3WBWA

Crystal structure of gox0644 in complex with nadph
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
271
structure length
271
Chain Sequence
EAQTVISFHDGHTMPQIGLGVWETPPDETAEVVKEAVKLGYRSVDTARLYKNEEGVGKGLEDHPEIFLTTKLWNDEQGYDSTLRAYEESARLLRRPVLDLYLIHWPMPAQGQYVETWKALVELKKSGRVKSIGVSNFESEHLERIMDATGVVPVVNQIELHPDFQQRALREFHEKHNIRTESWRPLGKGRVLSDERIGKIAEKHSRTPAQVVIRWHLQNGLIVIPKSVNPKRLAENLDVFGFVLDADDMQAIEQMDRKDGRMGADPNTAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Gox0644 in complex with NADPH
rcsb
source organism Gluconobacter oxydans
molecule tags Oxidoreductase
molecule keywords Putative 2,5-diketo-D-gluconic acid reductase
total genus 101
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3wbwA00
2F38A 3V0SA 3LENA 1YE4A 2IS7A 3U2CA 3BCJA 3R94A 1AFSA 3CV6A 4LB4A 1MI3A 3F7JA 1YNPA 2IPFA 4YVXA 1XJBA 1OG6A 2WZTA 2INZA 3N2TA 4WDXA 2I17A 1M9HA 3CAVA 4G5DA 4XZNX 1VBJA 1PZ0A 2HV5A 3CASA 2PDLA 3LQGA 3UZXA 3M4HA 2FZBA 1XF0A 3LUTA 5KETA 3V0UA 1Z9AA 2PDJA 1LQAA 3RX3A 4XZMX 1QWKA 3BURA 5LIUX 4YVPA 1VP5A 2PDBA 1X98A 4YS1A 2PDXA 5LIWX 4WDTA 3O0KA 2PD5A 4XAPA 4QXIA 3N6QA 3UWEA 2ACQA 2IQDA 4FA3A 4GQ0A 4GIEA 1S2CA 2DV0A 2INEA 4L1WA 3LNMA 4OTKA 4JTAA 4JQ3A 4GQGA 4JQ1A 2AGTA 3GHRA 3R58A 3R8HA 1ZSXA 1ZUAX 2BP1A 2DUXA 4DBWA 1S1PA 2DUZA 4XVDA 1Q5MA 4DZ5A 3LEPA 4PRRA 2R9RA 3VXGA 2ALRA 1JEZA 2ACUA 2NVCA 1UR3M 3RX4A 2PDCA 4ASTA 3R6IA 4WEVX 1FRBA 4R9OA 3G5EA 3GHSA 3ONBA 3UZZA 3UP8A 3EAUA 3MC5A 2PDNA 4FALA 1EKOA 4AUBA 4IJCA 2IKGA 4XK2A 4XZLX 5HNUA 2FZ9A 2A79A 3BUVA 4XZIA 3WBYA 4JTRA 3EB4A 4PMJA 2IPGA 2IQ0A 3O3RA 2PFHA 4Q7BA 2PDWA 1AZ1A 3C3UA 3WBXA 4WGHA 1X97A 1K8CA 1ZQ5A 2PDIA 1PYFA 4QX4A 4DBUA 4GACA 1IHIA 2J8TA 4ZFCA 2BGSA 4GABA 4WRHA 5JH2A 1Z3NA 3M64A 3UZWA 1XGDA 1GVEA 5HNTA 4PUWA 4L1XA 2P5NA 2PDPA 4PR4A 4HMNA 4JTDA 4LBSA 3UYIA 4EXBA 3FX4A 2IKIA 1X96A 3R8GA 2HVNA 1T41A 3P2VA 4XO7A 1PWMA 4WDWA 2PEVA 2HE5A 5JH1A 3EB3A 3UFYA 1AH3A 3R7MA 3MB9A 1ZGDA 4MHBA 2ACSA 4FZIA 2BGQA 3LZ3A 1AH4A 3KRBA 3COTA 3LD5A 4YU1A 4GCAA 1PWLA 3UGRA 4RPQA 3RX2A 1S2AA 1ADSA 2PDMA 3GHTA 3Q67A 3D3FA 4H7CA 3B3DA 4JTCA 5LIYX 1RALA 1EF3A 2PF8A 2PDYA 2FVLA 3G1RA 4WDUA 5DANA 4LAZA 1J96A 5LIXX 3DN5A 1IEIA 3LQLA 2PDKA 3LZ5A 3M0IA 4JTQA 3GUGA 1AZ2A 3BV7A 1LWIA 2F2KA 2R24A 4JQAA 2QXWA 2PDHA 4PRTA 1SM9A 1EXBA 1RY8A 1YNQA 4LB3A 4H8NA 4YVVA 3R43A 3LBOA 2PDQA 2ACRA 4EXAA 2VDGA 3T42A 1PZ1A 3CV7A 1YE6A 2I16A 3ONCA 1C9WA 2FGBA 2IPJA 4FAMA 1R38A 3FJNA 3V0TA 4I5XA 4F40A 4HBKA 4PUUA 3V35A 4XVEA 4XZHA 4LBRA 2HVOA 4QR6A 1RY0A 1AH0A 2C91A 3WCZA 1Q13A 3H7UA 1A80A 1T40A 5LIKX 3UG8A 4JQ4A 2NVDA 4XO6A 4JIIX 3H7RA 2IKHA 3WG6A 4Q3MA 1MZRA 4NKCA 5AZ0A 2HE8A 4ICCX 2HDJA 3CMFA 2PDUA 1Z89A 1US0A 1Z8AA 3GHUA 4JIHA 2CLPA 5AZ1A 2WZMA 2IPWA 5HA7A 3UZYA 2FZ8A 4GA8A 3WBWA 1HQTA 3V36A 1MRQA 3H4GA 3DOPA 3NTYA 3S3GA 3CAQA 2PZNA 3ERPA 4IGSA 2PDGA 3Q65A 1HW6A 4JIRA 4LAUA 2HEJA 4IJRA 4QBXA 1S1RA 3LN3A 4DBSA 5C7HA 4JQ2A 5M2FX 2IKJA 3QKZA 2PDFA 2ISFA 2PD9A 1QRQA 1EL3A 2FZDA
chains in the Genus database with same CATH superfamily
2BOEX 2E9BA 3CB3A 5M17A 4LSBA 2ODOA 3W29A 4EPDC 3L4UA 1CBGA 3FOKA 4JFWA 1MDLA 3CL8A 1MI3A 1MQRA 4O1DA 2IMRA 4UUIA 2C1IA 4R5EA 2JF7A 1TYGA 3DU0A 5D2TA 2MANA 1HKJA 2O9RA 4AD4A 3G1SA 2WWCA 1TPB1 2QGYA 2D2GA 3RMEA 4B3ZA 2OEJA 3HG4A 4XZNX 3CHEA 3CASA 2XIOA 1NFBA 3UZXA 4ZB2A 1I1XA 4H9YA 3M4HA 3SURA 1RLDA 3WDIA 4IPNB 1KGUA 2CLMA 3I7QA 1GOXA 4FHAA 3IGHX 3N3TA 1XLEA 1ZHAA 2RH9A 2W92A 1E1CA 3RM8A 1OHLA 3FVDA 2HBVA 4QE5A 4FA3A 3SN0A 1M1BA 3TXZA 2ZRZA 3A12A 3N9SA 3QH2A 2YA0A 3DG7A 3QV9A 2A3CA 4JHZA 2NXHA 1Z42A 2BTMA 3N9RA 4LV9A 3ITGA 3NQEA 2WVVA 3BOXA 1S1PA 4XVDA 2QVHA 5GQBA 2VURA 2ZA3A 2PWFA 4HPJA 4K8HA 4KEZA 4F0LA 4O53A 3RR4A 4QG9A 4A05A 3TAKA 2VOTA 2PAJA 4AF0B 1U30A 5A8MA 3JU2A 2NT1A 3BLDA 3PSVA 1LT7A 4C6OA 4Q7NA 3QF0A 4AU0A 1NEYA 3OLEA 5IXEA 3CUFA 1D8CA 1OD8A 3O9NA 1CT5A 1QR7A 1KM2A 1JRCA 4PUNA 1UA3A 4IF2A 2G37A 1LM1A 3H8AA 4RZ5A 4JN8A 1OCNA 2E8ZA 1EJSC 1SYTA 2G3NA 4JTIA 4B5TA 2FVKA 3O3RA 2QUUA 4W7VA 2YB4A 4S3GA 1LUCA 5F4WA 2G5WA 2X7VA 3L0GA 1SVDA 1R3VA 4CNNA 1C9DA 1YLVA 4UOJA 3ARQA 3OGSA 1XLBA 2GQ9A 1IHIA 4IQJA 2X0YA 3ATZA 4WRHA 4HN4A 3UVAA 5I07A 4MY8A 4R3UA 2ISVA 3EEZA 4PUMA 1IXQA 4O13A 4CEUC 1UPMB 3RHGA 8RUCA 2NUXA 4AMAA 2XVKA 1SW3A 1VH7A 2FDSA 1K7FA 4ZSUA 3W73A 5K9DA 1S3HA 3E0IA 4C5ZA 4HCHA 2IKIA 4JDBA 4UFLA 1DJZA 3MBDA 3BSMA 3JS3A 2PGFA 2G8ZA 2CPUA 2XH4A 4PL1A 4N02A 5AHFA 4IGMA 4NF7A 1EBHA 1XC4A 2YB1A 3F5LA 4HYRA 3EOSA 3K4AA 3TA9A 2ZC1A 4XIAA 4IISA 1IZJA 3HPFA 1E0XA 5ABFA 5KZEA 1TWZA 2EG6A 3LHTA 4AEOA 5C6MA 1ODZA 1O94A 3MT1A 2VFHA 1UH2A 3S9YA 3M44A 1E1EA 3II1A 4O15A 1TFVA 3QW3A 4LF1A 3ZIZA 1US2A 4DX3A 3CO8A 1NDWA 2WMIB 4TUFA 4KEMA 2E28A 4K1GA 3BJFA 2VVNA 5HJXA 3B3DA 1HGYA 2D23A 2ZRVA 1R9XA 3WUEA 4MWAB 4PODA 4PCSA 3PG9A 3AXKA 2BZNA 4QNEA 4U5IA 2PTDA 3IGXA 2OPJA 5F2IA 3W76A 2QJJA 5IHRA 3LZ5A 4DRSA 3GUGA 1PKLA 2PUZA 2QDDA 4BQ5A 4GK8A 2VR4A 1FWHC 2OSYA 4UMBA 3WH7A 2WKJA 3CS2A 1U1HA 1OT2A 4JCLA 4PL2A 4H8NA 3MKVA 1KD0A 5GJNA 4RKAA 3SSZA 2PLMA 2VDGA 4O11A 3EMCA 2ZWYA 3UR8A 4S2CA 4DO6A 3O2LA 4FR1A 4AD2A 1K6WA 4CCDA 2YJQA 1O5QA 5D30A 3WQEA 2EPOA 2BWGA 4FEZA 2UY4A 2VEPA 4JNYA 5DX7A 4OECA 5CSYA 5T8GA 1VHNA 1L6GA 5A6SA 3IAQA 1W32A 1MNSA 3HU7A 4Z1AA 4F0MA 1KXQA 2V3FA 2ZIDA 4Y2WA 3A9IA 2BSLA 3MCOA 4MMWA 4F66A 3I6TA 3N1AA 2HE8A 2F6XA 4WF7A 3CLMA 2PGEA 3LSBA 3PWGA 4PYSA 5I2UA 5AFDA 1V6VA 1J2BA 1LOQA 2QT3A 4Q22A 3PJWA 4QJ4B 1QT1A 4MSSA 3VDAA 1MWOA 4K8GA 1PX8A 3TVAA 5JIWA 3GK0A 3ZOAA 4UIOA 1QAPA 3B0VC 2VRQA 3V36A 1JCMP 3F03K 3N17A 2VELA 1VEMA 4IG2B 3G77A 4KRZA 1TA3A 3VIPA 4DJDC 1LLWA 4PCFA 1F07A 3VABA 4AWTA 3R2GA 4PZVA 1YXYA 3U7BA 2ZRXA 3GAKA 4PC8A 1BFNA 1LL7A 1FHUA 1VPYA 1HGWA 1W5QA 1X6NA 3FW6A 4L5ZA 2E6DA 2VOMA 4CU8A 2OZ0A 4AZIA 3TFCA 1IXPA 4HOZA 1UUMA 2FTPA 3PHAA 1BYDA 2PCQA 3N2TA 5DXYA 4HA3A 2J62A 4LJ3A 3VNZA 1M9HA 5KZMA 2Q09A 4E8GA 3QY8A 4PEEA 3V18A 5CJ5A 1K77A 1DKWA 1QDSA 2CWNA 4YTSA 3PTDA 1R9YA 4HHMA 3P8JA 1B3XA 2OJPA 2D22A 1FWTA 2B7NA 2BBFA 5HAOA 4UTTC 3T0CA 2HRWA 4KCVA 3STGA 4FX7A 1CDGA 1D2KA 2DZWA 3RU8X 4L6HA 1EIBA 2AMGA 2WJZA 4DAIA 4HMDA 1FHLA 1GNXA 1X98A 3WH5A 3HGOA 1FCBA 2P88A 1RQEA 1CXKA 2WSRA 4QNWA 2QCNA 2HPMA 1QO5A 4TIMA 2IQDA 3GRIA 4GE8A 4LYRA 4QDWA 4J3SA 4S1FA 3DKLA 5A94A 3AMDA 5DT7A 3G1HA 3M9YA 2VEKA 1C29A 3B8DA 4WY0A 4P8XA 3LCIA 4F79A 3LRMA 3RMJA 1BRLB 3NZRA 1KRMA 2UWFA 3T2PA 1QASA 1E73M 4MY1A 2I7GA 5BOOA 2F9RA 1VF8A 1E4NA 2VQUA 1XISA 2PF0A 1NH6A 4FLRA 4N2YA 1HKIA 1VCGA 1BYAA 3M7WA 3DENA 1Q6FA 1YBQB 3ITTA 4AAJA 4BF5A 4L4LA 5DT5A 3FYPA 3VDBA 5LNWA 4S23A 1BWLA 4FX6M 4R88A 4CD7A 4QJ3B 1EKOA 1KRBC 3LRLA 3TCSA 1A3WA 5GNXA 1W3TA 5HANA 4L4PA 1IIHA 1WE5A 1I8JA 1KBBA 2WBGA 5FJPA 4XK2A 4Y90A 5HNUA 3W7JA 1MW1A 4EKJA 3FYYA 1TVPA 1I6NA 3S5ZA 3OJGA 3VMNA 2HK0A 1JCXA 3WEZA 1TV5A 3KHJA 4UWMA 1A5UA 1DIEA 1EJVC 3EDEA 1W6TA 3ITYA 3O6YX 3GTIA 2DT0A 1MQPA 2WMGA 3WBXA 2QCHA 2FIQA 3RG6A 1XR2A 2WPBA 4S2BA 3TIMA 1K8CA 4C5YA 1PCKA 3BWWA 1X1OA 4XIMA 2INFA 2ZKMX 4ATLA 2UBPC 3N34A 5FF4A 5EA9A 3VOIA 3S1GA 4PMOA 3U4AA 3VDGA 4UQ9A 4GGHA 4MB5A 5D9OA 4BJHA 5HNTA 2FMNA 4F9JA 4GRSA 1Q6DA 3A3XA 4JOMA 3G6MA 5CH9A 3VA8A 2AKZA 3QZAA 1R3RA 2Q3RA 4R7OA 3CM4A 1AK5A 2VEGA 3RRAA 1QFEA 1HVQA 3ZR6A 2DFAA 1M7PA 3GH7A 2AMXA 3REQA 4JICA 2YSWA 3R8GA 2RDXA 2ZUUA 1H63A 3HG5A 4LUSB 2E40A 3P2VA 2O9TA 3MSRA 5M03A 2OELA 4O10A 5G5IA 1QJWA 3EWBX 3GNXA 4BR1A 4UC5A 1CGTA 2E67A 3WQVA 4D1IA 4M19A 1JZ4A 5BXTA 3AZTA 3VUSA 3KRBA 1YDNA 2V3DA 1V03A 2VFFA 3W07A 3WIJA 3LD5A 3WYZA 4IMEA 4C6KA 3ABOA 1WXJA 3RX2A 1H1NA 3AHTA 1E4MM 1YTKA 3M0KA 2ALDA 1W9VA 3O6AA 3N29A 5D33A 4X3ZA 3KS6A 4JTCA 3G22A 3E74A 3NQBA 2PC8A 1KTNA 4W86A 4IWWA 1BVNP 3FCPA 3TUUA 3KRUA 4UMCA 3GU2A 4NXSA 1B9BA 3UU0A 3BOFA 1RP9A 3PAJA 1MYRA 3AYTA 1RLCL 4Q8TA 5DELA 2Z7KA 1OX5A 2X7WA 3TKFA 1XRTA 4B5UA 1I2QA 1FFRA 1RY8A 4W84A 3L68A 4CKQA 4BF9A 1X8CA 2YCJA 1JZ5A 3JRKA 5I3KA 4LT9A 1ZAJA 4O14A 1FUYA 3WK3A 4V33A 1UC4A 1GWJA 4IMFA 4X9SA 1DJYA 2J8GA 3IAPA 8CGTA 4DJEC 4XZHA 3NZ1A 3B8UA 2EAWA 2ASHA 1Z6KA 3VKJA 3CYJA 3UR5A 3M1ZA 1OC6A 2D24A 3M6YA 4AVFA 1EXPA 2ANUA 4KQNA 1GYMA 4JQ4A 1GONA 4P8VA 3VZXA 3LM3A 3P74A 4GZIA 4IUOA 1B2YA 1FA2A 3M6DA 4DHGA 5FA5A 1LL6A 3K8KA 2FZNA 4YMZA 3MPGA 4KCUA 2E6YA 1WDQA 4N42A 3VUPA 4ERGA 2CLEA 4UTJA 3VCCA 1XYMA 4JKMA 1XD0A 3KOYA 5FOOA 1G7UA 3ZVHB 4EF9A 1OCBA 4IX0A 3EXRA 4JTSA 4IGSA 3Q65A 3PPCA 2FJUB 1EC7A 4HCLA 3T4WA 3T40A 1KWKA 1D7KA 1XRFA 1REQB 4JKLA 3W1LA 4GMEA 3VGGA 1XBVA 3BLIA 2F84A 4RL3A 1W9UA 1R3TA 3AWNA 4QDMA 5I7GA 5D32A 4FR6A 4IPPA 1WX0A 2FHBA 2FPYA 1J18A 1M68A 4DEFA 1NM9A 3MP3A 3CV6A 4OUIA 2ZVRA 2R1PA 1REQA 2OO0A 4TX8A 4FF5A 1GORA 4DJFD 3BE7A 1F6YA 3P5YA 4UCFA 5I3HA 1BYCA 1BSIA 2RJGA 1SMDA 2CIPA 1R3WA 5BW6A 4RZ6A 1M5WA 1PZ0A 2HV5A 4KRUA 4NI8A 5E9XA 3ITXA 2GGEA 1RAKA 4MZ8A 1XIGA 1EPXA 3J7HA 3LUTA 2V6AA 1JQXA 4S3KA 1EH9A 3W1AA 5D03A 3ZFHA 1MSSA 4I9TA 4YVPA 2A21A 3UJFA 1EHNA 3HMCA 2PDBA 4DVOA 3ZLGA 2PD5A 2ZICA 3FKKA 1E4IA 1GPFA 1EIXA 3C2OA 3GH5A 3QYSA 4IIFA 4LH8A 4GZJA 3ARYA 3SCRA 3L5MA 5CEWA 2R1KA 4IH3A 5JU6A 5CBJA 4LFYA 2DUXA 4DBWA 3W1TA 4DZ5A 4PMVA 2R9RA 3VXGA 2J7GA 3TN4A 2HWGA 2NVCA 4W9TA 2QDHA 1P48A 3H54A 5F7UA 5LYRA 4EP8C 1GTHA 3C61A 5AVHA 3FY1A 5K9XA 3LERA 4WEVX 3BO9A 1XKJA 5DEZA 1U5HA 1NP0A 1W2PA 2XFWA 3ABQA 1OFRA 2WVTA 3GSMA 1W54A 5CC5A 4IIHA 4Q4KA 3SGUA 1FWAC 1J10A 1VYRA 2BS9A 1TPDA 3AU6A 5CPQA 2GLKA 3HOJA 2OZ3A 3WBYA 3H4XA 2Z6JA 3HQPA 1JZ6A 1GHRA 3BLOA 3TLQA 3T55A 4HD5A 3A13A 5BRPA 1NDYA 1HXJA 1N2VA 2OLHA 3EKZA 1DP0A 3OIHA 4PCNA 3PZIA 3OA5A 1FWCC 1VFUA 3WY1A 1X6UA 2PDIA 4DBUA 4HSHA 5C70A 4Z1YA 2A4AA 2G96A 4UTHA 4LW7A 3D0CA 4HPHA 3V1HA 1FP8A 1T6MA 4UBPC 3M5YA 2QGHA 3M43A 2VR2A 3NOYA 3MJMA 4ML4A 1RK6A 4J3WA 3P7YA 3WK2A 5BU6A 3C2FA 2C1GA 4AIOA 1TWDA 4GCXA 4PR4A 4WSHA 2DH3A 2QCGA 1EJXC 1PVNA 2CKSA 3BMWA 1OC7A 3F4VA 1XHGA 4Z1DA 3LHVA 7ENLA 1OYAA 3VD3A 4IPJA 3TWAA 1DV7A 7CGTA 2A2IA 3NG3A 3QYQA 3Q45A 2C79A 3QOMA 4XO7A 5C5YA 1UD6A 2D0HA 4HNCA 3KOZA 5HJLA 5G2IA 1AJ0A 4XKYB 1C8YA 3PBGA 3TTSA 1JAEA 1OFEA 1OT1A 3NURA 3T44A 3P93A 1W8SA 3ABZA 4L80A 2OX1A 4UFMA 1KLZA 3SY5A 1XIHA 3WMCA 3MMDA 3STCA 3UG3A 1ZZMA 4ZVJA 4JEQA 4DZHA 2QVNA 3CUIA 5LA2A 4C6FA 1AH4A 3LU2A 4CVUA 1KQYA 3IEBA 2VGFA 4FXSA 1DJWA 3O6DA 1C7SA 1P4CA 1QWGA 5CGMA 2BXYA 3D46A 1XCFA 3OODA 2Z2UA 3AUJA 4LEQA 1Q8AA 4NYYA 4PFHA 3VNDA 1MNZA 2QF7A 3N9KA 4G2DA 2ZUNA 4QTGA 4WDUA 1GKPA 3DN5A 4PTWA 2ZBTA 2CYGA 1PKNA 3LM7A 4GNKB 3MI2A 3W7DA 1WA3A 4BY3A 3CU2A 1CGYA 2Z00A 1EXBA 2P0OA 1IWPA 2XIMA 1YNQA 1PEZA 5D4YA 3WD3A 2Y0FA 4H9VA 4B3LA 1EGZA 2YDAA 1IV8A 1Q6CA 3XIMA 3SY1A 3W7NA 2JKEA 3GD6A 4YCOA 1OZQA 1K9TA 1UOZA 2UZ9A 3EX4A 1BXCA 4ML9A 3ONCA 5DFAA 3RUBL 3VGHA 3MP5A 1BAGA 2L5HA 1FP9A 5DCEA 4F0HA 1SO5A 5CAHA 3YPIA 4EOUA 2GQ8A 1GEHA 1HO4A 2GSHA 5D04C 5I06A 3THCA 4DZIA 1VPXA 4I6VA 3MTWA 4HK7A 4UZSA 1ZJIA 4C6CA 5A8PA 1E71M 1X39A 4Q6JA 4I7WA 1OYBA 3WG6A 4P7OA 1OQFA 1SZEA 3BLEA 4CN1A 4TV5A 2JIWA 1ICSA 3FYOA 2A7RA 3VTRA 3NPUA 4I8YA 1BG4A 3VGFA 4DUWA 1PTDA 4LVFA 1J0YA 3UETA 3HQ1A 1FCQA 2Z1XA 5D05A 2HISA 2FZ8A 2DU2A 2PB1A 4GJ1A 1VFOA 1IQ8A 1ZBCA 3EOLA 3N73A 4OWGA 1W5OA 5D38A 4JTTA 4ATWA 3AXIA 3SR7A 1CIUA 4U31A 3UY7A 2GOUA 2J7DA 4PGLA 3CUJA 2YBVA 1TVNA 5FF7A 3QKZA 3VYLA 4QS5A 1Q6GA 4MDPA 3KL0A 4FP1A 4M5PA 3W81A 2XWEA 1PTAA 3QV6A 5FAGA 2FTYA 1JJKA 2PGRA 4GXMA 1W3LA 3E0WA 4GG9A 4EWND 4MKVA 1PB0A 4GFIA 3SGGA 4LB4A 1J0JA 1O5RA 3UXAA 4DELA 3H21A 1KTCA 3L5LA 1TPUA 1O4UA 3CB8A 3GB6A 4REQA 1V08A 3LV5A 5MKGB 4GUGA 1LORA 3CHDA 1LT8A 3RU6A 1TJ1A 1V6XA 4BHYA 4W8BA 4E4PA 2VC5A 3OA3A 5C8BB 3HGRA 2Z1SA 1MXDA 2WVVB 3I6RA 3SAZA 2Z1VA 5A6BA 3PUDA 4GGBA 2Y8UA 2QNEA 5JIPA 2R82A 2WQDA 3WLTA 1B54A 2A85A 2V0TA 2C71A 4TVCA 4XZMX 1H7NA 3BURA 3UJ2A 4PB4A 1OFAA 3A4XA 5H8MA 5LIWX 1K8YA 1TTPA 3AS0A 1OYCA 4S3EA 1SFLA 4Q32A 3S2CA 1XSIA 3A47A 5REQB 4MAZA 4JY9A 3WBAA 3W1RA 1TRIA 2INEA 1LF1A 4MB3A 3K30A 3B40A 3EWDA 2D20A 1WZMA 3GXDA 1M6JA 3PZOA 1CCWB 4IIGA 4GX9A 3TFXA 4GHRA 2RFGA 3RITA 5M5DA 2DSVA 4Z2JA 3SRFA 4AB4A 1E0WA 3NO1A 4OU1A 1VC4A 4IMGA 5CSRA 3W01A 2FVMA 3BMXA 3VMPA 1EX1A 1F3WA 2DJXA 2P10A 4ZTXA 4Y9MA 3ISIX 1OCJA 3VU2A 4NZFA 1GW1A 4IGHA 1OINA 4GXPA 2IW0A 4A21A 5CSUA 1CB7B 1TTJA 1F5ZA 3EDKA 3PUEA 1E0VA 2D3NA 3UQNA 1W1PA 2WNWA 4PB5A 1YTDA 3L21A 2DIEA 2H8XA 2ZUMA 1OF8A 4US6A 1Q6LA 3GXPA 4L1GA 1C8XA 5FACA 2WM1A 3NIYA 4B5NA 1ZQ5A 1PYFA 4HTYA 4O1FA 2Z2AA 1HG3A 6A3HA 4ZSTA 3TTOA 1UWAA 4ZFCA 1ZCCA 2ZX7A 1IE7C 1Z3NA 3GVWA 3VINA 3VNLA 1GKRA 4Z1CA 1H60A 3PM6A 4PUWA 1J8VA 3MVIA 4S39A 5LNVA 3C2YA 3CHVA 2J6VA 3W72A 5CPTA 4RZBA 4LRTA 5BYWA 4BEUA 2J7HA 2DZXA 2GVJA 2X1RA 1RA5A 5I78A 1KBIA 4IMAA 3G1YA 4IFKA 2D0FA 2PCEA 3WX7A 3GC4A 1U5VA 1EDQA 3NEHA 1O5XA 4UNKA 3C5QA 2W79A 4PRWA 3KP0A 4KF1A 3QC3A 3B8WA 1U2YA 3ZVIA 2ZUSA 1EZ2A 2FKPA 2WVUA 3DESA 4MZYA 5DQPA 1QNRA 4YU1A 1QOPA 1WV2A 4U33A 4FLQA 4A22A 1XINA 1OG0A 3PZNA 4JS3A 5D8ZA 1DIKA 2PDMA 4DJFC 4ACZA 1EPVA 3PJTA 2YPIA 4P7NA 3P62A 3DX5A 1DWJM 1PDYA 3SDOA 4C6MA 2FJKA 3JVAA 3PTQA 2NV1A 2FVLA 3G1RA 3NOEA 3IVTA 2WNQA 3OBKA 4AG0A 4GUFA 3FSUA 1J96A 4X2RA 1JGMA 3S6TA 5I02A 3CZJA 3FJLA 3V16A 4ERIA 1VB9A 3NYZA 1NFPA 4M3PA 2R24A 2WHLA 5EGRA 2PDHA 2J9ZA 1SM9A 3TC7A 1P1XA 2EBNA 1VEOA 3LCGA 1BGGA 4HTBA 1P0KA 4L9XA 4LS2A 4F48A 3QFEA 2ZZ1A 4R53A 2GGIA 4JTGA 4YYFA 1CLXA 1LRTA 1QNOA 1YE6A 1EZWA 2I16A 3FA5A 4ZO7A 5ECVA 4RJEA 2OZTA 5A6TC 1I2PA 1C9WA 4FNUA 3E5PA 4O4VA 2X1SA 2PBOA 3H26A 1CXFA 2BVYA 3BC9A 2OOGA 5I23A 3BQ6A 1MZHA 2VCBA 4HK6A 4R7JA 3B8VA 4E38A 2C91A 2FB3A 3BARA 1QI0A 1E51A 2BVDA 3NA8A 3SUVA 4Q6XA 5LIKX 5HXMA 4L7ZA 3BSHA 3NQ7A 3W25A 4ZOBA 1UWIA 1SSDA 2EF9A 1XW8A 2A3EA 1JI2A 2BMBA 4O0ZA 5C9XA 2UY2A 1W3JA 4JBRA 2DT3A 2Q71A 4XSLA 1Q6QA 5HJYA 3BAJA 1G69A 1NWRA 4TOQA 3T8QA 4DO7A 3AHZA 2OYLA 2Z29A 4F2TA 5EFDA 3W84A 1TX2A 1YMYA 2Y8VA 1X7FA 3H22A 4I5UA 4O1CA 3PBMA 2TYSA 3EB2A 1HN1A 3N12A 1C93A 3APTA 2WSYA 3G0XA 8XIAA 1LROA 4YJ5A 5HULA 8TIMA 3S3GA 1YPIA 2PZNA 1KXHA 1VFSA 4ZQNA 3ZR5A 2CKRA 1A0EA 3CPGA 1P0EA 2DGAA 1BXBA 4AD3A 3CZGA 5M2FX 2PP1A 5FJTA 5LGZA 1PL9A 3L4TA 3KTCA 4Q8NA 1G94A 4OUEA 3ZJ7A 1M01A 1EOKA 2Z7GA 4IICA 1IR2A 3VO0A 2KZHA 3G1VA 1TQXA 3BL3A 2IPFA 2AQVA 3A3HA 5CC3A 1CXLA 6TAAA 3ZJ8A 2QCMA 2ZXQA 3NCOA 3W7QA 5LNRA 2OKOA 2WXDM 2CNCA 1XDLA 4AD5A 2AAAA 3UEQA 1Y0EA 1TSIA 3ME3A 3FDGA 2VZUA 3EGJA 1H41A 4IUGA 5EYWA 4US5D 1Q66A 4NZCA 4G1NA 3KP1A 4LY8A 4P8UA 3IJ6A 4PE8A 4D72A 4OBRA 1DWHM 3O7UA 3AFBA 2PDXA 4MNKA 3ITCA 4DI8A 1U1JA 3OO2A 3LXCA 3MUZ1 1C90A 1G67A 2C3ZA 1SZFA 4GQ0A 2JGYA 5FJRA 1UZDA 3QJAA 3A4JA 5KSWA 7TIMA 4ES4A 3CK5A 5KITA 4Q4QA 3FSTA 4OVXA 1RJRA 1JCNA 2YL9A 2CBUA 1RCQA 2A6NA 1H11A 4H8HA 3CO4A 3ZWSA 5HUOA 4X61A 1UMLA 3KDOA 3T7VA 2CETA 1NOWA 3BJTA 4FIQA 4K38A 5FCZA 1ZCOA 4QHRA 1P0DA 4AYSA 4A3RA 4JAWA 3KUMA 4GI9A 1JI1A 3EAUA 3WSUA 2XYLA 3CH0A 4KESA 1XYBA 4WQ6A 1WDRA 3AALA 1P6CA 4J35A 2JEQA 4IJCA 2XISA 2OLSA 1NELA 1ZL1A 3SRHA 4UMAA 1VFMA 2VJXA 3KOFA 3Q37A 2Y7DA 4JR5A 3C3NA 1FTXA 3UY8A 2E09A 3ARRA 4HNLA 3NM3A 2C0AA 3W7LA 2PDWA 3GU9A 2C16A 4BFAA 5D2YA 3N18A 2FFIA 4LV4A 1H09A 5HR6A 5HPOA 1H4PA 2CLIA 4XD4A 2PI6A 4BF7A 4IFOA 2GDVA 1RD5A 4E8CA 3DG3A 3N4EA 2YXOA 2PTZA 1VFHA 2ON3A 5U4NA 5JH2A 2DVTA 1TKKA 3NSMA 2AQOA 3ZJ6A 3QHMA 4HGXA 3LNPA 1GVEA 3T78A 2WVSA 3LG3A 4H6EA 4CD4A 3PZTA 4RR4A 2X42A 2I9UA 4BS0A 3IJ8A 5FJUA 4D6CA 2JIEA 1Y7VA 4ZQCA 5EMUA 1DIOA 4EXBA 4HPNA 1ZAHA 1W91A 3JUGA 3IIXA 4CN6A 5A3HA 3F2DA 4NI3A 2TODA 2BG5A 3QRHA 5IM51 2NWSA 2W9MA 4PUDA 2PEVA 2HE5A 5JH1A 3WKZA 4UR9A 3PB2A 3UFYA 3GNNA 3LXBA 1EFZA 4DF0A 1Q4WA 1AL7A 3WD1A 1ZJAA 4CN4A 3OQEA 1A49A 5C9RA 4POCA 3ZT6A 4HP5A 4F8XA 1RH9A 2EO7A 3GKFA 2ZXAA 2Z28A 3PBUA 3L7RA 3URQA 3UGRA 4E2VA 3TJXA 2YCEA 2PODA 3F4DA 3IV3A 4S3JA 5U7SA 3RCNA 1ISWA 1YDOA 3VAVA 3MS8A 4KBXA 1EF3A 1QATA 1LBMA 1XS2A 2OYMA 3U57A 4RUBA 1JNEA 1P0NA 2G3FA 3K13A 1IGSA 3W38A 3ALFA 1TZ7A 4GINA 2F61A 5HMDA 5CAKA 4DWSC 4KEVA 8A3HA 2QXWA 5CBBA 3CGTA 3IACA 1VEPA 4O17A 1NQ6A 1LLOA 2WNZA 2WV8A 4YTUA 2QCEA 4PMNA 4O54A 3RLUA 3CWHA 4FF7A 3WF4A 1DYSA 4LUTB 3Q2DA 4O12A 1EDGA 2Y62A 1BWVA 1ZJBA 2AAMA 2QV4A 4XTIA 3FJNA 5CLWA 1E72M 4CQBA 3B9AA 4HT3A 1XXXA 1AMYA 2GDQA 1VFLA 1QPRA 3GTNA 4N4QA 3E96A 3QV7A 1TJPA 3GG7A 1MVYA 3PJXA 3UWWA 2YW4A 3AMGA 4GQQA 4EANA 2BOFX 3SRKA 4DPPA 1HKKA 1FKXA 3W7RA 1X7IA 4IIEA 2DQWA 4CD6A 4Q3MA 3WMSA 3T0BA 5C54A 1WOBA 3E0VA 3MHGA 3GG0A 4WY0B 2ADAA 4JFTA 2YL5A 4LPCA 1BRLA 4ZQRA 3T2OA 5CBIA 1Z8AA 3BOLA 2VUNA 1XIBA 1XQLA 1DHPA 1HIZA 2JBMA 1R46A 2UY3A 1UP0A 4U2YA 3DFNA 1QPQA 3VOCA 1I9CB 3UZYA 4S3DA 1LG1A 4B9ZA 3RNDA 5BZAA 4Y9NA 1K9DA 4V1XA 4HK5A 3PZGA 2EPHA 3W6YA 2G3JA 3IARA 4HPGA 5F4SA 2X2YA 4JKKA 4H41A 4NILA 2PDFA 4GKTA 1DTUA 4MPKA 3CL6A 1ECQA 2E1WA 4DM1A 4UTLA 3JZUA 3LI1A 3P84A 5CJMA 5IFPA 1KFJA 3MV11 1RBLA 5HK4A 2YIHA 2IS7A 1GVOA 1MUMA 1E56A 1V5XA 4H8UA 3IUHA 4BI6A 2B7PA 3PP7A 3OIXA 4FOJA 4XUGA 5JBDA 5F2GA 2WZTA 2V9DA 2QPSA 4W8LA 4PTMA 3FHAA 2VENA 1XGEA 1ZFJA 3GZ3A 1OADA 3DHUA 2YXXA 1J5SA 2VR5A 1JULA 2PZ0A 3AYSA 1FH9A 3DBPA 3M5XA 3LQGA 2POZA 1YHTA 3HFYA 4OBTA 2BY0A 4LS1A 4GVGA 4KWOA 4FOKA 1P7TA 1DXIA 3L5AA 2Y6ZA 3F5KA 2RAGA 6REQB 1VJZA 3H2MA 2XH7A 4ONVA 4P7LA 1PIFA 5EPDA 4MB1A 4S3CA 1K4HA 3FXGA 4AW7A 3W2UA 3LGDA 1L9WA 3L67A 9XIMA 4ZXOA 3W7OA 1TWIA 1R6WA 1S2CA 4DF1A 5DN1A 3WFLA 3L23A 5FF2A 2WJFA 3LPGA 3VNYA 1GVYA 4IP5A 1W2VA 3R8HA 4GYPA 1F3TA 4FNTA 1UZ1A 1BVZA 4LUTA 2ALRA 1A47A 1XYLA 3A5VA 3P5ZA 4YCPA 3RCYA 3T08A 3LMYA 3GBDA 2YYUA 3MZ2A 1A5NC 2V5LA 4EIVA 3PFMA 1PAMA 4QLKA 1F4HA 1G9HA 1V0MA 3MDWA 3MI3A 2NWRA 1KXTA 3VNJA 3G8EA 4KCWA 4X22A 2H9AB 1GQIA 4CNUA 2XN1A 3EDFA 3NJ3A 3UZZA 3BICA 3W71A 5GJPA 1F3EA 4KH2A 3RF9A 3K4DA 3ITOA 2PP0A 3URNA 1KCXA 1VQTA 1FX6A 5AOUA 3M5ZA 1LCOA 3PTKA 1HP5A 4CCEA 1EDTA 3MYPA 2IPGA 3KX6A 2IQ0A 4JX4A 3MCMA 4QCFA 2W0UA 1GOMA 3PVFA 5DRCA 1AZ1A 2Y5JA 2Z0IA 2Z1BA 2GSEA 1PKYA 2GQAA 4AHOA 4K1WA 3URBA 4H1ZA 2QJHA 5GVJA 1IEWA 4AMCA 1E70M 3B9EA 3C0JA 4GY7A 2P1FA 3KOWA 4E2BA 1KWGA 4JIEA 2G3MA 2ZDRA 3KZSA 5ECUA 4C6QA 3U0HA 3MV01 1KRCC 3PZQA 1B4EA 1V6WA 1Q45A 1J0HA 3W7MA 1TPFA 3W7GA 2Y89A 3KBNA 1MXSA 3TYZA 3W7EA 2VZOA 2OODA 4I5RA 1MUCA 1X96A 3UJRA 3LHZA 2JGQA 1NWSA 5KTLA 3NWRA 1GJPA 3WDRA 4GQRA 3ARTA 1DPMA 3CQHA 1EBGA 3MP4A 3TONA 1E9YB 1T8XA 1DVJA 4ZODA 5ABHA 4M6PA 4NT0A 2SFPA 2A5HA 2CW6A 4L9YA 4JPGA 4NNBA 5D9NA 3CWNA 3B97A 4L56A 3WNNA 4QEEA 3DEQA 2V38A 4AHQA 5LZLA 3GS6A 2BGQA 1DIDA 3LZ3A 1YDVA 4D6DA 1SGJA 4JY8A 1DJIA 4A29A 3VCNA 3AJXA 1NDVA 3GQYA 3KWSA 5DCDA 1S2AA 3BGJA 2W6RA 1OSEA 3D3FA 4H6QA 3WQDA 3WEMA 3BPWA 3DAQA 4RDYA 2H6RA 4H19A 2VKZG 2YCLB 3P0XA 3B04A 4X0VA 3GDRA 3MUAA 3KDNA 2XHYA 7XIMA 2QKFA 4PCPA 1SZNA 2UV8G 2XVLA 1E6SM 2PDKA 3UR2A 2FGLA 3SGZA 5E6ZA 5T9CE 2QMJA 3QR1A 2Y70A 1DTNA 4DM2A 3TR9A 2E0PA 2LLEA 4F2UA 2EKCA 3FV9A 4KEUA 4B92A 3PTMA 1XRVA 4H9MA 3CQIA 1L2QA 3GNRA 5C9WA 2I5QA 4UQBA 2VCCA 2ZZ4A 3LHUA 3WQPA 1JPMA 1IT8A 3BMVA 1DWIM 3LHWA 3DIPA 2NQHA 1J11A 4O8AA 2VFEA 3BAXA 3WQ6A 4W5ZA 3VKDA 4NNAA 1V0KA 3GR4A 2EPKX 2CC0A 4NAFA 2XZ9A 5DLCA 1BD0A 1UR8A 1TJRA 2BNJA 2VFDA 4QDPA 1UQYA 3AMKA 4HIBA 3WF2A 4PMDA 4P7RA 3EXSA 4CQCA 2VHLA 4DO5A 2QJIA 4WCJA 3WLRA 4N6EA 3UG5A 4LVAA 5L6UA 4RDWA 2E9MA 4HMEA 3ABRA 4AIEA 4M81A 5C2XA 5FKYA 1GG1A 3CV1A 1Q4NX 2EEXA 4IOTA 2HDJA 4FI4A 1Y5XA 1EEXA 4Q8VA 1R47A 4TR9A 5A6JA 3WMBA 3WDQA 1P6WA 4Z2GA 2OSWA 2O7QA 1V77A 4I3GA 1SJAA 4YTTA 1HQTA 3DCPA 2UY5A 4XAYA 3SBFA 1ZPTA 1SFTA 3H2NA 1RK5A 1W9PA 5XIMA 4BQ3A 2KX9A 3RO8A 1UHVA 1YPFA 1QXLA 1W9XA 3W85A 5LXXA 4XB3A 2E1DA 3WD4A 1RCXB 3CEPA 3KS5A 3UG4A 1JPDX 5K3VA 2F38A 3V0SA 3GW0A 3LENA 1YE4A 2R1MA 4LYPA 2ESCA 4V1YA 5CPNA 3BDKA 1ICPA 4GQBA 4DJDA 3PSWA 2XH0A 4Q4SA 4ZO9A 3GIPA 2INZA 3GYEA 2O4MA 3WQGA 3MYOA 5KZ6A 2A7NA 4D71A 3NSNA 2OEMA 4EAYA 2ZWZA 4AC1X 3FEMA 2JK2A 4M6QA 4PMUA 1TV2A 1V6UA 2YDRA 2Q8XA 3LTSA 3SIZA 2G4JA 2VWSA 3B4YA 5B7ZA 1Z69A 3N25A 5LA0A 1AD1A 2CERA 4ERAA 2FZBA 5DF0A 2QIWA 1QNPA 3WLPA 3VIIA 3HN3A 4PULA 4AIUA 4YLWA 4CNTA 2VYOA 5FIPA 1WXZA 1VP5A 1FWJC 4U28A 4WKFA 5B7YA 3GG8A 1I0BA 5C9ZA 1OK4A 3HFTA 3M0HA 3AS2A 4HOWA 2NW0A 4O0QA 4G7EB 1DQXA 1ADOA 1XGZA 4B4HA 4QSHA 3A21A 3OTRA 2O0TA 5IDIA 4AZGA 4JQ3A 1ZALA 1R3QA 2GJLA 5FF0A 3VD7A 1B9ZA 1S2TA 3W28A 3FEQA 5A1AA 2BP1A 5AYIA 1HKVA 5BWFA 3LEPA 2YL8A 3OVPA 3RGTA 4TTGA 3RLGA 2XINA 5FJOA 4RW3A 4NJKA 1UR3M 3CTTA 4NJGA 1AA1B 5BXSA 4UTKA 3VKAA 3W87A 3N04A 1WDDA 2ZQ0A 3VGEA 1TPC1 4ATDA 4RE2A 4HSNA 5GJMA 8XIMA 2QPXA 2WZIA 4MFDA 4NNCA 2YZRA 4E4FA 4Y6GA 1OM0A 3DC8A 3FKRA 3DXIA 4H01A 4XUYA 2FZ9A 4GUIA 4GKLA 5DCBA 2QCCA 1A0DA 1TMLA 3SCVA 3HTWA 5FJIA 3KHDA 3QFWA 1K3UA 5D9PA 3WLIA 3BJSA 5FEPA 3QHOA 1QHOA 4WGHA 4CQAA 3MO4A 3AIWA 1GUVA 4RLIA 5FEXA 1XPGA 3GNOA 1RBAA 3UGVA 1OIFA 3RPDA 3TW7A 1XICA 2ZA2A 3E12A 6CGTA 3MBFA 3R8RA 2X8RA 4PMZA 2I9EA 3CNYA 3ABSA 1QK0A 4X2PA 2VP8A 3AXHA 3DFSA 1XLKA 4HNTA 1V3MA 4QEHA 4HHHA 5K2ZA 1K02A 1A50A 3ZO9A 3HIJA 1SFJA 2EPMX 1RUSA 4LGXA 4LC6A 4JTDA 4DJED 4UR7A 1WKFA 5IDZA 4RZ4A 4PTNA 2D2JA 4B16A 4J3VA 3AJ7A 4W89A 3ZJKA 4JTFA 1AL8A 2DZSA 1JFHA 3IJDA 5HMSA 3NQDA 3MZNA 3FA3A 1R85A 3F4NA 2GUUA 4HA0A 2H3BA 1VGAA 1VJSA 4MNJA 1B31A 3A23A 3GTFA 2RUSA 4FZIA 2AGKA 3TTQA 3NL3A 5J8LA 4LYQA 7TAAA 3L65A 4AXNA 3PNZA 1WAWA 2QV5A 4PFMA 2MNRA 3C0LA 3RRXA 3IUDA 3DUGA 3EWUA 1ADSA 1O68A 2VFIA 4A8LA 4RXFA 1FWGC 1W1IE 5TIMA 1L8PA 1JUBA 4ZOAA 3UWZA 1TPEA 1E3ZA 1RALA 2PF8A 4CU6A 1XYCA 4TVDA 1JIBA 3THDA 2NX1A 2PTYA 3TTEA 1FDZA 4YTQA 4JDYA 5ABFB 5C2GA 3WD0A 3TZNA 1R5YA 3WNLA 2QDEA 3W23A 1JD7A 2CU0A 2J66A 3B4UA 1WUFA 5T9BG 3I3DA 4NJIA 4W4QA 3BW2A 2PDQA 3IGUA 2D2OA 2NT0A 3UXLA 3C4UA 3CV7A 1KB3A 2DZVA 4HZ6A 3JR2A 3WF3A 2FGZA 4QP0A 3STFA 1S5TA 1C8VA 3DFQA 2NQ5A 1FXPA 3EKGA 4B4FA 5AHNA 3CT2A 4KFNA 7ODCA 1DJGA 4D6EA 1W17A 3NL6A 1AW2A 1MW2A 1RP8A 2WSKA 4Y8FA 1G4PA 1LOSA 3UCCA 1UIPA 1MQQA 5LHFA 3C8NA 2NVDA 1EB3A 2V5BA 4XO6A 2NX9A 1HL8A 1LWJA 3ZWTA 3G1DA 1RBOB 5G2WA 4YYCA 4KWWA 1XLCA 3KBMA 5AZ0A 4ZB5A 2OTDA 1Y5VA 3S1WA 5KZDA 4QRNA 2CLPA 1JUEA 3U2ZA 2IPWA 4EVZA 2XZ7A 1YIXA 1E5JA 1L2UA 3C86A 2FB2A 3L9CA 5EMJA 3A3WA 5H8PA 1MRQA 2AQWA 4KIEA 4INFA 1QK2A 2W66A 3ERPA 1RQBA 2QCLA 1X38A 3AIBA 2HEJA 4AF0A 5EB8A 3FA4A 4RE4A 1SO6A 5D2WA 3LN3A 5CZ0A 3THQA 2J7CA 3OLGA 4AVNA 1PZ3A 1U22A 2PD9A 2FZDA 1MUWA 1KCLA 4JFUA 1B4KA 3WQFA 1FWSA 3I65A 3LY0A 3LTPA 4X60A 1V7YA 4DBEA 4BQ4A 1DQWA 1XQKA 1LJYA 1YNPA 4REQB 1XLLA 5CZKA 5D02A 5G4WA 1KRAC 3V7PA 4Y9AA 4LVGA 3BK0A 1ONEA 5ABTA 4JTUA 2VL4A 2WLZA 4QG6A 4U3AA 3NQGA 5K7JA 4OV9A 3TNBA 1JUKA 1DWGM 3CIXA 1BEUA 4YN5A 1AMKA 5FF3A 3ZYZA 4JCMA 3CEUA 4F0KA 3T05A 2C0HA 2VTFA 3HM7A 2WC4A 3B8SA 1TCMA 2VWTA 5BOFA 3SCUA 5H91A 3E0FA 4GC4A 3O0KA 4OZOA 1E43A 2CZ5A 3G3MA 4Q8UA 3OVRA 1TV8A 3NDOA 3W1UA 5CPOA 2GVYA 2X0HA 3U3HA 3W0KA 3WLHA 4GWEA 2XSBA 1E6XM 4D6JA 3VK5A 1VYPX 3W6LA 4CD8A 4A4AA 1KNWA 5E6YA 4AZHA 5EBUA 2XU2A 1THFD 3OZMA 2Q01A 1ITUA 3HO8A 3K5XA 3ENLA 4NRSA 1V0NA 4XZWA 2ACUA 4LAKA 3S6OA 3WQWA 1X1NA 2XM1A 4A8RA 5LHEA 3HJZA 5HR7A 5JMUA 5AHMA 1SPQA 3W2KA 3ZLHA 3AXXA 4NX5A 3A4WA 4R9OA 4DI9A 3CMGA 4R27A 1UKTA 3M5VA 1XC6A 3ARZA 3W24A 3UP8A 2PC4A 3M0JA 1XIFA 2BDQA 4HMCA 1O95A 4E4UA 2XJ7A 3WLQA 4LRSA 3S6DA 4XZLX 4WKHA 1R3YA 2QCDA 3SQLA 3PBVA 1JAKA 4CU7A 3BVJA 3NSXA 1VCFA 4Z0SA 3BAYA 1KR0A 2B7OA 4GZ7A 1X97A 4G6CA 1GVFA 4UQCA 3ZVHA 2Z6IA 4QX4A 2A3BA 1I2NA 3N6JA 1DEDA 5TD4A 3VI2A 4ZZ9A 4S3FA 2BGSA 4GABA 3ZT7A 3H70A 5IHSA 1TREA 3MMTA 1IF2A 2E25A 3RO6A 1TV7A 3T6CA 3UBPC 4XKYA 3KBWA 2R14A 1ONXA 3T81A 4PTDA 2YX0A 4TQTA 3UXKA 1Z7AA 5HDRA 3TMQA 1UR1A 5GNYA 3EPMA 1EJWC 3T9PA 5K4ZA 2BVTA 2CZFA 1HL9A 1VJIA 3EOOA 4IL0A 4MAVA 3H2CA 4ADSA 2ISSA 2HVNA 5A6BD 3W74A 5K4XA 1T41A 2VVSA 3LCWA 3VKBA 3CT7A 1PWMA 2HS8A 3HG2A 1JGIA 2FH6A 3GFYA 4AIBA 1AH3A 3KZPA 1TWSA 1YKWA 5I24A 2J8FA 3R0UA 1QCWA 3RDKA 1A5LC 3G1AA 4AX6A 1Y8BA 5J5RA 1US3A 1KC7A 2V2DA 1GKQA 1SO4A 4PMXA 5AVNA 3AU2A 1XH0A 4I9AA 1Q6EA 2YLLA 3EXTA 3FDKA 5CGQA 3CXOA 4RV8A 4NQ1A 5FEZA 4TXEA 3R79A 4TVUA 3W3OA 3GHTA 3BLPX 3S2JA 2WCGA 3S2MA 3SI9A 3UPWA 5DO8A 2GVGA 5LSMA 3EBVA 1H7PA 4RW5A 5LIYX 1F05A 3V4BA 4CCCA 2XGBA 5EMKA 4P5UA 3K1GA 4JTLA 4DXXA 4FNSA 2PURA 5GPRA 2J7FA 3UA4A 3E9AA 4JTEA 3TYUA 1N7KA 1OFOA 2XIQA 4A3QA 3TYCA 3LBOA 2DVUA 5DY3A 3KOXA 3R1ZA 1Q6RA 4I6KA 3K8LA 4NP7A 2QQ6A 1QNVA 4PTVA 3WDHA 1AJZA 2YL6A 2ZRYA 3POHA 1JYXA 3P60A 4CQ9A 4B9YA 3UXIA 2QULA 4R33A 2QW5A 3GIQA 4F40A 1QBBA 2PRHA 2PTWA 1FWWA 5T91A 6XIMA 3B9NA 4DWSD 4RE3A 3QPEA 4GD0A 3P81A 3TXVA 4KIRA 2XFRA 1XIJA 3ZZ1A 4AEEA 4YL2A 3APGA 1F74A 4IP7A 2WAGA 4W88A 1XFCA 1YQ2A 2GQ3A 3W7KA 5I3GA 4B3KA 2GJXA 2OZ8A 3VIFA 4QFUA 4TX6A 2NLYA 3B0UX 2ZFAA 4Y9PA 3F4CA 2Z27A 3Q4DA 4AZCB 2OX4A 3TN3A 2ABAA 4LCRA 3WQOA 3D6NA 4RDVA 2B4GA 1SZGA 4UTUA 3AIRA 1E6ZA 4XISA 3ZSTA 5CZSA 3KTXA 1YBQA 3TQVA 1LP6A 2BFGA 4JHOA 4EACA 2GVEA 3N2XA 1K9FA 2ZVIA 3TTYA 4PUEA 3S46A 3DFYA 3M0MA 3MWAA 4NJHA 2CITA 2H90A 4V15A 5D2XA 2G97A 3IANA 2ISWA 4TMBA 2PA6A 3H2FA 1KKOA 2YGYA 3MMWA 3F7JA 3NL2A 2W4XA 4HKPA 1TMHA 3W70A 5HATA 5HQEA 3LMZA 3U2EA 4KKXA 4QGCA 5FJJA 1QNSA 4H00A 3GAYA 3VE7A 3OGVA 3OZOA 2XN2A 4CVWA 3PPHA 1V6YA 3E2SA 2EXOA 3OG2A 5AECA 3SN4A 2FMOA 3L4VA 4KPLA 2I1OA 1HL2A 3OBAA 4AEFA 3VOGA 2RGLA 3VC6A 3PG8A 1KBKA 2J77A 5F2LA 2WW5A 3GDKA 2CLOA 2PDJA 3SCWA 4WXZA 4C6IA 3TV8A 4N7QA 2J78A 1NTHA 3T09A 4MF4A 1SMAA 1H7XA 3T0TA 1V4YA 3IK2A 4G56A 1UR2A 3O6CA 5HNRA 1G01A 3UNDA 4CNOA 2I14A 3TW6A 3OLDA 1GG0A 2WZHA 1P7TB 5CPSA 5C9UA 3IS4A 1F6PA 3GM8A 4QJ1A 4GVIA 1IXOA 1XLHA 1XYFA 5LXEA 1ZUAX 2ZX6A 4HZ7A 1GW9A 3RM9A 2EJ1A 2QLYA 4NX0A 1XKYA 3N4AA 2VX5A 3M0ZA 2GWGA 9CGTA 4R7WA 5JXQA 1UBPC 3ZSSA 4E2OA 1UBSA 5HMFA 4ROQA 1POKA 1B3YA 1EP2A 2ZOXA 4EPBC 4LUIA 4ZMGA 1R2SA 2J88A 2OB3A 2OG9A 3UVIA 3BAWA 3WLKX 4IX2A 5A6KA 2W63A 2VC9A 2IKGA 1RD6A 2JALA 1BLIA 3BUVA 3LXAA 2R91A 1S39A 1KFLA 1DWFM 4UTIA 5CLTA 3GXIA 1XBXA 3PY2A 5BMWA 4QG8A 4Q7BA 2BHUA 2HCVA 3WBEA 3FJ4A 2CZVA 4BQ2A 2VFGA 1D3GA 2VGGA 3TAOA 4V28A 4DXKA 3B9OA 3MUY1 2XGIA 1VIWA 2I56A 5FL0A 1ICQA 3IV8A 3GR7A 3RILA 1JNDA 1XG4A 4E3TA 5CG0A 2CLLA 3SN1A 3QGVA 1A3XA 3MANA 4H9UA 3EWWA 1OC5A 2VEIA 3C56A 1SO3A 2XTKA 4GUJA 3VOHA 1T5AA 1QOXA 4AC7C 4PUJA 1I75A 1U83A 3REQB 3AUOA 5ENLA 4RV3A 1B5TA 2E6AA 4NASA 1CECA 4J40A 3CL7A 4PMYA 1IWBA 4C6NA 2VX4A 2NUWA 4D9PA 2GJRA 3CIVA 2Y8KA 3S5YA 3LBCA 3QQ1A 5D9MA 3TOPA 1ZJHA 3R7MA 2PBGA 1EOMA 4QQ3A 1WCGA 1MEIA 4UXDA 1TE6A 3WN6A 3U9IA 4WUIA 5EMLA 4CNSA 1XLMA 1TIWA 4YHGA 4NY2A 4R9XA 1GK8A 1PWLA 4JTKA 1GJUA 1TB3A 2XSAA 4RNJA 3K8MA 4NVTA 4WR3A 3QZEA 2Y2WA 4TO8A 4LAZA 3W7IA 2YCIX 4DZAA 1HJXA 3RFAA 3EOEA 2XPKA 3W7CA 3CUGA 3HPSA 1WB0A 4H7VA 4EK7A 2E7FA 5DBTA 1A5MC 5C0QA 3QBUA 1O5KA 1MEWA 1LRQA 4Y8EA 2Q02A 2WYSA 2F2KA 2XFYA 1EGVA 4O8RA 1EQPA 5C71A 2WMIA 1N8WA 1JXKA 4D8ZA 4BI5A 4NZ1A 4CUCA 3TJ4A 4XBJA 5LNUA 3SQSA 3ARVA 4N9BA 4I8DA 3T42A 4Z42C 3KBJA 3RXZA 2GUYA 1G4EA 2YDQA 5ABEA 2Q6ZA 5HINA 3RR1A 3TROA 4GBDA 4YHEA 2NXGA 1V51A 4IXXA 4J5NA 4MGGA 3NQCA 5DXXA 4GIRA 4PUUA 3CBWA 3KL5A 2E8YA 1ZLPA 1OCQA 2VZTA 2QDGA 4E0CA 4PUKA 1MO0A 2VZSA 3AAMA 3QC0A 3H7UA 3ANVA 4F0SA 4K39A 2QS8A 3TEVA 3THAA 4JZ5A 4ZB0A 3E6EA 4MWAE 1AW5A 3UNTA 2POTA 4LNYA 4HPXA 3NDZA 2RDUA 3VD4A 1GZGA 5C55A 3H2EA 4Y96A 3UWYA 3IWPA 5HA7A 1LLZA 1JG9A 1EC8A 3HURA 3SCPA 3INPA 3QPYA 4NG3A 4K36A 5H6HA 3TYAA 1E3XA 4L64A 4JIRA 4J27A 1HZYA 1ZY9A 1W56A 3T07A 3BAIA 5E70A 2VMFA 1QVBA 2ISFA 3AROA 4LC8A 4UFJA 1GT8A 3M7SA 2DH2A 5CPMA 2GK1B 1P0BA 1ONRA 4Q8QA 3U2CA 4O28A 3RIKA 4FXFA 1WNOA 1I2OA 2DIJA 3H12A 1LTDA 3LOTA 1ME7A 4C65A 3VD5A 2WSQA 5KINA 3KBVA 1W9DM 1M53A 5DMYA 4DYJA 4WDXA 2V68A 2NXIA 1DJQA 3EWCA 5AHEA 3T2QA 3CAVA 2OKTA 5A8NA 3MDUA 2FDMA 4C7DA 1P43A 5K9CA 4RK8A 3AO0A 2PDLA 2VGIA 4MJZA 1WUEA 2WBKA 1W5PA 5BRQA 3BZJA 2ICSA 1JYNA 2P8CA 3H7VA 2CLKA 1JDEA 5KETA 1LQAA 1JYWA 2BASA 4AZBA 3E1F1 2W91A 2D0GA 1QWKA 5LIUX 3MUCA 2QJNA 4JTHA 3MY9A 4WDTA 3L2IA 4DYEA 3MUXA 5I3FA 3SZ8A 4S38A 4MZ1A 2GJPA 3B0PA 2HNHA 3BLKA 2YCLA 3LNMA 4OTKA 3G1XA 1TZ9A 3TH6A 3I68A 4JTAA 2VX7A 3QGAC 3KEHA 1EWDA 1R30A 2QIIA 4U4MA 3L4ZA 1ZSXA 4AWEA 4ACZB 1JCJA 3C0QA 4EWJA 1J6PA 1TR1A 1DE5A 3DHFA 3HQNA 1NF0A 1NJJA 3WH6A 3UJSA 1FCVA 3NQVA 4GYJA 3TJIA 4Q8OA 3PULA 3GUWA 1UA7A 2PDCA 4ASTA 4GY0A 3VD9A 4S3AA 4PBEA 3GY1A 4GUHA 3MSYA 3WD2A 2P8BA 5I09A 1E9ZB 3LCHA 3PBYA 4R34A 1ALDA 3KRZA 5AB3A 3GXTA 4XZIA 4TU1A 2X40A 3GTXA 1JF5A 5CXPA 1SW0A 4JTRA 3GLCA 1UZHA 4GVFA 1X1ZA 1S2UA 5G1TA 3KBSA 1OWQA 1TO3A 2PWDA 4E8DA 2O9PA 5E0FA 3OVQA 2XDFA 2AOSA 1F4AA 1OD0A 3LSCA 4GACA 1S2WA 1HVXA 3QTPA 1M65A 1MW0A 1ISVA 3N2MA 3BAKA 4O19A 4EF8A 2ZUVA 1NDZA 2P3EA 4H8VA 3R11A 4M56A 3SB0A 3BLFA 4M51A 3QW4B 2DORA 3VFLA 3UYCA 1WDWA 1IT7A 1V79A 1PJ9A 3RLHA 1YX1A 1JDAA 2ZYFA 3M0XA 1LBLA 1RVGA 4Q8PA 2A3LA 5LGXA 4NAEB 4QAIA 6XIAA 2B7QA 3AI0A 4JNZA 1SSGA 4IG2A 4FNPA 1G1YA 3A6OA 4WDWA 3UF9A 3QOKA 5DRIA 1OK6A 3W22A 1TWWA 3LLFA 3C2VA 5G2HA 1H49A 3L4WA 1G7VA 1KM5A 2XVNA 3LCLA 3HPXA 3GE7A 2ACSA 3SECA 1WXYA 4FNQA 3VNMA 2OXNA 2JEPA 1K8ZA 1NAL1 2AKMA 3C2RA 2EHHA 3LX9A 1EP1A 1F61A 1NU5A 3EWXA 3R0DA 2YR1A 3LA4A 3HV9A 3GO2A 3TQKA 4OQVA 1DJNA 3PANA 4XD3A 2J9YA 1VHCA 4QE4A 3IRSA 3Q94A 6ENLA 4JX6A 4AXKA 1CPUA 3VOJA 2WM0A 5E5CA 2J79A 1XRSA 4Z0JA 2VD9A 2YBTA 4IPIA 4MNLA 4FIRA 1XPYA 4YIWA 3ARXA 1JCYA 4TV6A 4AISA 1FH7A 4LOCA 2IXVA 3GNPA 3S1UA 4C6DA 3FJ6A 2GDUA 4O18A 1UG6A 1JPHA 2ZXDA 3TWBA 5E09A 5TBOA 4AVOA 1WKEA 2R8WA 1XCWA 3N13A 1MFVA 4QM1A 4KFPA 1TJ2A 3IIVA 2OCZA 1Y5WA 1EJ7L 1C7TA 2WPGA 4FAMA 1R38A 2VNCA 2VM8A 3FXYA 1SQ7A 3ARSA 1R3SA 2Z1KA 2C14A 4C6EA 2OWWA 1DHKA 3V35A 1H0GA 5HWNA 1EEPA 3FS2A 2YXGA 1Q63A 2HVOA 3CPUA 4QR6A 4JXCA 3DYMA 4WZHA 3R89A 2OR2A 3VIHA 3FAXA 2E9LA 3NXLA 1H7WA 1OEPA 3H7RA 1CWYA 1IGWA 1W3KA 1XH1A 1OFDA 3ECQA 4GH3A 2VRKA 1FDYA 1B3WA 3MU7A 2XM2A 3CMFA 4MJMA 2X05A 4M29A 3LRKA 2E4TA 3C6CA 2G4FA 4LUYA 4OJYA 4O16A 2MUCA 3U5UA 1W37A 5D09A 4KRTA 4WIWA 3L4XA 5A2CA 1G4TA 2CHNA 2PMQA 2DIKA 3G3DA 2BB0A 3AYRA 1PCWA 3EYPA 2HROA 3CC1A 3BG5A 7A3HA 5A6MA 2HS6A 3SM0A 1O12A 1KM0A 1OX6A 2ISDA 3VNKA 3W82A 4IJRA 1W31A 1ME9A 3WNOA 3WO8A 3V1PA 5BRBA 1UW9A 4E3VA 4XBSA 1L0PA 3GC5A 1MRAA 5EBAA 3ELFA 1XLGA 1QO2A 4QIUA 3VKKA 4DLFA 4PTXA 3R94A 3OYZA 4LY4A 1H51A 1F9CA 1KCKA 3K4WA 3W53A 3W7HA 4GI4A 1KLYA 2TMDA 4MJ2A 4Z1BA 1T96A 5I77A 1L6YA 2W3ZA 4QROA 1XJBA 4MVAA 1BKSA 1M7JA 3HPZA 1WKYA 4WX2A 5HNNA 4H6RA 4RNHA 3CLWA 4GYPC 3TJLA 2B31A 4G5DA 2XH2A 3A64A 3A5FA 3FAWA 1HF6A 4LBUA 4KW2A 1Q6OA 3IVUA 1UROA 3N2OA 4XV0A 3P82A 3VIGA 3OGRA 1SJBA 3B05A 4HU3A 4GFSA 2Y4SA 1ZAIA 4Z17A 4DB7A 5A6AA 3DECA 3GWQA 3VDHA 1W5MA 5EL1A 4IIBA 1HUVA 3ORWA 3SIMA 4M0XA 4MLRA 4W93A 3IJ9A 2JE8A 1VLWA 4LXFA 1V6TA 3W83A 3SCTA 2DV0A 2DZPA 3GXNA 1IZKA 2PWVA 3VIMA 3LCFA 2YOCA 3W4RA 3NDYA 3SJ3A 2AGTA 4Q8MA 2ZE3A 1AUSL 4UB9A 1S3TC 1UKPA 2Q8LA 2V2HA 4NZ5A 3W7PA 6ALDA 3PZVA 5BXRA 4XD5A 3FVMA 1BPLB 2YFOA 1XIDA 3KXQA 1RA0A 2CEQA 4AWSA 2CFFA 5JUVA 3U7VA 4ZTYA 4E2DA 1RXOB 2PPGA 5MKGA 1XSKA 5M1TA 3RX4A 4F4RA 2WO5A 2QCFA 1PV8A 2Z26A 1L6SA 1E55A 4ICMA 3R6IA 3QY6A 5I0DA 3G5EA 1W1TA 2PWGA 4MADA 4B15A 2FYMA 4C6PA 1BVWA 3BGAA 3EA1A 3E2QA 1XBYA 1KR1A 1VBUA 2OWCA 1PZ2A 2QZRA 2NV2A 2WMFA 4HU4A 3DKJA 4K37A 3TSDA 2J9XA 2NX3A 2BY1A 3STEA 3EB4A 4PMJA 5A8OA 5AKQA 4EPKA 3C3UA 3HMJG 3HBLA 5CKSA 3I3BA 3NXFA 4BEQA 4F9DA 2VEMA 4AZ5A 3G0SA 4PBGA 3UZJA 2P3ZA 4P2VA 2ZZ3A 2J6XA 2WKLA 1QHPA 1F2JA 4UCGA 1H1ZA 3CZEA 2HVMA 3KLKA 3U8GA 4I90A 3F2BA 3TYDA 3M07A 3WJYA 1O7AA 1UR0A 4GH1A 1YRRA 3S0CA 4UTFA 1I45A 2WHJA 3PPGA 4QISA 3NPVA 3LPOA 2ZA1A 3QMRA 4J3TA 3FX4A 1V3JA 1Q85A 4C1KA 1FWEC 4C1NB 4Q7IA 4Q33A 4CQ8A 5DMMA 4Q8WA 5A69A 2PLKA 1B3ZA 4HB7A 3E2RA 3LCXA 1EJUC 2PWEA 2C13A 3WLSA 1JZ3A 3EB3A 3NZGA 4BZYA 4MWAC 3LS9A 4IMCA 3MB9A 3H2AA 3DH7A 4MHBA 1KFKA 3ZMRA 1W9BM 3PUGA 1NARA 1LBFA 3PNUA 3R0KA 5KMYA 3RPTA 3W37A 1KTBA 2OEKA 4O0KA 1K7EA 5TNVA 2X1IA 5E93A 1BF6A 3ANUA 2F6UA 3DI0A 3HF3A 1VRXA 4UOQA 3R12A 3TA6A 1KV8A 2E5DA 4R85A 4J28A 3GVGA 5AHLA 4NYUA 2JQXA 4DF2A 1W1YA 2ZZ7A 1ITXA 4K3ZA 1RJPA 3USZA 2GPTA 1XDJA 4JTQA 3NFUA 3BV7A 3AXMA 5FI8A 2OMAA 1EA9C 3QR0A 3PC0A 2DT2A 3CUHA 1VYSX 3WL0A 5MHBA 2V5DA 4HYVA 3BW4A 3NPXA 5I00A 2ZE0A 4DUVA 3GFXA 2HTMA 4YVVA 3XINA 4W87A 2BY2A 2ZUWA 4I7UA 5F1VA 1ZP4A 3L0KA 1OX4A 4C1NA 4NZ4A 1AD4A 1Q7QA 1VRDA 4WKAA 3GTHA 1PSCA 4HCDA 4HJWA 3A9BA 3F2CA 4KCTA 4RCXA 3V0TA 3CUXA 3OW1A 1J12A 1H5VA 2DZTA 3WQ5A 2DVXA 1UMYA 3UERA 1Q13A 5H1WA 2RHGA 2QUNA 3FGCA 3L66A 4JIIX 4FB7A 1FH8A 1YNYA 4K2SA 4LYKA 3AIQA 1LOLA 4HYWA 2WZEA 1MMFA 1MZRA 2X1UA 4NKCA 4HQVA 3W02A 2H8ZA 4LVDA 1BTCA 3LLDA 1NF7A 3WDJA 2OGYA 4YWIA 4JIHA 4KGJA 1VZWA 3VIOA 3EX1A 1VLIA 3OVGA 2G95A 1HX0A 5LNSA 2OQYA 4OOUA 4ZQOA 3RPMA 5I79A 4KWSA 3WBWA 1CGWA 3H4GA 3DOPA 3P67A 1TIMA 4XAGA 3HA1A 2WNNA 5HWMA 2PDGA 1NWUA 2P50A 1UWSA 2DSKA 1QU4A 1TV4A 3VNIA 3ITLA 5J5DA 3WLOA 3B8TA 3WJWA 4ZQPA 4NU7A 1JF6A 4FOUA 3WQCA 1EL3A 1NQKA 3BGGA 5XINA 3WUGA 3HB9A 1IYXA 4XTDA 4IQDA 4IPLA 4ZA0A 1EA0A 1ZBVA 3RJYA 1LWHA 1K6AA 1WDSA 1TPVA 3WH8A 4C7FA 2WLYA 4M7SA 5JVLA 1SZRA 3P14A 1CXEA 3SUSA 3T0AA 3LV6A 1G6CA 1F76A 5AYBA 3N19B 5HUPA 1PKMA 3LK6A 3CJPA 4DUXA 2WJEA 1OZMA 3QSRA 1M41A 2QJMA 3ATYA 3PF3A 3S42A 2P53A 3NZPA 1EUAA 1CB2A 3U2OA 1C8QA 2FTWA 1S5VA 4MB4A 3EPNA 1Z9AA 4UFKA 2HXUA 3SUUA 3RX3A 1A4LA 3T0DA 1FDJA 2OGJA 4AYGA 1RVKA 2D73A 4XAPA 1D7FA 3UWEA 4NHVA 2A0NA 1B30A 2ZZ5A 4ADUA 1A4MA 1IT0A 2XWDA 1L6FA 1VS1A 4GLEA 4XZ9A 2QYGA 3KAOA 1ITCA 2CLFA 1ECEA 1DXEA 1G5AA 5C7VA 2WSPA 2Z4GA 4H3DA 2XUCA 4H4IA 2DUZA 3NQFA 5LKYA 2PWHA 4JFVA 1RQHA 1RSCA 5ABGA 1W3IA 1JEZA 1CTNA 4O1BA 4G9PA 5A5WA 1UIOA 4J3ZA 2DUAA 2GJNA 3QSTA 3QN3A 3AMLA 2ZX8A 1AW1A 3L0NA 4M6VA 4WGXA 2X09A 2J74A 5A8GA 3TDFA 2XVPA 2A3AA 3TN5A 2DEPA 3EX3A 1LQ2A 3O0FA 4B5XA 4ZR8A 1CGUA 4F3HA 5EU9A 3WZ0E 1FQ0A 2CZEA 4GPNA 1XUZA 2XG9A 4ZQMA 4UQEA 3GDLA 4DWDA 1ELSA 1B90A 3VFCA 3KVLA 3XISA 1JPKA 1JD9A 4F2BA 4GZEA 1AQ0A 4H04A 1YPXA 3O8AA 2VXNA 1FVPA 2A7PA 3KVKA 3WFZA 1T7LA 3KCOA 4HHLA 4WD0A 4AZ6A 1ZRQA 4UOZA 2BVWA 1WO2A 4CEXC 2ZX5A 4GNVA 4XAFA 1YXDA 1O1HA 3NQAA 4C6LA 1W3HA 3DGBA 3AYVA 4ACYA 1KM1A 3ZM8A 2PDPA 3WQ4A 3KTSA 2GK1A 1UYQA 1Z41A 3KW3A 5CG7A 4HMNA 1KXVA 2EG7A 3C52A 4IIDA 3UYIA 2DSWA 2GOKA 2VDHA 1HNYA 3SQMA 1EWEA 4W5UA 5HQLA 1GYNA 2D3LA 3QQ0A 1GOWA 3Q58A 1BKHA 2XN0A 2AL2B 1NFGA 2XVGA 5L9FA 1U5JA 4ZO8A 2XSXA 1AQMA 4JN6A 3VIJA 5AC6A 1QW9A 4ZCWA 1SW7A 1DOSA 4P8WA 1DJXA 4FSAA 4HSOA 4DAFA 3GYCA 3TLLA 3DFTA 4UR8A 3WNPA 3I7SA 3EDDA 5IBXC 2J24A 4DYKA 3UWQA 2CESA 1UP3A 3BW3A 4H83A 4JHMA 3IGSA 3CZLA 3I3EA 3DDMA 1PHWA 4JD4A 3ITVA 2V5KA 1I2RA 4J9JA 5DANA 3R4IA 2GGJA 5LIXX 1IIGA 2B81A 4FLSA 3CH9A 1GOOA 3M41A 1YADA 3ID7A 5CQ1A 1V02A 2V63A 4M6UA 1NY1A 3TQ0A 4FXRA 4US5A 4MUPA 4D2JA 2QEZA 3AIUA 3EMZA 1MEHA 3RJXA 2O55A 5FAJA 4GOAA 1FBAA 4MUZA 2A3HA 4KFOA 4KS0A 4C6JA 3PAOA 2PGWA 2E5BA 1XIEA 2QUMA 5EMMA 4EXAA 4UZUA 1HJWA 3TYEA 4MTVA 3UPMA 1RPKA 2IPJA 1FWNA 1JYVA 3VVGA 3PFRA 3WLJA 3B06A 1E9IA 1CGVA 2DPEA 2JF6A 4DPQA 4XVEA 3S1VA 4RNFA 1FWRA 4LBRA 1XSJA 3W6MA 4GJIA 3SADA 1XLAA 4QS6A 4QLJA 1EO7A 1XD1A 3UPBA 1AVAA 2JKPA 3G18A 4H9XA 5I03A 1J0IA 4JYDA 4QQUA 4JNMA 2FPVA 4HJFA 1V7AA 3EZ4A 1PTGA 1F73A 1XBZA 5KEZA 1Z89A 2Y7GA 4RNIA 4DN1A 1US0A 2J7EA 1UWUA 5I3JA 3WQ8A 1CGXA 2PTXA 4JIQA 4NIRA 3S4TA 4Q4MA 2P76A 1P6BA 3JZEA 4DWSB 5CZJA 3CUZA 3EKLA 4X0NA 1VD6A 4ECLA 5CSSA 1IZCA 1OIMA 3DGRA 5DY2A 4Z2HA 3GIYA 3AIVA 4QITA 3FN9A 1IEQA 4A2RA 3VC5A 4H9TA 3P6LA 4XD6A 1XX1A 1YEYA 2W61A 4AFYA 4JQ2A 1M3UA 4EPEC 3H4WA 1OGBA 1QRQA 3UZ5A 3NZQA 3W1MA 2E5CA 3W1PA 1ENUA 1GZ1A 1NWTA 2QR6A 3I10A 2O56A 1W1ZA 3P0WA 1GEQA 1V3HA 3TSBA 4FK9A 2DSZA 2TPSA 2WQPA 4BCEA 4D8AA 4PA8A 2DY3A 3GW3A 3QLLA 3I7RA 3QMSA 4IGNA 4NJJA 2NQZA 4OFCA 3RM4A 4DLMA 2QAFA 3VMOA 2WWDA 2JKAA 4NRRA 4N9CA 3WF1A 3QKEA 5BMXA 4M1BA 1A5AA 2BHZA 1VBJA 4YXGA 1T99A 2VI0A 2W27A 3OBEA 2OLAA 1BQCA 1SUXA 3WUBA 3PZ9A 6REQA 1ZU8A 4IT1A 2R94A 1Z32X 2CCRA 4Z2IA 4WVXA 3R25A 1SU5A 4WOQA 1QPKA 4QXIA 4MYXA 4WK9A 1UOKA 3DYOA 5EY5A 3BSGA 3PK7A 4GIEA 1K7XA 5A8QA 3S8HA 3WJZA 4L1WA 2ZRWA 4QE1A 4JQ1A 1R2RA 3GHRA 3MCNA 2FLIA 3QVQA 1O60A 1U1UA 2V2CA 1BQGA 3BH4A 2GJXB 3GX9A 1XP3A 2BHYA 1C3FA 4G8TA 1PYMA 1W5NA 4MG4A 3TW9A 3W9ZA 3F4WA 3WDPP 3S47A 3ZT5A 4B2DD 2GL5A 2E77A 2V30A 1TZZA 1TA3B 4HU0A 2W67A 3OU8A 1W3NA 3UA3A 2O4QA 1UH4A 1BWKA 2VUYA 3NM1A 3BANA 3ONBA 4XZBA 1A0CA 4D6HA 1JRBA 1WBHA 4O1AA 1ISXA 3MC5A 1CXHA 3VCRA 2HJPA 3HGJA 3ES8A 3LPPA 3CQ0A 4Z2LA 1CW2A 3M47A 1V3LA 1XLDA 1UCWA 4U10A 2X2GA 3MO7A 4UQDA 3KVJA 2Q3OA 4WSKA 1AQHA 2TRSA 3OZYA 3MUIA 4P7QA 2HMCA 2W62A 2XIJA 3NPWA 2J7BA 2HBXA 3B0XA 5AC5A 2VRJA 3ARUA 4AD0A 1CNVA 3WNKA 1VPQA 3NVTA 1XFBA 5H2ZA 2CHRA 4GISA 3GXMA 3CHCA 2V5JA 2CHOA 1DXFA 5FSEC 1QPOA 2AL1A 2C8NA 4OE7A 4LUSA 4JYEA 3KVMA 1KO0A 2PLJA 2FQIA 1J2WA 1TUFA 3IIOA 3DBNA 2GZXA 3PBWA 2CXGA 4OV4A 4J4KA 2J47A 4ZE5A 1H0IA 5HMEA 5HBFA 4NZJA 4CNPA 1B3VA 3U48A 3KL3A 4B5WA 3QXBA 3KM8A 4IP4A 5BU9A 5A6LA 2VO5A 3OG3A 3S9IA 2YW3A 1DE6A 4LNCA 1W1A1 5D8WA 4RX0A 1XG3A 3DFOA 3PN8A 4GY1A 1D3HA 1WZLA 1SJCA 1WZKA 1ZGDA 2G41A 1I0DA 4RE0A 4AD1A 1UWTA 1POJA 4M8UA 3TR2A 2V8ZA 3AMCA 4M24A 3ABXA 1DORA 4GCAA 4G7FA 1E9LA 4PMQA 4RPQA 1TJ0A 4QLLA 1ONWA 5C2CA 3THUA 3WK1A 3LGGA 2X1TA 1EHAA 1A5SA 1IXNA 3GU1A 2QCDB 4ZFMA 2WCAA 1IEIA 3LQLA 3QMTA 2FHCA 1TE1A 3IJ7A 1VENA 1R0MA 4U5KA 3UCDA 4N0RA 4IM4A 1QNQA 4JQAA 1T0OA 2I5IA 3SRDA 2XIBA 3QEZA 3M0YA 3KFTA 3ALGA 4P61A 1ZB5A 3EOUA 1HJQA 5CC6A 1J01A 4MNMA 4H9ZA 4BI7A 4OT7A 3SUTA 3N4FA 1JCLA 3D5HA 3GBEA 5BCAA 1L6WA 3H2OA 3AQUA 3VX0A 5BWAA 4JGDA 1OF6A 2GWNA 1JZ8A 4JFSA 1PS9A 3L4YA 3GVQA 3WNMA 4PSPA 2QJGA 3GDMA 1VBGA 5MF5A 1TR9A 4HZ8A 4O4WA 3USBA 1ZNNA 3DHDA 3RYSA 1A80A 4JL2A 4EE9A 3NO3A 1A5BA 1GYLA 1UD5A 5B80A 3WLLA 2D69A 3SFWA 3SFKA 3HZ3A 3LDVA 4ZEPA 3DFHA 3WFAA 1QI2A 3UCQA 1XM3A 3WJXA 2QAPA 2VX6A 3E5BA 3OLIA 1A53A 3HJEA 3TQPA 3WL1A 3GHUA 5AZ1A 2WZMA 3EEGA 3O05A 5HOSA 2J25A 1IEXA 5AC7A 1O66A 3S83A 5REQA 3VGDA 1ZP3A 3N11A 5A2AA 1UR9A 3SW6A 4X63A 3WJSA 3V3WA 1AG1O 3MKKA 3CAQA 3E02A 3R13A 1V02E 3CZKA 1W8GA 4I7VA 1A5OC 4QJ5B 1FHVA 2KAUC 3HPAA 4KMQA 4LCQA 3S9ZA 4DXVA 7REQB 2Y24A 2O7SA 2YA2A 2X41A 3EMQA 3EPOA 4XSMA 3KWXA 3GXFA 1RJQA 1JZ7A 5H8UA 5JQ9A 3MQTA 3FK4A 1AFSA 2OVLA 4B5SA 2V67A 1MFUA 3H55A 5PTDA 4YVXA 5EFFA 1M7OA 4AHPA 2WANA 3GVVA 4GI8A 1W1B1 4UTWC 4ZBCA 1BYBA 1GOIA 3NVDA 1E1CB 1F7BA 4C6BA 4NSBA 4QSFA 3LGEA 4YWSA 2QMKA 3QHNA 2WMKA 3AZRA 3PB0A 2F2HA 3S2LA 3BCFA 4MWAD 4GJJA 1Q65A 3FHQA 1Q2RA 3IIPA 1M7XA 3ZS4A 1XF0A 4MOZA 2RDWA 3UWUA 4AY1A 2VDIA 1XDMA 5IOBA 2OSXA 1IR1A 3QLDA 4DQWA 2YLAA 1E0UA 3CTLA 1R86A 2GVLA 2WOQA 3N6QA 4MLJA 3SY8A 3E0LA 3W00A 3BG3A 1OFPA 1S38A 1N55A 3GC2A 2Y85A 1KCZA 1DQUA 2NSOA 3IJLA 1S46A 3VPLA 1QOQA 1UJPA 4GQGA 2OT1A 2F7FA 1YW1A 2R1LA 1UJQA 4AX7A 4IHCA 1GQLA 3BCDA 3ANYA 1P1MA 2HK1A 3E2VA 3FGCB 3CPRA 4A8IA 1VFFA 1W0MA 2I5GA 1UKSA 4PRRA 4M7TA 1EUNA 1XLIA 2QUVA 2VCAA 5TF0A 1Q7MA 2Q8ZA 4BA0A 3OPSA 2REQB 1ZS2A 2A1YA 2VEFA 4LU0A 4A3UA 2DZBA 3N14A 3AIEA 4JL1A 4DNHA 3G1FA 5HWJA 3GHSA 2H3DA 3MSDA 3W86A 1GTEA 3G6LA 4CGTA 5CCZA 1OBAA 3LBMA 4ZL1A 2WHKA 1UH3A 4LQ1A 1F6KA 3WF0A 1KKRA 2PDNA 2C19A 1E6PA 1OFBA 1TPH1 1H7OA 1A5KC 3MMUA 1KV5A 2CWXA 2BLEA 3H6OA 2WKGA 4Y7EA 3ICJA 2R1NA 2NQ9A 2ZTJA 2PFHA 1OABA 2WMHA 4GYFA 3R5EA 1GVRA 1H62A 1GCYA 1FOBA 2Z2BA 2Y7EA 2ZUTA 3VDCA 1QI3A 3WEOA 9XIAA 2Y1HA 1CYGA 1JL8A 1S5MA 1VKFA 1EGMA 2YA1A 1WAUA 2J8TA 2G50A 3O07A 2Z25A 1KM6A 3M64A 1LL4A 4GYKA 1XGDA 1XIIA 4XAZA 1SFSA 4BK9A 3CMJA 1YTEA 5G4EA 4IZGA 4O57A 3WH9A 3WELA 1UWRA 4WJXA 2WCSA 4XX6A 3UW6A 1J6OA 1XUUA 4EX4A 3AHXA 1ITQA 1UD4A 1J0ZA 1A5CA 3BLLA 2RKXA 3ARPA 2O9OA 1KGXA 1BGAA 1X6LA 1GJWA 4ICNA 1LRNA 1EO5A 2OQLA 5CC7A 2C18A 3ARWA 2ZDSA 2HPIA 3AS1A 1EP3A 1UPPA 2Z24A 2TSYA 2V3EA 2EKGA 5BROA 1CEOA 4UNLA 3DERA 5F2MA 3TN6A 1I4NA 4FPSA 4LANA 3BG9A 2GGGA 1ME8A 3K2GA 1UQZA 4IJBA 1FWDC 4AWUA 3BXWA 4LF2A 2Y61A 1R9ZA 3MA8A 2YYTA 4GI6A 4QCEA 3E3HA 3MSGA 3Q67A 4H2CA 3POCA 4O1EA 1E15A 1KBJA 4H7CA 3K46A 1K1DA 2Z1WA 1T8QA 2PDYA 3EX6A 2NQJA 1QPNA 3DYPA 2ZZ6A 3PS7A 5AC4A 2EPNA 5G1MA 2D1ZA 4AY7A 1UUQA 3VX1A 3QGKC 1K4GA 4ADTA 2BXVA 2YZ5A 1N8FA 1HTIA 3SCQA 5HQMA 4KGLA 3DZ1A 1YXCA 5F1UA 1EJTC 4IFKB 1ESWA 2NLIA 4A6GA 1H7RA 4PB3A 2NZLA 1UD3A 3TU9A 4NAEA 3VZZA 1H2JA 2BODX 3CYVA 1WDPA 4LWWA 1PZ1A 2P0IA 3SEPA 4GXWA 3H53A 1J9YA 3WLMA 1L8NA 4WJ8A 1QHZA 3APYA 4I5XA 1QI4A 1PE1A 3BZGA 3TK7A 4HZMA 1X8FA 4F0RA 1XLJA 3VGBA 4D1JA 4N9DA 1OGGA 2DW7A 1OGSA 1AH0A 1TG7A 1YYAA 3HV8A 3IK4A 3P80A 5EKYA 1K70A 5D2VA 1N82A 3VIKA 3UJEA 3G0UA 3S5OA 2V82A 2FH8A 2IKHA 5FL1A 1GOQA 1M03A 3CAKA 1XWYA 2X30A 4IMDA 3W2NA 2PDUA 4GIAA 1UKQA 3HGSA 1FCUA 2X0SA 1YDYA 1H3GA 1ISZA 1TMQA 1PPIA 3AZSA 2QHAA 5A95A 3LB0A 3LI0A 3QY7A 3B9DA 4V27A 1FY6A 3UWVA 4GA8A 3NQ6A 1VFTA 3IJIA 3NTYA 3W27A 4JTJA 4I9JA 1JVNA 4S3BA 4QAWA 4E5TA 3G2GA 2CXEA 1KM4A 4GO8A 3R10A 2OYKA 3TC6A 1FWBC 1B3OA 2NVAA 3WUFA 4DBSA 1V93A 2IUZA 4JIPA 1ZTVA 3W26A 4FLOA 3AOFA 4J3UA 1Q2SA 1KW1A 4HHPA 5DMNA 1BTMA 1UB3A 4Z2KA 3N2BA 3OB8A 3BCJA 1AJ2A 4WSJA 3CWOX 1PBGA 1C92A 1S2VA 2V5CA 4C90A 1H61A 2DJLA 3N6HA 1SR9A 4Y9OA 1V3KA 1AODA 4M1RA 2EQDA 2I17A 4GVHA 3JW7A 4B5VA 5FEWA 2ZZ2A 1CENA 2EJAA 3OP2A 3NEVA 2X16A 4BWLC 1XIMA 4FX8A 1GVIA 1LUCB 3OHMB 3C2EA 3NR0A 2OFJA 3ZLFA 4D6IA 1QW7A 1GVSA 1OX4B 3S1XA 3MW7A 3UR7A 3CAWA 1FXQA 4LUJA 1LDCA 1HKMA 1PUDA 3MJYA 1NOUA 2ATSA 4ZOEA 1DBTA 1JCTA 5CZTA 2CBIA 5E1QA 3HQOA 1MDRA 4YS1A 3TNOA 4GBUA 1QMLA 2ACQA 4RDZA 4LVBA 3W75A 4AZCA 5CGTA 2WJDA 4O50A 3M16A