5CJ5A 1RP8A 1GONA 2E40A 5A2BA 3JUGA 1BSIA 2VQTA 3AIWA 4X9YA 2J47A 2FHFA 3WNLA 4U33A 3AMKA 2OSWA 1P6WA 5E6YA 4HMCA 5IFPA 3L4UA 4W7VA 2O92A 4D6DA 4A4AA 2UY4A 4UFJA 3W25A 2WW5A 1DWHM 3CUIA 3CTTA 4FLRA 5HNNA 3BGAA 4XUYA 3WMBA 4GQRA 1HL9A 5A6BA 2WK2A 2VMFA 3BCDA 3VIPA 2J7CA 3WF0A 1V03A 6A3HA 2WSPA 1G5AA 2X1IA 3UETA 2WXDM 2VRJA 4YHEA 3L4ZA 3CLWA 3QOKA 1CWYA 4GQQA 4PTMA 4AD5A 4PMDA 4WK9A 4U2ZA 3N04A 4J3VA 4UQBA 1TR1A 3BAYA 5AYBA 3VM7A 3U57A 2PI6A 1GOQA 3WENA 3ARPA 5CGTA 4MADA 3SIMA 5D9MA 4CGTA 2XM2A 3ARWA 3VGEA 4UFMA 3GNRA 1BLIA 2NT0A 5I23A 5FL1A 1NOFA 5A6AA 3WNMA 3UG5A 1V0KA 1UD8A 3T0AA 3OG2A 1EIBA 4MB4A 3BMWA 3T0BA 3HN3A 1EO5A 4FLOA 1KWGA 3K8KA 4KGJA 3AJ7A 5CG0A 3CZLA 1VRXA 4ATWA 1PX3A 3W4RA 3N17A 3ALFA 1V02E 1YHTA 5A6BD 2WHJA 3PN8A 4QFUA 2NT1A 1S46A 1JI1A 1J12A 3WH6A 3AHYA 3WIJA 2ZUNA 2CPUA 1JZ7A 1KBBA 2DT1A 2O9OA 5A6SA 1VFFA 4U31A 2HISA 3MS8A 4HOZA 5BRQA 1JL8A 3ARQA 3CZGA 2BV9A 3MMWA 2XWEA 3ZSSA 2EO7A 3WMSA 2XG9A 1W1TA 3EDKA 2IUZA 1HKKA 1XHGA 1GOKA 4ZXOA 3CUGA 3VMNA 5BXPA 3KE0A 1WB0A 5GNYA 1EOKA 7A3HA 1MQRA 2J79A 2A3BA 1W9PA 2VNCA 3AYSA 3DYOA 4H8HA 4E8CA 1ZU8A 4LYRA 5D8ZA 1UWIA 2C0HA 2CKRA 5EMYA 3ARYA 1EHAA 1KGXA 3CZ8A 2XYLA 4B9ZA 2ZUUA 3U7VA 2WKGA 4X0VA 1OSEA 3TP4A 1M03A 4W93A 1K9FA 1J0HA 1XSKA 2VZVA 1JFHA 2VJXA 3PZQA 1G01A 4ACZB 5JBDA 3ARZA 4M56A 4EANA 4UFLA 3FHQA 1UUQA 5EB8A 2VUYA 1V6VA 5M17A 3MU7A 3NSXA 3APGA 1UWQA 2PBGA 4F79A 3SCWA 3T08A 2VRKA 1KR0A 1BGAA 4MNLA 4ZFMA 4GPNA 2WMJA 1DEDA 3BLPX 3CZJA 4BQ5A 2A3HA 2GSJA 1CENA 1QNOA 5IDIA 1HVQA 4GI8A 3O6AA 2VR5A 1LWJA 4KRTA 3PZVA 3RM9A 2FH8A 3SCPA 2QPUA 4GZEA 1XRVA 1W9VA 5EFDA 2VTFA 2GK1B 3QHOA 2VX7A 3E1F1 2V5CA 3FN9A 1CGTA 4MPKA 3EDJA 3A47A 2WANA 1UR8A 2DH3A 3AOFA 3MANA 3NSNA 3NDZA 1E6XM 1I75A 1AQ0A 2Y4SA 4OUEA 2GK1A 3K4DA 4JFWA 4EK7A 1UR1A 4D71A 3CHFA 4P8VA 4LXFA 3ZJKA 4N0RA 4TVDA 2J77A 2WKLA 1ITXA 1LWHA 1OM0A 1G0CA 4AIUA 1WAWA 3TOPA 4NSBA 5C71A 1XC6A 1V08A 2DT0A 3VILA 3K8MA 1E5NA 1BYCA 3OA5A 1MXDA 3PZNA 4P7NA 1PEZA 3BAKA 3BSHA 1JFXA 4JFUA 3WNKA 4GZIA 2WC3A 1UWSA 2WZEA 2X0YA 1H09A 4WKFA 3VIIA 1KR1A 4P7OA 3SCOA 4P8WA 3SURA 3EDEA 4LPCA 4GKLA 2BVYA 1V02A 5A8PA 1OGBA 2GJRA 3NIYA 1EQPA 2UY2A 3GTNA 3WD1A 3WQ8A 1UA3A 1JF5A 4BF7A 1DHKA 1IZKA 3AMGA 1H5VA 1JZ6A 5JIPA 1SMAA 3AISA 2EQDA 1ZBWA 2ZOXA 1I1XA 2QLYA 4TX8A 1QBBA 3W27A 5CGMA 4PTVA 1V0MA 4LX4A 1GQLA 4S3JA 5CSUA 2GFTA 2RGLA 3GH4A 4W85A 5CPQA 2TAAA 4GI6A 1E5JA 1CGUA 2JFEX 1JYVA 2EPLX 5IHRA 4C7GA 5DF0A 9CGTA 2XWDA 4W5ZA 5IFTA 4D6IA 4PMVA 1TE1A 1UH3A 2VZUA 3WFZA 4HMDA 2PC8A 3CUHA 3WD4A 2ZIDA 4W7UA 5LYRA 3VIGA 3VNZA 1CDGA 3KWXA 2WMHA 1E4MM 3W37A 5E09A 3CPUA 4HPHA 1LG2A 2G4FA 4TVCA 1C93A 4UCFA 4PMXA 5C70A 3FHAA 5ABGA 1CECA 3EBVA 4B15A 3ZQ9A 3PZ9A 1CXIA 1QHZA 3WH5A 4M82A 1DWJM 1XH1A 2C7FA 4AD3A 3W38A 3AHZA 1HVXA 1FFQA 4JIEA 3L4YA 5FKYA 1WZLA 1SFSA 2CERA 3VD5A 1UKOA 1OIFA 4BA0A 2FH6A 4J27A 1E1EA 3GH7A 2PWGA 5HDRA 1JYXA 5D4YA 1UD3A 5IHSA 2DT2A 2XVPA 3BH4A 3I3EA 4X0NA 3MUY1 1D3CA 3BAXA 2XM1A 3MV11 3A4WA 3OIHA 4HMEA 3OBAA 2OYLA 1VEPA 3W6MA 1W32A 4DM2A 1B31A 2ZX7A 1JGIA 4JL1A 2WC7A 1GHSA 3POHA 4MNMA 1KQYA 5HBFA 1HNYA 1Q4NX 1SYTA 3OGVA 4IPNB 1MFVA 3LPFA 4Z2IA 4PBGA 5FOOA 1EXPA 3VD9A 3SCNA 1DTUA 1QW8A 3DHUA 3B8SA 2VX5A 4MTVA 2ZE0A 1OT1A 4MB5A 5M03A 2D2OA 3CH9A 2XGIA 4IUGA 4WF7A 4M1RA 2XSBA 3AMCA 1ZBVA 1GJUA 3MUAA 4JFSA 2V3DA 2XHYA 4PEEA 4AD0A 4PMNA 3RMEA 4HOXA 2YA2A 3ZJ7A 4AZHA 5CLWA 1UR2A 3F5JA 1GOMA 1HIZA 4H8VA 5BRPA 2J7GA 3WNPA 4AISA 2UY3A 2J7HA 2X0HA 3PTQA 1TVNA 5I5RA 1WP6A 3WF1A 1US2A 3G6LA 1E6PA 2IXUA 1BYBA 1W2VA 1H2JA 5E0FA 7TAAA 3ZR6A 5BXRA 3LPPA 2EJ1A 3WQ6A 3WELA 1E55A 1B9ZA 1VJSA 3WEMA 1RP9A 2JIWA 5M5DA 2PWEA 3WNNA 2E9LA 4MDOA 2DDXA 4W8LA 4URIA 4JZ5A 1QPKA 3FAWA 2G8ZA 2ZXAA 3WBEA 4UZUA 1GQJA 4KMQA 1CLXA 4Z2JA 3ARUA 1C91A 2XUCA 2J78A 1WDPA 3VGFA 1DWAM 2J7BA 4OBSA 1W2PA 2BVDA 5A8NA 1E71M 5A6KA 5D9NA 4ATDA 4B3LA 1KFWA 1WE5A 3NUKA 2JE8A 1E6SM 2QV4A 3ARXA 1YQ2A 1GQKA 1L0PA 2YOCA 2DEPA 3EMCA 4QCFA 2VZTA 3GBEA 1B0IA 4V28A 1CXFA 2VRQA 1UZ4A 3WQ4A 2GDUA 2ZX9A 2FGZA 2DH2A 1R7AA 5BXTA 1XGZA 3AROA 4AWEA 1C3FA 4FK9A 3RILA 3AZTA 3EMQA 1UWRA 1EDQA 1VEMA 4JKKA 1E6NA 3GYCA 2OSYA 5JIWA 1M01A 4J3UA 2VR4A 1O7AA 1JYWA 4JKMA 4XZWA 5A94A 4PMRA 1HJXA 4IM4A 1J0ZA 1D7FA 3CGTA 4JAWA 4CCDA 2DIJA 2YL6A 4D72A 3VIOA 1XSIA 1ISXA 3W53A 1DWFM 3FY1A 1ESWA 1GZJA 3FAXA 1LL7A 1JAKA 1ISVA 2Z1KA 5EFFA 2FHBA 3U5YA 2VC9A 1JZ4A 2ZX6A 3A4AA 3VO0A 3WDQA 4TOQA 2YLAA 3M46A 4MAVA 3VIHA 2GVYA 3SCUA 1CXHA 1UD5A 3WF3A 4XZBA 3K1DA 1EGZA 4DUWA 1MQPA 4U3CA 3VX0A 3DYPA 1GORA 2UWFA 3D5HA 4KWUA 1ISYA 4K68A 3AMDA 2D23A 5TD4A 1HL8A 1MW3A 2Y24A 3SCTA 5AC5A 3DC0A 4PSRA 2DSVA 1G1YA 2QHAA 2Q8XA 4CCEA 3RDKA 1VBRA 1H3GA 2RGMA 2DSUA 3NCOA 3A3HA 1HP4A 1HF6A 1J0IA 2YL8A 1UKSA 1WDQA 2BXZA 1XCWA 2VOTA 3BCFA 4XB3A 3VD7A 2V3GA 1BHGA 1V3MA 2F8QA 3CIVA 3MV01 5CSYA 1XSJA 3WD3A 3MUIA 2E3ZA 1CZ1A 3WUBA 3VDAA 4WJXA 2YKKA 1NH6A 2G41A 1HJSA 1E4IA 3OLIA 1QOXA 1B3ZA 5FIPA 2VT0A 4Z2HA 3GDBA 4OKDA 1LQ0A 3WDRA 1CNVA 1QW9A 3CUFA 4JFTA 2W61A 4UR9A 1UQZA 3W28A 4IPLA 1E40A 3IJ7A 2WBGA 1V6UA 1BVNP 3WDPP 4NF7A 3VD3A 3WUFA 3AIUA 4WKAA 1ODZA 3L2LA 2Y2WA 1BF2A 2XFYA 1Q6CA 1R8LA 1BPLB 4TUFA 1JDAA 5BROA 3RPMA 5HPOA 1JXKA 2XVKA 4ATLA 2X09A 4HZ6A 1M53A 3THCA 3WDIA 4Y7EA 4HA3A 1GVYA 1KCKA 1XV8A 2E9BA 4CU7A 1JZ8A 1KXTA 5A8QA 1UKQA 5FCZA 1XH2A 4GO8A 4J3SA 2BY2A 3IJ8A 3II1A 1HJUA 1R7OA 2MANA 2CXGA 1E0XA 2VX4A 3PBGA 1HKJA 3WN6A 3BSGA 4F8XA 1MW1A 1EOMA 2BFGA 4P7QA 2D22A 4Q7NA 2JF7A 1WZAA 5LA2A 1CXLA 1EO7A 4F9DA 1CGWA 1QVBA 3ALGA 4MB3A 4CUCA 4D6HA 5BYWA 3OZOA 1MYRA 1B3VA 1GJWA 2O9RA 3AHXA 4PTXA 3WQ5A 1NWUA 1R85A 3VPLA 3D3AA 3O2LA 1QI0A 1IZJA 1TFVA 1TG7A 1M04A 5ABFA 1HP5A 2ZUTA 3ZIZA 4C7DA 1TCMA 1UKPA 4KRUA 4CD4A 3RCNA 2BVTA 1BTCA 3WQVA 1Q6EA 4WKHA 3GXDA 3CZEA 4M24A 5BWFA 1X6LA 1AQMA 1QI2A 4D6FA 1KGUA 5JBEA 4DWSD 1UKTA 3MSDA 4J3XA 3K4AA 3VDHA 1B30A 1JNDA 2A3CA 3U5UA 1J11A 4NRSA 3OGSA 4U5IA 4MNKA 4Z2GA 2PB1A 1ZBKA 2ZICA 1UD6A 1CIUA 1J0KA 3WQWA 4CD5A 2YBUA 3B9EA 3DECA 2O9TA 1JXJA 4D6EA 4E2OA 5A8OA 5IXEA 1W3LA 1CXKA 2CITA 3SCQA 4R5EA 2X2YA 2PWHA 2XPKA 3W26A 1CLVA 1V3KA 1FOBA 4OZOA 1XCXA 4QDMA 4R27A 2CBIA 2EEXA 4UOJA 2CESA 1UD4A 1WZKA 5KEZA 2CBJA 3KZSA 4OOUA 1J18A 1NP0A 4AD4A 2VZOA 1F4AA 2HVMA 3BC9A 4PSPA 1PIGA 3S2CA 2W92A 2BHZA 2WVVB 1FH7A 2ZWZA 1VEOA 4TX6A 2ZUMA 1PX8A 3TA9A 3LPOA 5FD0A 1E56A 4A3HA 3GNOA 4D6GA 2WMFA 5GNXA 2VURA 4P8UA 4AZGA 2CIPA 2WVVA 3IK2A 3EMZA 3QHNA 3T09A 1W1PA 2ZX5A 3ARSA 1PZ2A 4AD2A 1WDRA 2ZXQA 2WLZA 3VMPA 2G3IA 2OSXA 1OD8A 1W3HA 2QMKA 4PCSA 1RPKA 4PMOA 4QLLA 1UR9A 3AFBA 3ZT7A 1VJZA 1QI4A 4PTWA 2Y8KA 3L2MA 3MMUA 3WFLA 3WBAA 4C7FA 3VDCA 3WSUA 3T0DA 3UR7A 2AMGA 5A8MA 2WYSA 4AZIA 3L4XA 3ZSTA 3RJYA 1CGVA 1CBGA 1W9XA 1UD2A 3O9NA 4FLSA 1W9UA 4CD6A 3PZIA 3AZSA 4J3WA 5LA1A 4MB1A 2O9PA 1EH9A 5AYIA 2GDVA 4QCEA 2V38A 4AMCA 1FH9A 4UQDA 1W9DM 1ZBCA 2VCCA 1JD9A 3VMOA 2OWXA 2BHYA 2Y5EA 3VTRA 5A3HA 5AY7A 2FDMA 3AIBA 1HJVA 5I6SA 4PUEA 1OD0A 1CYGA 1K9DA 3NJ3A 3RM4A 3CBWA 3UG4A 3W29A 2VQUA 4AY1A 1X1NA 4BQ3A 4V2XA 1GOWA 3TTYA 4DUVA 3NYDA 3CHCA 2D0FA 1V3HA 2YA0A 4EE9A 5I77A 3AS1A 4IISA 4H8UA 1TZ7A 4N42A 1GOOA 2V3FA 1V6WA 2J62A 5A6JA 5D9PA 3MO4A 3AIEA 3WH8A 1H4PA 3NSMA 4CU8A 5GPRA 1ISWA 4BS0A 4CN4A 3WKZA 3HMCA 3VM5A 1CTNA 2BHUA 4MDPA 3VUPA 1IT0A 1MWOA 4CD7A 3GM8A 4LYQA 4GI9A 4AW7A 1VAHA 5DT5A 5ABEA 4KGLA 1OCQA 3BXWA 5I24A 1JIBA 2CBVA 2OWWA 2WMGA 2YDSA 4OIFA 1FP9A 1W9BM 1WZMA 1QNSA 3WEOA 3TONA 3QGVA 3WF2A 1Q6DA 4AXNA 3ZT6A 1JZ2A 3VVGA 3ZJ8A 3SCVA 5GQBA 3ZM8A 4KH2A 4GXPA 4D1JA 1R86A 2FHCA 2CYGA 5KZ6A 2BY1A 2J4GA 1JDCA 1C7TA 2WLYA 4CN1A 1B3XA 4W86A 2EPOA 2VCBA 4V27A 1SMDA 1DP0A 3KL5A 4Z2LA 3SUTA 4M81A 3M7SA 1NARA 2ZUVA 3HU7A 2W62A 1NOWA 3W6LA 2J7FA 2XTKA 4OOZA 2WMIB 3BAJA 3T2QA 4PMUA 1DWGM 4AZ5A 4ZEPA 2AAAA 3QHMA 3EDDA 4AEEA 1GOIA 3OLEA 1B2YA 4MJ4A 1C7SA 2WMIA 5E0CA 4UTFA 4TXEA 3VGGA 4P8XA 1JI2A 2WAGA 4W87A 3BAIA 1V3LA 3G6MA 2YBTA 4CD8A 1HJQA 2BNJA 3AI0A 4CKQA 1XD1A 2XFFA 2YJQA 1G9HA 3SCSA 1ZJAA 1WPCA 2WCGA 3ZO9A 1RH9A 3VDBA 1GVIA 3CUJA 1HKMA 1BVZA 2DPEA 2J74A 2D3LA 2DT3A 1H49A 2WZIA 1LF1A 3RIKA 5DMYA 1BG4A 4TTUA 1QHOA 3TTSA 2WSKA 2XVLA 2WMKA 3WH7A 4CVUA 1BG9A 4RL3A 4B16A 3WF4A 4BQ2A 3AXIA 2BXYA 4ML4A 3KEHA 3RJXA 1B90A 1RD6A 3AICA 1QBAA 2ZUWA 2W63A 4BCEA 1H1NA 1BYDA 1HX0A 4W88A 4NRRA 3AHVA 4GINA 4HPGA 1E6RA 3T2PA 3PHAA 4UFHA 1VFMA 3B9AA 2D1ZA 1ODUA 2E0PA 4JHOA 3VIFA 4UFKA 4M29A 5I0DA 1E4LA 5I79A 4BQ4A 3WMCA 1VBUA 4UNIA 2E4TA 4AIOA 1VFUA 3GXIA 1JF6A 1QHPA 3CHDA 2VX6A 3N12A 1KXQA 4HA4A 4H41A 3SUUA 3M6DA 5A69A 1Y7VA 1K9TA 1US3A 1NOUA 4F9JA 6CGTA 1J0YA 1JDDA 1V0NA 1GPFA 3IANA 3ZR5A 3AHTA 1M7XA 2W5FA 3WD0A 5I2UA 2CETA 1C92A 1JNEA 1ECEA 1UWUA 4B3KA 4MNJA 2OLHA 4PUDA 1KQZA 2WCAA 2AOSA 4PMQA 4QP0A 1TUXA 4GIAA 1B3WA 3UESA 2G3NA 2ZWYA 3W0KA 5HPCA 2QPSA 2DSWA 2JEQA 5JBFA 5BXSA 4UOZA 4OJYA 1OWQA 1AMYA 1CPUA 2W4XA 4H7VA 3VX1A 2WCSA 2FGLA 2XSAA 5E6ZA 1FHDA 1QI3A 2XJ7A 1B1YA 3CMGA 2BS9A 2DIEA 2F2HA 4TVUA 2W66A 1GUVA 5ABFB 1E1FA 1ZB5A 2E9MA 2ESCA 2WHKA 3VIMA 3WH9A 1ISZA 2E8YA 3L4VA 4W7WA 4ZE5A 1KGWA 1MQQA 4U3AA 1KBKA 3FXYA 2CBUA 1UH2A 1U33A 1N82A
chains in the Genus database with same CATH superfamily
4LVFA 4HP5A 5BOEA 3TTOA 3IGSA 3THUA 1Y5WA 4Z1YA 4ACYA 3I68A 4H7ZA 1F76A 3NFUA 4J2PA 3ME3A 5CGQA 3W1QA 2DZUA 1E15A 3T4WA 4PUJA 3TNBA 5FACA 4PL1A 4B3ZA 2QCHA 3H2CA 2PWDA 4WLCA 4PN2A 3W83A 3O6DA 4UB9A 2TRSA 1TVLA 2PF0A 3VC6A 4PL2A 4ZB5A 2WNNA 7CGTA 1HW6A 2CHNA 3IUDA 5CC7A 2EPMX 3OLGA 2YDQA 5EY5A 3EYPA 2XSXA 1QWKA 2WZHA 2R94A 1JG9A 1WXYA 3SRKA 1A53A 4HZ8A 2XIBA 5FEXA 1UZHA 2IKIA 4JBRA 2OZ0A 1KXVA 2JALA 3VGHA 5TNVA 4ZQRA 1QNPA 4WDWA 4HU0A 3LBCA 1BFNA 5KZDA 3HJZA 3SJ3A 5H6HA 1V79A 1PYMA 2XZ7A 3G1AA 4J7RA 4C6NA 4RW5A 6TAAA 1GWJA 1RXOB 3F5LA 1O1HA 1NP2A 1WOBA 5DANA 1JUKA 3QLLA 4GA8A 2J7EA 2XVGA 1X6NA 5HMDA 2E5DA 4UOQA 4RE4A 5G2HA 1TV2A 4AZCA 2PLCA 2OYMA 1HKWA 4ZMGA 2OX1A 2J25A 1V0LA 4JFVA 4C6OA 4FAMA 2DV0A 3N3TA 4N9BA 4IQJA 1NELA 1PX4A 4GVGA 4ZZ9A 3TAOA 1SJBA 2W91A 1WKDA 1LLOA 3W81A 2P88A 2ZTJA 3HBLA 3T05A 1J01A 2F6XA 2XFWA 1H41A 4W89A 2POZA 4JS3A 3CWNA 1DHPA 5I07A 1W17A 4J28A 1M7JA 1MVYA 1JEZA 3MCOA 5LIWX 1NM9A 3FKKA 3GC5A 1VENA 3HJEA 1OF6A 1Q5MA 4CN6A 1TPWA 4JHZA 1YPIA 2NZLA 3S2MA 5CQ1A 3UVIA 5I3DA 3W1AA 1M3UA 1W3JA 1HT6A 2J75A 1I2QA 2P0IA 4MYAA 1PZ3A 1T6MA 2PODA 2WVUA 4HHPA 2CCRA 4ZTXA 4GVFA 4O14A 2Q8LA 2R1MA 4ZB0A 2NQHA 3W84A 3KZPA 4HHLA 1XBXA 3WK2A 1FH8A 3OGRA 3CO4A 4UMCA 4KEVA 1R3VA 4LV9A 3NEHA 2HK1A 4HU8A 4Q22A 2NX9A 3H7RA 3N11A 1GW9A 1ITCA 2V81A 5T9CE 3ABXA 4X2RA 4PRRA 2BDQA 2G37A 4CEUC 1KRMA 1TPFA 1JPMA 4LEFA 2WHMA 3PZUA 3OHIA 3PTKA 3WDHA 1S1RA 1RCOB 2CLLA 3D0CA 1DJIA 3LHUA 3QMSA 4W5UA 4EP8C 1C90A 3DYMA 4ZO8A 3I3DA 5HOSA 3IK4A 3U7BA 4GACA 3DH7A 4R88A 2NSXA 2G50A 3SDOA 2ZZ1A 3FA4A 4AVOA 5BCAA 1AQHA 3AU6A 2F61A 1CW2A 5AB3A 1C8YA 2J8FA 2C6QA 1H62A 3EKLA 3M07A 1DORA 3C2FA 3P62A 4H6EA 2XVNA 4HBKA 4L4PA 3GAYA 4QQ3A 3SUVA 1VBJA 5LHFA 4A3QA 3UWUA 3UXDA 2Z26A 3UPMA 3TQPA 1XYZA 1W1A1 5DO8A 1XLGA 2JEPA 3IACA 2YSWA 2HMCA 4ZSUA 1Z3NA 3DFSA 1Q7MA 4L65A 4EPEC 4GNJA 3KTCA 1UOKA 5K2ZA 4NNCA 3VGBA 3HPZA 4C6BA 3AXMA 4F2BA 4Z42C 1GVQA 4JOMA 3LA4A 1XRFA 1O5QA 2DUXA 1U30A 4MF4A 2ZE3A 3DHFA 1UA7A 3E2VA 1LM1A 5C8BB 2Y61A 1ZSXA 3UJ2A 4U2YA 2FTYA 3G18A 2WOQA 3GW0A 1VHCA 2WWCA 1Q3NA 1GHRA 1J2BA 3OZMA 3TWBA 4JD4A 3K8LA 2YLLA 3MC5A 1E1CB 5DFAA 3WQDA 3ONCA 3C2OA 1PPIA 1V6YA 1TWZA 3GXPA 3VIKA 3PUOA 1UP2A 3F5KA 4ZL1A 2WPGA 2QCGA 1UROA 5A6LA 2YL9A 2BTMA 2ZUSA 2GGHA 5T9BG 5KTLA 4UZSA 4AF0B 2Y88A 1PBGA 2G0WA 1LOSA 2V5DA 4NI3A 2C8NA 3NQGA 3G5EA 2TODA 5JH1A 3QQ0A 1FWFC 4HPNA 2XIIA 2VGGA 3LG3A 3TV8A 4IIDA 4X61A 1UR4A 7REQB 3SUWA 3TYZA 1S2CA 4NKCA 1YMYA 1E6QM 1SR0A 3P8JA 2GGEA 3NG3A 3AWNA 4IMAA 2QXWA 3BG5A 1B57A 1TPDA 3QFEA 4AWSA 3NQAA 3CL7A 3CXOA 3GZ3A 4EACA 1U5HA 4E8GA 3STEA 3HPFA 1TA3A 2VEIA 4OV4A 3ATZA 1N8IA 4XIAA 2W67A 1PJ9A 4GH3A 1BSLA 1OZMA 4HK7A 4QITA 1UUOA 3QC3A 4H3DA 2YW3A 3AU2A 5DEZA 3ZMRA 3I10A 3TN4A 1ALDA 4LC8A 3AS0A 2ZXBA 1VF8A 1F8IA 1KBJA 5U4NA 3U2CA 3PULA 4DY1A 3NXLA 2VXNA 2A7RA 5B7ZA 1KFLA 2GSHA 2VM8A 3WL0A 3CHEA 1I4NA 3VE9A 4GFIA 3BLLA 1FWIC 3CZKA 4LCSA 1ZCOA 4H04A 2DQWA 3WL1A 2HJPA 3N9KA 2F6KA 3ARVA 4GQBA 3V5OA 3OB8A 1JZ3A 1ZCCA 4AXKA 4IT1A 1XG3A 2PDPA 1XINA 3VNJA 2UZ9A 1WKYA 5CPSA 3UXIA 4EOUA 1RP8A 3AIWA 1UCWA 4X9YA 3S2JA 1SJDA 1J6PA 3E74A 4W7VA 5I3FA 1IT7A 3GTXA 4QISA 4WR3A 5CKSA 5CPOA 1TCDA 3CTTA 1A5BA 5HNNA 3WMBA 2VFIA 4LU0A 5A6BA 2VMFA 3BCDA 1EIXA 2RDUA 3WF0A 1NDZA 1G5AA 1LUCB 3CLWA 4ZA0A 4GQQA 3GTIA 4DZHA 4YCOA 3U6WA 3C52A 1KM2A 3N04A 1XLLA 3LOTA 1S5VA 3KVJA 4GXMA 4JDYA 4BK9A 3OO2A 3H8AA 3UYCA 3UYIA 2QNEA 2PP3A 2ATSA 2V63A 3SIMA 6ALDA 1P0BA 3MP5A 1U22A 1NOFA 2B7NA 3WNMA 3V36A 1GVRA 4TQTA 5D04C 1XKYA 1PE1A 1IT8A 3FDGA 2JKAA 3IRDA 4KS0A 3M0XA 5HJXA 1TWIA 4FLOA 4UTWA 3DKJA 1KRBC 1W5QA 1M1BA 3PB2A 3CZLA 1C9WA 3TMQA 2VGIA 4L4LA 4ZBCA 3ABSA 2WHJA 1JI1A 5TIMA 1J12A 3WH6A 4UBPC 1TSIA 1RLCL 4KETA 4M1BA 2PTZA 2O9OA 5A6SA 4K39A 4U31A 2HISA 5DXYA 1JL8A 4BI6A 5FEWA 5D2XA 3ZSSA 2EO7A 3WMSA 6TIMA 4MOZA 1HKKA 4HZMA 5GNYA 3ZWTA 4CNNA 2VNCA 3AYSA 2GUUA 1SW7A 5JXQA 1FWSA 1DYSA 3TFCA 3NPUA 4K37A 3MQTA 5D8ZA 5EMYA 3ARYA 2FMNA 1EHAA 4YWSA 4B5WA 3CZ8A 2FPVA 4WUIA 1R9YA 4V15A 4X0VA 1S2TA 3LM3A 1K9FA 2VZVA 5FI8A 2VJXA 3B06A 2DZTA 3PZQA 3R58A 4MWAB 4HN8A 1CCWB 3B4YA 1MO0A 4OHQA 3NSXA 5F2LA 3APGA 1UWQA 2QAPA 3PNUA 2VRKA 4RDVA 1BGAA 4HHMA 1BRLB 3FSUA 4JY8A 3M0VA 2NVAA 1DEDA 2IQDA 3CZJA 4A8IA 2GSJA 3N14A 4DO5A 2FH8A 3VA8A 2KX9A 1XRVA 1Y65A 1X96A 4OE7A 1F07A 1ZZMA 1F6PA 3RR1A 3PPHA 5EL1A 3EXSA 4O0ZA 2CLKA 3EDJA 4ZQMA 2X41A 3A47A 1UR8A 2DH3A 3D47A 3MANA 3NSNA 2OU4A 1AQ0A 3KUMA 4I6VA 4EK7A 4TIMA 5I09A 5DY2A 5AVHA 2ZVRA 4AIUA 1WAWA 3TOPA 4S1FA 1V08A 5C9RA 4C1LA 5F2MA 4FNSA 4DX3A 1PEZA 5CZ0A 1SO3A 5CG7A 3BAKA 1P7TB 1Q66A 1JFXA 1ZTVA 3BSHA 4GX9A 4JFUA 3WNKA 3M0HA 1UWSA 3H4WA 3KM8A 2VELA 3W9ZA 1RJPA 3VIIA 1ME8A 3G1YA 3IVUA 2E6YA 4P7OA 3SQMA 1K8XA 3R8RA 3SCOA 3L5MA 4BY3A 3DFYA 4F0RA 3SURA 3GTHA 4LPCA 3M43A 3Q4DA 4FXRA 2QAFA 3SADA 5DRIA 1XQKA 2ZKMX 3WD1A 3QZAA 4BF7A 3B0XA 3G1HA 3HQ1A 2INFA 4POCA 3GFXA 3ATYA 1QJWA 1I1XA 3NQBA 1B54A 1QBBA 2YCJA 4PTVA 4AVFA 3SIZA 4S3JA 3B8VA 4Q3MA 5CPQA 1G7UA 2TAAA 4A22A 2OCZA 1CGUA 2O4MA 1JYVA 1ICSA 5IHRA 9CGTA 4MG4A 5HINA 4PMVA 2PDGA 2DUZA 4S3FA 3CC1A 4IZGA 3BZJA 2PC8A 1K70A 2OOGA 3VIGA 1TZ9A 4A3UA 2WMHA 2GOUA 1E4MM 4HCLA 3W7QA 5E09A 3CPUA 2G4FA 1FWWA 3CQJA 1C93A 3WLJA 3R89A 1R3QA 4GYPC 3EBVA 3TZFA 3ZQ9A 2XH7A 3A9BA 4N6EA 2DZXA 3H2OA 4M82A 2ZZ6A 3OYZA 4CQ8A 4E38A 2C7FA 3HGRA 2WJZA 3AHZA 4XKYA 4JIEA 4NY2A 2CLHA 2DZVA 3W02A 2IKHA 3WLKX 4Q8MA 2GPTA 1E1EA 5D4YA 2YYUA 3C8FA 3I3EA 1SO6A 3BAXA 1J4EA 2XM1A 4HCHA 2FVKA 4HU3A 1W32A 4DM2A 1B31A 9RUBA 4DAIA 4JTHA 3POHA 2RHGA 4IX2A 4PUMA 1KQYA 1SYTA 1Q4NX 3OGVA 5H8MA 1GQNA 1MFVA 1IWBA 3SM0A 4Q4OA 3VD9A 4A8RA 3SCNA 4UTLA 1P0DA 4MTVA 4NQ1A 5D2VA 4MKSA 2CLFA 2F6UA 4Q8OA 3RU8X 3AYVA 2XGZA 1PS9A 3QV7A 5AHIA 2PDFA 1TX0A 3MUAA 2NVCA 2XHYA 4AD0A 2Z7KA 1LDCA 1OC7A 5AN7A 1F3EA 4F0SA 4WJEA 1A5KC 2Q71A 4AZHA 3EB3A 1IXOA 1TV4A 5DN1A 3F5JA 1GOMA 2HXTA 1TPEA 3RCYA 4AISA 4L61A 1K6WA 1GTEA 4DXKA 4ECLA 4OTKA 2J7HA 3FX4A 2X0HA 3PTQA 1PDZA 3LTYA 1O95A 5MKGA 1TVNA 2X7VA 5I5RA 3EWDA 3LHYA 3W2LA 1BYBA 1W2VA 4EPKA 4NAFB 3PUDA 1H7WA 4LEQA 3WELA 1VJSA 3GVWA 1M68A 5M5DA 4NXKA 2YCEA 3UNDA 3WNNA 2E9LA 4JZ5A 4GJIA 4M6PA 3WBEA 3AYTA 3ARUA 2XUCA 3VGFA 1WDPA 2BVDA 1OZQA 3FIGA 1VFSA 5BW6A 5G2IA 1F8MA 3RR4A 3WLTA 1WE5A 5EMLA 2JE8A 3ARXA 1YQ2A 5D2YA 1CXFA 5ENLA 3QPYA 2VRQA 1UZ4A 3WQ4A 4JR5A 3ITTA 2NQ9A 4O1AA 3LCIA 1R7AA 2I9EA 3CQHA 2YR1A 5C7VA 4CLMA 4FK9A 3L5AA 3RG6A 3HZ3A 4IGSA 3EMQA 1UWRA 1EDQA 1R46A 1E6NA 1KTNA 5JIWA 4WVXA 1M01A 4J3UA 5I02A 4LJ3A 2BB0A 2X0SA 4LUIA 5DRCA 1LRTA 2PSNA 2A21A 4IQEA 2F84A 2C18A 3ZVHB 4H9VA 2X2GA 4CCDA 1F2JA 3WJXA 4DBDA 2CLMA 2YL6A 2BMBA 1ISXA 3W53A 1DWFM 1Z44A 1ESWA 1GZJA 3O06A 5AECA 1HTIA 2ALDA 1JAKA 1X1ZA 3BSMA 1ISVA 3R79A 2Z1KA 5H8PA 3U5YA 2Z1XA 2E6DA 3OU8A 3B0YA 4Y2WA 3WQOA 3A4AA 4JIIX 3WDQA 4MY1A 2YLAA 3VIHA 5CZTA 3SCUA 3UGVA 3QSRA 3VOGA 3BOFA 3QBUA 3WF3A 4XZBA 1EGZA 4YVPA 3ERPA 4DUWA 1MQPA 5C6MA 1ONRA 1XDJA 4U3CA 1GORA 4XO6A 1BF6A 4KWUA 2PP0A 3MHGA 2V0TA 1QMLA 3IS4A 5H8UA 3DC0A 4PSRA 4C6IA 1G1YA 2Q8XA 1VLWA 1A5UA 4GXWA 1DJGA 1WDQA 3IIZA 4PULA 1DQUA 3WUBA 3H7VA 4WJXA 4PUNA 1NH6A 1KM6A 1PZ1A 2BLEA 1B3ZA 1MMFA 2VT0A 1HG3A 2XZ9A 3DFNA 4DJEC 1SW3A 2MNRA 4NJJA 1XRTA 3CUFA 1R3TA 1KCZA 1M5WA 3W28A 4PODA 4IPLA 3LMZA 2WBGA 4IIGA 2QUVA 3LEPA 3UGRA 1ODZA 2Y2WA 1R8LA 4TUFA 3LV6A 5HPOA 4GK8A 1IGSA 3PP7A 3LXAA 1QASA 3TSBA 4HZ6A 1LRNA 5K4ZA 3WDIA 4Y7EA 5AYXA 4ORIA 2J88A 2A79A 1GVYA 2PDNA 1VLIA 1DJNA 2WJFA 1UKQA 5FESA 1XH2A 4GO8A 3H4XA 1YRRA 2CHRA 1HJUA 1TPC1 4DZ5A 2X1TA 1X8CA 3M4HA 2VX4A 1E51A 2WNZA 4UTIA 1VQTA 3WN6A 3BSGA 4YTRA 2RAGA 4Q7NA 4RR4A 1TE6A 3CIWA 2PD9A 1EO7A 4MIMA 1FCQA 4F9DA 5B7YA 3MI2A 4G7EB 1UIOA 4L4MA 3ALGA 3HV9A 4D6HA 3I4KA 1KCXA 3WQ5A 1NWUA 4FI4A 3VPLA 3KOWA 3LU2A 1WAUA 1TG7A 1XLBA 5BOOA 1HP5A 2VUNA 4FO4A 2A7NA 4C7DA 2ACQA 4KRUA 2E5CA 4H1ZA 4DF0A 2BVTA 3VOIA 1BTCA 5LNSA 4RV8A 3MB9A 4WKHA 1YDYA 4F3HA 3SRHA 4EAYA 3GXDA 1I0DA 1XLIA 4M24A 1X6LA 2X30A 5LKYA 4D6FA 1KGUA 4DWSD 3H6OA 4C5YA 4J3XA 4QQUA 1B30A 2B7OA 2OKTA 3DG6A 2A3CA 2WV8A 2AL2B 3G22A 4NRSA 3QR0A 3T8LA 4U5IA 4Z2GA 2PB1A 1UD6A 1J0KA 3BLFA 1YBQB 1XWYA 2YBUA 2GVEA 1QUMA 4P61A 3BMXA 4AX6A 1W3LA 1CXKA 4QDPA 2CITA 4R5EA 2VC5A 1VPYA 2X2YA 3QV9A 1E9IA 3PPGA 1FOBA 1XCXA 1P48A 4I6KA 4OV9A 1J18A 3B04A 1F4AA 3SR7A 4PSPA 5HA7A 1PIGA 4K1GA 3EWUA 5LGXA 4F4RA 2Y1HA 2BHZA 2WVVB 1WKEA 1N8WA 4US6A 3FJLA 1C9DA 3THQA 1PX8A 5A8GA 3LPOA 5FD0A 3N73A 3IUHA 1ZAHA 1E56A 3H54A 3DFQA 3EA1A 4MZ1A 3MSYA 2J24A 4P8UA 2Y5SA 3STGA 2XIOA 3GFZA 1LTDA 3QHNA 2ZX5A 1PZ2A 3G8EA 3MUCA 3U2EA 3VMPA 1DXEA 1W3HA 3IRSA 1UW9A 1RPKA 3PWGA 5FJRA 3ZT7A 4PTWA 3UW6A 4AIBA 1Q7QA 1VYSX 3BPWA 4L7ZA 2ZRZA 3NQVA 3T0DA 3UR7A 1ONWA 3M0ZA 1UBSA 1OCBA 4JXCA 4GYFA 4IXHA 1UD2A 2ZADA 4NJIA 3GVVA 2FTWA 5I03A 3SGUA 2DORA 4QTGA 4KIRA 4J3WA 3HPSA 1S5NA 3ZYZA 2GWGA 1PVNA 3VMOA 1VFLA 4JY9A 3VOJA 2OLAA 4MZ8A 3UWWA 3LHVA 5I6SA 2FDSA 4PUEA 1JGMA 4RE0A 4XVEA 1EGMA 4QE1A 4IIFA 1QK0A 1ONXA 2QT3A 3GU1A 1X1NA 1THFD 2Z1BA 3QEZA 4C91A 3JS3A 2D0FA 1PTAA 2YA0A 4UNKA 3GG7A 3SN1A 3AS1A 4GY7A 4H8UA 3TLLA 3DGRA 1GOOA 3A12A 3G1DA 2J62A 5A6JA 3U48A 3WH8A 5CC3A 3NSMA 4CU8A 4UIOA 4CN4A 3H22A 3I6EA 2BHUA 4MDPA 1MWOA 4DPQA 1OYCA 5F1VA 2JGYA 1G4PA 3KBNA 4LNYA 5CZJA 3L0GA 4YTSA 1EF2A 1JIBA 2CBVA 5DELA 3L21A 4HU4A 5JH2A 4FPSA 3MKCA 4WGXA 2V6AA 1M7OA 4N9DA 3WEOA 4JX5A 3TONA 3WF2A 1Q6DA 3T0TA 1JZ2A 3ZJ8A 1PO9A 3EAUA 3ITCA 3SCVA 3EEGA 3CS2A 3TVAA 1V77A 5HUPA 4B2DD 5I06A 4O16A 5KZ6A 4CNUA 3EEZA 4MGGA 3W1XA 4TO8A 2WLYA 3QMRA 1DJHA 2XIQA 1SSDA 3E0IA 4LUYA 1DP0A 3DBPA 4DEFA 3M7SA 1GYMA 1DXIA 1NARA 2ZUVA 4B5TA 3KOXA 3BDKA 2W62A 3W6LA 2J7FA 4OOZA 1SU5A 1DWGM 4AZ5A 3QHMA 4ZQCA 4GMEA 1AJZA 3EB4A 1LP6A 4UTFA 2ONEA 1JI2A 4W87A 1BWKA 1TMLA 1V3LA 3G6MA 3EA3A 3W87A 3BW4A 4I9JA 3W85A 2HRWA 1QK2A 3CAVA 2GLKA 2XFFA 2C0AA 2PEVA 3H55A 1PCKA 3SCSA 2ZZ4A 4QM1A 4A6GA 1GG1A 2R1PA 1IHIA 1XYMA 1ME9A 1F3TA 3VDBA 1Z89A 3EOSA 3CUJA 4KCWA 1J96A 2J74A 1XIIA 5AC6A 3GK0A 5F2IA 1UPPA 2AQOA 2WZIA 1LF1A 2PDXA 4TTUA 1IIHA 3TTSA 2WMKA 4YMZA 1AL7A 1OYBA 5LNWA 1B5TA 3IWPA 3EKGA 3KEHA 2XH4A 4FX8A 3RJXA 4FSAA 1R30A 4W88A 1YKWA 4NRRA 4MUPA 4HPGA 3TDFA 1XQLA 3PHAA 5CPLA 1X7FA 1J8VA 2ZVIA 3B9AA 1MEHA 2CLEA 2D1ZA 4MY9A 1Q7ZA 4M29A 3VZZA 1W3IA 2E4TA 3GXIA 3DGBA 1R2TA 1FWDC 4O15A 4Z1AA 3P82A 3N12A 4D8AA 2DW7A 3R6IA 4PBEA 2CZFA 1Y7VA 2J13A 3S8HA 4DHGA 3IJLA 3MMTA 4GCXA 5AYYA 4NG3A 1EX5A 1XLCA 1TJRA 2QDDA 3W00A 3WD0A 3KDNA 4F2TA 1ECEA 1FCBA 5D38A 4DN1A 2OLHA 4PUDA 5KITA 1TUXA 1DPMA 2ZWYA 4EX4A 2X42A 2BGNE 2JEQA 5JBFA 1DIDA 1E9YB 3Q45A 1AMYA 4LB3A 3GXTA 4LH8A 4H7VA 2XSAA 1YX1A 3W7RA 1LUCA 5E6ZA 1QI3A 1F9CA 4QRNA 1RALA 2DIEA 2F2HA 2W66A 4XSMA 1E1FA 3N34A 3BVJA 3O07A 3DN5A 1SQ7A 2ESCA 2WHKA 4XBJA 3UP8A 3GX9A 3WH9A 4W7WA 1A5SA 2XIMA 2HZGA 3R2GA 2OG9A 5H91A 4S23A 1MQQA 3WLRA 3AO0A 4NZ3A 3ARTA 3GU2A 2IKGA 4Q4SA 3SRFA 2X8RA 1SGJA 3I3BA 3N2CA 4S3AA 3GHRA 1OVDA 3WYZA 3M0LA 3KBMA 3W07A 1JD7A 1OG6A 3VU2A 2NXIA 1Z9AA 4ADSA 4Z17A 8XIAA 1EJ7L 4XO7A 3PBWA 2J6XA 4DWSA 1J10A 4O52A 3RK8A 4KQNA 2B4GA 3S1XA 4TTGA 4P2VA 1HJWA 1LBMA 1RZMA 1TVPA 4M6QA 3THAA 4ZO9A 4F66A 2PZ0A 3GNNA 4IGNA 5A2CA 4GNVA 3FSTA 2QDEA 4PMJA 1HKIA 4NI8A 5HXMA 4ZENA 3AUOA 2DW6A 1S1PA 1NDWA 1JCYA 2RDWA 3T78A 2O0TA 2WC4A 4XAGA 1VBGA 2D20A 4M51A 4OFCA 5HR6A 3G1SA 2V3EA 4UMBA 3A13A 3HG4A 3SN0A 4XD5A 1P6BA 1IV8A 4AZCB 3N1AA 2J8GA 3S9IA 3S5YA 3PZGA 4BWLC 4O53A 3UJRA 4Q7IA 1GYNA 4PTDA 4HMNA 3ZT5A 2PD5A 1ZP4A 4Y9PA 3B8DA 4D6CA 1QNQA 2NX1A 1BRLA 3KVKA 1MUCA 4CU6A 1SSGA 2CW6A 3TC3A 3K1GA 1OBAA 4FXJA 2PZNA 2ZC8A 1I60A 5A2AA 4WY0A 4DJFD 1EDGA 3QN3A 1J0JA 3OZYA 3OODA 2Z1VA 4UQCA 4HT3A 4AC1X 5LSMA 2EPKX 3W24A 3CMJA 3UWVA 4JN7A 2PWUA 1CXEA 3S5NA 1DE5A 3BLKA 1BD0A 3ZR4A 2VWSA 4B5UA 3O1NA 3W7IA 4A3YA 1FDZA 1XBVA 3USBA 3GG0A 1O60A 2I17A 3LLDA 3TLQA 3CT2A 3A6OA 3DG3A 3MSGA 4GHRA 1F3WA 1UZ1A 3RO8A 8CGTA 2ABAA 2YIHA 2Z29A 1YE6A 2EBNA 4F0LA 4BR1A 2D0HA 5ABHA 3GXMA 2ZZ3A 1C8QA 2V2DA 1QNRA 4AG0A 1C29A 4JICA 2D3NA 4ZCWA 1KA9F 4FX7A 3UEQA 3JRKA 3GE7A 5FEZA 3CPGA 1XH0A 4IP7A 4NZCA 4JTJA 5CZKA 2WVSA 3BICA 1A3HA 2XFRA 4MVAA 3O3RA 2FFCA 2B31A 2JF6A 5M3WA 3IGUA 2WB5A 1QRQA 3T8QA 3MKKA 4KFNA 3S47A 3A5VA 4B5VA 4J3ZA 3NQMA 3PZMA 4DNHA 2ZXDA 1SZEA 2WJDA 1VGAA 5C0QA 4IG2B 2OQLA 6ENLA 2DQXA 3QQ1A 4HTYA 3W73A 1VCGA 2QUTA 2X40A 2C16A 2Q3OA 2QIWA 1X8FA 4QNWA 1EJUC 3WQCA 1HN1A 3W22A 5I3HA 3WNOA 3GIPA 1NWSA 2SFPA 5EPDA 4KWVA 1KLYA 3SN4A 3TW6A 4NZJA 4QG6A 1E43A 3GZAA 3LCHA 3PNZA 1JAEA 2H9AB 4FOUA 1EZ2A 3PUGA 3TTQA 3UG8A 1XP3A 3BCJA 2VL4A 4HNVA 3PG9A 3H4GA 4X9SA 4BKNA 3URAA 1EBHA 1UWTA 4OT7A 1AFSA 1VPQA 1ONEA 4A2RA 3LPGA 4C1NA 1FFRA 4B2DA 4QJ4B 1FP8A 1ITUA 3GBDA 2Z1WA 4AD1A 1P1XA 2IXVA 3AUJA 3VOCA 4AYSA 1S5TA 2P1FA 3LCXA 4RE2A 3VC5A 2F7FA 2POTA 2R6OA 3SB0A 2VD9A 1KBIA 4GFSA 2VVSA 4ZE4A 3P93A 2JBMA 2QMJA 5C9ZA 2BGQA 1E3XA 3N2MA 3LMYA 3NXFA 2W0UA 4JCMA 3LDVA 4INFA 1O4UA 1EJSC 2VYOA 1BGGA 3MUZ1 4NILA 1IE7C 5I3IA 2BY0A 1VD6A 1IEXA 3A3WA 5IM51 4JQAA 2R8WA 1DVJA 1KWKA 5TQLA 1RPXA 4W8AA 2PBOA 3WQGA 2YBVA 2E5BA 4NIRA 1FHUA 1JCXA 3EB2A 1I2NA 4Q7BA 4W84A 1H11A 5DBTA 3USZA 2CHOA 3KBJA 3BMVA 3M1ZA 4ZFCA 5E70A 2ISFA 1UC4A 3C3NA 3W71A 3KDOA 1DWIM 2H8ZA 3P14A 3W76A 3OLDA 1F4HA 2WSYA 3TMLA 1XIHA 2Y5JA 4ZO6A 1Y5VA 1NQ6A 1LL6A 1ZAIA 2QIIA 1XYCA 4ZXLA 1EUAA 2XN0A 4WSJA 4IOTA 4KWSA 2HVOA 4JTAA 1J9YA 1OCNA 1NF0A 3DCPA 1V6XA 1E6ZA 1UMYA 1WKFA 4E4PA 4NAFA 1EPVA 2PF8A 1TA3B 2ALRA 4Y9MA 3DI1A 4CNPA 2Y8VA 4UQAA 3IJQA 2Z0IA 4I5RA 3TR2A 4WIWA 4PYSA 4CCCA 2E7FA 4FLQA 3KCJA 4N7QA 3C6CA 4FF5A 5AZ1A 4DQWA 1X98A 1EBGA 1TREA 4YWIA 3TKFA 1XBYA 4LAZA 3IVTA 1L8NA 1IR2A 3H2EA 2CEQA 2OPJA 3C0LA 3H2FA 1KB3A 3B3DA 4GUJA 2VVNA 2OYKA 3E9AA 3L4WA 3EWWA 3CQIA 2A85A 2VZSA 1C8XA 4LYKA 3GUGA 3I6RA 4LS0A 4Z0JA 1VFOA 3EOEA 1EGVA 4NL1A 3F4VA 2V5KA 5D03A 1Q45A 5SWUA 4RE3A 1AVAA 1KXHA 3WO8A 4E8DA 2W6RA 3WFAA 3PZTA 5G4HC 3MDUA 4AWTA 1T8XA 2VWTA 3S42A 1N2VA 2OZ8A 1VPXA 3BLOA 1U2YA 4RW3A 1GOXA 4F0HA 2PDHA 4R3UA 2P8CA 3JUGA 1BSIA 3H2AA 2FHFA 4YXGA 4PTNA 2ZBTA 3N2TA 4NAEB 5IFPA 3L4UA 2HBXA 4D6DA 4ENLA 3MZNA 4UFJA 5FF7A 2QS8A 3W25A 3CUIA 5I3KA 4XUYA 1GJPA 4E3VA 3TN5A 5G1MA 1HL9A 4PA8A 3VIPA 2V2HA 2J7CA 3OQ8A 4FIRA 3S6OA 2WSPA 2X1IA 1DBTA 3L4ZA 4PTMA 3DX5A 4Q8UA 3HGJA 3F4NA 1YADA 3ZLHA 4WK9A 4LWWA 3C0SA 3FOKA 4KEZA 3BAYA 5AYBA 3VM7A 4LS1A 3JW7A 2ADAA 3TCEA 3LRMA 4AFYA 5CGTA 2DVUA 1OX5A 1NU5A 3N2XA 1AD1A 3VGEA 4UFMA 3ABZA 2NT0A 5I23A 2NXGA 3QV6A 3V7PA 3BARA 5LIUX 3OG2A 3GHSA 4MB4A 3T0BA 2EGZA 3WLMA 4JQ2A 3ZLGA 3OQEA 3AJ7A 1VIZA 1PX3A 3MPGA 4KFPA 3MBDA 4LAOA 1ZPTA 3MUXA 3PAOA 2NT1A 1S46A 5ECVA 2FJKA 4GC4A 3AHYA 1JZ7A 2DT1A 4E4UA 1VFFA 2DU2A 4MZYA 2I5QA 5BRQA 4EF8A 2XWEA 3N4EA 3WCZA 2XG9A 1IEQA 3GVRA 3KHDA 1GOKA 4RZ4A 1TTPA 1W3TA 1MQRA 1XISA 2NQLA 1W9PA 3IGXA 3W1UA 3MO7A 3E0FA 1HQTA 4H8HA 1ZFJA 3AALA 4E8CA 3CU2A 3LCFA 4JTGA 5A6TC 2FB3A 3RRAA 4DJFA 1XLDA 2XYLA 2I16A 2ZUUA 2CLIA 5AYZA 3U7VA 2WKGA 4PZVA 4W93A 1J0HA 4JNMA 4O8RA 4JTDA 4ACZB 3ARZA 4EANA 4K7VA 3T40A 3MJMA 1UUQA 1KV8A 2VUYA 3TXZA 4KKXA 4GNKB 1KFJA 3P74A 5GVJA 2YB4A 3DEQA 3OVGA 1P5BA 3PBUA 3UF9A 4FXFA 4L64A 2Y62A 1FRBA 4MNLA 4ZFMA 2A2IA 4GPNA 6XIAA 1PTDA 4GUFA 4DPPA 3UR2A 1AD4A 1QNOA 1PSCA 2I1OA 5C2XA 1HVQA 3GHTA 1NEYA 4KRTA 1YDOA 3RM9A 4X2PA 2QV5A 1I2PA 1MSSA 3RITA 3TJXA 2FZNA 1NTHA 4UTHA 3EA2A 1QPOA 4H9UA 3FN9A 4MSSA 3AOFA 2R14A 3NDZA 3K30A 3ITOA 5KETA 4IQLA 4OUEA 4XKMA 2GK1A 1OCJA 3CHFA 4YTTA 2IMRA 4K3ZA 4HSHA 3VXGA 4LXFA 4N0RA 1RY8A 2J77A 3S2NA 3W01A 3QY8A 1OM0A 1G0CA 5C71A 1E0UA 3WX7A 5BU6A 3K4WA 3K8MA 1EWEA 1E5NA 1YXCA 1BYCA 1MXDA 3PZNA 3U4AA 1HKVA 4MWAD 4K8HA 2YZ5A 3GG8A 2PLKA 4GZIA 1CT5A 3QSTA 5CBIA 5GJPA 2X0YA 4JTEA 3EKZA 3B05A 4WKFA 1IR1A 1FWBC 3PB0A 1AZ2A 1Q13A 3U8GA 2KZHA 1UIPA 6REQA 3VKCA 1QOQA 4REQA 2VFGA 1D3HA 2PDUA 2Y0FA 4GKLA 3TX9A 1OGBA 2GJRA 3NIYA 5EMJA 5EKYA 4S3GA 2GL5A 3KOZA 1YLVA 1OX4A 5T91A 1JF5A 1A0CA 5I7GA 1LQ2A 4A2SA 5JIPA 4Q4MA 1SMAA 1ZBWA 5HNUA 1FX6A 3GC4A 4TX8A 4UCGA 3F4CA 5CGMA 1O5KA 2OGYA 4US5D 3CJPA 3M0YA 3FKRA 2GFTA 5AVNA 2P10A 1M7PA 3IUIA 2GVGA 5DF0A 3PFMA 2XWDA 4C7GA 3GKFA 4I9TA 1TE1A 1UH3A 2VZUA 4HMDA 3QR1A 4W9TA 3CUHA 2ZIDA 4W7UA 5LYRA 1RHCA 3EXRA 4O1CA 4HPHA 3W7CA 3S1VA 2HWGA 2J6VA 4XKYB 3E0WA 1JPIA 5ABGA 3U2ZA 4FOKA 3FJNA 1QHZA 3WH5A 1R47A 4DIAA 4UUIA 3W38A 3KS5A 1DJZA 2XH0A 3A64A 5FKYA 2VOMA 1LLZA 1UKOA 1OIFA 4NJKA 1TRDA 3C2EA 1Z48A 5HDRA 1JYXA 4PR4A 1UD3A 1IXPA 2DT2A 3NL5A 3MUY1 3NQ6A 5AHMA 4NZ1A 3NO3A 1JCNA 2OYLA 2BP1A 1YNQA 1TRIA 5HQMA 2WC7A 1YPFA 4J1OA 3RYSA 1HNYA 4IPNB 3W1NA 2GJNA 4N4QA 1EXPA 1DTUA 3DIPA 3IIXA 5MHBA 3EXTA 2VX5A 1VCFA 3HB9A 1OT1A 4MB5A 4IUGA 1QAPA 1L6SA 3TU9A 1NQKA 2W3ZA 3MJYA 1G4EA 1GTHA 3RMEA 4HOXA 3CAKA 3ZJ7A 4B90A 5MKGB 1HIZA 2QJGA 4JTLA 1QFEA 3QZEA 3NZQA 1TV7A 3OVRA 3T7VA 3W75A 4M19A 1LQAA 1US2A 3VCCA 4KFOA 3NQEA 4L56A 4JIRA 1H2JA 1PL9A 5BXRA 1DJYA 5FJTA 1PCWA 4AQLA 2F2KA 1RP9A 2JIWA 4YVXA 2GQAA 1TTQA 1EZWA 4X60A 4URIA 1M65A 2FB2A 3HQNA 2ANUA 4AX7A 4Z2JA 3BW3A 4XVDA 2J78A 3V3WA 2IPJA 2J7BA 1CB2A 1EX1A 3DAQA 4OWGA 4YLWA 1Q4WA 2A4AA 3NUKA 2RDTA 3GC2A 4IJRA 1QOPA 4IP4A 4V28A 5FAJA 3MP4A 4C65A 1J6OA 5BXTA 1XGZA 2RDXA 2OQYA 3AROA 4RK8A 3RILA 1VEMA 4QJ1A 4JKKA 3GYCA 2H3DA 2BG5A 2ASHA 4ZVJA 1O7AA 3GO2A 3KTXA 3WK1A 3SY1A 5FF0A 2WM1A 3P5ZA 1J0ZA 2DIJA 2VFHA 3CLMA 3VIOA 1T41A 3LK6A 3PWAA 1AL8A 3B4UA 3FY1A 4MWAE 1O68A 1LL7A 2HEJA 4GIYA 1UWAA 1LOQA 1XDMA 6XIMA 4RX0A 3PJWA 3TYUA 4Y9NA 4AHOA 4R85A 3M46A 2Z6IA 4UXDA 4C90A 2GVYA 4OU1A 3ELFA 1CXHA 1UD5A 2YFOA 4RNIA 3K1DA 3VX0A 3DYPA 1O5XA 3OEXA 4K1WA 3S6DA 3QC0A 3W2NA 3V5CA 3AMDA 3O8AA 1UMLA 3CB3A 1HL8A 1MW3A 3GUWA 3SCTA 1P0NA 3AAMA 4ICNA 1O94A 3KBWA 2DSVA 3KP1A 2VFEA 4FNQA 4Q32A 5K9XA 3RDKA 1H3GA 3NCOA 1J0IA 3LD5A 2Z28A 1BHGA 2F8QA 7ENLA 1W5PA 4TMBA 5EGRA 1AZ1A 3STPA 1AH0A 3N6QA 1E4IA 5ABTA 1CB7B 4MWAC 1QOXA 5LXXA 4Z2HA 2XN2A 1FWTA 3NM3A 2OO0A 4UR9A 3N9SA 4LY8A 2C1GA 1SFLA 3LLFA 5IRPA 3RLGA 4NF7A 3VD3A 3WUFA 4H6KA 3UY8A 1JDAA 5BROA 3NURA 2REQA 3W74A 4DELA 1H50A 2X09A 3M0KA 1N55A 2PU0A 4KWOA 3M0MA 4I9MA 3OJGA 3VZXA 1KM1A 4A3RA 1DIEA 2QJIA 4WDXA 4L6OA 1KCKA 2ICSA 3GVQA 1KXTA 1JULA 1AH3A 3VNIA 2ZA3A 2BY2A 1SM9A 3HFTA 2ZFAA 3MTWA 1R7OA 3UR5A 4NP7A 1R3YA 3W1TA 2CXGA 3C61A 1E0XA 4R9XA 3IV3A 4LUSA 2PGWA 3SRDA 1QR7A 3UWZA 3HO8A 1YDVA 3A21A 2D22A 5HR7A 3R94A 2DP3A 3FVMA 2VFFA 1QVBA 4MB3A 2X7WA 3KRSA 1JJKA 5JU6A 1BXBA 4QAIA 4MKVA 3MWCA 2E68A 3R25A 3AHXA 5AHFA 4PTXA 1F05A 3ZZ1A 3O2LA 4RXFA 2ZDSA 1IZJA 4ICMA 3TTEA 4H4IA 5FJUA 2EHHA 2ZZ2A 4WZHA 3ZIZA 4IH3A 1MDLA 3HGSA 1L2QA 3GDRA 4D8LA 4EWND 2G5WA 2XDFA 4J4KA 3EX4A 1JDEA 2FVLA 1K7FA 2OFJA 1Q6EA 5E5CA 1PKNA 1RR2A 1QI2A 4Z08A 3VKDA 1I8JA 2VENA 3VDHA 3VKJA 4EXQA 3U5UA 1XIFA 1J11A 4L9ZA 1AW2A 3U4FA 1JRBA 3GDMA 3OGSA 3E2SA 5AHEA 1XUZA 3M16A 2ZICA 5LIYX 4QJ3B 3QPZA 1FDJA 3GVGA 2DVTA 4NASA 2OO6A 4D8ZA 1ZHAA 4N9CA 1RVKA 3VKBA 2WZMA 1TPUA 2PWHA 3N9RA 1ZJHA 4KT2A 2XINA 1K7XA 3CUZA 4QDMA 4UOJA 1WDDA 2CESA 1UD4A 2GGIA 3W1MA 4US5A 5KEZA 2CBJA 2PDKA 1YXDA 4TV5A 1VRDA 2IPGA 4DYKA 3N6HA 1FH7A 1VEOA 3P0XA 1RJRA 5TF0A 4HNNA 4KF1A 2ZUMA 3TA9A 5HNTA 3UNTA 4M5PA 3VZYA 1RCQA 1ZP3A 2W9MA 3GNOA 4ZB2A 3TA6A 4C6DA 1F73A 3NQ2A 2QYGA 3EMZA 3F7JA 2I56A 1UP0A 3ARSA 4AD2A 1WDRA 3C8NA 3V18A 4G1NA 4RZ5A 3NPWA 2G3IA 3H21A 1OD8A 3SO7A 1V51A 3UZXA 4PMOA 3HFYA 2Y8KA 3FJ4A 4DVOA 4EPDC 2DVXA 3WFLA 3WBAA 1K4HA 2V8ZA 3WK0A 1A3WA 2FIQA 2YCLA 2NUWA 4FOJA 3AJXA 4K8GA 4GJ1A 4NXSA 3UXLA 3ABOA 1CGVA 1UR3M 3ZWSA 4GRSA 4FB7A 1TV8A 4JTQA 1W9UA 4CD6A 1XR2A 3GKAA 1K1DA 5LA1A 2O9PA 2GDVA 4QCEA 2V38A 4UQDA 1W9DM 1S2WA 2VCCA 4IG2A 4QR6A 2OWXA 1EWDA 1MDRA 4GABA 3W72A 3OA3A 5AY7A 1VYPX 1OD0A 2XN1A 3EOUA 3GU9A 5D2TA 3R10A 5REQB 1K9DA 3MZ2A 3NJ3A 4IMEA 3RM4A 4DBSA 4MUZA 3W7GA 3UJFA 4BHYA 5EMMA 4BQ3A 4E5TA 5L9FA 3ANUA 4LVBA 4GIEA 4DUVA 1LORA 3GIYA 1TUFA 4HSNA 1V3HA 1VR6A 2DIKA 1EP1A 4PUUA 3KW3A 4IISA 1TZ7A 3S9ZA 3PS7A 2H9AA 1EJXC 2A6LA 5JVLA 2V3FA 2PGFA 5CJNA 3UFYA 1V6WA 3OIXA 2I9UA 5FSDC 3GR8A 1BWLA 4M6UA 3OG3A 5D9PA 3MO4A 3RO6A 1OFEA 3TQKA 2NQJA 1W5OA 2OB3A 1CTNA 4M7SA 3V35A 4JYFA 3M5VA 5CBJA 5HQEA 4EXBA 4GI9A 3KCOA 2Z4GA 1VAHA 5DT5A 3FA5A 5HQLA 1O12A 1OCQA 2OWWA 2WMGA 4AB4A 1OG0A 4OIFA 3PJUA 1FP9A 1U5JA 1W9BM 2OTDA 3CK5A 3BK0A 1QNSA 3TH6A 2Z24A 1W54A 4IFKA 1UB3A 3TSDA 3VVGA 4LVDA 3A5FA 4QX4A 9XIAA 5GQBA 4GXPA 4D1JA 1XLMA 4LRTA 2PTWA 3A22A 4V27A 4Q4QA 3W86A 3SUTA 4QIUA 5K9DA 1Q6QA 2Y7EA 3IIOA 3LM7A 4DLFA 1PWMA 5G5IA 2R91A 1CX9A 2XTKA 2VKZG 3K5XA 1Q8AA 3BAJA 3PFRA 4PMUA 4EF9A 1XXXA 4I8YA 3F2DA 3EDDA 4AEEA 4MJ4A 3IV8A 1C7SA 1AODA 4UTJA 1H63A 4DI9A 1X6UA 2WAGA 4MMWA 2Y7DA 3W3OA 1HJQA 2ZRUA 2VEPA 5C55A 3PK7A 4JN8A 3UCDA 1KKRA 1R5YA 1XD1A 2YJQA 1G9HA 3C2RA 4FXSA 3W2KA 1A50A 1ZJAA 4L1WA 3CT7A 3NTYA 1TPVA 1PHWA 4LW7A 1G6CA 1GZ1A 1BVZA 2DPEA 1UBPC 3OW1A 1J5SA 2EAWA 2D3LA 4UWMA 5KINA 3A9IA 1SR9A 3PANA 5D05A 1H49A 5LHEA 2P5NA 5DMYA 1BG4A 4XSLA 3NQ7A 1RCXB 8RUCA 1ZJIA 1BG9A 1FXPA 4B5NA 3QY6A 3CAQA 1UZDA 4MM1A 2HVNA 4KCTA 1RD6A 4DNMA 2QUUA 2OGJA 1BYDA 3MW7A 1LT8A 1VFHA 2INZA 1AW5A 4S2BA 5EMKA 3LCGA 3VIFA 3LSBA 5I0DA 2NWSA 4KIEA 4QE4A 1JDFA 4AIOA 1VFUA 2WSRA 5DX7A 3GNXA 1QHPA 4ROQA 4ONVA 5FF4A 2VX6A 2GQ3A 1OYAA 2QCDA 5C9XA 1KXQA 4FEZA 5AFDA 3SUUA 5A69A 4HHHA 1K9TA 3O63A 3IPWA 6CGTA 2F38A 2OVLA 2YX0A 1V0NA 4U10A 1GPFA 3IANA 1XIDA 1DJWA 4U28A 1OADA 3ZR5A 2C1IA 5I2UA 1C92A 2EKGA 3ES8A 4G6CA 4MNJA 4NAEA 3PTDA 1KQZA 3HG2A 3UWYA 1KD0A 4GIAA 1A0EA 1W1ZA 3G0XA 1KM3A 2VC7A 2DSWA 1HUVA 1RD5A 4GKTA 4OJYA 3W1RA 1W1IE 3R0UA 4AMAA 4GUGA 1R2RA 2J27A 1WBHA 1R9ZA 3GLCA 1TPH1 2NVDA 2FGLA 3LNPA 2P3EA 1T5AA 3CMGA 2BS9A 2ZRYA 1GUVA 3L7RA 5DCBA 3CB8A 3W6YA 1ZB5A 3L9CA 3KP0A 1X7IA 3V16A 2QCFA 2E8YA 3L4VA 2ISVA 4ZE5A 1KGWA 1A0DA 2PDCA 3FXYA 1EP2A 4Q33A 1UH2A 1U33A 2G96A 1O5RA 1UJPA 4PMYA 3WDJA 2ISSA 4RCXA 1KC7A 2Y7GA 4DWSB 1I1WA 1W1VA 2YXGA 3CEPA 4N02A 3SCRA 2HE5A 3TCSA 2DGAA 3WUEA 4DJDD 1EB3A 4ALDA 4OQVA 3TYDA 4XBSA 1U1JA 1SJCA 3UPWA 2OODA 4HK6A 3PZOA 4XZMX 1TTJA 2E8ZA 3EDFA 1HO4A 1AK5A 2GYIA 1JYNA 3LERA 2BVWA 1W91A 4ADTA 5IBXC 1EJRC 4H9YA 3W7DA 3BQ5A 3ARRA 3OHMB 4XAZA 1CGYA 1MI3A 3IARA 3KBSA 3M5YA 4LGXA 3NQDA 3B9DA 3M44A 2ISWA 4JTCA 4XV0A 3QZ6A 4M8UA 3B9NA 3D6NA 3BAWA 2HK0A 3QOMA 4JQ1A 1QW7A 3WQPA 1SZNA 1GNXA 5D9OA 1YPXA 4MFEA 4ACZA 3ZXWA 5B80A 3L0NA 5DY3A 4BZYA 3T07A 1ZS2A 3ZOAA 4AWUA 8A3HA 3VABA 3A4XA 2HPIA 3L68A 1F61A 5C5YA 4WY0B 2PPGA 2ZX8A 1MXGA 1D8WA 4MAZA 1IYXA 3AXHA 3NZPA 4E0CA 1GCYA 4Z0SA 2YDRA 3GYEA 5FJIA 1PKMA 3B8IA 3QKZA 1ZJBA 4D6JA 2TYSA 3WLQA 4G1KA 2E67A 1KM5A 2VEMA 3RLVA 2QULA 1HGYA 3E49A 3AS3A 3W2MA 5JUVA 3B03A 2HBVA 2QF8A 3MYOA 4JKLA 1GK8A 5D8WA 1TTIA 1D3GA 3UY7A 3NWRA 3HURA 1XUUA 4B4FA 3AYRA 2OLSA 3FK4A 3WEZA 3WZ0E 3CM4A 5CAHA 3DFHA 3M41A 5K9CA 1TR9A 3AIVA 4AEFA 3C2VA 3H53A 3TYEA 1WO2A 4DJED 4Q8VA 5I78A 1UQYA 3AMLA 4JPGA 4LQ1A 1BYAA 2DZBA 5D09A 1E70M 2ZCGA 1TMQA 4O10A 3V0SA 2C14A 1OGGA 1WDSA 3O0FA 1G69A 1FHLA 1XW8A 4JCLA 3VKKA 4NVTA 3WLSA 1XIGA 4YYFA 3ABRA 1H7NA 2PMQA 2HE8A 2EPNA 3VFCA 2GUYA 1US0A 1LWIA 3IAQA 3NVTA 2R1LA 4XG1A 1BKHA 3DHPA 4M80A 1K8ZA 4HA1A 1WNOA 1K77A 2NUXA 5HUOA 1K9EA 1XYLA 5M1TA 2OWCA 5HMEA 2OOFA 3VGDA 3GH5A 4XZNX 1MW0A 4AZ7A 4K8EA 1QI5A 3VNKA 3LQGA 3EWXA 2B7PA 1E73M 4MPQA 3GXFA 3T44A 5KSWA 3UZWA 1H0IA 1QT1A 1MEWA 4LANA 3QM3A 1NJJA 2PWVA 3RX4A 2IPFA 4E6MA 4C1NB 3POCA 1PWLA 4LOCA 4FMVA 2BY3A 1JZ5A 1L6GA 1DOSA 3QR3A 3GR7A 1QPNA 1Z32X 2AQVA 5C9WA 2RJGA 4C6CA 4I7WA 4NX5A 1DJQA 2QGHA 1E0VA 1KW1A 1KCLA 4OBRA 1PKLA 1E72M 1RK6A 2JK2A 3NO1A 3VINA 1AMKA 2NW0A 1OGSA 1S5WA 2AMXA 2AL1A 3E6EA 4GYKA 1AG1O 1V7AA 5DT7A 1EFZA 4XWUA 1BAGA 2ZQ0A 1P0EA 4IIBA 1CEOA 2KAUC 3EPNA 4DAFA 4ML9A 4XD4A 3IAPA 3QYQA 3SJNA 1XYFA 1FA2A 2PTYA 3LHTA 3MSRA 4GO9A 5GNZA 3N18A 3QW4B 2WQDA 3NO5A 5DQPA 3KL0A 2TMDA 4AZ6A 4PFHA 3ID7A 3UCQA 4PCTA 3W82A 4DUXA 2DJXA 1B3YA 2DZSA 1GEQA 1HFBA 2V2CA 4CNSA 1X39A 3F03K 3AQUA 1A49A 1G94A 2WWDA 2P53A 4KPLA 2FMOA 3VIJA 2ACUA 1GVFA 1VJIA 3ZVIA 4AHPA 1RQBA 2DSZA 3NZGA 3PVFA 1SJAA 4GYPA 4YN5A 4HOWA 1GT8A 3UT0A 4YVVA 2A3EA 4V1YA 3KRUA 5EA9A 1DV7A 2GJXA 4DO4A 3RNDA 4AY7A 4BEQA 4A29A 3V5FA 2HPMA 3BG3A 4LBSA 1ICQA 1NWTA 5EMUA 3EX2A 1NDYA 1VIWA 3DESA 1SW0A 3GG1A 1YNPA 3PWIA 4S3KA 3GXNA 4W8BA 3WUGA 4DJDC 4FS9A 2QF7A 3DHDA 4F48A 3STFA 4UNLA 2HDJA 4DF2A 2GQ8A 3COTA 3TW9A 1O6IA 1VBHA 3SEPA 3VD4A 1V3IA 2AAMA 3GFYA 4QS6A 5HWJA 3WQEA 5D30A 3FNDA 3AXXA 1UG6A 1PV8A 2NQ5A 4ZSTA 4E4FA 2YGYA 1XIEA 4QNEA 2YCIX 4G7FA 3T55A 2WVTA 1EF3A 1H0GA 2UY5A 3DFOA 4HNOA 2E1DA 5FAGA 1EEPA 1WYIA 2WNWA 1EQCA 3N25A 1HO1A 3L23A 4GUIA 3ZFHA 5JQ9A 1J93A 4DF1A 2NSOA 3P61A 1GONA 5F2GA 4G5DA 4U33A 2NUYA 3EWYA 1G7VA 2ISDA 5IOBA 2OSWA 3R1ZA 1P6WA 1TJ1A 5E6YA 3U9IA 5I3JA 1FKWA 3A3XA 1DXFA 2ZRXA 1JQVA 4A4AA 2UY4A 1F3XA 4FLRA 1DWHM 4PCNA 3BGAA 4JTFA 4GQRA 1R3RA 4H00A 4H7CA 4RUBA 2WK2A 1NSJA 4HYWA 1JCTA 4FNPA 2A6NA 4HIBA 5HAOA 3ONBA 6A3HA 5F4WA 3B8WA 4UR8A 4YHEA 2PDYA 4TMCA 4M7TA 2IQ0A 1ZLPA 4JEJA 2A7PA 4PMDA 5BMWA 4QSHA 4U2ZA 3TEVA 3XISA 3EX1A 1TR1A 3DFPA 3JZEA 2QZRA 1K3UA 1JRCA 2FGBA 3LZ5A 3U57A 2ZYFA 2VEFA 1GOQA 3G0UA 3KRBA 2O7SA 4CGTA 3CYJA 3N2BA 1BLIA 1XBZA 3TNOA 5FL1A 2CWNA 5D02A 1K8YA 3UG5A 2ACSA 2PCEA 1UD8A 4Q8QA 3PAJA 3AC0A 3T0AA 3H24A 1EIBA 1IF2A 1KWGA 3DU0A 2P76A 4KGJA 4JHMA 5CG0A 1VRXA 3BL3A 2RKXA 5XINA 3W4RA 3N17A 3I6TA 4HNLA 3ALFA 1YHTA 3WLPA 5A6BD 4JTUA 3PN8A 5CC5A 3NL2A 2ZUNA 1FXQA 3S9YA 1G67A 3W23A 1F6KA 5HNRA 4HOZA 3ARQA 3CZGA 3GIQA 3P2VA 1RSCA 5T26A 3MMWA 1LRQA 1XYBA 2QW5A 1W1TA 3EDKA 4LUTB 1XHGA 4ZXOA 5BXPA 1EKOA 3VMNA 2XU2A 3KE0A 2Z00A 1EOKA 5BOFA 1OC6A 4WD0A 4FX6M 2GSEA 3PBVA 1KLZA 1ZU8A 2C0HA 2CKRA 5TBOA 7ODCA 2X1SA 3LRLA 3GDLA 1KGXA 4B9ZA 5LIXX 1H1YA 3M9YA 1GVOA 3TP4A 2RJHA 4JYDA 1V6TA 1JFHA 4RDYA 3T1GA 2ATMA 1G01A 3ITGA 2DZPA 3LLXA 2GJLA 5JBDA 7TIMA 4M56A 4UFLA 2V82A 3FHQA 5EB8A 1I0BA 1V6VA 2HS8A 3ZLFA 3MU7A 1BVWA 4B5XA 1YE4A 3KFTA 3SCWA 3T08A 3CV1A 4DJEA 2QUNA 3TC7A 4LVGA 3M5XA 1TYGA 1ADOA 3NOEA 1KFKA 2WMJA 5HMSA 1WV2A 4A21A 4BQ5A 4CCZA 2A3HA 3O0KA 5KZEA 3DG7A 1CENA 2C15A 4JQ3A 4GI8A 3LHWA 1ENUA 3O6AA 5C54A 3PZVA 4GZEA 3AXKA 5EFDA 1JCMP 3R11A 2VTFA 3LGGA 4NZ4A 3O6CA 2GK1B 3IJDA 2O4QA 2V5CA 3B0VC 1CGTA 2WANA 3I4EA 5HANA 1E6XM 1CI1A 3GAKA 4O57A 4LAUA 4CNOA 3K4DA 3E0VA 5K4XA 4D71A 4P8VA 5F4SA 4TVDA 3Q94A 2WKLA 1LWHA 2OELA 3RHGA 3AWOA 4P5UA 4NSBA 1W0MA 4GIRA 3MYPA 2DT0A 3VILA 3MI6A 1XLEA 4P7NA 4MJMA 4XZHA 4M3PA 3WLIA 6REQB 4GOAA 2C91A 4REQB 3MWAA 1H09A 2FPTA 4HD5A 2G4JA 4D2JA 4UMAA 2AGKA 1KR1A 1YTEA 3OBEA 4P8WA 1EJVC 4BI5A 1KBLA 1Q6RA 2Y6ZA 1OX4B 1YIXA 1Q6LA 3EDEA 3C4UA 3CQ0A 1EQPA 2UY2A 4C6LA 1XLKA 2PTDA 3GTNA 3NGFA 4IXXA 3CO8A 4JTSA 4AU0A 3WQ8A 4LRSA 3R0DA 4RDZA 3T4CA 1KRAC 1IZKA 5PTDA 3RPTA 3INPA 2BSLA 1XLHA 2EQDA 1JUEA 3VCNA 1KFBA 3W27A 3V0UA 3M47A 4UC5A 2PRHA 3ES7A 2DFAA 2BWGA 2QJNA 2RGLA 1ADSA 4I5XA 4W85A 4H9MA 2JFEX 3S5ZA 1H7PA 2EPLX 2G95A 5IFTA 4D6IA 3PPCA 3WFZA 3LSCA 1YTDA 4IL0A 1CDGA 3W37A 3W7JA 4L80A 1EJTC 4TVCA 4XQ6A 2VDIA 4UCFA 4PMXA 3E2RA 3C86A 2FVMA 2FZBA 3K2GA 1CECA 4B15A 1CXIA 1M41A 2J8TA 2PLJA 1FWRA 4QSFA 1WZLA 3LUTA 2CERA 1KTCA 5REQA 4Z1BA 4LY4A 4H19A 2BOFX 4BA0A 1TJ2A 1SZFA 1IEIA 2JQXA 5IHSA 2EJAA 2XVPA 3BH4A 3VKAA 3QGKC 3LN3A 3A4WA 3OIHA 4HMEA 1XLFA 4HQVA 3W6MA 1EC7A 2ZX7A 4C6EA 1JGIA 4GY1A 4MNMA 5HBFA 4B4HA 3QRHA 3LPFA 1L6FA 4FR1A 1DL3A 2V69A 4PBGA 4RZBA 3SY5A 7XIMA 5FOOA 2WSQA 3TQVA 3STCA 3DHUA 1K7EA 1UUMA 4IMDA 2ZE0A 2YXXA 4PGLA 5M03A 7PTDA 2D2OA 2XGIA 5GJMA 4WF7A 4M1RA 2RH9A 4XBKA 1GJUA 3N6JA 4PEEA 2V3DA 1VP5A 2H90A 4R7JA 1GG0A 4N6FA 5J5DA 2YA2A 3UA4A 5CEWA 2YZRA 5BRPA 2J7GA 3M5ZA 4F40A 3WNPA 4LC6A 1H7OA 1R3SA 1IWPA 3S2LA 1T7LA 3QH2A 2IS7A 5HULA 1E6PA 2DZAA 7TAAA 3W7NA 1BWVA 3DFTA 1OF8A 3SQLA 3WQ6A 2UBPC 3S83A 4NHVA 1B9ZA 1XFBA 1DIKA 4QDWA 3WEMA 1AQFA 4GD0A 3UWQA 4MDOA 2DDXA 3EOOA 3B8UA 4O1DA 1QPKA 2G8ZA 1OABA 1GQJA 1CLXA 3FCPA 1VS1A 4WJ8A