3WBMA

Crystal structure of protein-rna complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
93
structure length
86
Chain Sequence
TPTPSNVVLIGKKPVMNYVLAALTLLNQGVSEIVIKARGRAISKAVDTVEIVRNRFLPDKIEIKEIRVGSQVVSRVSTIEIAIRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA/RNA-binding protein Alba 1
publication title Biochemical and structural insights into RNA binding by Ssh10b, a member of the highly conserved Sac10b family in Archaea
doi rcsb
source organism Sulfolobus shibatae
molecule tags Rna binding protein/rna
total genus 24
structure length 86
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01918 Alba Alba
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.20 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Alba-like domain 3wbmA00
2EK0A 1NH9A 3IABB 1NFJA 3IABA 2EH1A 2H9UA 2BKYX 1VM0A 1H0YA 3TOEA 2A2YA 3U6YA 1H0XA 2Z7CA 3WBMA 1Y9XA 2Q3VA 1UDVA 4Z9EA 1NFHA
chains in the Genus database with same CATH superfamily
4K87A 1S8EA 4YDQA 3VTIA 3LVKB 3IABB 4TWAA 3IABA 1JDQA 2EH1A 4Q15A 3ZIHA 3ZIIA 3U6YA 1H0XA 1Y9XA 4K88A 4NZTM 3TSUA 3ZIEA 4Z9EA 3P04A 1JE3A 3TTDA 1NH9A 4YKEA 1NJ5A 1HC7A 2P9BA 1XEZA 1LN4A 1H4SA 3TSPA 2CRQA 3TTCA 2H9UA 3ZIGA 2Y1BA 3TTFA 1Y2IA 2L8YA 4HVCA 1H4QA 3IALA 4FBKA 3LVJC 1NJ1A 1NJ2A 2Z7CA 1II7A 3VTHA 2LXRA 4EO0A 1NFJA 1PAVA 1H4TA 1RQ8A 1TIGA 3T1IA 2M71A 1DCJA 2BKYX 4HD0A 1VM0A 1H0YA 3TOEA 1VR4A 2IFEA 3QKBA 3WBMA 2Q3VA 4OLFA 3HZ7A 3DSCA 1NFHA 2EK0A 4FBQA 1NJ6A 4WI1A 3TSQA 3DSDA 2GTCA 2LN3A 4HVZA 2A2YA 1JO0A 4FBWA 4NCXA 4FCXA 4NZRM 1UDVA 4K86A 1NJ8A
chains in the Genus database with same CATH topology
2EK0A 1NH9A 3IABB 1NFJA 3IABA 2EH1A 2H9UA 2BKYX 1VM0A 1H0YA 3TOEA 2A2YA 3U6YA 1H0XA 2Z7CA 3WBMA 1Y9XA 2Q3VA 1UDVA 4Z9EA 1NFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EK0 A;  1NH9 A;  3IAB B;  1NFJ A;  3IAB A;  2EH1 A;  2H9U A;  2BKY X;  1VM0 A;  1H0Y A;  3TOE A;  2A2Y A;  3U6Y A;  1H0X A;  2Z7C A;  3WBM A;  1Y9X A;  2Q3V A;  1UDV A;  4Z9E A;  1NFH A; 
#chains in the Genus database with same CATH topology
 4K87 A;  1S8E A;  4YDQ A;  3VTI A;  3LVK B;  3IAB B;  4TWA A;  3IAB A;  1JDQ A;  2EH1 A;  4Q15 A;  3ZIH A;  3ZII A;  3U6Y A;  1H0X A;  1Y9X A;  4K88 A;  4NZT M;  3TSU A;  3ZIE A;  4Z9E A;  3P04 A;  1JE3 A;  3TTD A;  1NH9 A;  4YKE A;  1NJ5 A;  1HC7 A;  2P9B A;  1XEZ A;  1LN4 A;  1H4S A;  3TSP A;  2CRQ A;  3TTC A;  2H9U A;  3ZIG A;  2Y1B A;  3TTF A;  1Y2I A;  2L8Y A;  4HVC A;  1H4Q A;  3IAL A;  4FBK A;  3LVJ C;  1NJ1 A;  1NJ2 A;  2Z7C A;  1II7 A;  3VTH A;  2LXR A;  4EO0 A;  1NFJ A;  1PAV A;  1H4T A;  1RQ8 A;  1TIG A;  3T1I A;  2M71 A;  1DCJ A;  2BKY X;  4HD0 A;  1VM0 A;  1H0Y A;  3TOE A;  1VR4 A;  2IFE A;  3QKB A;  3WBM A;  2Q3V A;  4OLF A;  3HZ7 A;  3DSC A;  1NFH A;  2EK0 A;  4FBQ A;  1NJ6 A;  4WI1 A;  3TSQ A;  3DSD A;  2GTC A;  2LN3 A;  4HVZ A;  2A2Y A;  1JO0 A;  4FBW A;  4NCX A;  4FCX A;  4NZR M;  1UDV A;  4K86 A;  1NJ8 A; 
#chains in the Genus database with same CATH homology
 2EK0 A;  1NH9 A;  3IAB B;  1NFJ A;  3IAB A;  2EH1 A;  2H9U A;  2BKY X;  1VM0 A;  1H0Y A;  3TOE A;  2A2Y A;  3U6Y A;  1H0X A;  2Z7C A;  3WBM A;  1Y9X A;  2Q3V A;  1UDV A;  4Z9E A;  1NFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...