3WBWA

Crystal structure of gox0644 in complex with nadph
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
271
structure length
271
Chain Sequence
EAQTVISFHDGHTMPQIGLGVWETPPDETAEVVKEAVKLGYRSVDTARLYKNEEGVGKGLEDHPEIFLTTKLWNDEQGYDSTLRAYEESARLLRRPVLDLYLIHWPMPAQGQYVETWKALVELKKSGRVKSIGVSNFESEHLERIMDATGVVPVVNQIELHPDFQQRALREFHEKHNIRTESWRPLGKGRVLSDERIGKIAEKHSRTPAQVVIRWHLQNGLIVIPKSVNPKRLAENLDVFGFVLDADDMQAIEQMDRKDGRMGADPNTAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Gox0644 in complex with NADPH
rcsb
source organism Gluconobacter oxydans
molecule tags Oxidoreductase
molecule keywords Putative 2,5-diketo-D-gluconic acid reductase
total genus 101
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3wbwA00
3BURA 1Z8AA 2WZMA 3G1RA 4QX4A 3WCZA 4H8NA 2F38A 1RY0A 4GABA 2ISFA 4H7CA 3COTA 1S2CA 1EF3A 3CAVA 2WZTA 3UWEA 1US0A 1UR3M 4DZ5A 1XJBA 1EKOA 3DN5A 3GHRA 1K8CA 3Q65A 1HQTA 4MHBA 1T41A 2IKIA 1AFSA 2PZNA 3GHTA 1EXBA 1HW6A 2ACSA 2IQ0A 3H7RA 3CASA 3O3RA 4EXAA 2IPGA 5LIWX 1PYFA 1GVEA 1Z3NA 4I5XA 3V0UA 2BP1A 2R24A 4DBUA 2AGTA 3N6QA 5LIYX 4R9OA 3N2TA 2IS7A 3RX4A 4HMNA 2IQDA 2FVLA 4ICCX 3T42A 4JIHA 4L1WA 3GHUA 1FRBA 4WDUA 1S2AA 2PDFA 2P5NA 1LQAA 1MI3A 4PRRA 3UGRA 4GA8A 4AUBA 5KETA 2C91A 3LENA 4DBSA 2FZDA 3G5EA 2IPJA 2PDMA 3M4HA 2HVOA 4XZLX 3R8GA 3QKZA 1ZGDA 4LB4A 4XK2A 1YE4A 3MB9A 2A79A 3P2VA 1M9HA 3C3UA 1PWLA 4GIEA 2INEA 4JQ3A 1LWIA 2NVCA 3UZWA 5LIKX 1S1RA 5JH1A 2PD5A 2HE5A 4WDWA 4DBWA 5M2FX 1VP5A 4XVEA 3LBOA 3R8HA 1R38A 2PDGA 3WBXA 3ONBA 4WDTA 4NKCA 4IGSA 4XO7A 1PWMA 4L1XA 4FAMA 1IEIA 3EB4A 5JH2A 3BCJA 3KRBA 4JIIX 1AZ1A 2PF8A 1SM9A 1QWKA 2PDNA 4QBXA 4WRHA 3LQGA 3GHSA 4IJCA 2PDQA 1Z9AA 3B3DA 1XGDA 3NTYA 2PDPA 1X97A 5C7HA 2NVDA 4JQ1A 3R43A 3WBYA 3ERPA 1OG6A 4PUUA 3UZZA 4YVVA 4JTDA 3LNMA 2PDJA 1S1PA 4JIRA 4XZIA 4XO6A 3V0SA 4YVXA 4Q3MA 4LB3A 2PDLA 1Z89A 3Q67A 3BUVA 4LAZA 4WDXA 3UYIA 1J96A 1ZQ5A 3LEPA 3UG8A 2IPWA 2PDYA 2HDJA 2DV0A 5HNUA 1QRQA 2INZA 2PDHA 2ACRA 4ZFCA 4WEVX 4GACA 2FGBA 4PRTA 1AZ2A 3R7MA 3EAUA 4LBRA 3UFYA 3O0KA 1VBJA 3M0IA 1ZUAX 4XZMX 2IKGA 4JTCA 1X96A 2PFHA 4XZHA 2HVNA 4YVPA 1AH4A 4XVDA 5AZ1A 1IHIA 3EB3A 3LZ3A 1A80A 3CV7A 5LIXX 1RALA 2PDWA 5DANA 5LIUX 1Q13A 3WG6A 2IKJA 4JQAA 2I17A 4G5DA 2IKHA 1C9WA 4FZIA 4GCAA 4HBKA 2FZ9A 1ZSXA 2R9RA 2PDBA 1RY8A 3UZXA 1AH0A 1JEZA 2FZ8A 3VXGA 2HEJA 2ACUA 2QXWA 1X98A 3LN3A 1MZRA 4YS1A 3FJNA 3U2CA 4JTRA 3WBWA 3RX2A 5HNTA 3LD5A 1Q5MA 2BGQA 2FZBA 3R94A 2PDUA 3MC5A 2HV5A 3S3GA 4JQ2A 4JQ4A 5HA7A 4LBSA 4EXBA 3FX4A 2CLPA 1MRQA 4XZNX 3F7JA 1PZ1A 4RPQA 4JTAA 3DOPA 3D3FA 4OTKA 2J8TA 3LQLA 4LAUA 3H4GA 4GQ0A 3R6IA 2I16A 4FALA 1ADSA 4PR4A 4QXIA 5AZ0A 4YU1A 3LUTA 2ACQA 4PUWA 3UP8A 2ALRA 4PMJA 1YNPA 4WGHA 3V35A 4Q7BA 1AH3A 1EL3A 4ASTA 3LZ5A 2DUZA 2PEVA 3BV7A 2PD9A 3V36A 3RX3A 2PDCA 1T40A 3V0TA 1XF0A 4IJRA 4F40A 1YE6A 2VDGA 4GQGA 3CAQA 3R58A 4JTQA 4XAPA 2F2KA 2BGSA 3CMFA 3ONCA 3CV6A 2PDKA 3M64A 2IPFA 3H7UA 2PDXA 2PDIA 4FA3A 4QR6A 2DUXA 3UZYA 1YNQA 2HE8A 3GUGA 1PZ0A
chains in the Genus database with same CATH superfamily
3S2CA 3MMTA 1HKMA 1QAPA 3L4UA 3M9YA 4JX4A 2W0UA 5DBTA 4N02A 4P8WA 1VFHA 3F2DA 4GH1A 4Q4QA 1EA9C 3N15A 2GGIA 1GEHA 1NDZA 4OUEA 3NGFA 3ZOAA 2J75A 3TONA 4DUWA 4PSRA 1EKOA 3WLSA 4R7WA 2E9MA 3STPA 4Q4KA 2NWRA 1TIWA 3L2LA 4Z2JA 5KZ6A 3H55A 3VIJA 2Y61A 4EP8C 3MHGA 3RNDA 2PLJA 4B92A 1WZKA 4ADUA 2IPGA 1N55A 4AZ6A 4ZCWA 1NVMA 3GE7A 3QQWA 3TUUA 4HHPA 1QPRA 4L9XA 3C61A 3DFSA 1SO6A 4XKMA 3NAVA 3N73A 5KMYA 3C0QA 2XIIA 4F0RA 1VC4A 2CBJA 5FIPA 4L1WA 1SO4A 4CD7A 4LNCA 5G4WA 1Q4WA 5LSMA 2PWDA 4J3SA 4XD3A 2WKJA 1TTJA 3WQDA 1F74A 5BOOA 4LANA 4UTTC 4A05A 4CNUA 3S1WA 1B90A 4CCCA 2PDMA 2F6UA 4GWEA 1TR9A 1TV2A 2WOQA 3C52A 4C1LA 3A9BA 4W8LA 1EDQA 2GGHA 7TAAA 3CLMA 3P2VA 1A0EA 3W82A 1UWQA 3AU2A 4JQ3A 4MWAC 4DZIA 2PGFA 1Z41A 2NVCA 2BSLA 4JN6A 4US5D 3JRKA 3UPMA 3STCA 2H6RA 4H9TA 4DUXA 3QV6A 4C65A 5D2XA 1BYBA 3QRHA 4DIAA 1K9DA 2OYMA 3B0VC 1J93A 4HOWA 3IEBA 4LV9A 3AIQA 3PNUA 4DLFA 3RO8A 4QFUA 3GVWA 3A47A 4PMNA 2NSXA 1BKSA 4KWVA 2V3GA 3QYQA 1UUQA 1L9WA 1NWUA 3GHSA 1NY1A 4NAEA 4MDOA 5HWNA 4EXQA 5EFFA 3N2MA 5BWFA 1IT8A 3U8GA 4JHMA 4PUUA 4ZMGA 3HFYA 2Q02A 3VAVA 4U33A 1V7YA 4LUJA 5DT7A 2Z26A 4E2OA 4NIRA 3W6MA 3NXLA 3DFYA 3BUVA 4JKLA 3V5FA 1TV5A 1A5LC 4WDXA 5GQBA 1W5MA 3EDDA 4JIEA 1ZTVA 4DJDC 5HANA 1K9FA 1QDSA 3FNDA 1N2VA 4DPQA 1LT7A 1HGWA 4UQCA 6CGTA 2DZPA 4TOQA 1JPKA 1KM5A 4X63A 3MBDA 3LNPA 4MF4A 3H24A 3NM1A 3LRLA 5AVHA 3BTNA 3QZAA 4LRSA 3ARPA 2V67A 1LDCA 3BCDA 3K4AA 3VOJA 5IDIA 4UC5A 4D2JA 1W3JA 3F2BA 4ADTA 3UVIA 4Z42C 2OEMA 4Q8WA 4IPLA 2HVNA 4OVXA 1ICQA 3W7KA 1C8XA 4MLJA 4K37A 4KS0A 1M65A 4IT1A 1HNYA 3WD0A 3G0UA 3WK0A 1LP6A 1MYRA 3U2ZA 2ZDRA 1IZCA 1C9WA 5MF5A 4L6OA 3REQB 3AHVA 4D72A 2R9RA 5F1UA 2FZ8A 4AD2A 1L6FA 2QXWA 4E0CA 2GSHA 2DW7A 1I0DA 3M0KA 3HG2A 4X0VA 1UJQA 4H9UA 3VA8A 1TG7A 3P80A 3E3HA 3G77A 3KBNA 1J11A 3B04A 3P0WA 3VMOA 9CGTA 1QPQA 5FJOA 3B8SA 1QBAA 4PMRA 8XIAA 4RXGA 4K68A 1EO7A 2ZC1A 3TN6A 4BI5A 3FXYA 2YKKA 3AFBA 3W73A 4D6FA 3FX4A 3NDYA 2F7FA 2JF7A 3HFTA 4C6CA 1B1YA 4RX0A 1P6CA 4A8RA 1Q45A 2DT0A 3ITCA 4X9SA 2XPKA 1BVZA 4EOUA 1ITQA 4JTAA 5ECVA 3GD6A 4ICNA 4RV8A 2AKZA 3LQLA 2QJNA 4BQ5A 4RK8A 4H8HA 3WDQA 1UIPA 2E6YA 2E25A 1KFBA 1JYVA 4D9PA 2QJIA 1G7VA 3N9RA 2NX1A 4JY9A 1WDSA 4JD4A 3NO3A 2W6RA 1UD4A 1Q63A 2HNEA 5CH9A 2VR2A 3W9ZA 4YU1A 2QGHA 1Q6EA 1XCXA 1RQEA 2G97A 4JTUA 2ALRA 1UA3A 4R7OA 1DIDA 3SAZA 3PBMA 3WX7A 2YDAA 2HK0A 4CQAA 1EP2A 1I45A 3IIPA 1E6RA 2PURA 2QAPA 2BVYA 3SADA 5ABHA 5AHEA 1J12A 3CTLA 5K9XA 1DPMA 3SUSA 2SFPA 2X1IA 2IPFA 4IZGA 4AAJA 4HZ7A 1GPWA 4X2RA 2YW4A 3FAXA 4AY1A 3EOSA 3GDKA 5EU9A 5D2WA 1Z44A 4S39A 1VJZA 3WD1A 3M44A 3TSMA 1FWAC 4O11A 2C1IA 3G1RA 4I6VA 1IWBA 1O4UA 3WCZA 1PZ3A 3B8UA 3HOJA 2OSYA 1XKYA 2W91A 3NUKA 4DJDD 3OYXA 4DBDA 1LRNA 2OGYA 1JG9A 3W71A 3IIOA 1B3VA 3AC0A 5LXXA 2QUUA 2BVDA 1A5SA 3W7PA 3VCRA 5IOBA 4FOKA 1EGVA 1VFUA 2YXOA 1QHPA 3WDPP 3STEA 5LXEA 5EMJA 1WOBA 2ZOXA 4U2ZA 5G2WA 4NZ1A 4P7OA 1LL4A 2UWFA 4UNIA 3ZR4A 3GZAA 1E5JA 3NEHA 2J7CA 5AHNA 3IVTA 1XLLA 1ZP3A 3VKKA 2J9XA 2AGKA 3FSTA 5I06A 2UV8G 2BHUA 3O63A 4JIPA 3LTYA 3TA6A 4R27A 5HPOA 1TV3A 2OKOA 5KETA 3S6DA 3A3WA 1KC7A 4M81A 1TTPA 4DELA 1RVGA 3BLIA 2BZNA 5C2CA 3P14A 1EJXC 4LC8A 3W75A 1KV8A 4C5YA 1BSLA 3AS0A 4KW2A 1T5AA 3NJ3A 3CO4A 4HNCA 4GZJA 2WNNA 3BAIA 3LLDA 1G69A 2A79A 5CPOA 3MYPA 2BBFA 3W7GA 3C3UA 3TJIA 1DE5A 1SFSA 4Y6GA 2CBVA 2ZVRA 4XISA 1HG3A 3UR8A 3JZUA 1FH7A 4PMZA 2WW5A 5AYZA 3ZVHB 3NM3A 1TMHA 4HNTA 5M2FX 1QJWA 3RLUA 1UJPA 4GVHA 3TDFA 4AD4A 4C60A 3W88A 3R0UA 3BDKA 5LA2A 3T4WA 1FDZA 2VUNA 3WQWA 5CAHA 1LQ0A 4GYJA 5GJMA 3EPNA 1P6WA 7A3HA 1O5QA 1C8YA 3PWAA 3DKJA 4OUIA 1J0IA 3TJ4A 3LOTA 5HWJA 1JUKA 1GTEA 1BG4A 1YTEA 3VMPA 3GFYA 3KW3A 3KWSA 1RPXA 2ZRXA 5E0FA 4UNLA 1SW3A 1YW1A 4HNLA 2DH2A 4YCOA 2I5GA 4XZIA 3VM5A 1JDEA 1OABA 1EFZA 4Q3MA 3O05A 1E6ZA 4HVXA 2ZX7A 2NXHA 1E1CA 4J3UA 1I2NA 3TCEA 3LCFA 3UETA 5EBAA 2OOFA 1G01A 2CNCA 3VOCA 3AXKA 1LF1A 1X8FA 5I3HA 3HGSA 2QV4A 2ZRUA 4N42A 4Z0JA 4DZAA 4AIEA 3B8VA 1F6PA 3UD6A 4ZZ9A 3U2OA 4ES4A 4CD6A 2OX4A 4U5IA 3AUOA 1ME9A 1FXQA 4UTTA 3PFRA 5CZTA 3TYAA 2V69A 1DQUA 3G3DA 4NY2A 3TYDA 1PXGA 4X22A 4JNYA 3VKJA 1VPQA 3VIHA 3WBEA 4Y8EA 5J5DA 1NWRA 2CW6A 2FTPA 3SN4A 3TQPA 1CLVA 3SI9A 1IHIA 1JQXA 4M80A 3BSGA 3W2KA 2X42A 3SN0A 3ANUA 5ABFB 4ZVJA 4WIWA 3R13A 1DBTA 3FN9A 4N6EA 1UH4A 2OTDA 3WLRA 5FOOA 1SZNA 2FPVA 4P61A 3O1NA 1PX4A 1ZSXA 2PDBA 3NQ7A 4IQLA 5BXPA 1XDJA 4K1WA 4OBRA 4GYPC 4FLOA 2VEKA 2JBMA 4M19A 2WZEA 1G0CA 3KWXA 4J3VA 2BOGX 4U2YA 3XIMA 4O0ZA 1QO2A 3Q58A 3I3EA 4S3BA 3M6DA 2VX7A 2FFIA 3CJPA 4U5KA 1XI3A 2BXZA 4GG9A 2FPYA 4HU3A 1WQ5A 2PCQA 2DZBA 2NQ9A 3GNDA 3B0YA 4UMBA 3UR7A 1JJKA 3MUIA 4OV9A 3N34A 3LBMA 1EDGA 4AHOA 2V38A 2CCRA 1O60A 4IIDA 4CEUC 4AWSA 1QR7A 3SCQA 4JHZA 5C7VA 5I6SA 2QCLA 4IMGA 3ZLGA 3OBEA 3OO2A 1KBBA 1VQTA 1SYTA 4QJ3B 2V68A 3EX1A 4PR4A 4GH3A 4QXIA 1C7SA 4D1IA 4OJYA 1SO3A 4IPPA 4PUWA 4AZCA 1E0WA 3WL0A 3KLLA 2QHAA 3VPLA 1MXGA 3TCSA 3QSTA 1RLDA 2XFFA 5A6BA 4CQDA 1YKWA 3CHVA 3WLKX 3T0BA 4J40A 4N2YA 2QULA 3RXZA 3VDBA 3F4NA 1ZPTA 3LX9A 4NJJA 3UZJA 2R1MA 3M64A 3O8AA 1S2VA 3H7UA 2G3IA 4DBEA 4HOZA 3P60A 1GTHA 2PDIA 1ISYA 1W2PA 4XKYB 3ISIX 2I56A 3T2PA 1L6WA 3VNZA 4A6GA 3BURA 7ENLA 3VNIA 4GIAA 5CBBA 2PI6A 5I3FA 1TIMA 4C6KA 3VCCA 2C79A 2Z00A 1Q4NX 2XVNA 3WLQA 4JTJA 5CSUA 2J24A 3BMXA 4NF7A 2WNWA 4ZO7A 2EQDA 3WQ5A 4BQ2A 1AQHA 1FWEC 1EF3A 1VIWA 1DOSA 2XVGA 1AVAA 3U7BA 2OT1A 4PTWA 1J0JA 2BWGA 4I8DA 3O0FA 4B4FA 3WENA 3ZZ1A 2HCVA 2GJLA 4O0QA 3QV7A 1E5NA 1TQXA 3N4EA 1XC6A 2WZHA 1GVEA 4G2DA 3PBUA 4W7WA 4EANA 1R9ZA 1KCLA 4DBUA 3ZT7A 3GR7A 3DUGA 1GJPA 1TTQA 2HTMA 3Q37A 3CUHA 1H7NA 5D02A 3TZFA 1PB0A 1EX5A 3PC0A 5F2MA 3HQOA 3SRFA 1QWGA 1XFCA 2YYTA 4A4AA 4R85A 1ZL1A 2EJ1A 4AX6A 3CHDA 1KFLA 3T08A 2F6KA 3CM4A 3G5EA 3PZ9A 4JFWA 4MZ1A 4DWSC 2WB5A 4IFRA 4YMZA 4IMEA 2QIIA 4DJED 1C92A 3KOXA 4LUSB 4B2DA 3CL7A 1WKFA 3WIJA 5A2CA 3F4VA 1GOWA 1NF7A 1F9CA 2PTZA 2JALA 5E9AA 4W87A 3FJ6A 5CCZA 1OINA 5CSRA 3SBFA 1PX3A 3HJEA 3FOKA 3UWVA 1S5TA 1S1RA 3UWYA 3LTSA 2HE5A 4WDWA 1XM3A 2NV1A 1DWJM 4IQDA 5A8MA 1POKA 2EF9A 1UWUA 2CLHA 4AIOA 2FB3A 1JZ7A 1KM2A 4HA0A 1NP0A 4JGDA 4IQJA 4KEUA 2TAAA 2JGYA 3HN3A 3L4WA 4JZ5A 3PZTA 3ZLFA 3W2NA 1JNDA 1BVNP 3EPMA 2AQVA 3XISA 3TSBA 2Y88A 4NXKA 2PTXA 3SCRA 1LBLA 3QTPA 2R14A 4B3ZA 3VIPA 1BYCA 2POTA 4NL1A 4PL1A 3IARA 5HMEA 3SB0A 1YADA 3QQ0A 1OZMA 2BGNE 3ITTA 1ZJBA 3S5OA 3PP7A 4Z1DA 4PYSA 1GK8A 3OU8A 3WLTA 4KMQA 3ITYA 3SUUA 3UNTA 3G18A 2CXGA 4GHRA 1TTIA 1S2WA 4O1EA 2WPGA 2CHOA 4C6JA 3C2YA 3LEPA 3G22A 1LJYA 2G3FA 2I5QA 3L0GA 1R3SA 1QRQA 4YIWA 2Q71A 5EKYA 3ABOA 1J18A 1GKPA 3K8KA 2C3ZA 3LI1A 2Z6IA 4B5VA 4E6MA 2QPSA 4LALA 4HD5A 1XR2A 1VYPX 3SO7A 3MUXA 3WUBA 4I9MA 4L4LA 3EOEA 1JXKA 3RPDA 1V5XA 3A64A 1LROA 3E49A 4K6AA 1SUXA 2D3LA 3AIWA 2RGLA 3E0VA 4NZCA 4HU4A 1W9XA 5CPQA 1BEUA 2ZIDA 2CYGA 1Q6CA 4CUCA 5CG0A 3OVRA 3VI2A 2HRWA 4O28A 3OZYA 3VTRA 4GK8A 3JUGA 3ZJ8A 3RM4A 3DHDA 3A21A 3C2RA 1YPFA 4US6A 2AL2B 3IGSA 1Q13A 2C14A 5FSDC 4UTJA 2QMJA 3OVPA 3WFAA 5AECA 4JQAA 1RPKA 1LZOA 4Y9NA 3IGUA 2Y63A 3TMQA 4WY0B 1NP2A 2DSVA 4WVXA 5HXMA 3L68A 5K4XA 2HVMA 1ISVA 3I3BA 4C6BA 1JEZA 1F6YA 1XLKA 5HK4A 2HEJA 3QGVA 4WQ6A 1DJWA 4RDZA 4GBUA 1UR4A 2CITA 4NNCA 3L4YA 2REQA 5LGXA 5I02A 2A7NA 4Z17A 3M0ZA 4TV5A 3N17A 3JS3A 1KR1A 3R94A 1OFEA 1THFD 2PDUA 4CNPA 3AHTA 1P1MA 5ABEA 1REQA 4IL0A 4UTKA 4LAOA 3VFCA 2VWSA 4BWLA 1LOLA 2Y0FA 3RGTA 3GUWA 4Y7EA 1HVXA 2CBUA 4PGLA 4PMYA 2I1OA 1TPFA 1J6PA 2DZSA 1XX1A 1DHKA 5LNUA 3FSUA 2CPUA 2GQ8A 4DRSA 1W1YA 3BG3A 4QEEA 3L4XA 1EOKA 2ZADA 4QDPA 5HMFA 3ATYA 4OOZA 1RCOB 3D0CA 1WDPA 1OFBA 3TQVA 1BVWA 3VNYA 2YB4A 4IIHA 2XHYA 1H50A 1W54A 2D2OA 1XQLA 2G95A 8A3HA 2QIWA 5A6KA 1QHOA 2CLMA 4WF7A 1HO1A 2FVKA 3KTSA 1I8JA 4P2VA 4QNEA 2DT3A 1KM3A 1GVOA 4K38A 1LLZA 4MPQA 3MO7A 2DIEA 3M7WA 3WDHA 3S0CA 2V6AA 2FDSA 3VNLA 1CDGA 3SCNA 5TAOA 1HVQA 3VX0A 2OZ0A 3D3AA 3G1FA 4GGBA 3L12A 1IGSA 3ARYA 3R58A 1C9DA 4ENLA 3WKZA 3FKKA 5CZJA 4O14A 3W37A 3M0JA 2WSQA 1CW2A 3GU9A 4S3AA 4Q8VA 3KAOA 1C91A 1R2TA 3IUIA 4P8VA 1H0GA 2DIJA 4HYRA 4BI7A 2YSWA 4JTTA 3PUGA 5JBDA 1R87A 1U1JA 5JBFA 3L2IA 3QVQA 4HCHA 4FNUA 3ID7A 1D7FA 4GABA 3WF3A 2DSZA 3FDKA 4WLCA 4H7CA 4NG3A 4V33A 1CXKA 1QASA 2J7EA 1K4GA 3HMJG 3FFSA 2HZGA 1KGWA 1C90A 1JZ6A 4O8RA 3A4AA 4I9JA 4LS1A 4ERIA 4M56A 1KXQA 3RUBL 1T41A 4F3HA 1XBVA 1WYIA 2IKIA 3CL8A 4UFKA 1FTXA 4PTMA 4LYQA 1XLEA 4LY4A 4AF0A 3NIYA 5CLWA 4Q7IA 2GQAA 2Z1VA 5I3IA 5E6ZA 4QJ1A 5A8QA 1J01A 3EWYA 3LGDA 4LBUA 4JEJA 5LIYX 1H7OA 3RF9A 3TFXA 3BPWA 1V6XA 1LBMA 3TN3A 2QCGA 3AMLA 4OIFA 3SCUA 4ICCX 3DESA 1YXCA 2RDUA 1E71M 4PRRA 5F1VA 4E8GA 2YLAA 1CXLA 1AUSL 2XH2A 3G24A 1ICSA 1FFRA 1JZ2A 1B4EA 3AAMA 3MMWA 4LYKA 3WLOA 4R9XA 1ZGDA 2UZ9A 3DYPA 4LB4A 1DXEA 4ORIA 1A0DA 1NFGA 2VZUA 4HHHA 4FF7A 3DZ1A 5HBFA 1IEVA 3H22A 2J27A 3W25A 4UIOA 6PTDA 3POHA 1E4MM 3FS2A 1C29A 2Y6ZA 3F4WA 4OFCA 1CB7B 2WVSA 1W8SA 3OB8A 3TFCA 1C8VA 2O7SA 3GH4A 1T96A 3EZ4A 4QIUA 3VGDA 1OSEA 4ATWA 1NELA 1YLVA 3ANYA 4LUTA 3FAWA 4GUFA 5DY3A 4PA8A 3KBVA 5C8BB 3A6OA 3LY0A 4GUIA 4UOZA 2VM8A 3CPUA 1MFVA 4A22A 3OQ8A 1VENA 2OWCA 5HMSA 3GG0A 4B9YA 1BWLA 1W1TA 3SEPA 4NRSA 1Q7ZA 2XWEA 1SZFA 1UD6A 2PDNA 4OECA 5AHFA 1OD0A 1X6UA 1PKMA 3F1QA 3NTYA 1W3TA 5CBIA 1CLXA 3V4BA 3CZEA 4GISA 9XIAA 3N2BA 4S2BA 3ARQA 3S5YA 2BS9A 3ARZA 3REQA 1KGUA 1GYNA 3VKAA 2PDJA 4GI6A 4LH8A 5FJTA 3BO9A 3W1UA 1CXEA 1FHLA 3T0CA 3BQ6A 2VO5A 1LLOA 2DZWA 2XGZA 5LYRA 3K30A 4H6KA 3AXXA 1KB3A 2ZVIA 1KRAC 1I60A 4J35A 4XZBA 2E8ZA 3UZ5A 4JYEA 1OFDA 4GVIA 2AKMA 4ZTXA 1M7PA 3SJ3A 2VEMA 2ZUVA 4I7VA 2C0HA 2P53A 1NDVA 3KTCA 3C2FA 1XIFA 4Z1CA 2P76A 4MWAD 2J9YA 2Y8UA 1CIUA 2UBPC 2DU2A 3W23A 4FX8A 3NPVA 2NQHA 3W87A 3UWZA 2VD9A 3M43A 2QF8A 1HN1A 4LS2A 3BG9A 3BANA 2GGGA 1VBJA 3BLFA 4MFDA 2D23A 3PZUA 1FP8A 2P3ZA 4JTCA 5CPNA 3UA3A 3QR3A 3EX3A 3O07A 1L6SA 1VYSX 3VKDA 2OLAA 1RQHA 3TWAA 2RHGA 1CXIA 3HO8A 3LPOA 1UKPA 4MWAE 3TTYA 5HOSA 1ENUA 2DSKA 2NW0A 4GO8A 5FF0A 2Z2BA 2FH6A 5LIXX 1UD3A 4BHYA 4M6VA 4CNSA 1TUFA 3WG6A 3BLDA 4FK9A 2Z1SA 3S1XA 4LX4A 3KS5A 2NT1A 3OZOA 1OK6A 1ONRA 5TIMA 3IJLA 3QY8A 1P0DA 1RA5A 3W7OA 1O7AA 2H90A 5I03A 1W1VA 4UB9A 4KH2A 4YS1A 4NAEB 4S23A 1QNOA 2GVYA 3H70A 3WLJA 5DELA 4FX7A 3T1GA 2XN0A 3KRZA 3RRXA 4JQ4A 2A3BA 2D0FA 3WD4A 3SSJA 5FL0A 3BCFA 3KL0A 3LCHA 3O2LA 4K2SA 1X1OA 3S47A 1XDLA 4JTFA 1QOQA 2CERA 3A5FA 1NM9A 1XS2A 2TODA 3MSDA 2I14A 3MJYA 2VEPA 3KOFA 2O56A 1XLHA 3MCNA 5XIMA 4Q4RA 2OLSA 3ABRA 3UT0A 4AYSA 1BPLB 4IWWA 2YZ5A 1H51A 3E38A 2VQUA 5I78A 1MDLA 1XYFA 5DRIA 3WDIA 2BODX 4LNYA 3MP5A 1HJQA 1UKQA 2XVKA 1VFOA 1KR0A 1TZ9A 2QPXA 3W26A 1S46A 2QCCA 2V63A 4O1DA 4MOZA 5D9MA 1NOUA 2CZ5A 1GVIA 1GZGA 2Q01A 5PTDA 2VRQA 1GG0A 4NZJA 1XD0A 1FWBC 4H3DA 2Y4SA 4UBPC 4DNMA 5E6YA 1M41A 3WLPA 3OHMB 4FA3A 4QR6A 3GXMA 5LNVA 3FV9A 3VUSA 3KUMA 3MDWA 2PCEA 4ZENA 3BGGA 3LS9A 3MUAA 5I79A 4WKAA 4ZQCA 2UY2A 1ZB5A 1HXJA 1U33A 1GOMA 4NNAA 4H8NA 2H3DA 1VRDA 3NVDA 3COTA 3IAQA 5EMMA 2PP1A 4K7YA 1X7FA 3CAVA 1KD0A 3USBA 2WZTA 3UWEA 2BY1A 3WK2A 3S2LA 1XJBA 1XIBA 1VJIA 3PUEA 3BLLA 4NYUA 2FQIA 3VMNA 1CI1A 2OQLA 5F4SA 5CKSA 4NASA 1F3EA 4AIUA 4E4PA 2C1GA 3AWNA 2DZAA 4KGLA 5LIWX 1JZ3A 1P6BA 4G7EB 1Q85A 1T0OA 4Q4PA 4TX6A 4J5NA 4LSBA 7REQA 2QVHA 1ITCA 4QCEA 2P88A 3POCA 3O6AA 4ERGA 3GHUA 2ZC8A 3OG3A 1QNQA 3WUEA 2PC4A 4L5ZA 3TR9A 3LLFA 1F8MA 1NWSA 4WKFA 3GBEA 4RZ6A 3BL3A 2D2HA 1DXIA 3GLCA 3R8GA 2BY3A 3E0FA 4ZBCA 2HPMA 3TEVA 3URBA 1TWDA 3LV6A 1YE4A 4JNZA 3O9NA 4NSBA 1J0HA 4KBXA 1POJA 4GIEA 4WGXA 2H9AB 3MWCA 4MTVA 1FWWA 4M8UA 3W74A 3ORWA 2VCBA 3VNKA 4J7RA 1A49A 2H3BA 1F6KA 3RPMA 3SSZA 1F4AA 4I7WA 3KRUA 3NFUA 3P0XA 1VBUA 4R7JA 1J5TA 2NQLA 3RJYA 3BOLA 4FAMA 3AXMA 3MT1A 2VURA 3IJDA 1PV8A 4HPJA 2XIJA 4LCQA 3WQ4A 4Z2KA 4KFNA 3ZM8A 1EO5A 3U3HA 3V1HA 4GYFA 1OYAA 3VVGA 1WXJA 2D3NA 3IJ9A 5U7SA 5A6AA 3OW1A 3H2OA 1QFEA 1R30A 1RQBA 4EAMA 1KW1A 1QI2A 1VFMA 4A3YA 4F66A 1VFTA 3TYCA 3TOPA 4PTDA 5T26A 3VGGA 3HG5A 1DWFM 3MI2A 4AD1A 1UIOA 3ME3A 1IE7C 1BXCA 4V1XA 4HNUA 5IFTA 2Z1WA 1GVQA 2E68A 3NR0A 3DG7A 4JY8A 4DHGA 2QCDB 2VFIA 3T7VA 3NQBA 3FY1A 1TPH1 3D6NA 3MSGA 3OEXA 4A21A 1D3CA 1WB0A 3CWNA 3L2MA 5CZSA 1LG1A 4LF1A 1F3WA 1QHZA 4NU7A 4KF1A 3CH9A 2YL8A 3JVAA 2VEFA 3R25A 5SWUA 2OVLA 5FD0A 1ZJHA 5HR6A 4H9MA 3CQJA 3WK1A 4J3XA 1JFXA 3N4FA 2Y7FA 1F61A 3GB6A 2VFDA 1VKFA 3GWQA 2ZTKA 4GNVA 4FXJA 3W1MA 3CUFA 1ZFJA 4HA3A 4U3CA 4FSAA 2E67A 2XUCA 4Y90A 1EEXA 4XWUA 4HNVA 1ZLPA 4MLRA 3EB3A 2E5BA 3WH6A 4W9TA 3CQKA 4M3PA 2P3EA 2PP3A 1WBHA 3BSMA 1UP0A 1R8LA 2X8RA 3MWAA 4GCAA 4HBKA 1ODZA 2VX4A 3F5KA 3LTPA 1GQNA 3M16A 2VRJA 4MIMA 1VCGA 2FKPA 1FWDC 4YNGA 1V02A 1XRTA 2BG5A 2BASA 4H83A 2OGJA 2WM0A 3TWBA 3PY2A 4IL2A 4MJZA 3PNZA 1A5UA 4MJ4A 3N19B 1JDCA 5IFPA 1P48A 3CMJA 2VX5A 4LAMA 5DCEA 1JRBA 3APYA 3GX9A 1ZJAA 3MYOA 1DJQA 3WQVA 1UUOA 4EX4A 2YL6A 4V1YA 3E2VA 4TTUA 5FI8A 1JCMP 5MHBA 2X1SA 4W7UA 5CPTA 5A95A 3G1HA 3RN6A 4Q33A 2AQOA 2ZUWA 2Q6ZA 1UA7A 4CN4A 5HJXA 5C9XA 3LSCA 4L64A 3EWWA 2CLLA 5TBOA 1CWYA 5AC5A 3M41A 3S5NA 1G4EA 2WMIB 5CZKA 2QDDA 4P5UA 1Q6GA 2E5DA 3Q45A 3NZ1A 3W84A 1JPDX 3HPZA 4FIQA 5AB3A 1GOOA 1GWJA 4F0HA 3AIBA 3SCTA 1C93A 3C3NA 1G1YA 3BGJA 5EBUA 1FHUA 3WK3A 1EJUC 4IJRA 1C8QA 2GWNA 4ZEPA 2F2KA 1OT1A 3LCWA 5LKYA 1JUEA 1UB3A 2PDXA 3UJRA 3L65A 4C5ZA 3WL1A 4O0KA 4O16A 4J3TA 4PFMA 4IH3A 4WSJA 3WFZA 2VMFA 4WJEA 1GVYA 4AC1X 1EIBA 1Z8AA 3CV1A 1UP3A 2C16A 2ZRZA 3OLDA 2VFHA 2AMGA 4AZBA 3RCNA 1NTHA 2XSBA 4LUYA 4Q8PA 1JL8A 4N6FA 1JD7A 1BYDA 1X8CA 3QYSA 4ML4A 2C13A 3I6RA 2PRHA 1DIKA 3IRDA 3CUJA 1E4NA 4KWWA 4MAVA 3MUY1 3KVKA 3S5SA 4Q8MA 3DN5A 1JF6A 2Q3RA 3BC9A 1OFOA 3L0KA 2HS8A 3Q2DA 4FLSA 4YYFA 1P7TA 1CB2A 3TU9A 1UPMB 3B9AA 5M5DA 2HNHA 2EG7A 3MBFA 3GVVA 1TV7A 4TVUA 4GINA 5CGMA 2FHFA 1DIOA 1H49A 2R1LA 3E74A 4DWSA 3TXZA 4R9OA 3PUDA 3N2TA 4QM1A 5DCDA 1XLJA 2GUUA 1FRBA 5G5IA 3M0VA 4D6IA 4Y8FA 1WPCA 4QAIA 4GJ1A 4GA8A 1KO0A 1SMAA 3B9OA 3ZSSA 3UG5A 3ICJA 4XZLX 8XIMA 5XIAA 1M01A 4MVAA 2XN1A 3TNOA 3HV9A 3GY1A 2HXUA 1TZZA 3GU2A 1VS1A 3WLNA 1BF6A 1M9HA 3N12A 2PRLA 3OVGA 1V6UA 2V5JA 4C90A 2VC6A 2VP8A 4JKKA 2P0OA 3M5YA 1OC5A 4EKJA 3EYPA 4J2PA 1J9YA 1EJ7L 3WUFA 1HJUA 5DRCA 4EPBC 4QE4A 3T2OA 2ZZ5A 5U4NA 4LU0A 2HISA 4YYCA 2GL5A 3ZYZA 4AD5A 2YZRA 2QCHA 3VFLA 3KTXA 4M1BA 4JHOA 4CKQA 2REQB 3EB4A 4B3LA 2B4GA 1I4NA 4QISA 4JYFA 1NARA 2CWNA 1XLCA 3U9IA 2BDQA 3D47A 4HHMA 1DJXA 3BWWA 4RE4A 3W28A 5I7GA 1XG4A 1DJHA 3WDRA 3GG7A 2EBNA 2ON3A 4E4UA 1J5SA 1MEHA 2PDPA 3WMCA 3U5YA 2GVJA 1ECEA 1X39A 5C55A 3R43A 1OEPA 4PBGA 1OC6A 3ERPA 1H5YA 2J7GA 1HTIA 3U57A 2HROA 5AY7A 4LVAA 4AEEA 4NZ4A 4GE8A 2H8ZA 2QV5A 3PS7A 1TWIA 1PAMA 2Q8LA 2E0PA 1Z89A 4A8IA 5REQA 2I5IA 4MWAA 3GXIA 3GAYA 1S5WA 1R2RA 2ZXBA 3L67A 3ARUA 5DCBA 3R10A 2PPGA 2HDJA 3KOYA 5HNUA 1PKLA 1BWVA 3LXCA 1R47A 3G1AA 4ZFCA 3W1TA 1E15A 3TA9A 4PRTA 4CCZA 1PHQA 5A6JA 2A6NA 1W1IE 1KNWA 3KZSA 3WQOA 1TV4A 3NO5A 1L6GA 4TUFA 2OJPA 4ML9A 1HO4A 4NXSA 1UW9A 3I7RA 5BRBA 1X96A 3EB2A 3CWHA 3XINA 3VDAA 2Y8VA 3R4IA 4OWGA 1OZQA 3QLDA 3GIYA 4FNSA 4IQEA 1RBLA 3INPA 3GVQA 1G6CA 3TC3A 3P84A 3BH4A 1O68A 3C8FA 3I65A 4NQ1A 1BRLA 5DANA 4KESA 1F73A 3QV8A 1AQMA 3FHQA 3EDEA 4A8NA 4UQBA 4PRWA 2WLZA 1W1ZA 4M6UA 1LQ2A 2FZ9A 1JZ8A 1ZCOA 4DPPA 4KEZA 1Q65A 1QK0A 1F2JA 3M7SA 4YWIA 5D09A 4FR6A 3RRAA 3H2CA 2J8GA 3M1ZA 4AX7A 4IUGA 2GVLA 2FGLA 3UWUA 3P82A 1MEWA 4UOQA 4CCEA 3BICA 3QOMA 3EMCA 3LXAA 4PBEA 4KKXA 3WBAA 2ISSA 5CC3A 5EGRA 1W2VA 1KRMA 4C6OA 5ECUA 5M3WA 2VR5A 2DSWA 4S3GA 2J9ZA 3SY1A 3W83A 2QCDA 3DGBA 3TTOA 1UOKA 2PP0A 3NOYA 1Q6QA 4LAUA 3W01A 3IACA 3H4GA 1YDOA 3WH5A 1W0MA 4FS9A 2GK1A 3LM3A 1XV8A 1F3XA 4UQAA 2J4GA 3GAKA 1GOQA 2ZX8A 1WOAA 4WXZA 2QUMA 4QG6A 3NYZA 5AYIA 3C2VA 1D9EA 3QJAA 4JFUA 4RZ4A 4NZFA 4H1ZA 3SQMA 3SY8A 4JTGA 4AVOA 2V0TA 3DG3A 4ALDA 1CXFA 3BV7A 4PB5A 1T40A 1H2JA 2BVWA 4DUVA 5B7ZA 2VWTA 2VEGA 1IGWA 4PEEA 3A3XA 5FJUA 4W88A 1IEXA 3EX4A 3QBUA 6A3HA 1X1ZA 4AWEA 4EF8A 2W79A 2B7PA 3UZYA 3P8IA 3L23A 3VU2A 1XG3A 2OU4A 5JIWA 4L7ZA 2XGBA 1US3A 4LCSA 1VF8A 4QG9A 4BS0A 1CT5A 3QTGA 5EPDA 3SFWA 1YX1A 3RFAA 2B7OA 2V2CA 1OGGA 4L4OA 4GX8A 2QZRA 1HGYA 4GY7A 1TPUA 2A85A 3VIMA 3G1XA 3I6EA 3HA1A 2VDHA 3QPEA 5CJNA 4F0LA 1E1FA 3WD2A 1VZWA 4DZ5A 1KCKA 4UQEA 1TV8A 1QPKA 3GHRA 3NQ6A 4JTHA 1CGUA 3NQMA 3NG3A 4DJEA 2QUTA 1CYGA 1W8GA 2DDXA 1Z69A 4S38A 4GZIA 3I68A 4YXGA 2AOSA 3CASA 1V8EA 4I3GA 2VDIA 4RNJA 1KA9F 1U83A 2KAUC 2J6VA 3VOHA 2QMKA 3H54A 1L2UA 4PUDA 4GY0A 1V03A 3A24A 2YIHA 4QHRA 1X7IA 1E9LA 3GXPA 5FKYA 3RX4A 2G5WA 1JFHA 4LJ3A 3GYCA 3L0NA 4MB4A 4HYVA 4UTHA 3S2MA 2P5NA 1HKWA 3QGKC 3L5AA 5I3DA 1AA1B 4CU7A 3UGRA 1F05A 4GXPA 1K7FA 2CLOA 1RJRA 4NNBA 2KX9A 3PG9A 3EXTA 4U31A 2C7FA 3BV4A 3MUCA 2TMDA 3VGBA 2QCEA 1KTCA 3DKLA 3BE7A 4GNKB 4QSHA 3H4XA 3ZWSA 2NZLA 1JULA 4S1FA 3SIZA 2DZXA 3PWGA 1TJ1A 1GG1A 2BY2A 3N9SA 3SCPA 5K4ZA 1HF6A 2VI0A 5EY5A 3DIPA 4AW7A 2P0IA 1IXPA 1ZY9A 4IMFA 8RUCA 3MMDA 1BSIA 3M5XA 5AYYA 5GVJA 2YBVA 3WJXA 3U0HA 1E56A 4P8XA 3WQFA 4YTSA 1R38A 4TU1A 2XH0A 1AK5A 1GEQA 5IDZA 3CIWA 1OCBA 2VGBA 2WKGA 4HMCA 1BWKA 1I2OA 5JMUA 1Y8BA 4G56A 4RCXA 3DU0A 3GVRA 4LVDA 2PS2A 3BCJA 3EEZA 3KRBA 3SDOA 4B5XA 5HDRA 1P7TB 3KL5A 2PGWA 1TCMA 1QWKA 1CGTA 1XHGA 1NH6A 3LXBA 5IRPA 4PUNA 1LOQA 1SGJA 2BB0A 1T7LA 3B3DA 3USZA 3NZPA 5DT5A 4FI4A 1V0MA 1MXSA 1KKOA 1KTBA 1AL8A 1OG6A 4GCXA 3GDLA 1ZU8A 4AISA 1O1HA 4UTWC 4WY0A 4LOCA 2A7PA 1BGGA 2PDLA 1MWOA 3LLXA 1V0KA 2Z7KA 1ODUA 3T4CA 3BSHA 4ZE5A 3HMCA 3KVMA 4D6DA 2YGYA 1JCXA 1WBJA 5E93A 2FYMA 2GSEA 3UG8A 4NT0A 2C0AA 4IG2A 2NLIA 4LPCA 5RUBA 4QJ4B 1OB0A 5DBUA 3T55A 4Z1AA 3SRHA 2A21A 3QM3A 1UH3A 3ARTA 4MUPA 2ICSA 1CGYA 5A8GA 4TMBA 2VYOA 4Y9AA 3VE7A 3EKGA 1TFVA 1SJAA 5FAJA 5BMWA 1V0NA 1HUVA 1Y65A 1UWTA 4FR1A 3N18A 3TYBA 3OLIA 1R9XA 3WNPA 1ZUAX 4DI9A 4HU8A 3LMZA 2E3ZA 4XZMX 4UTMA 3PZNA 1V3MA 4XVDA 5AZ1A 3DG6A 2X40A 3EWCA 3CV7A 5LIUX 3C4UA 7CGTA 4TV6A 1XLIA 3H2MA 1TJ0A 2X09A 5H1WA 5IBXC 2QKFA 1LG2A 4MYXA 2ONEA 4R53A 2PU1A 4HB7A 4I6KA 5BU9A 3R12A 2BX7A 1E4IA 4ZXLA 2DUAA 2HPIA 3RCYA 1E6QM 4M51A 2ACUA 2XIBA 1A5OC 3T81A 2V5LA 4W86A 1YPIA 2E40A 1AMKA 4NAFB 3AIUA 4KRTA 3DC0A 3LMYA 1NQ6A 1T8QA 1WA3A 2RDWA 1SSGA 3W6LA 3MC5A 4YHEA 4RE3A 4WJXA 4ZL1A 3QC3A 1I2PA 2QF7A 4PCFA 5EB8A 1TPDA 4Q6XA 2YXGA 5EA9A 3CQIA 2JEQA 4DJFD 3WNLA 2XINA 4FXSA 3B06A 4PFHA 3GYEA 5LNWA 4L6HA 3PWIA 5D38A 3VE9A 4AZ7A 1N8WA 3KX6A 3CYJA 2CLPA 3HIJA 4LTSA 3BZJA 2ZDSA 4MDPA 5TD4A 4BR1A 1ML1A 1GGOA 5FEWA 4OBTA 4PUMA 4LS0A 4RPPA 4CCDA 3W1NA 4UR7A 1E0TA 2Q3OA 4GQ0A 3WSUA 4LYRA 2ZX5A 1OJXA 3OBKA 2FTWA 3R6IA 4DWDA 2PWVA 1UZ1A 1EBHA 1CPUA 4HPHA 4EF9A 3LA4A 3PF3A 4D1JA 3GNNA 3CIVA 1NFBA 3CZGA 3P6LA 5LZLA 3WNOA 1B2YA 1DWAM 3CIXA 4C7GA 3QMTA 2RJHA 3S2NA 1D8CA 3ZQ9A 4AZHA 4WGHA 4MYAA 2PD9A 3W7RA 4NJKA 2QQ6A 3UXKA 3HU7A 3MP4A 4W4QA 5EYWA 4F2TA 4XB3A 2XH4A 4GQGA 3E5BA 3D5HA 3URQA 4UFMA 1DP0A 3EBVA 1Q6OA 1RJPA 1A5CA 2X05A 2CEQA 3F5JA 1OY0A 3URAA 5D9PA 3WEOA 1CX9A 3W7DA 2OWXA 4IHCA 1AG1O 2OXNA 3NZQA 5I09A 1AODA 3WEZA 2BFGA 3M4HA 2OWWA 1VFLA 4Z08A 2RDTA 3UERA 3FA4A 3TTSA 1H1NA 2F38A 4B90A 4NHVA 2Z1XA 4M82A 4UUIA 4YTTA 2IUZA 1CZ1A 3AIEA 3U48A 4EK7A 4W5UA 4ZO8A 1TYGA 1WAUA 3BZGA 4QLKA 3THDA 4GC4A 4GFIA 4MHBA 5BRQA 3H12A 3K5XA 4MKSA 4DWSB 1W31A 4H2CA 3KM8A 3ABXA 3BXWA 4B5WA 2G3NA 2QDHA 2NVAA 1TVPA 2JK2A 1HKKA 4FP1A 3EWXA 3UA4A 1E0XA 1XP3A 3B4YA 2AGTA 1IYXA 3IGXA 1W3HA 4TQTA 3OGRA 5T9BG 3ECQA 5FAGA 3DFNA 1CECA 5D4YA 4EWND 3TIMA 4JNMA 4CLMA 1E40A 1HL9A 2YBTA 1O94A 2WANA 1M03A 1RCQA 1YPXA 4MGGA 3ZVHA 3GVGA 4RZ5A 1VYRA 4HIBA 3OA5A 1E43A 3W0KA 1S38A 1Z48A 4ZOCA 3H6OA 1DJYA 1BGAA 4PB4A 2D1ZA 4KCWA 1HIZA 4GUJA 1WUFA 2Z0IA 1RP8A 1LM1A 4ACYA 3BLKA 4XK2A 3S4TA 1XPGA 5DN1A 3HPSA 3HB9A 3I7QA 4DO6A 2PZ0A 2EG8A 5CC7A 4H7ZA 4F2BA 5KITA 2WVTA 4YLWA 3FVDA 3T0TA 3F03K 3THCA 1UBSA 4YTRA 4KCUA 1Z32X 1FBAA 1A5MC 5LIKX 4LYPA 2J62A 5JH1A 3PZOA 3SUTA 1UD2A 1IF2A 1TSIA 2VVNA 1JF5A 4JTIA 1J4EA 3PSWA 1GW1A 4MB3A 3VX1A 1VIZA 5CSSA 3DC8A 3I7SA 3VOGA 1ZBKA 3W2UA 3W76A 3PBYA 5H8MA 3VOIA 1DWIM 3NPUA 3QEZA 2QUVA 1H09A 3QFWA 2NXGA 4FIRA 2FJKA 2WMGA 3NL3A 1XINA 4W7VA 3WQ8A 1SU5A 4F0SA 5D05A 4E2VA 3LPFA 3VZZA 3ZS4A 4AG0A 1Q8AA 1ZNNA 3TR2A 6ENLA 1RSCA 1M53A 1PYMA 4JCLA 3NZRA 3AHZA 2Z25A 4H9YA 3HM7A 2EGZA 2WBKA 4LEFA 5CC5A 4XD5A 1I1XA 2XJ7A 4MJ2A 2BXVA 3MP3A 5G4HC 4JOMA 1M3UA 4LEQA 3ZIZA 1KQZA 1V6WA 3F4DA 1SFTA 3WQEA 4N4QA 2ZA1A 1C7TA 4ROPA 1GNXA 3PBWA 3W38A 4K8GA 1I6NA 1XLAA 1TPC1 4KETA 3RMJA 3AS3A 4HZMA 2JIEA 4Z1BA 3KZPA 2WNQA 3W2MA 1UZ4A 3UWQA 1H41A 1REQB 1BG9A 1KFWA 2AL1A 1UR9A 1F8IA 3NQ2A 3T9PA 3NQDA 5JVLA 1B9ZA 1TMLA 3R7MA 4WSHA 4X2PA 1R85A 2PUZA 1E9ZB 3UFYA 4XD4A 1AW5A 3S8HA 3G6LA 3QLLA 2W66A 3GNXA 3ABZA 2IQTA 3WYZA 4WJ8A 1G67A 1DL3A 3W02A 3H21A 2X2YA 3WF0A 2QJJA 1QXLA 1A4MA 3WMLA 3C86A 4YPJA 2V81A 3SW6A 1BRLB 5CSYA 5KZMA 4GUHA 1RALA 4ZFMA 1R5YA 3S1UA 4GIRA 1AW2A 5BZAA 5C54A 4UTFA 1B54A 1P0EA 1N82A 2XWDA 1HZYA 1UC4A 1MDRA 3L5LA 3IVUA 1Y5WA 2C19A 1UMLA 4URIA 1HJWA 1H7PA 2VC5A 1KWGA 3GTFA 5A2BA 4F0MA 4Q6JA 1WP6A 3TW6A 2W27A 2BY0A 3EPOA 2BLEA 4J1OA 4UFJA 4V27A 2FZBA 2XTKA 5BW6A 2PC8A 3T8QA 5A6MA 3TP4A 1QNRA 2EPKX 1FDYA 1F5ZA 2GVEA 2PWUA 3S1VA 3VD9A 1A3WA 3B40A 2E6DA 3OP2A 1TJRA 2V3EA 4TVDA 3W86A 4LF2A 3WQPA 3RLVA 4OZOA 3C0LA 3KVLA 4AMAA 2X1RA 1BXBA 3F7JA 2R6OA 1PZ1A 1ZRQA 4DJFA 4B5SA 3GU1A 1OYCA 4FO4A 3NGJA 3VD3A 2XM2A 1TJPA 1YRRA 1E70M 2R1PA 1QPNA 3NPWA 6TAAA 2YA2A 1AD4A 3WJZA 3IV3A 2FH8A 2G41A 2W62A 2WCGA 2Y2WA 1QVBA 1T6MA 3G0XA 1OGSA 1LORA 3AALA 4P8UA 3VABA 1FWRA 2NSOA 3MKCA 4FNQA 1ONXA 5AZ0A 3W24A 2WMJA 4ATLA 4UFLA 4Z0SA 3B05A 5I3JA 1CGWA 1H63A 4QGCA 1AH3A 1FKXA 4TXEA 3VD5A 3VKBA 4G1NA 3V36A 3C2EA 3R11A 5DO8A 1XF0A 1Z42A 1NOWA 1Y5XA 1BYAA 2A7RA 3CO8A 1FWGC 2CZFA 1VLIA 4XAPA 3BK0A 3S2JA 4F8XA 1CTNA 4LUIA 2YXXA 4DY1A 3TH6A 4S3KA 1VCFA 2EXOA 1TKKA 3N04A 1T8XA 1QI5A 2J6XA 2WMKA 1LRTA 3T44A 3VIGA 1XLFA 3BW3A 4QX4A 5F2IA 5KZEA 3CC1A 3B4UA 3W4RA 3KCOA 3W7EA 2RDXA 4O1FA 1XUZA 2ISFA 3WH8A 3NSMA 5C9RA 3EKLA 1NAL1 2ZZ6A 1KRBC 4IM4A 5D33A 4AEFA 1MW0A 1WV2A 1EQPA 4LVBA 1S5NA 5AHLA 3HGRA 4WY0F 4MSSA 3MHUA 1JCTA 5C71A 2FZMA 4QROA 4DWSD 1QNVA 2ZUSA 4J27A 4ZB2A 2OX1A 4E8CA 5I23A 2ACSA 2QVNA 3A9IA 4UCFA 1Z3NA 3K1DA 2DPEA 3PULA 4F9DA 1VBGA 1GOXA 4IGHA 3IJ6A 5CPMA 5CPLA 3TROA 1L2QA 1UR2A 3IWPA 2CLIA 4NI8A 1GYMA 3NSNA 2G0WA 3IJ7A 4JN7A 1W9UA 4HMNA 2IQDA 4JL1A 3BAKA 4RNIA 4KWUA 4A3UA 2PDFA 3K2GA 3UJFA 4CQ9A 4GC3A 4FNTA 1AJ0A 3DBNA 1MZHA 3EA3A 4HOXA 3S5ZA 1KM4A 1UC5A 4UMCA 4DBSA 3W29A 3TV8A 1EIXA 1OCNA 3CHFA 3UPBA 3PBGA 4NZ5A 4M29A 2ZRWA 2B7QA 2DVTA 1VFSA 3UCQA 2DY3A 2Q8ZA 4RJEA 4IISA 4ZGYA 2DQWA 3PJXA 5BCAA 1NDWA 3OQEA 3QY7A 2E77A 1A5KC 4Q8TA 3GDRA 2W63A 1W3NA 3A4XA 2WSYA 1S5VA 2Z1BA 1E4LA 2YDSA 1O6IA 1P0BA 3B9DA 2WXDM 1OADA 4V28A 2PD5A 6XIMA 1MUMA 3E0IA 1PKYA 1JUBA 4DBWA 2W5FA 1JVNA 3WLLA 1EJWC 4KWSA 4AU0A 3R8HA 5KEZA 4U28A 3GNOA 2O9OA 1JPMA 1KGXA 4XKYA 1NEYA 3H23A 5CAKA 4Y96A 3U5UA 4A35A 1NQKA 2WWDA 4CU6A 1E0VA 3DBPA 1FCVA 4D8LA 3QHNA 1WX0A 1H7XA 1GZ1A 2YCEA 3HG3A 3CHEA 3N2XA 4XTIA 1PHWA 4C91A 1UBPC 2O9TA 4MKVA 2Y8KA 1JR1A 3W7QA 1KM6A 4PBFA 4DM1A 1H7WA 5E0KA 1OX4B 5C7HA 2NVDA 1ADOA 3V16A 2R1NA 2FB2A 2XFYA 3UBPC 5JBEA 4F4RA 4M7SA 2JKEA 1NFPA 1RHCA 3A12A 2GJXA 4MUZA 4LB3A 1R3TA 1R2SA 3MA8A 1GVSA 3GZ3A 3Q67A 4WCJA 3UR5A 1LWJA 4LAZA 3VILA 1VPXA 2I57A 4X9YA 2X1TA 3EKZA 3T40A 4O13A 1ISZA 1WCGA 3WMSA 1MUWA 3WH7A 1A3XA 2GJPA 3EA2A 3VDCA 3KHDA 1W5QA 4HZ6A 4I7UA 3BW4A 1RK5A 4W85A 4H6QA 1V93A 2CU0A 2RGMA 1CENA 3TC6A 1JDAA 5KSWA 2PAJA 4TX9A 4LAKA 1JI1A 2J74A 1TRDA 4LBRA 1IWAA 2OB3A 3K8LA 2B31A 3BMWA 2OR2A 1KLZA 3OLEA 1L6YA 1LBFA 4AXKA 2OEKA 1W1B1 1QNPA 3WELA 5K7JA 4Y9PA 4BEQA 2VCCA 2DIKA 2YYUA 2VGFA 3WJWA 3CT7A 4M0XA 2DJLA 2WVUA 3MQTA 2J77A 1RAKA 4E2DA 2XG9A 4G8TA 1MNSA 3PPGA 2ZUMA 5TF0A 3ZSTA 1DQWA 2IKJA 1EQCA 2FDMA 4FNPA 5FJIA 4B9ZA 2R82A 3OODA 4S3EA 4JX6A 4C6QA 1JCNA 2ISVA 3UJ2A 1YQ2A 3AMGA 4JDYA 5DX7A 3E6EA 4DNHA 4H01A 2Z4GA 3NQEA 3UG4A 2QCMA 3FJNA 3DFHA 3PZGA 4HTYA 4NP7A 5CJMA 3TJLA 4WD0A 1KCXA 3G1YA 1FWIC 4J4KA 4IPNB 2GQ3A 1PJ9A 4JQ2A 4P7RA 3TC7A 4GYKA 2DORA 4ZO6A 3N11A 2OO6A 3EXSA 4RE0A 4QS5A 4EXBA 3S1GA 2Y24A 2J47A 1OX6A 5A6SA 2NQ5A 2DP3A 6XIAA 2WJFA 3FYYA 4LUSA 2WSKA 4BCEA 1FWNA 3RCMA 2ESCA 1RXOB 4QNWA 5LA1A 2NV2A 4ROQA 4D8ZA 2HBXA 3THAA 5I00A 3W7HA 3UESA 3CWOX 1Y7VA 2GVGA 1XLBA 3NDOA 1PKNA 3ARVA 4TTGA 3T78A 3W53A 3WJYA 5A3HA 4P7QA 3QMRA 1ADSA 1IIHA 4S3DA 3QPZA 1HT6A 2A3LA 2ZUUA 1BD0A 1EGZA 2WHKA 2C6QA 1QW7A 2A0NA 1MSSA 4GYPA 3W70A 1UWIA 2WM1A 2D2GA 5TQLA 3B9EA 4NUWA 2GGEA 2ZZ1A 1B3WA 4AQLA 4ASTA 4IMDA 1VEOA 4W8AA 1UCWA 1WDDA 3N3TA 1AD1A 2DZUA 4BF9A 1GVFA 1B5TA 3SUVA 4UNKA 2VVSA 5JXQA 4HKPA 4JIQA 1VCVA 3MY9A 2HSAA 1FWSA 4CD4A 2A4AA 4GRSA 2ZQ0A 3PZVA 3RMEA 2G3JA 1MFUA 4AZGA 1S5MA 2WZMA 4XD6A 4JX5A 2ASHA 5GNXA 1GCYA 3JW7A 1DTUA 5HJLA 2OT0A 1UD5A 2J25A 3FYPA 4GQQA 1R3YA 1HFBA 4C7DA 1S2CA 4WOQA 2VD8A 1K9TA 1Q2RA 5GNYA 1DWHM 1OM0A 2OLHA 3ALFA 3O16A 3CXOA 3FHAA 2YX0A 2HJPA 5F2GA 2WHLA 1OFAA 1OVDA 2ZXDA 3EOOA 3KP1A 2EPMX 4EPDC 5HNRA 2NV9A 5A94A 1K8ZA 1JZ4A 5BYWA 3GKFA 1SFLA 2GDVA 5GNZA 4YN5A 3OYZA 1JGMA 2FGZA 2IQ0A 5AOUA 4IJBA 4EXAA 3KBWA 4GJJA 5EMKA 1OIMA 4AF0B 2R24A 4KFPA 2A5HA 4IIBA 3A3HA 3PK7A 4DYEA 5FJPA 4AZCB 1W5OA 2ZZ7A 1MW1A 3W72A 5MKGA 2IS7A 1FKWA 3ANVA 2CLKA 1GUVA 1Q3NA 5KZDA 5FCZA 3G2GA 3ITXA 4QSFA 3CV2A 3LK6A 4GLEA 3AUJA 3B0PA 1JAEA 4W8BA 3AYVA 2Y85A 1QW9A 2ZXAA 1OT2A 3CLWA 4Z2HA 2V9DA 2NQJA 3BARA 5HQLA 1EPVA 4ZQNA 3DI0A 1KCZA 3V3WA 1XW8A 1PIGA 3M07A 4GJIA 3MU7A 5G2IA 3E0WA 4PTNA 2J79A 4DN1A 2WAGA 2ZWYA 1A0CA 2W3ZA 3IRSA 4MAZA 5C9ZA 5I0DA 3WLHA 3R2GA 4O1BA 3L7RA 5CG7A 1ZALA 3P8JA 3S9IA 3RU8X 5CBJA 3ZWTA 3B8WA 3V5OA 2EEXA 2DSUA 4PMUA 3OGSA 2OO0A 1LRQA 1MMFA 3ES8A 2OZ8A 4XX6A 1RBAA 1ONWA 2NX9A 4MKNA 5I3GA 1FVPA 1QUMA 3BVJA 4YTUA 3RU6A 4MG4A 1OYBA 4B3KA 1EJSC 2POZA 4LC6A 3R89A 2WPBA 3HTWA 2PTWA 1SM9A 4C1KA 4XZ9A 4IP7A 2GPTA 1G94A 4K39A 1D2KA 3HBLA 2DT1A 1WUEA 1AL7A 3SZ8A 2QR6A 4R34A 2ZCGA 4LW7A 1S3TC 5D2TA 1MW2A 4JQ1A 1E1EA 3MCMA 3T0AA 3APTA 1XUUA 2NUYA 3UZZA 2V3FA 4JTDA 2X0SA 4AZIA 3KEHA 3STGA 5F4XA 3BQ5A 3NL2A 3M46A 1RV8A 4H19A 1YTKA 4CQCA 3C2OA 4UZUA 3VNJA 3P81A 5G4EA 3T07A 5HQEA 3N6HA 3KCJA 5A69A 3S9ZA 2NXIA 3PTDA 4WUIA 4M24A 1SZRA 5EMUA 3STFA 4DEFA 4S3FA 3BAXA 3DYMA 1EA0A 1HP5A 3NDZA 2BV9A 3NCOA 4AY7A 2ACRA 1LL7A 4JYDA 3H2EA 2OEJA 2V2HA 4OV4A 4X0NA 4UZSA 1LTDA 1NF0A 3PAOA 4XSLA 5AKQA 4DAFA 4UFHA 3HG4A 4Y9OA 3W81A 2PMQA 4AFYA 4XBSA 3QR1A 4EPKA 3RDKA 1K70A 1OFQA 3AXIA 1UD8A 1IEQA 4XZHA 4Q7NA 2HQAA 5T9CE 3DDMA 4C6LA 3W7LA 3AI0A 5K9DA 1YTDA 3N3MA 2JFEX 5G1MA 3TNBA 2G3MA 3K46A 2IKHA 4FZIA 1KXHA 1E6XM 3V5CA 3Q4DA 3TVAA 1AH0A 1YNYA 5DF0A 4LXFA 9RUBA 1B3ZA 3LN3A 3P3BA 5HULA 3OZMA 3KXQA 3PTQA 3EOLA 3NQCA 1XL9A 4PMQA 1EHNA 3I6TA 2VTFA 2CKRA 3R0KA 3VD4A 3ZMRA 1SJBA 4QJ5B 1E9YB 1SSDA 1BFNA 4L4MA 1XDMA 1V6YA 5GJNA 4RW5A 3EXRA 3URNA 4ZB0A 3C0JA 3RG6A 4F0KA 3D3FA 1J0ZA 2Y5JA 4D71A 2J66A 2W9MA 5HWMA 4MM1A 3DI1A 1OX4A 2Y89A 4IGMA 5BOEA 2UY4A 2E09A 4DO7A 4GXWA 1KFEA 3MKVA 1V3LA 3AXHA 3UP8A 3HURA 1UWSA 3LHWA 4AD0A 1MRAA 4QE5A 1K3UA 4AB4A 3LZ5A 3C56A 4OE7A 3PUOA 4J28A 5BRPA 4Q8UA 3MI6A 1XPYA 4FLRA 1SO5A 4DVOA 4G7FA 3M0XA 1ZAHA 2VDGA 1PCWA 3QQ1A 3DGRA 3SN1A 3LHTA 1FWHC 1YXDA 3H2AA 4P7NA 3VOFA 1B3XA 3ONCA 5C70A 3RILA 2RH9A 4NJHA 1UROA 3KHJA 4XUGA 2VZVA 1GKRA 5CEWA 2WJEA 3NPXA 1UKSA 3W2LA 1TZ7A 1K4HA 6TIMA 4LQ1A 4YJ5A 3GUGA 3GW3A 1FCUA 2ZWZA 3EX6A 2XISA 4MB1A 5E9XA 4Q8OA 3OPSA 2J13A 1EYEA 1SR0A 3DFOA 2HMCA 2BTMA 2QCFA 4OBSA 1XRVA 4S2CA 1JRCA 1RJQA 3CMGA 1EXPA 1IT0A 2QJMA 2PZNA 4KEVA 2ALDA 4NJIA 4B2DD 1N7KA 2GFTA 1O12A 3O3RA 1UR1A 1PYFA 2ZRVA 1R9YA 1VH7A 3V0UA 1ONEA 3FDGA 4Q32A 2DQXA 3N6QA 1KBIA 4S3CA 4Z1YA 4GX9A 3FYOA 2PBOA 2GZXA 1RCXB 4H7VA 1SVDA 2Y5SA 3H8AA 3UG3A 2VQTA 4O1CA 1LQAA 1MI3A 2E1DA 4MNKA 2AMXA 1B3YA 5E70A 1CNVA 4N9DA 2VOMA 4L9ZA 3FEQA 1ZZMA 1ZBCA 2EJAA 1VBHA 4ZSUA 4HJWA 4WK9A 3SQLA 2NX3A 4D6HA 1DORA 1QW8A 2BHZA 1V3KA 4L61A 2ZKMX 4O18A 3TZNA 3ABQA 1QI4A 4DM2A 4H4IA 4KPLA 1H1YA 3MHFA 1ZJIA 1WKYA 3UJEA 3AZTA 4GKTA 3WH9A 3NO1A 3NQ8A 2NWSA 1VP5A 3T6CA 3UVAA 5EFDA 2V8ZA 1EJTC 3LBOA 2E4TA 3HQ1A 4K3ZA 3W22A 2Q09A 1V3IA 4AZ5A 5M17A 4L1XA 1WAWA 3DX5A 4RNFA 3S6OA 4PMDA 1XC4A 1ADDA 4L56A 1B31A 1LUCA 4EAYA 1O5KA 1GONA 5FEPA 1O1ZA 3O15A 5TNVA 4NZ3A 2DH3A 3CPGA 5F2LA 4QDWA 3VC5A 5HINA 3M5VA 4OQVA 4BWLC 3LQGA 1EZWA 4Q8QA 2JF6A 1AJZA 5HMDA 3M47A 2W61A 3ZT5A 1XGDA 4M7TA 1AQFA 1GORA 1X97A 2LLEA 4ZOAA 1PVNA 3YPIA 4AVNA 5L9FA 5GPRA 3LI0A 3AYTA 5C2GA 3B03A 1TCDA 3GXFA 4HMEA 4JIRA 3EWUA 2H8XA 3CEPA 3L4TA 3W85A 3CZ8A 2TSYA 4JXCA 1EUNA 3ZJ6A 4MPKA 4H9XA 5IBXA 1JDDA 3UXLA 1KM1A 2ZICA 1H60A 4BK9A 2FJUB 3MMUA 3EDJA 1S3HA 3WJSA 1FHDA 4JBRA 1VBRA 1S2TA 3W6YA 3PN8A 2PBGA 1EPXA 1XFBA 4GUGA 1P1XA 2XSAA 4ILSA 3UU0A 3CUXA 4JFSA 3R79A 4WHBA 3MI3A 3W1PA 3FXGA 2MUCA 4H04A 2FGBA 3M5ZA 4BI6A 4HSNA 1G7UA 3VIIA 3UWWA 3WZ0E 5ABFA 1OHLA 2FIQA 5REQB 3CUIA 1K02A 4REQB 4A3HA 1XIJA 3MJMA 3LERA 3EWZA 2IKGA 3HV8A 4IXHA 2PFHA 1ME7A 3IV8A 1A50A 4GVFA 2Z29A 1EX1A 1W32A 4HSOA 4PE8A 1TB3A 3MZNA 3QXBA 1R6WA 4K8EA 1KBKA 2QDEA 3PSVA 3LZ3A 2X7WA 1BQGA 3HQPA 1MQRA 1X38A 2VGIA 3R1ZA 4C6PA 3KCLA 1XICA 1DV7A 2C18A 2QJHA 3IGHX 4ZQRA 2NT0A 4ZQMA 3W7MA 3GM8A 1TPVA 1N8FA 2ZA3A 1ZENA 1XSJA 2OCZA 1V02E 1X98A 4IG2B 2VOTA 4GY1A 5FEXA 4QG8A 3LV5A 3SUWA 4AHQA 3AQUA 3WDJA 4JTKA 3PJWA 4ZA0A 3CUGA 3V75A 2OMAA 1ISXA 4FHAA 3S3GA 5C9UA 1UKTA 4PH6A 1TX0A 4JN8A 5LHEA 4O54A 3DENA 2X7VA 1E3ZA 3AZRA 1BF2A 4YCPA 1ITXA 3WY1A 4KT2A 1U1HA 4NJGA 1US2A 1JQVA 2YA1A 5E09A 3U7VA 1PTGA 3MSYA 3THUA 5DXYA 1UR8A 2J8TA 3VZYA 1MUCA 1QI0A 2Y7GA 1PSCA 3RITA 1GQLA 3SM0A 3AMDA 2PLMA 1GPFA 1IR2A 1K7EA 1VEMA 2P10A 1J0YA 3SJNA 1EOMA 1EZ2A 4XG1A 1R46A 3DERA 1I2QA 3W7IA 4Q7BA 2X30A 1EEPA 1J79A 5E0CA 3W1RA 1PZ2A 3ITVA 1IIGA 3KBSA 1E6PA 2V3DA 1LUCB 3NQFA 5K2ZA 5LNSA 4H6RA 4PODA 4MMWA 4CNOA 2PU0A 3RR1A 1FCBA 1A5NC 4IUOA 1VB9A 3SECA 1FWJC 5A6BD 3K1GA 4B5NA 4H8UA 1XYZA 5MKGB 2DUXA 1UZHA 3CT2A 4AIBA 5D2VA 4O8AA 3LGGA 3CK5A 5BXTA 4GI4A 2QGYA 4E4FA 5I77A 1DJNA 1R3QA 3FIGA 2E7FA 1H0IA 5LGZA 4QDMA 4C1NA 4DB7A 4N7QA 3C0SA 2EAWA 3LSBA 4GQRA 1B3OA 3Q65A 1L8PA 1J2BA 1NIUA 5DQPA 2ZRYA 3ABSA 5C9WA 4CQBA 4RUBA 1EXBA 3TTQA 4HJFA 2RKXA 3WN6A 1TREA 1R3VA 2Y62A 1JAKA 3B97A 1QTWA 1XLMA 2D0HA 2WO5A 1R7OA 4PZVA 2WCSA 4YL2A 2O9RA 2C15A 3MUZ1 1V7AA 1JXJA 3M0LA 1WE5A 1U5HA 2FVLA 1TPWA 2RFGA 4W93A 4WDUA 4D6GA 5F7UA 4PSPA 2QT3A 1DVJA 3AIRA 5IM51 1UMYA 2BOFX 3R8RA 5EL1A 1A3HA 2C91A 4G7EA 5H8UA 1VFFA 3V18A 3OBAA 4JEQA 2GYIA 2J88A 2ODOA 1MXDA 4QCFA 3TLQA 1R7AA 3G0SA 4C6FA 4DAIA 1FCQA 3SR7A 1OD8A 4CGTA 2E1WA 3CB3A 3GBDA 1R0MA 1VJSA 2C1HA 4DXKA 4GI8A 5I2UA 4O1AA 3I3DA 3FCPA 3AYSA 3OHIA 2VZTA 4A3QA 3H7VA 1XBXA 4HGXA 2FPTA 3CYVA 3E02A 3W1XA 5FF2A 1NSJA 4O50A 1TWWA 3L5MA 4WZHA 4MY9A 2YCLA 3WF2A 3VDGA 2GLKA 3VO0A 7PTDA 4PL2A 3OVQA 3KL3A 4O10A 1PWMA 1XRSA 1TPB1 4ZSTA 2YW3A 3NQGA 4R88A 3CNYA 4O19A 5CGQA 3GIQA 3OLGA 4K36A 3IIVA 2EKGA 5D03A 3RLHA 4TR9A 3SQSA 2WSPA 2AL2A 1EHAA 1E1CB 4QBXA 1UQYA 3BGAA 4WRHA 5DY2A 2FFCA 4JTEA 2PODA 4IX2A 3CPRA 2CFFA 3ZJ7A 1XKJA 1XBYA 3N4AA 1VR6A 3TTEA 4B4HA 1CLKA 2PTYA 2B81A 3K8MA 4L4PA 1TUXA 1I9CB 2ZUTA 4TVCA 4K7VA 2QNEA 1SJCA 1U1UA 5J5RA 1XCWA 3MDUA 1IR1A 2NUWA 4WR3A 4F48A 2OFJA 4LGXA 4PUKA 4BY3A 1A5BA 1ZQ5A 4J3ZA 5D8WA 4EE9A 4FPSA 3IJ8A 2DV0A 3QZ6A 4XIAA 2PDHA 1KTNA 5E1QA 3B0UX 3T05A 4DJFC 3P93A 4TO8A 1KBLA 1V3HA 3U6WA 4MNMA 4HPXA 3G3MA 3G6MA 4U10A 4WEVX 4GNJA 1GT8A 3SCVA 4BF5A 2P8BA 3ITGA 3DECA 4FNRA 4X61A 2CETA 1RH9A 5BNKA 2ZYFA 3O0KA 3GNPA 2ZZ4A 3GC4A 1YBQA 4KQNA 1ZAIA 3N14A 3M0YA 4E5TA 1QI3A 2O92A 3B8TA 1AJ2A 1IZJA 2DFAA 4XIMA 3PHAA 3GG8A 3AIVA 1PBGA 2Z2UA 4LWWA 4GFSA 4DUOA 3DAQA 4NRRA 2DGAA 5BMXA 5C2XA 3FJ4A 3B0XA 1XISA 4G5DA 5EMYA 2G96A 5IHSA 5L6UA 3RYSA 2E9LA 4AYGA 3UZXA 4RLIA 4J2MA 3LU2A 3UNDA 3W00A 1S39A 2G50A 3KBMA 4I90A 3PPFA 2VZSA 2VHLA 1H5VA 1WZMA 1D8WA 4AEOA 3LPPA 3WBWA 3LD5A 1LT8A 2EPOA 3HGJA 2QS8A 1L0PA 2CWXA 5GJPA 5D30A 1WZAA 1XIGA 5CJ5A 4ONVA 3QSRA 5CQ1A 3LPGA 3BAWA 1SW7A 4W84A 1XGEA 2G4JA 2Z27A 2ZUNA 4GIYA 1M1BA 1AW1A 2E28A 2JEPA 2QYGA 1WDQA 3M0MA 3L21A 2V2DA 5ENLA 4NX0A 4IGNA 1HKJA 4DLMA 3A4JA 8CGTA 1TO3A 1W91A 4QTGA 1FOBA 2I16A 3L4VA 3IAPA 4G6CA 4HNOA 1WO2A 2G4FA 2ADAA 2R91A 3S83A 4ADSA 1W1A1 3CQHA 2CIPA 2PWEA 1BXNA 3E2SA 1VAHA 1PDZA 3TKFA 2FZNA 3RJXA 2ACQA 1ZP4A 2O4MA 3GDTA 3UXIA 4EIVA 1YDNA 4PMJA 3CAKA 3V35A 4BJHA 3U4AA 4I9TA 3WNNA 3P61A 1XYAA 3LG3A 3DHFA 1CBGA 3AZSA 3QF0A 1EB3A 4MNLA 2VFFA 4MNJA 2Z28A 1ISWA 2GSJA 3ITOA 3T2QA 1CEOA 3H2NA 2V5BA 2WQDA 2X16A 2WMHA 4DO5A 2HE8A 2YL5A 3CU2A 2ZBTA 3PZIA 4J9JA 3PB0A 3QR0A 3KOZA 4MZYA 3TJXA 3BJTA 1DJZA 2Q8XA 2WKLA 2OYLA 1I1WA 3EDFA 3IANA 1SPQA 1IV8A 3S9YA 3HGOA 1O95A 5AYBA 4UFIA 3W27A 1CXHA 1FH8A 1QCWA 1FDJA 3L9CA 1D7KA 1JI2A 2XDFA 1W5NA 2MANA 4JCMA 4CVWA 3W7NA 4NI3A 2P50A 3IIXA 1O5RA 1NJJA 3PM6A 3H7RA 3I10A 5DMMA 3VGFA 5G1TA 1JYWA 2PF0A 5C0QA 1FWFC 1Q8JA 5LHFA 1GOKA 4W89A 1KBJA 1A47A 2WJZA 4PN2A 1RD6A 5FF3A 4IIFA 1NWTA 1TE6A 3T42A 3WNMA 2ZZ2A 3TE9A 1S2AA 1ZAJA 5AFDA 5BXSA 5CC6A 2JGQA 5FF4A 3MTWA 1PPIA 4H9VA 4KRUA 2J78A 3FVMA 5FESA 1TMQA 4R5EA 3O6YX 1UH2A 1EP1A 4MJMA 2ZTJA 3FGCA 2ATMA 3N9KA 1B30A 3O6DA 4D6CA 2XU2A 1B9BA 1P0KA 4CNTA 4N9BA 2D0GA 1TR1A 3FK4A 1TJ2A 1XQKA 3NSXA 5A6LA 4CQ8A 1K9EA 1JYXA 4W5ZA 3CAWA 1LWIA 4Q4MA 1P0NA 4GPNA 3PTMA 4N4PA 5I07A 2YB1A 4K8HA 3GSMA 3G8RA 5KTLA 1XYBA 3ZR6A 4QP0A 4XVEA 1G4SA 3WLIA 1WDRA 2VRKA 3MV11 4WDTA 3QGAC 2VELA 4XO7A 5AHIA 1G9HA 4ZR8A 1SR9A 2XFRA 4A2SA 3WQGA 3DFPA 4JDBA 4ZB5A 1A53A 3FLUA 1DYSA 1HL8A 2A2IA 5JIPA 2YJQA 3UYCA 3G8EA 1RK6A 1FHVA 2B0MA 7ODCA 5LNRA 1QOXA 3R5EA 4IOTA 3UPWA 3OTRA 4IF2A 3TK7A 1RR2A 4I5UA 5EMLA 5ABGA 3ZVIA 2C71A 1EWEA 2Y70A 1VLWA 4MB5A 1HJVA 3PZQA 3TW9A 3WBYA 3KE0A 2R8WA 2HK1A 3KP0A 1OGBA 2WVVB 3CS2A 1EYWA 4MFEA 3E9AA 1WKEA 1XH0A 1VHNA 4YVXA 1TWZA 1K1DA 2AQWA 5FF7A 5CZ0A 2GWGA 2OQYA 1JPHA 3ALGA 3JZEA 2FTYA 5HPCA 2Z1KA 5D37A 3MVIA 3UYIA 4IFOA 1PCKA 3GNRA 4FXFA 4LFYA 1YMYA 2PDYA 4CD5A 4O52A 1VHCA 2W92A 2I9EA 2Y7EA 3TYUA 3LCLA 3LCGA 3P67A 1OC7A 4FOJA 2Z7GA 4C6EA 1EJRC 3P62A 4MY8A 1QO5A 2VNCA 2CHNA 4IMAA 4QLJA 3R0DA 3EAUA 3LHUA 3QZEA 1UYQA 2A3CA 3A23A 3LBCA 3BAYA 3QW3A 3BLOA 4Q22A 2YR1A 5M03A 5FSEC 2YLLA 2VR4A 1XD1A 1K7XA 4Q4OA 4GZEA 2J7DA 1K77A 3WO8A 3CGTA 1AH4A 3ES7A 1WNOA 4ZE4A 1XCFA 3S6TA 2TRSA 4DO4A 4HN4A 5AC7A 4IPJA 4RNHA 5DXXA 2E9BA 3RHGA 4UR9A 2WHMA 2CHRA 4INFA 4BEUA 3PAJA 4B16A 4WOZA 3TN5A 4ZOEA 3VIFA 2A1YA 3LB0A 3LYEA 2OODA 2P1FA 3QFEA 2JKPA 2VCAA 3AICA 4RW3A 3UGVA 2B7NA 5G2HA 1F3TA 3O7UA 3MSRA 4JTLA 1LOSA 1TX2A 1ZCCA 4PMVA 1FWCC 2F9RA 1SZEA 3VYLA 1W17A 2Z2AA 2BGQA 2E5CA 2OZ3A 3GDMA 3WD3A 1GOIA 2A3AA 1V3JA 5DMLA 4Z2IA 3SRDA 3S42A 5J8LA 4H9ZA 1SFJA 3V7PA 2TYSA 1L8NA 5C6MA 1ICPA 4AC7C 4RPQA 2V5DA 2D69A 4EPEC 4OTKA 4LT9A 4QRNA 5A2AA 3K13A 4E3VA 4L1GA 3DFTA 4HA1A 4AY8A 1JNEA 2H9AA 3JU2A 3UXAA 2VL4A 2HXTA 4GKLA 4UTWA 2WCAA 3IK2A 3NL5A 4BFAA 3M6YA 2OELA 2YCJA 4GO9A 2J7FA 3GIPA 3MANA 3OIHA 4V15A 1V08A 9XIMA 3V0TA 1RUSA 5DMYA 1DTNA 3E1F1 4A8LA 2DEPA 1EC8A 4KIRA 4F40A 1DEDA 2IXUA 1QMLA 2VKZG 2YBUA 2ANUA 4AVFA 2BGSA 4DZHA 4KFOA 2ZXQA 3GFZA 3QH2A 4GBDA 3TOYA 4Q8NA 3LHZA 4NYYA 3AU6A 4H41A 3NNTA 1SZGA 4UTIA 2HS6A 3AMKA 1J8VA 1PX8A 1RY0A 5C5YA 2QW5A 4UOJA 3FEMA 2DVXA 1UOZA 1V0LA 1EP3A 1UQZA 3P5ZA 2ATSA 3B8IA 3UY7A 4HK5A 1VEPA 2EG6A 1K8CA 3A22A 1HQTA 3LM7A 1XIDA 1AFSA 1TPEA 1UHVA 3RO6A 4XAFA 4D8AA 1R86A 3L4ZA 3TYEA 2GUBA 2QAFA 3EOUA 1WXYA 4CN1A 2R94A 1HJXA 2J8FA 3GH7A 1XIEA 2JQXA 3SIMA 2PGRA 3NOEA 1MO0A 4JIHA 2OZTA 3OIXA 2WMFA 3FA5A 2VZOA 1YDYA 1TWSA 2V30A 1Q6DA 4AUBA 4DX3A 1MEIA 3P7YA 2F61A 4BF7A 3ZXWA 3TQKA 2PWFA 4A2RA 6REQA 4EWJA 3IIZA 4C7FA 1YYAA 1V6TA 2PWGA 3IJIA 3RLGA 4LV4A 2XZ9A 4JTSA 1C3FA 3MB9A 1H61A 3PTKA 4KCVA 2WC3A 5B80A 5J04A 1JYNA 2XYLA 1T99A 4BA0A 1HKIA 3SY5A 2D2JA 2HWGA 3WUGA 4IFKB 3DFQA 3F2CA 1MQQA 3V1PA 2OSXA 4RR4A 1XH1A 5HUOA 4UQ9A 1O66A 4O17A 3HPFA 1W9DM 1J0KA 4X3ZA 3ZLHA 2PGEA 1DIEA 1QNSA 1U5JA 4PEKA 2OPJA 4POCA 4IGSA 3EGJA 1M7OA 3GC2A 4HNNA 4XAYA 1M7JA 4ERAA 1JZ5A 1GHRA 1AZ1A 1W3KA 4N0RA 3AISA 3GTHA 3T0DA 4JAWA 3K4DA 3WQ6A 1EGMA 4AD3A 2E6AA 2PF8A 2X41A 4FMVA 2YFNA 1KXTA 3Q94A 1PDYA 2ZE0A 1FP9A 3G1VA 4H6EA 4IJCA 1JCYA 4H00A 2FHCA 3KVJA 3ZJKA 5AC6A 4KWOA 4US5A 1UWAA 1Y5VA 4YVVA 4QEHA 1IXOA 5DEZA 3SGGA 4JFTA 4RDYA 3BMVA 3LNMA 1RBOB 1RP9A 3GQYA 3PANA 1Q66A 1S1PA 4XO6A 4HU0A 5H6HA 3UR2A 2CKSA 3BOXA 4G9PA 1JDFA 4FX6M 5HNNA 3AJ7A 2PLCA 4NVTA 3MS8A 1W6TA 1GQIA 2YA0A 1F07A 4PCPA 1EH9A 2ISDA 3AJXA 1QU4A 3MZ2A 4GXMA 1PIFA 3BOFA 4HK6A 2OQHA 3TN4A 1PL9A 4IPIA 2O7QA 1AZ2A 1TQJA 1V51A 5CLTA 2GJXB 2G8ZA 4OHQA 1LLWA 3LRKA 4IICA 1XGZA 1I75A 1OFPA 3DH7A 3HPXA 2VJXA 3LHYA 2VUYA 3N1AA 1W9VA 4NILA 4KGJA 2D20A 1H3GA 3PPHA 2O0TA 4HK7A 4F2UA 3HF3A 1YBQB 4V2XA 1RLCL 5B7YA 2O4QA 4D6EA 1A80A 2F6XA 4C6DA 2PDWA 3I4EA 1DKWA 1S2UA 4HN8A 2PTDA 3QPYA 3NEVA 2L5HA 4HPNA 4LVFA 2BXYA 4HCLA 1HP4A 3A13A 1XH2A 5IXEA 1IXNA 1WXZA 4J3WA 2QPUA 5T91A 1F7BA 1BLIA 4DYKA 2JIWA 3SRKA 2EPLX 2V82A 3CHCA 1FA2A 4RV3A 2GJNA 4JS3A 5ABTA 3ATZA 3BW2A 4TMCA 1MZRA 4QQ3A 5FJJA 4RZBA 3LDVA 1K03A 1QOPA 3U2CA 1NDYA 3KRSA 1DJGA 2OSWA 1FFQA 1E6SM 2WQPA 4UQDA 2HV5A 4FXRA 1K6AA 4QE1A 5HJYA 5FJRA 2Y1HA 2QJGA 2F84A 3H26A 1DHPA 5LA0A 2AAMA 1P5BA 1EDTA 4E8DA 1Q6FA 2JKAA 3H2FA 4IX0A 5D9NA 4IFKA 4CU8A 2DW6A 1NU5A 2YDRA 1F4HA 3E2RA 1M68A 3DOPA 3MV01 1CGXA 5A1AA 1XYCA 4JICA 3DXIA 4HPGA 5XINA 4B5UA 4GQBA 3OOQA 1KFCA 1XLGA 4ZO9A 3VZXA 2W67A 3BJFA 4FALA 3QW4B 2D24A 4RE2A 3FW6A 4DF1A 1RVKA 2A3EA 5H2ZA 4GOAA 4REQA 3CZJA 1WZLA 3UW6A 3LUTA 3RAOA 1TVNA 4LUTB 2VENA 1ITUA 3ZT6A 5BOFA 1EL3A 2DUZA 3HQNA 3K4WA 3GC5A 1DE6A 4YHGA 1W3IA 2PE4A 1A4LA 1ESWA 3VIKA 2GJRA 5HATA 3VCNA 3HZ3A 3KS6A 4I9AA 1BTCA 4UWMA 2GGJA 3CAQA 2EPNA 2DZTA 3GKAA 3CV6A 4GMEA 4UMAA 4QAWA 4Z2GA 3RM8A 2NLYA 1H11A 4A29A 1CCWB 5BXRA 4B15A 5HUPA 3N6JA 3KBJA 3AO0A 4UR8A 3AMCA 3MW7A 1XIMA 1OCJA 1OCQA 3VDHA 1F76A 3TMLA 4ORMA 4RL3A 4JPGA 1US0A 2WYSA 1UR3M 1JCJA 3NXFA 2EKCA 3AYRA 3AS1A 4MZ8A 3GW0A 4DJDA 2E6FA 1E9IA 3GHTA 3C6CA 2ZFAA 3CEUA 4AMCA 3LGEA 1PTAA 1KV5A 4IP4A 3SFKA 1PIIA 4JR5A 3RM9A 3WQCA 2EHHA 1E55A 3BJSA 3GDBA 2XIQA 3WLMA 4Y9MA 2BP1A 4FEZA 2O9PA 2VC9A 3W1QA 1W37A 2XVLA 5HR7A 1FX6A 4KRZA 5DLCA 1TA3B 1VRXA 3IJQA 4C6NA 1RA0A 3UJSA 1OF6A 1Q2SA 1EC7A 2X2GA 4NAFA