3WBWA

Crystal structure of gox0644 in complex with nadph
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
271
structure length
271
Chain Sequence
EAQTVISFHDGHTMPQIGLGVWETPPDETAEVVKEAVKLGYRSVDTARLYKNEEGVGKGLEDHPEIFLTTKLWNDEQGYDSTLRAYEESARLLRRPVLDLYLIHWPMPAQGQYVETWKALVELKKSGRVKSIGVSNFESEHLERIMDATGVVPVVNQIELHPDFQQRALREFHEKHNIRTESWRPLGKGRVLSDERIGKIAEKHSRTPAQVVIRWHLQNGLIVIPKSVNPKRLAENLDVFGFVLDADDMQAIEQMDRKDGRMGADPNTAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative 2,5-diketo-D-gluconic acid reductase
publication title Crystal structure of Gox0644 in complex with NADPH
rcsb
source organism Gluconobacter oxydans
molecule tags Oxidoreductase
total genus 101
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3wbwA00
3V0TA 2IPWA 4NKCA 1YE6A 1R38A 1AZ2A 1RY0A 1YNPA 1OG6A 1JEZA 1HQTA 3BV7A 4PR4A 4XZIA 2CLPA 3M4HA 4Q3MA 4WGHA 3V0UA 4XO7A 3GHRA 3CASA 4JTAA 2IQDA 2R9RA 4YVVA 3WCZA 4L1XA 2PDUA 3UP8A 2HVOA 1UR3M 3RX3A 3UWEA 5LIKX 1Q5MA 3LN3A 3O0KA 3CAQA 4QXIA 1AH4A 3UZZA 1IHIA 1SM9A 1K8CA 1HW6A 3V0SA 3LBOA 2IKGA 2FGBA 1XJBA 3U2CA 4XVDA 4GACA 4JIHA 4PRRA 3RX4A 2IPFA 2PD9A 5DANA 2PDFA 2I16A 4G5DA 3MB9A 3O3RA 3M64A 5M2FX 4JTCA 3R6IA 3NTYA 1ZQ5A 1AH3A 4QR6A 1MI3A 2HDJA 1PZ0A 4EXAA 3P2VA 1S1RA 2PDWA 3N6QA 1LWIA 4XZMX 5HNTA 3R8HA 3KRBA 4FA3A 4ASTA 3LQLA 4XO6A 3V36A 3VXGA 4GABA 2PD5A 4AUBA 3LUTA 1AH0A 2PDGA 5AZ0A 4PMJA 2FZ9A 4IJCA 2HE5A 1VBJA 2PDPA 4JQ2A 2WZMA 1RY8A 2DUZA 4QX4A 1QRQA 2PDIA 3CV7A 3GHTA 3T42A 2PDKA 2FZBA 4GIEA 3UGRA 2J8TA 3LQGA 4GQGA 4JQ1A 2NVCA 3C3UA 4LBSA 3ERPA 2IS7A 2PDQA 2INZA 3QKZA 4YVPA 1MZRA 3COTA 3ONCA 1ZSXA 2IKIA 2PDYA 4HBKA 4JTRA 3CMFA 2DUXA 3H7UA 4FAMA 3R7MA 1EL3A 3CAVA 3WBXA 1YE4A 1ADSA 2BP1A 4PRTA 4JQAA 2F38A 1GVEA 1Z89A 4ICCX 2AGTA 5LIUX 2FZDA 2PEVA 4LAUA 1IEIA 1ZGDA 5JH1A 4F40A 2PDXA 4R9OA 4YVXA 5AZ1A 2A79A 4Q7BA 4LAZA 2ACUA 1XF0A 2ACQA 4YS1A 3G1RA 1PWLA 1J96A 3UZXA 3BCJA 5KETA 3N2TA 2PDJA 2HEJA 3DN5A 1US0A 2VDGA 2HV5A 5C7HA 4FALA 4WRHA 4ZFCA 4QBXA 3LEPA 3F7JA 4XZLX 4XAPA 3UYIA 1A80A 1EKOA 2DV0A 2IKHA 2IQ0A 3V35A 3EB3A 4L1WA 4LB4A 1AZ1A 4DBSA 4LB3A 2PF8A 1VP5A 2HE8A 2INEA 3WBYA 4GQ0A 1EXBA 2P5NA 3H7RA 4DBUA 2NVDA 4IJRA 3UG8A 3BUVA 3LZ5A 4EXBA 1S2AA 1Q13A 3G5EA 4JQ4A 1Z8AA 3Q67A 2BGQA 2ISFA 3LD5A 3UZWA 4DZ5A 2PDCA 3R58A 5HA7A 4H8NA 3ONBA 1M9HA 1ZUAX 3LZ3A 4IGSA 5LIYX 2WZTA 2PDNA 1X96A 4JTDA 2ACSA 2PDLA 3GUGA 1S2CA 3R8GA 5HNUA 3R94A 3GHSA 2PDBA 4DBWA 2I17A 2PZNA 4FZIA 4YU1A 2PFHA 4JIRA 2PDHA 2IPGA 3UZYA 4WDUA 1QWKA 1T41A 3FX4A 4RPQA 1X97A 2PDMA 1PZ1A 1AFSA 2F2KA 1YNQA 4XVEA 2C91A 3B3DA 3FJNA 3RX2A 1S1PA 4WDXA 2IKJA 1PYFA 2IPJA 2HVNA 5LIXX 4MHBA 1PWMA 4JQ3A 1X98A 3DOPA 3EAUA 4JTQA 2FVLA 4XZHA 5LIWX 4WDTA 4I5XA 3D3FA 4PUUA 4PUWA 3WBWA 1FRBA 1Z9AA 3EB4A 4GA8A 3R43A 4WDWA 1T40A 1EF3A 4XK2A 3WG6A 1LQAA 2BGSA 2FZ8A 1MRQA 2R24A 3H4GA 4LBRA 2ACRA 4JIIX 3UFYA 5JH2A 3BURA 3CV6A 4XZNX 4WEVX 1C9WA 3Q65A 1XGDA 4H7CA 3M0IA 1Z3NA 2ALRA 4HMNA 3LNMA 3LENA 4GCAA 3S3GA 1RALA 3MC5A 2QXWA 4OTKA 3GHUA
chains in the Genus database with same CATH superfamily
1W9BM 3MW7A 1XC4A 2YB1A 1JZ4A 3CHFA 3PWIA 3DXIA 4U5IA 3N12A 1UZHA 2C71A 1U1UA 2QGHA 3IJ9A 2G37A 3MMDA 4Q3MA 1CLKA 4XUYA 3HZ3A 4IT1A 2OO6A 2BV9A 3WCZA 2E1DA 3QQ1A 1PHWA 5I3GA 3VOCA 4FHAA 3NURA 3EEZA 2C13A 4O10A 3VKBA 3OA3A 1IWPA 6TAAA 1OCNA 4HMCA 1KCLA 4HK7A 1AH4A 1RBOB 4OOUA 1SM9A 3LBOA 4H6KA 2I9UA 3GXTA 4RV3A 3AMKA 4JIHA 4NG3A 1QHOA 4Q6XA 4UTWA 4S3BA 2Q8ZA 5FACA 4ZENA 4E3VA 1J01A 3PVFA 4FI4A 4Y8EA 2P8CA 3MBDA 3VM7A 3EWCA 3JS3A 3QH2A 1MI3A 3ITGA 1S1RA 1UC5A 4IQJA 1SYTA 2YKKA 3DHUA 4GQQA 3IVSA 2GYIA 3LQLA 2O0TA 3IJQA 4HYVA 3W01A 1ONRA 4QITA 5KZEA 4IPLA 2BXZA 3UZJA 3VGHA 1OINA 3NVTA 3LHUA 4NZ3A 3IV3A 3WN6A 2OU4A 2HE5A 1ZJAA 4J3UA 3BG9A 3GR7A 3TN5A 3WMLA 1YKWA 2Y70A 1Q6FA 5A94A 1QO5A 1WBHA 1H4PA 4PE8A 2PDKA 2JGYA 3M5YA 5LZLA 3IS4A 1ITQA 4C60A 2GDQA 3VC6A 3DFNA 2F9RA 3GDKA 3WH6A 1R0MA 4RZ6A 4E4UA 4J3SA 1XI3A 1G4PA 3QKZA 3BAWA 2B0MA 1MZRA 3RU6A 3OP2A 5D02A 1XLGA 1J12A 2FB3A 3TSDA 2C15A 3CMFA 1IEVA 3A4XA 4FAMA 1C29A 1R87A 4LUTB 1OFEA 3GXIA 4F0RA 4XBJA 1R86A 3AQUA 3G6LA 3OTRA 1CYGA 1BAGA 3W82A 4Q4OA 3QFWA 1E40A 3BPWA 4QG8A 1I9CB 3WD2A 1GOMA 4RR4A 3W7LA 4AIOA 4P8WA 2E9LA 3UNDA 4YVXA 1QNPA 2G97A 1ONWA 1YIXA 1W3IA 1MW3A 4A3RA 1H41A 3N2BA 3ZIZA 3G1RA 4CNUA 1WBJA 3BARA 5GJNA 5T9BG 1MFVA 4UMBA 3P5YA 3VAVA 3BOXA 1KFWA 3HPFA 3CL6A 2VC9A 4R34A 5DT5A 1W5NA 1XG4A 1SW7A 3AYSA 5I24A 4M82A 2ZZ7A 3S9ZA 4NT0A 4R3UA 1N2VA 3UYIA 2X0YA 3CZJA 3N2XA 4EPEC 3FEQA 4PUMA 4RJEA 4C7DA 4YWSA 4UQDA 3TWAA 1PXGA 1NF0A 5DELA 4DBEA 1X6LA 3S47A 4FNTA 1VLWA 4JEJA 3TNBA 1V8EA 2Z00A 5CZJA 4ENLA 1Z42A 1ZZMA 5A6MA 4U33A 1UH4A 1LT7A 1UD6A 3BMVA 4BKNA 2CKRA 3UG5A 5FEPA 1JCXA 1V3HA 4V1XA 1V6WA 3N2OA 3ZT6A 1QOXA 1H0IA 2XVLA 3Q4DA 5A6TC 3HM7A 2GSEA 3CQ0A 3H2OA 4DX3A 1D9EA 4KFOA 3EB2A 3PB2A 1HP4A 4Q8QA 4AEOA 3FDGA 1SSGA 4AISA 1BSIA 3R94A 3GHSA 1JI2A 1FP8A 1YTDA 2XVGA 4Q4PA 5E5CA 4E8GA 3AALA 4S3DA 1FKWA 1L2UA 4Z2GA 4AMAA 1KR0A 1VFTA 3TFXA 3AJ7A 4Q8PA 4O12A 4PBGA 3PAOA 4XV0A 4QJ3B 4AD0A 4RE0A 4GWEA 1TA3B 4HU8A 4PCNA 2I5GA 1A53A 4Z08A 4NIRA 3SCOA 3VIGA 4QG6A 4YTRA 3LU2A 1K9DA 4MWAD 4PUJA 4C1NB 1JDEA 1PIIA 1FWCC 2P8BA 4FNUA 4A3HA 1UR8A 2WHKA 1SFJA 4AZ7A 3LSCA 3ARPA 4JX5A 4CN4A 5JIWA 2XIMA 1RA0A 5DRCA 1TPUA 1PKYA 3KOYA 4H6EA 2DFAA 1MQQA 1XDMA 3M0KA 2NV2A 2TAAA 4OWGA 3S1GA 4H19A 3S5OA 3MT1A 3MWAA 3L65A 4GA8A 3R0KA 3AIVA 3GDLA 4UFIA 1AQHA 1XRFA 1RK5A 3LLDA 2TYSA 5REQA 4O0ZA 3KRSA 3TSBA 1DJYA 5CPLA 1Z32X 1HX0A 3NSNA 4HA0A 3AHYA 2V5LA 1JI1A 2DGAA 5FOOA 4GX9A 4HHMA 4D8AA 3BAKA 3SCWA 2R1LA 3ZSSA 3ISIX 4Q7NA 1FH9A 2OGJA 3MO4A 3S3GA 1S5VA 3KAOA 3DECA 3MKKA 1EF2A 3CH9A 1XSIA 4DJEC 4S1FA 4HHHA 3W38A 3SRKA 4V33A 2E40A 2FMOA 1H62A 1A0CA 3HG2A 5CLTA 4CVUA 3KCJA 4J40A 4I9TA 3HURA 1B30A 3U48A 2J88A 3W75A 4DO6A 1FWAC 4HHLA 4TOQA 4O1AA 1M1BA 4QM1A 3ENLA 4HNLA 2CZFA 1WKFA 3B0UX 1ADDA 3EWZA 3FAXA 2E3ZA 5E93A 1LP6A 1TVPA 1HGYA 2VRQA 2Y0FA 3P61A 3CL8A 1XV8A 8A3HA 2GGEA 3VZXA 2ALDA 3S4TA 2XVNA 2VYOA 1EDGA 1Y7VA 3W2MA 3LGGA 1RQBA 3VDCA 1E9IA 3PBGA 1BKHA 4DBDA 1EEPA 3LTSA 3W07A 5DANA 1O60A 3U6WA 3QFEA 4EF9A 3HPSA 3GG7A 1V3LA 1GUVA 3S2JA 3LBMA 3T05A 3NTYA 1A5OC 4OBTA 3U8GA 2VP8A 3GXMA 1O68A 1FFRA 4IWWA 2CBUA 2BX7A 3H8AA 3GUWA 2POZA 3AISA 6ALDA 3GNDA 3V36A 3ZJ8A 3QPEA 1GEQA 3F5JA 3DCPA 3OJGA 4JHMA 2ZX9A 3WJSA 3HG5A 1OGBA 2PGRA 5HATA 4IFOA 1WPCA 1JJKA 4MNLA 1OB0A 2WMIB 2FZBA 4H9ZA 1FCBA 2A3LA 3SEPA 3W85A 4PB5A 2ZUMA 3S5ZA 3K4DA 3PULA 2Y62A 5HWMA 2IS7A 3EXRA 3T07A 3WF3A 3ZVHB 1IEWA 3KUMA 2VR4A 3C0SA 1ENUA 4MUZA 3ZVIA 1W3KA 2YL6A 3TV8A 1XW8A 1BG9A 3M7WA 6XIAA 2G3NA 1J0JA 1CXHA 4KFPA 3PBUA 2ZWYA 1M7XA 1P1XA 1VGAA 4PRTA 2ZZ2A 4IIBA 1QVBA 1AK5A 4N9CA 3BAJA 2PURA 4ZB5A 3VDGA 1B4KA 3MJMA 4MNJA 5A8PA 3EA2A 1OIFA 2PDXA 5HXMA 2A79A 2G0WA 3DC8A 4DWDA 2BZNA 2J9XA 1VRXA 4NQ1A 4Z2IA 5FF0A 1Q85A 1KBBA 1J96A 1OABA 4JKLA 3WK2A 5EY5A 4O50A 4LY4A 2ZBTA 4Q8WA 1WV2A 1WYIA 5GPRA 1H1YA 2E77A 4KEVA 1WUEA 2XG9A 2VCAA 5AC6A 3SCTA 1AODA 3G0UA 3KDOA 4FR1A 3RRAA 3FXYA 2AAAA 3WDHA 1GVYA 1R5YA 1Y65A 1VBHA 2CZDA 1TX2A 2PI6A 4NZ1A 2ATMA 4Q4MA 2EO7A 4JYEA 2HMCA 1DWJM 4TTUA 1L8PA 4LYQA 4WCJA 1EXBA 3M0YA 1WDPA 3TWBA 2QCNA 3KEHA 3L7RA 3HGJA 2OLSA 3PB0A 1EJTC 2A3HA 4YNGA 2DIJA 3URQA 1UKSA 1BXBA 3KLKA 1EJUC 3TC6A 1GOOA 2X09A 3GU2A 3LD5A 3PHAA 4TMBA 2FTPA 4UTTC 1ODZA 3MU7A 3TC3A 4D6EA 5FL0A 1RR2A 2WVUA 3VM5A 1L6FA 1CT5A 4R85A 3R8GA 1GQNA 1BKSA 3U4AA 4CCZA 4BEQA 1MXDA 1P1MA 1EQPA 1IIGA 3CZ8A 1A4MA 2FJUB 3APYA 2WSQA 2WMJA 1DJQA 1XM3A 5F2IA 4WDUA 1G67A 1DQUA 1QWKA 4WSJA 1EHAA 3TU9A 2YDQA 2DT3A 2CLLA 3TSMA 1OYBA 2WWCA 4O16A 3IJ8A 1K7EA 1XH1A 1MW2A 3DAQA 1A5LC 4XVEA 2NXHA 3E5PA 1M6JA 1PX4A 1FP9A 1XYCA 3L66A 4O53A 4DJFC 4WDXA 4LC6A 2C7FA 1DJHA 2J8GA 2PWVA 3MUIA 5AC8A 5D2WA 1JUKA 1CIUA 3K1DA 1U1JA 3GFYA 1TSIA 4N9DA 3LPOA 3ZO9A 2X1IA 4XB3A 3UR7A 2WXDM 4I5XA 3F2CA 4J3XA 3GDTA 3MTWA 2NUYA 4A29A 4NZ4A 3HQPA 1L8NA 2R14A 4LH8A 4GGBA 5D05A 4UFLA 3W3OA 4NAEB 4IHCA 1P43A 3WLPA 1LBMA 4XK2A 3UWWA 1X1NA 1LROA 3GSMA 4FLRA 1E55A 3WD4A 4WVXA 1W1A1 4HGXA 3PNZA 2RDUA 3BSMA 3T6CA 1VENA 4OOZA 1H5YA 4Y9NA 4WEVX 5KITA 2VEMA 4B9ZA 4QCFA 1YEYA 1E6NA 5AHEA 5C5YA 5JIPA 1LOLA 1QNQA 3LHTA 3GK0A 2WZHA 2ZADA 4Y96A 1S38A 5H2ZA 1JVNA 3QSTA 1YQ2A 3BGAA 4LGXA 2OMAA 1HGWA 4GJ1A 1OWQA 3A21A 1OT2A 3ZZ1A 2QCLA 2CLPA 2QAPA 4AW7A 3RPMA 3BG3A 3SECA 3PZMA 1TMLA 1Z44A 4Q8TA 2RGLA 3NVDA 4UQAA 2PP1A 3UD6A 4RZ5A 3AICA 1PCKA 3RPDA 2DW6A 5FJIA 4US5A 2WANA 1VFMA 1OFRA 7ENLA 3W6LA 4BCEA 4C6CA 4D8LA 4HJFA 3G1AA 3WLSA 3NQMA 4ZFMA 2FGBA 3ID7A 4GACA 4GG9A 1D7KA 1H49A 1O66A 2D0HA 3MUAA 4IICA 2QMKA 1GVFA 1UUQA 4FXSA 1L2QA 2YX0A 1B3VA 4P8VA 1UCWA 3QY8A 1VEPA 2VCCA 1VBRA 1K6AA 2NLIA 3A5FA 4FLSA 4Q4SA 2FVMA 3C52A 1ZB5A 5ABGA 3NQ8A 4EXAA 4EP8C 5XIAA 2PODA 5C70A 4J1OA 4A22A 4FIRA 5H1WA 4EXQA 1J5SA 1I0DA 4IPIA 1WE5A 3SN1A 4N4PA 2DZAA 3LTYA 4PSPA 2DPEA 2QCHA 1MEHA 4X0VA 4DJEA 3PK7A 2ZXDA 4W89A 1I2OA 2ISWA 3DG6A 3E2SA 4ZEPA 3E0WA 4HOWA 3E0IA 4K7YA 1CTNA 3HGOA 3I10A 4GYFA 1O6IA 1VBUA 3NQDA 4AWTA 4FOUA 5EA9A 3URAA 5EGRA 1P0KA 2IUZA 1UROA 2YXGA 1CW2A 4O13A 2QEZA 2Z1BA 5AN7A 3F4NA 3NWRA 2YIHA 1XLBA 3WDIA 2WSPA 3TH6A 4KRTA 2JE8A 4UNIA 3W7NA 5CZKA 1UJPA 3I4KA 2ZA1A 5FJJA 1K77A 4MFEA 1B3ZA 3CHDA 2RUSA 4A3QA 1GJPA 1JUBA 1WNOA 3CB3A 4NUWA 3TX9A 4H04A 2QF7A 3CAVA 4M24A 2QUUA 2F6XA 3WH8A 3AC0A 1LF1A 3MHGA 4CU8A 5F4SA 3PUEA 1UIPA 1EJ7L 4ERAA 1KTNA 1SW3A 3GM8A 2DIEA 2RDTA 2P3ZA 3T81A 5BWFA 3V5CA 1ZGDA 3FSTA 5JH1A 2DZWA 3HTWA 3UEQA 5M3WA 4QDWA 3WJXA 4DF0A 3VCNA 4AX7A 4A2RA 3O6CA 1UPMB 1P5BA 1K4GA 2QHAA 2FTYA 1TV3A 1KTCA 3PBVA 1XBXA 1LJYA 1PO9A 3B8DA 5KZDA 3CM4A 1CDGA 2PC4A 3T8LA 1K7XA 1XRVA 3QTGA 1LL6A 3FYOA 4AZIA 4EAYA 5D37A 3KLLA 3MP3A 4O4WA 5BRQA 4F79A 5FSEC 4DWSD 1QFEA 2IKHA 2IQ0A 3TQPA 3HB9A 2Y85A 4NSBA 3ES8A 2C16A 4FX8A 2WCGA 1AZ1A 4DBSA 5M03A 1TE6A 3DHDA 3KP0A 5CPMA 5C71A 5DCBA 5BCAA 3QW3A 2GJXB 4Z17A 1FWSA 4I5UA 4C7GA 3QV9A 3W25A 2CBJA 2NX1A 2V8ZA 1W3LA 2FGLA 4RW3A 1FWBC 3LCLA 3IAPA 1S2AA 3NNTA 3CC1A 4Q4QA 4WY0F 3O1NA 3SJNA 2V9DA 5CSRA 1MEIA 1QNRA 1CLVA 3W7MA 1HFBA 1HUVA 1TZ7A 1DJIA 3UZWA 3FJ4A 3GZ3A 3PZTA 2NWSA 4MADA 4WQ6A 4A8LA 1UKTA 1VYSX 1DWIM 5HMSA 5FIPA 1GVSA 4GPNA 3NL5A 1IIHA 3FKKA 2PB1A 3NM1A 2QUVA 4V15A 1TELA 3WNKA 3WK3A 3CUFA 2A7RA 1WAUA 3MMUA 3T0TA 4UOZA 1UWQA 4KFNA 1AJ0A 5GNXA 1O5QA 3IK2A 1UJQA 2ABAA 2PDMA 4QEEA 3CPRA 3WUGA 3C2VA 3QM3A 1W9UA 3MVTA 2JBMA 1EH9A 1O5XA 3OHMB 3FJNA 1WXZA 5HNNA 2J24A 2CXEA 3LLFA 3EOLA 4E2OA 1XKYA 3BH4A 2FQIA 4JQ3A 1DXFA 3KL3A 3EAUA 1KNWA 3CXOA 4XZBA 3EWWA 3N13A 5HWJA 1R2SA 1E6XM 2VXNA 3RMJA 1TE1A 2DT2A 5CJMA 1JFHA 3AHXA 3DFHA 3EWYA 4UZUA 2V3DA 3E6EA 3WG6A 3THAA 2FZ8A 2PAJA 2DDXA 3MS8A 4D6GA 4AFYA 2Z27A 3CUJA 1ZS2A 4JIIX 4PL2A 2WC3A 5F1VA 2WSRA 2YLAA 3KVKA 4HPXA 4M8UA 4IQLA 5FD0A 4HQVA 2ZA2A 4X9SA 1WUFA 1MWOA 2WC7A 2NQLA 3QOKA 1RALA 3VFLA 4YXGA 3DG3A 3MI3A 1MW0A 2ONEA 1V03A 2Y7FA 3OEXA 5CPQA 1RPXA 1OFOA 2VR5A 1CXEA 4WKHA 1F6PA 4GX8A 3NAVA 1W2PA 2NQZA 3ME3A 5GQBA 3M0HA 1SJDA 4G6CA 4J35A 4WGHA 1I1WA 1HJUA 2IW0A 4LPCA 4DJFA 2XN0A 4QFUA 5C9XA 1TO3A 1G7VA 2ZRWA 3WQPA 2TPSA 1KGXA 4US5D 4UMCA 1W37A 4X63A 2EJAA 3O0FA 1XPGA 1W56A 1VIZA 5D30A 5DX7A 1QBAA 2Z0IA 2VOTA 2P76A 3ALGA 4GI6A 4UFMA 2GK1B 3RN6A 1V7AA 3W6YA 4XVDA 4LUTA 1UWUA 3S83A 3W1PA 1IXOA 2PD9A 4OZOA 3PY2A 1JAEA 1H2JA 5CPOA 4LRSA 1NWTA 1ME8A 1E5JA 2VFGA 2HDJA 1OK4A 3AROA 4ORIA 2CLOA 4IGNA 3MYOA 3CU2A 1OBAA 1VBGA 1QI0A 2CC0A 2YDAA 1B3YA 1KXHA 3UPWA 1EZ2A 3V16A 3AIRA 3E9AA 3N14A 3WFLA 3T2OA 1W0MA 3P84A 1W1PA 5HANA 3LCFA 3V5FA 3PPCA 1GZGA 3HU7A 2P1FA 2Q01A 5E0FA 3WD0A 4O4VA 4IJCA 3GYEA 4DUVA 4HA3A 3WF2A 3NCOA 3GU1A 4RL3A 1U5JA 1GGOA 5E9AA 1AW2A 4K6AA 1W9PA 4IZGA 3BMWA 3N4AA 1JPIA 3GH5A 2DT0A 3O9NA 3WJYA 4L5ZA 1OADA 3LQGA 4XIAA 4E4FA 1P0EA 4V2XA 3L12A 2PWFA 1FWWA 1ZP3A 3ZJKA 4G8TA 4M5PA 3W9ZA 4YVPA 4V1YA 1I0BA 2QCEA 3NJ3A 4LCSA 3TK7A 2EG6A 1JR1A 2EPOA 2VVSA 5JBEA 5DBTA 4GVGA 2AOSA 1DHPA 1YTKA 1W2VA 2VI0A 4GJIA 1FHVA 3WBXA 1N8IA 2CESA 3NM3A 1IF2A 1ONXA 3AXXA 1WDQA 4BQ3A 2ZXQA 2QCGA 4R7JA 4RE2A 1JD9A 1I8JA 3BG5A 4DELA 4Z2KA 1MZHA 2ZOXA 5A2AA 2PGWA 4MDPA 4HTYA 4S38A 4BWLC 1PHQA 5H8PA 3GG1A 2D73A 5LYRA 3ABOA 4UOJA 1SUXA 1E5NA 2YBTA 1G6CA 1FOBA 1PWLA 5BXPA 1HO1A 3EGJA 5KETA 2BWGA 2HEJA 2HCVA 1RLCL 3GW3A 1BXNA 3NL2A 2X2YA 5C7HA 1R9ZA 3PM6A 4GK8A 4UZSA 4FALA 1TA3A 1XLJA 3M0MA 3IPWA 3KS6A 4XAPA 3ATYA 2FHFA 3PANA 3CUGA 3I6TA 2ZYFA 5I3HA 4NRSA 3EB3A 3BJFA 3QR1A 3T7VA 3MI6A 4MJ4A 4C1NA 4DUWA 2KZHA 2WQDA 5ABEA 1KRAC 4IPPA 3ZLFA 4PMRA 2YA1A 2BB0A 5HMDA 4WXZA 4M56A 3CHCA 4A8NA 1CXFA 1BSLA 1K8YA 5KMYA 1ZCOA 3Q67A 1UQZA 4BF5A 1N82A 2VDHA 3R58A 4O28A 3SY8A 3L2MA 5K2ZA 4P7QA 1FHUA 1ME9A 2E09A 4CD6A 3DHPA 5U7SA 4GXWA 2J78A 4JCLA 2X0HA 3HN3A 5HWNA 3T8QA 4S39A 4BS0A 3P80A 1KA9F 1FVPA 2R82A 2FFIA 3Q45A 3DFYA 3AUJA 1U1HA 2EGZA 5E0KA 2Z2UA 3U5YA 4NJIA 2RDWA 4FZIA 3S1UA 4MWAB 1MW1A 3KCLA 1EBGA 3M9YA 5AHNA 3FAWA 4R53A 3ABZA 3A23A 5I79A 3P8JA 2QAFA 4Z2LA 1JZ3A 1VR6A 1E3XA 2VDIA 4OHQA 3W76A 4CEUC 1V0NA 1E3ZA 3DFOA 3NQAA 3SSZA 4EVZA 1DBTA 4DM2A 5F2GA 5CBIA 3RCNA 4AY7A 3S2MA 1J8VA 4LUIA 3BLPX 1PZ2A 2DORA 4MJ2A 5DBUA 3B8WA 3NXFA 4ZO7A 4I7WA 3SCUA 3NOYA 1W5OA 3BGJA 2Y63A 2F6KA 4JTQA 2NUXA 4GMEA 1NOWA 2O9TA 3IANA 1E1FA 2VFDA 1NWSA 3I7QA 1TPC1 4IX2A 1YDVA 1OK6A 3OZMA 2ZUTA 1M01A 2Y4SA 4Y2WA 1CB7B 4GQRA 1NH6A 3THDA 2ZDSA 1D7FA 1EF3A 1MRQA 3SSJA 2D2HA 1GVOA 1XCFA 3AOFA 3R12A 3W27A 2G3FA 1R7AA 2VT0A 4H83A 3EZ4A 3CV6A 4XZNX 5A8NA 5DLCA 1C9WA 1VD6A 3A64A 4W7VA 4WUIA 3LNMA 4CQ9A 4X2RA 1BQGA 1FWTA 1OG0A 5CQ1A 8RUCA 1WXJA 2JFEX 4DVOA 3U4FA 3L4ZA 4J28A 1KWGA 2NX9A 2REQB 2V2HA 4EAMA 2R1KA 4L6DA 1OYAA 5FEXA 1EUNA 1FX6A 3IUDA 5F2LA 3W72A 4KWUA 4RNJA 4I9MA 3SN4A 1NVMA 4Z2JA 2WMIA 4DJFD 3SCNA 1GJUA 4L4OA 4QRNA 1DVJA 2EBNA 2VR2A 2Y89A 3AS1A 4Z1CA 3LCXA 3TTOA 4YJ5A 2G3JA 3M5XA 2Z2AA 4NX5A 4TV6A 3PZIA 2E1WA 2D2JA 2UY3A 5TF0A 5I3IA 3ZVHA 3LI1A 1QCWA 2XGIA 4HCDA 1R3SA 3ECQA 1O1ZA 4QG9A 4XSLA 1A0DA 1H61A 4E2BA 3B40A 4O18A 3MSDA 3PZNA 3OU8A 1VJSA 1BD0A 3EX3A 4C5ZA 4AZ6A 2VUYA 3VGEA 5I3DA 2AQVA 3WLQA 1GW1A 3HF3A 3W29A 5DFAA 1XX1A 6A3HA 2JF6A 4GVHA 2VX4A 3WQCA 3LHVA 3ARWA 4HK6A 4P7OA 2V69A 1OHLA 4RCXA 4LAMA 4ADUA 3T0CA 1Q8JA 1FWRA 4FSAA 1O94A 1KFEA 3KRBA 1Q4NX 2I5QA 1V3MA 4OT7A 3VDHA 4W7WA 3UF9A 3VXGA 5KSWA 3S2CA 2ZKMX 4JICA 1H7RA 1GYNA 3ZR6A 4O0KA 4H9YA 1AH0A 1F76A 1SPQA 3M7SA 3MKVA 1TRIA 5DT7A 1OT1A 1YPFA 1GNXA 3KWSA 4O52A 3DH7A 4HMEA 4U28A 3H53A 2YCEA 2DZVA 4A8IA 1EBHA 2ZUWA 1KKRA 2NSXA 5CAHA 2ZZ4A 3B8SA 2QMJA 4GIEA 3GDRA 3AU6A 3QY6A 3IUIA 2WKGA 1K3UA 3NFUA 2NVCA 2V2CA 3KBNA 1ISWA 1SMAA 5KZ6A 2CW6A 1VF8A 4LSBA 1E43A 2PWEA 1OFQA 1W1YA 4BQ2A 4ADSA 4PEEA 1HVXA 4XWUA 1SZNA 5DEZA 2Q02A 1DOSA 1CGUA 2BP1A 3S5YA 3ICJA 1OFPA 3DX5A 4B5NA 2PCQA 2QDHA 1UWTA 3M6YA 2EG8A 4ICCX 2AGTA 1DYSA 1KRBC 2QNEA 1B54A 3MUZ1 1V6VA 4KEUA 3WX7A 4LAUA 1IEIA 4BQ5A 5ABHA 1RVGA 3WNPA 3GS6A 5AZ1A 3P5ZA 3KM8A 3ALFA 1XGEA 2A5HA 4LAZA 1E56A 4O1BA 3KBWA 2HVMA 5KEZA 4LC8A 2E9MA 4IM4A 5FEZA 3UCCA 4KIRA 2GFTA 4H8HA 1ICPA 1FXQA 3VPLA 3H4WA 1UMYA 3TA9A 3VNLA 1BYAA 3GKFA 3GXFA 3H4XA 4S3JA 1HG3A 1US0A 2CXGA 3V1PA 5JXQA 3W22A 3W1LA 4C91A 4F8XA 1TV8A 2F7FA 1KBJA 4KMQA 2PTXA 1AL8A 4PODA 1HJXA 3F2DA 2XN1A 1RP8A 4ZE4A 4E8DA 4PYSA 3AS3A 4JOMA 4S23A 4FS9A 4QS6A 3WQEA 1FQ0A 2GQAA 5AHFA 3GXNA 2WSYA 3LCGA 3EWDA 1BVNP 3RM4A 4TUFA 1KM3A 3D0CA 4Y9PA 4HB7A 2NV9A 3VE7A 3CB8A 1B9ZA 4FLQA 3NL3A 5FJRA 3VILA 2A4AA 3BUVA 4MYXA 1PKNA 3UG8A 4I3GA 3B4YA 4QQ3A 3KZSA 3UA4A 5DCDA 4JBRA 3OBAA 1Q65A 3TN3A 3MDUA 2ISFA 2V0TA 4CQ8A 4NAEA 3S6OA 5EB8A 3E0LA 5LA1A 1QATA 1JPDX 1XKJA 4JN6A 1IE7C 2A1YA 1XYBA 4WR3A 1VIWA 4PTNA 4LS2A 1TG7A 2QLYA 3E02A 3OIHA 4BWLA 3G8RA 5G5IA 5A69A 3L2IA 3BOLA 1R30A 5A5WA 3PJXA 2FFCA 5EYWA 3VIFA 4Z1YA 1GORA 1XLDA 1G4EA 4GKTA 2JGQA 1V0MA 3I65A 4CN1A 2XSBA 1TWWA 2BVDA 3OW1A 5AVHA 4BK9A 3NXLA 3ITCA 1G9HA 3UWYA 4EK7A 3BAYA 1KD0A 1PZ3A 4GZEA 3WQVA 4H9TA 3UNTA 3E49A 1Q7QA 4JIEA 2WVSA 1GVQA 2CITA 4JNZA 1HKVA 1L9WA 1AD1A 1Q6LA 5AHIA 1HNYA 1POJA 2C91A 2VOMA 4O0QA 5G4HC 4JFWA 3LB0A 4W8LA 2PTZA 1JRBA 4LBUA 1DWHM 1EHNA 4K2SA 1E0VA 3RUBL 3W1NA 1IGSA 4MHBA 4GYKA 4IH3A 1PWMA 4DM1A 3MSYA 2DSUA 3L0GA 2R1NA 3A9IA 4D1IA 3M0JA 4Y9MA 1W5PA 2PA6A 2XHYA 3TTEA 2ISVA 1C8XA 1LZOA 3P93A 5I23A 1QHPA 5DY3A 5M17A 3R43A 5D9MA 3IGSA 4HVXA 1W3NA 4WY0B 3N17A 1MDRA 1BQCA 4KEZA 4ZVJA 3SCRA 3ZOAA 3KOZA 4ML4A 2G4JA 2NXGA 4LTSA 3GIYA 5C9RA 5C2CA 1DJXA 4UR9A 3BMXA 3BW2A 1P7TB 1VJZA 2HPIA 3H2CA 1FXPA 1GTHA 3GWQA 4YIWA 3NPVA 3BVJA 1PSCA 3NEVA 4EANA 4JL1A 2GLKA 2WJDA 3IVTA 3B4UA 2P0OA 1RY0A 1W6TA 4QIUA 1OG6A 5D09A 1C8QA 4A3YA 5K4XA 3OLIA 1THFD 1VFSA 4IP7A 4R7WA 2CEQA 3BO9A 1V6TA 4KWWA 1I60A 2YA2A 3EOOA 4GZIA 4JFSA 4ZSTA 2ASHA 3KVJA 5CZ0A 3ZSTA 1IT7A 3UP8A 5C9WA 3CQKA 3VYLA 2V2DA 3NZ1A 3N15A 1WZKA 2Q3OA 7TIMA 4B2DA 1U5VA 3WF0A 3T0DA 1Y8BA 1OZMA 2PCEA 2XN2A 1IZCA 3LPFA 1Y5VA 3NQEA 3J7HA 2NVAA 4RKAA 2Z7GA 3KFTA 3BQ6A 5K9CA 1GOKA 4YTSA 4K8EA 3B9NA 4H8UA 4AH7A 4NJJA 4EKJA 1C91A 5HQEA 2VO5A 3PSVA 1GOIA 1PZ0A 3VI2A 2WJEA 4DEFA 3B0XA 1M7JA 1VFFA 4YMZA 3E12A 1VPXA 1X1OA 2VX5A 1B1YA 2ZRVA 5FJTA 1MSSA 3VK5A 4FA3A 4ASTA 4XO6A 1UBPC 1DWGM 1XLHA 3LM7A 1XYZA 2PD5A 3SFKA 1YLVA 4B3KA 4GNJA 4FXJA 4HNNA 4ZQRA 2PDPA 1RY8A 3WLOA 3WLJA 1T99A 2QYGA 4F2UA 3CV7A 1OC5A 3DERA 1MFUA 4PFHA 3RO6A 1H7XA 5CBJA 1QI5A 1JDDA 4HJWA 4YPJA 2J8TA 4UOQA 3UJFA 3P3BA 3AYTA 4ZGYA 1QXLA 2O7QA 1GJWA 1WX0A 4P5UA 4Y6GA 3HQ1A 2YL9A 5FA5A 1E4LA 1JD7A 2GJXA 2PDYA 3AWNA 3NSMA 3R7MA 5I2UA 2NLYA 3Q2DA 4CQDA 5BOFA 3IK4A 1ADSA 3CS2A 4MY1A 2EKCA 2NQJA 1B0IA 1YYAA 3AHTA 2ZC8A 4DXKA 3BGGA 1XRTA 2J27A 5I03A 2CPUA 3VU2A 4QE5A 5I09A 3G0XA 1VYRA 4GZJA 2OR2A 1FWDC 4IGMA 2A6LA 3AIQA 3WD1A 1CGXA 4B16A 1MYRA 5A6LA 3QV6A 3C2OA 4AEEA 5FL1A 3EOUA 4ERIA 2UV8G 2WMKA 2EPKX 3SR7A 1RLDA 2RDXA 4DWSB 5BZAA 4AWUA 1VHCA 4LWWA 4LXFA 1TWIA 3HFTA 4AXNA 1MDLA 4JYFA 2D3LA 3QGVA 3EKZA 1W1IE 1ISXA 3FNDA 3V35A 1Q63A 3NG3A 1UR2A 4S2BA 3LGEA 3TQKA 3VD9A 2OQLA 5DQPA 5DMMA 2J7BA 4GXPA 5CSYA 4JIPA 4UTHA 3K4AA 1JULA 5I06A 4GC4A 3R89A 4H2CA 1V4YA 5BNKA 4N6FA 2BFGA 3I4EA 3NDYA 1NM9A 3S9IA 5HK4A 2CIPA 2QIIA 2BVWA 2C18A 5J8LA 2CLHA 3T55A 7ODCA 3QN3A 4GFIA 2CLEA 1R7OA 4W8BA 1RCQA 2VRJA 3U7BA 3GBEA 2VHLA 4DZIA 2PDLA 2ISDA 3ITOA 4U3AA 2DQWA 1HJSA 4XD3A 2B7OA 3C6CA 1BTMA 4KESA 1IGWA 4OFCA 1UR4A 1FDYA 4FX7A 2GL5A 1S2VA 3SN0A 1RA5A 1GVIA 2I17A 1YMYA 4UQCA 3IVUA 3NDZA 1SO3A 1OEPA 4ZXOA 2OXNA 2Y6ZA 1UZ1A 2ZUUA 1ODUA 3ZQ9A 2H3BA 3HIJA 1GOWA 3SGUA 3PPFA 1PZ1A 4QHRA 1EIBA 4EACA 3GIQA 3TFCA 1VFUA 4AZ5A 4IL2A 1WZLA 1K9TA 1UBSA 3RX2A 1S1PA 4GINA 4O1EA 3SCVA 5ECVA 3ARTA 1VJIA 3WQ5A 1S5MA 3KOWA 1PIGA 2YYTA 3GNPA 1IZJA 2ZDRA 3WEOA 3GNRA 5ABTA 9RUBA 1BGAA 2VKZG 3D3FA 3NIYA 2CBVA 4RW5A 4PUUA 2O55A 1ELSA 1YXDA 3FS2A 2GK1A 1P0NA 1S2UA 1UH2A 2XINA 3CLWA 2TSYA 1B2YA 4LEQA 1UASA 3WFZA 3PP7A 2WZIA 1EGZA 1US2A 1YADA 4OQVA 2ABBA 2XIQA 4GUHA 3RMEA 1QU4A 2L5HA 2EPHA 3DIPA 3UGVA 4LVFA 1R47A 4EPKA 3PF3A 1T8QA 3BURA 2Y8KA 3E5BA 5GJMA 4GJJA 3TLQA 2HXTA 3L4WA 3VDAA 2XIBA 3ITXA 1TUFA 3LSBA 1HL8A 2D24A 2VC6A 3THUA 2ZRXA 3UVAA 1Z41A 1UB3A 3ITLA 4QE4A 2QXWA 3QBUA 1A5KC 1R9XA 3REQB 1TV5A 1Q8AA 2C0HA 4U10A 2ISSA 1XGZA 1UMLA 4HU4A 1DORA 2V68A 1MRAA 4X2PA 4MKSA 1SGJA 1PDYA 3KXQA 1DJGA 4B5TA 1C7SA 1CGVA 2WHMA 1CI1A 3CUIA 4ACYA 1I2PA 3KBVA 1AQ0A 4C6BA 4XO7A 2OPJA 1P48A 4F3HA 3GHRA 1YPIA 1XP3A 3B0VC 3GRIA 3CASA 5T91A 1U5HA 1TJ1A 1I45A 3WLTA 1YX1A 1E0TA 1D2KA 5D33A 4B15A 2DY3A 3SUTA 4W9TA 2J66A 4ZQCA 1TTIA 5AFDA 1SFTA 2PGFA 3CAQA 4S3GA 1F4AA 1B90A 1FFQA 2EHHA 4GVFA 1FTXA 4F48A 2GVEA 3HMJG 4PULA 3OG2A 4PRRA 3RX4A 2O7SA 1IV8A 4MMWA 3VNYA 2ON3A 3A3HA 3KRZA 4ZOAA 4LUSB 3R5EA 3VX1A 1NDWA 3VUSA 3C2FA 3MUXA 3W7CA 1EX1A 2J7HA 3WDJA 5BU9A 3E74A 3CGTA 1UPPA 1HJQA 4XZWA 2VFEA 3JZEA 4NNCA 2A3BA 3UZ5A 1TJ0A 1LUCB 2BHZA 4UTFA 3EX2A 3N25A 4RDVA 4R33A 5AHMA 4WD0A 1ZBWA 1K9EA 4AUBA 4K8GA 3LUTA 3O63A 1UA7A 4M6QA 4H3DA 1UD4A 5CPTA 4ACZB 4UTMA 2W6RA 3K8KA 4QAWA 2E6DA 2D69A 1EOKA 3GQYA 1IYXA 4IG2B 1LRQA 2JKPA 3CZKA 3VIKA 3IIOA 3MMTA 5DY2A 4MB3A 2PGEA 4IQDA 2KX9A 2WV8A 3LRKA 4I8YA 5G1YA 3L5AA 2J8FA 1S46A 3AMCA 4NL1A 1R2TA 3QW4B 3SB0A 5DMLA 1F07A 1AL7A 3QYSA 1TREA 4HNTA 1O1HA 5EMKA 5IFTA 2VD9A 2X1TA 5JQ9A 4MZ1A 4BEUA 4L6HA 1UA3A 3HG3A 4X3ZA 1YDOA 2FIQA 4PZVA 2BVYA 1GVEA 3CQJA 3KDNA 3QRHA 4V27A 3VD5A 4P2VA 1M65A 1F3EA 1QDSA 4TVUA 1E71M 4B90A 3UXLA 5CBBA 1REQB 2PZ0A 5DN1A 1W54A 1VYPX 1ZHAA 3SY1A 2OT1A 1CNVA 3VKJA 3S8HA 5I02A 4RUBA 1TFVA 2VGGA 1XF0A 2AMXA 4AQLA 1CENA 4IP5A 4YS1A 2O4MA 2E8YA 1XIDA 4UXDA 3BSHA 1UHVA 5MKGB 5E09A 2E8ZA 2VDGA 2WPGA 1ZJIA 1DJZA 1LQ0A 2FDMA 3FFSA 4UBPC 4H9XA 2YDSA 1U22A 5B80A 1HKIA 4XSMA 3F7JA 1MXGA 1ONEA 4QJ1A 4YTUA 3URBA 1LRTA 1VFLA 2GJRA 1KM5A 3QR0A 3NZPA 4UQEA 1KGWA 1XLMA 3MHFA 1K6WA 2GGGA 1RK6A 1XPYA 3H22A 1DKWA 3UR5A 4ZTXA 2FZNA 4ZODA 3WEMA 4GY7A 4NZFA 3NQVA 4DBUA 1JYNA 2XFRA 5HDRA 2ZFAA 3C56A 3CT2A 4HNOA 4GZ7A 3B06A 3NOEA 5HBFA 1N55A 4HA1A 3ZFHA 2VX6A 3OYZA 3GW0A 4IOTA 5CC5A 4EIVA 3DI1A 1DIKA 4XKYB 3P67A 5F7UA 2JIWA 4K8HA 4WKAA 4TR9A 1F3TA 3LERA 1TIMA 3N4EA 3D47A 1PTAA 2YCIX 4IL0A 1ISZA 4O1FA 2VWSA 1EB3A 1GYLA 3WIJA 2PDBA 1F05A 3HGSA 5FCZA 1M5WA 4Q8UA 4TVDA 3WZ0E 3CUZA 1E1EA 4MM1A 3RNDA 3IIZA 3DFTA 3W1QA 3S0CA 5TNVA 1QMLA 3MCNA 3CH0A 2REQA 2VM8A 1IWAA 2E4TA 3N9SA 2XWDA 2J74A 3W4RA 1DIDA 3OA5A 4ZB0A 3LCWA 3PPHA 5HPCA 1Q4WA 2J7CA 4QISA 2D1ZA 4JL2A 3R79A 3EX6A 2IXVA 1J0KA 2FH6A 4TVCA 3ZT7A 2OSYA 4ALDA 4JTLA 3BTNA 3SGZA 4PTMA 4JNMA 4ZO8A 2IPJA 3GR8A 3GBDA 1H60A 3IGHX 2J7EA 4JTEA 3WL0A 3W7QA 4AZHA 4KW2A 3GNNA 1JPMA 2WLYA 5D03A 3HJEA 1PIFA 4B4HA 4I9AA 3PNUA 2XZ9A 4IP4A 2W61A 3RM9A 3L4UA 1KQZA 3L4XA 2GVJA 5A2BA 2ZX8A 3CTTA 2E5DA 1IR2A 1G1YA 3W7GA 2X41A 2X16A 4JX6A 1TTJA 1ALDA 2OGYA 1QI3A 1XIFA 5I07A 5LGZA 2R24A 2NUWA 4MYAA 1JDFA 1JCYA 5D2VA 3UPBA 4LYKA 4DJDC 3TYCA 2Z1WA 5JH2A 3H23A 2E5CA 1XINA 4MVAA 1V79A 4AHOA 1XGDA 2ALRA 3LV6A 5I3FA 4M7SA 3LENA 4FPSA 3JU2A 5D4YA 3WQDA 3F1QA 2GDUA 4KH2A 5DF0A 1OF6A 4I9JA 1X1ZA 1PS9A 3UPMA 5EMJA 4TMCA 4M19A 5D9PA 4MJMA 3H2MA 4M6PA 4NKCA 4DWSC 2ZX5A 4U3CA 1V51A 2CKSA 4WKFA 1E6QM 2OFJA 5BMXA 2ZXAA 5HMEA 4XZIA 3M4HA 2YL8A 2HISA 5EU9A 3ZM8A 2A3CA 3F2BA 3VKDA 4PN2A 4B5XA 3UY7A 4M6VA 3UR2A 1IEXA 1XQLA 3CTLA 1DE5A 1Q45A 1RSCA 3AXKA 1W1TA 1NOUA 3GTHA 3OB8A 3AWOA 3O0KA 3OQEA 4HTBA 2YFOA 5MHBA 3INPA 3TYUA 1MVYA 4W93A 3V5OA 3UZZA 4CD4A 5D38A 3V0SA 1J0HA 3W1RA 1TPWA 3NPWA 3D5HA 2OSXA 1LOSA 4UQ9A 3EPOA 3LGDA 4DZHA 4KT2A 5M2FX 2QJIA 3CZGA 3G22A 1ZQ5A 3BJTA 4D71A 4HSNA 1TCMA 3WYZA 3BWWA 2Y88A 5I0DA 1OJXA 4MTVA 2Z1KA 1BTCA 4PH6A 4CQAA 3WDQA 1SR0A 2VNCA 4DYKA 3QEZA 1OFBA 7CGTA 3GTNA 4KRUA 1V6YA 1K7FA 4LS1A 4RZBA 4RE4A 4PMJA 4ZE5A 3A4JA 3L5MA 2QV4A 3HO8A 5G4EA 1KC7A 4O11A 5BXRA 2WWDA 1A5NC 1V0KA 1X7FA 4C7FA 5C9ZA 4PB3A 3UXIA 3E2QA 2H90A 1KXVA 5CGMA 3MSGA 4GQGA 3VOHA 3M0XA 1UWRA 1IT8A 2INZA 4AD3A 5IM51 4DI9A 1U83A 4G7EB 3AHVA 1P6WA 1UP2A 2DUXA 3EDDA 4PMDA 2Y5EA 3GFZA 3NQ7A 3UWVA 3PZGA 2EG7A 2O9OA 4GC3A 2E28A 5FJPA 2Q3RA 2DT1A 3YPIA 3ARSA 5LNWA 4REQB 1NP2A 4Y7EA 4MSSA 4WK9A 4F40A 4ZO9A 4GUIA 2RAGA 2ZVRA 3WLIA 1J2BA 2BOFX 3CNYA 3F4VA 1J0IA 3AZTA 1XD0A 1ZPTA 2JQXA 4UTIA 5H6HA 1EXPA 4IGHA 3BV4A 2O9PA 4CVWA 3LG3A 2X1SA 4AD4A 3BCJA 1A3XA 3K46A 2ZRUA 3GAYA 3O15A 4S2CA 2YDRA 1VRDA 3VUPA 4E0CA 1AMKA 3GVRA 4B92A 4AIUA 1POKA 4AY8A 3B8VA 1WQ5A 1FWFC 1A80A 3ELFA 3SY5A 2Z4GA 1H7PA 3W53A 1K8ZA 3ARUA 4LRTA 1Y5WA 2J9ZA 2QIWA 4CNNA 3KL5A 2P10A 1DP0A 4UIOA 1PV8A 4J2PA 4LVDA 1FUYA 3QMRA 5I5RA 4AWSA 5K9DA 2DJXA 4LF1A 3KTXA 4U2YA 3WDPP 4ZQPA 4GBDA 3R1ZA 2VZUA 3ABSA 3W83A 1UUMA 3LZ5A 3STPA 1NSJA 3C86A 2J13A 2YFNA 2QV5A 1JPHA 1TTQA 3GX9A 1KFKA 1KM0A 4O1DA 1Z8AA 2PLCA 2FB2A 3HQNA 4Z1AA 2YSWA 1T8XA 3POCA 4WY0A 4PB4A 2PDCA 3SQSA 1EWDA 3W7OA 4N02A 4XBKA 5CPSA 4F4RA 3ORWA 1B3WA 2BOGX 2PDNA 1M41A 3O6DA 4JTDA 2Y61A 4RNIA 2WOQA 3EPNA 5DRIA 4FOJA 1Q6GA 1LTDA 2ZTJA 2QJHA 5HR6A 2W79A 3M0VA 2EAWA 1P7TA 2DSWA 1NTHA 2V81A 3VGDA 3TYEA 3QGKC 5C54A 6XIMA 1DPMA 1YDYA 3QGAC 1K70A 5FF4A 3AIWA 3UZYA 1O7AA 3T0BA 3F4CA 3AIEA 2CNCA 1OX6A 3APTA 4JAWA 1T41A 1Q7ZA 3QMSA 4WXYA 3II1A 5EL1A 1TJRA 3SRFA 5K7JA 3G8EA 2IMRA 3A13A 3N4FA 2WHLA 1S5WA 3KHDA 3TMQA 4O17A 4MY8A 5BU6A 4HSOA 4MIMA 3P62A 1H1NA 2YCLB 4Q8NA 1TQJA 2VGBA 3N11A 1GEHA 3WQ6A 3ATZA 2QDGA 1J11A 3N04A 4C6IA 3FLUA 4NHVA 5G1TA 2CZVA 3IIPA 3QC3A 4XZHA 1GYMA 1BYCA 4DYJA 3R25A 1Z69A 3H12A 1SQ7A 1FRBA 1LRNA 3EB4A 3BAIA 4PMZA 3QQWA 3S1VA 3TYZA 3HPAA 1K03A 4JTJA 5FESA 1PE1A 1ICSA 4N7QA 3OBEA 2R1MA 4YYCA 1EYEA 4PMXA 3UVIA 2OCZA 3B8IA 3BZJA 3G1HA 4IX0A 2V3GA 1DHKA 4GD0A 4NYYA 3N2MA 2ZWZA 4ADTA 1PBGA 1XLKA 4JYDA 3HPZA 4Z0SA 1V5XA 4FO4A 1PDZA 5HJYA 4W5ZA 4LYRA 4PMVA 3GIPA 3LMYA 1AG1O 3V75A 4LFYA 2P88A 2V38A 3LTPA 1M7OA 1TR9A 2IPWA 1LM1A 2FMNA 1AZ2A 4JTSA 2DUAA 4O19A 1EPXA 3FCPA 1KLYA 2NSOA 2WNQA 4QNWA 4QCEA 2QDEA 2GGJA 3FOKA 2DVUA 3SUWA 5KZMA 1JG9A 2YLLA 4B5UA 4JNYA 1NP0A 3PR2A 5HQLA 2Z6IA 1GHRA 5D04C 1Q66A 5TQLA 3VKAA 2XFYA 3A3XA 4MF4A 4Z1BA 4KCUA 1E9ZB 4KERA 1E0UA 2WM0A 1BWVA 1GW9A 4EOUA 1R8LA 4JIQA 2HVOA 2GJLA 1CECA 4FOKA 3OHIA 2OEKA 4NILA 5LIKX 2GQ8A 3C2RA 2GVYA 4HZMA 5GJPA 3SI9A 4Z1DA 3SQMA 3OVQA 2BDQA 4GIYA 3TTSA 4TU1A 4NAFA 4S3AA 1XCXA 3BSGA 3RO8A 3SRHA 2QJMA 1H3GA 4QJ5B 1MMFA 3UXDA 1ZJHA 1W8GA 4HSHA 3BL3A 1BYBA 3A47A 1MUCA 3H70A 4DJDA 5IHRA 1JYXA 3LXCA 4OBRA 3WQOA 4UQBA 3P2VA 2PDWA 3QR3A 2A7NA 4MG4A 1XXXA 1EUAA 2YOCA 3EOSA 3NUKA 3L67A 4JTGA 2DZTA 3UXKA 1F2JA 3WNLA 4PUDA 4PMQA 2O4QA 4DWSA 3GDMA 2QR6A 4W84A 1ZNNA 1Q6DA 3RYSA 1QAPA 4QX4A 4J4KA 2B7PA 3GHTA 2QS8A 1DJWA 4ZXLA 1OCBA 1ZAHA 1GQIA 5I3JA 1XUUA 3VZZA 2CU0A 2OQHA 4D2JA 3WNOA 4D1JA 3W7HA 3FVMA 2YR1A 4IFKB 1BVZA 4WZHA 3CZEA 4JDYA 3AXHA 3QPZA 3N34A 1CZ1A 2VURA 2OO0A 1M7PA 3GKAA 3I7RA 1BLIA 4JY9A 4LCQA 2R6OA 4DRSA 2WJFA 1NFGA 1ZY9A 3CIXA 1S2TA 1V3IA 4JQAA 4X0NA 1LLOA 4S3KA 2RFGA 4NZJA 4NI3A 4JTTA 2HZGA 1R3QA 3Q58A 2DZPA 3AFBA 3C4UA 4CU6A 3K13A 4HPNA 2BLEA 3V3WA 2G50A 3IGXA 4A05A 2D2OA 5KTLA 2V3FA 2BXVA 1PTDA 3SQLA 4J3TA 1UQYA 1QO2A 3HV9A 1FDJA 4TQTA 4M81A 3ARXA 4D72A 3CBWA 2YCJA 2PPGA 3UESA 1FKXA 3LHYA 3MBFA 1RZMA 1GT8A 2G3IA 3MANA 5A1AA 3S5SA 2GJPA 2HRWA 4QTGA 3R10A 3N9RA 2OVLA 2H8ZA 2V63A 1XSKA 3MA8A 4OE7A 3WY1A 2DV0A 9XIAA 2F6UA 4J27A 8TIMA 5IFPA 4LUJA 3LV5A 3UJ2A 1UP0A 2OLHA 3UWQA 3RK8A 1EX5A 2YYUA 2PF8A 2VENA 3I68A 2INEA 2OQYA 3ARRA 1JL8A 1QPOA 4UB9A 3CV2A 4HA4A 4ICNA 4ECLA 3RAOA 1GOQA 2VJXA 1TTPA 4K1GA 4BHYA 2A21A 2WQPA 5D9OA 4FIQA 2FLIA 6CGTA 3LDVA 4M80A 1BGGA 4JQ4A 3UG4A 3B9OA 4IIGA 4IPNB 2OT0A 2CZ5A 4DZ5A 1YPXA 3W7DA 3ONBA 4CNTA 1JYVA 4WIWA 3GXPA 5DXYA 3LZ3A 1EDTA 1TVNA 1XYLA 3OYXA 2E5BA 4PBFA 3WF4A 2Z7KA 3M07A 4WJEA 3WEZA 4H00A 4MKNA 2J79A 5EPDA 1XBYA 2X1RA 2D20A 4DO4A 3LA4A 1K8XA 1RBLA 1F73A 3REQA 3ARZA 4GYPC 4KF1A 3DGRA 2WKJA 1ZLPA 2D2GA 4I7VA 3LXBA 3W1MA 1LG1A 4RPQA 1SU5A 3KRUA 1OGSA 5E6ZA 2BSLA 3VTRA 3FKRA 3BE7A 5TD4A 2F2KA 1TV4A 1YNQA 4QLLA 3VVGA 5CSUA 4WLCA 2J9YA 4R9XA 3EDKA 2QCCA 3TOPA 2FVKA 2VRKA 1PKLA 1Q3NA 4LU0A 3IIVA 2BODX 2ZA3A 1VH7A 2CFFA 3ABXA 1ITCA 5C8BB 1OFDA 2A85A 4W85A 3CEPA 4C6PA 2Y5JA 4Q4KA 4R5EA 1VLIA 5CH9A 3WH5A 4K38A 4N9EA 3U2ZA 3PFRA 2ZTKA 1JGIA 3NQCA 3IRDA 3VOFA 7XIMA 1Q7MA 3XINA 1LQAA 5C6MA 2C79A 4GHRA 1AQFA 1V6XA 1ZJBA 1TCDA 4LUSA 5TIMA 1E4IA 3LNPA 1QI4A 4PCTA 2WKLA 2PU0A 1Z6KA 2Y8VA 4GI8A 4IISA 4C6FA 4F0KA 1DQXA 2OODA 4FXFA 1UZDA 3PZ9A 1LUCA 1Q6RA 3GVGA 1E9LA 4KCVA 4JS3A 1TWZA 4X22A 5CSSA 4DHGA 3USBA 1R3VA 1JZ7A 3EDFA 3W87A 3PUGA 3A5VA 5BW6A 4GO9A 4H8VA 5CZSA 1IXPA 4OTKA 4XAFA 4ZQOA 1EP1A 3H6OA 1R38A 3B97A 6REQB 4ACZA 3VABA 1JEZA 1ECEA 1XIGA 4K7VA 4O14A 1EYWA 1FWEC 1SZFA 3NL6A 1XIHA 2PLJA 4IG2A 4W86A 3LI0A 1KRCC 3SRDA 4M7TA 3RIKA 4DAFA 1EFZA 5CGQA 1DQWA 2H9AB 3MCMA 4QAIA 1B5TA 2BHUA 1P6CA 4GISA 3TDFA 1V02A 2Y7EA 3BDKA 1Q5MA 2ZUSA 2CHOA 3LN3A 2MUCA 4PRWA 1TPDA 1U2YA 1KCXA 5CJNA 1HL2A 1WDWA 3KBMA 1W31A 2GSJA 2IPFA 3H24A 3QKEA 3TZNA 3NPXA 4DJDD 1KV5A 1JXKA 4W87A 3M64A 4HYWA 1AH3A 2PC8A 2EJ1A 1REQA 5HMFA 4UTKA 2CWXA 3AS2A 5D2XA 4NVTA 3CAKA 4US6A 8XIMA 4J9JA 4ATLA 5GVJA 2X2GA 3EWBX 1XLLA 3JRKA 2RJGA 3GTIA 4FNSA 1ISYA 1LBLA 1JFXA 3NZQA 5MKGA 2X40A 3WMSA 1X6NA 4FR6A 2DEPA 2ATSA 2V3EA 4OGZA 3LYEA 5CLWA 4NXKA 3WQGA 1PAMA 4PMOA 5JU6A 2OOFA 4NJGA 3TONA 3UGRA 3HMCA 3S46A 3M1ZA 2YZRA 4S3EA 3VOGA 2PBGA 1B31A 3OO2A 2XGBA 1F4HA 3EWXA 5H8MA 1SO4A 2G8ZA 3QHMA 5AVNA 3U2EA 5EBAA 1KM6A 4F2TA 3CK5A 3G3MA 4XZ9A 3BICA 4O8RA 1IEQA 2NWRA 2ZUVA 3MV01 3B9AA 2HXUA 4D6JA 1XDJA 4ATDA 1XYAA 1YHTA 5AECA 3SUVA 2F8QA 3JUGA 4JTHA 2XZ7A 1Z89A 1SSDA 3N2CA 1C90A 3WLKX 5LA0A 4P8UA 3AO0A 3M0ZA 4NY2A 2ZXBA 4XKYA 1WKYA 1KCZA 4PCSA 3EYPA 3HQOA 5A8OA 2V5JA 1ML1A 2VZSA 1FA2A 2V5KA 2HK0A 5JBDA 1CB2A 3IEBA 3QTPA 2Z1VA 5G1MA 3TAOA 1W5MA 4DO7A 4NX0A 2FJKA 4WJ8A 2F2HA 4MPKA 5CJ5A 3M46A 3UETA 4HT3A 1RBAA 3ZMRA 1I2QA 3M44A 2JEPA 4YTTA 2BG5A 4ZFCA 1DJNA 4PTVA 3C5QA 1EP3A 3KW3A 3W2NA 4XD5A 1OSEA 1CBGA 1U30A 4GY1A 5C7VA 2W63A 5I00A 5LSMA 1TPFA 2FZMA 2XM2A 4JFUA 1XH2A 4DF1A 2HE8A 1NQ6A 4PMUA 4UTTA 3FHQA 2PWUA 4FNPA 3DYMA 1A5CA 1VCVA 2PLMA 4PTDA 1ZTVA 4IJRA 4NXSA 1BG4A 2OZ0A 4IIDA 4EXBA 2DZXA 3TC7A 3CL7A 3A6OA 4QROA 2XVPA 1ZBCA 1F8IA 6ENLA 3R11A 1EQCA 3CAWA 1BXCA 4YHEA 3MUCA 3EDEA 4A8RA 3FW6A 2OYLA 3QLDA 3OVRA 3TVAA 1CGWA 2HQAA 1VZWA 1E0WA 3W26A 3LPPA 4HN4A 3PJWA 3W02A 1OX5A 1FCQA 2ZIDA 3TXZA 3VFCA 1A5MC 4MGGA 2GGHA 4LNCA 1EA0A 1KB3A 2DIKA 3N73A 3OZPA 5HQMA 4L7ZA 1UD8A 1W9DM 4PEKA 2PZNA 5FJUA 3KVLA 2W4XA 4H1ZA 3T44A 3GH4A 3CV1A 3T78A 2VZVA 1GTEA 4G1NA 1US3A 3N1AA 4NYUA 3AIUA 4BI6A 4LVAA 5SWUA 3RLVA 1F3XA 1NARA 1B57A 4AIEA 1ZBVA 1NY1A 4GI9A 3BANA 3QVQA 3QXBA 1SJCA 2VUNA 4H6QA 4OJYA 3CMJA 4DXVA 4Q8OA 2VEIA 1HVQA 3B3DA 1W9VA 4F0MA 3GXDA 5BYWA 3MHUA 4RNFA 2CHRA 3O05A 4WGXA 2E67A 1JIBA 1XS2A 2W67A 4RK8A 3GG8A 4FB7A 4IJBA 5PTDA 5I77A 3W1XA 2HROA 2ZZ3A 2OLAA 3XIMA 3RFAA 2QKFA 1WDRA 5LIWX 1RJPA 4GVIA 1OIMA 1LLWA 1NF7A 3FIGA 4TV5A 2PP0A 3WUFA 5ABFB 1PX3A 4PUNA 1VPQA 4TX8A 3SURA 1BYDA 2QPXA 4UCGA 2HPMA 4LW7A 3IGUA 1ZAJA 3VMPA 1LG2A 3VNMA 1EP2A 3PAJA 1WA3A 5E1QA 5I6SA 1E4MM 1RV8A 4XX6A 2J7GA 5AYIA 2C1IA 4Q6JA 4PMNA 4E6MA 1XIJA 1XYMA 1W8SA 4PFMA 2AMGA 4MZYA 4H6RA 4LEFA 4GH1A 1OFAA 4FLOA 2QJGA 1JZ6A 1OCQA 3G1SA 2OKOA 2WO5A 5A6JA 2PU1A 2A3EA 3HJZA 1OX4B 4GYJA 5FAGA 3DBNA 5XINA 4Y90A 5LNRA 1DIOA 4GYPA 2Y1HA 1BRLB 3UT0A 1J93A 3GHUA 1XLCA 4TIMA 5A6BD 3SIZA 3PBYA 1ZAIA 4JFTA 2B81A 3CT7A 2FDSA 4PR4A 3WNMA 2C1GA 4LV4A 4MWAE 4BQ4A 3PWGA 1X6UA 3WQ4A 4MB1A 1CWYA 3RPTA 5I7GA 1H5VA 3W2UA 1F61A 3A4WA 3AU2A 2NX3A 1NQKA 2WCSA 4IMGA 3N6JA 5FJOA 1XIIA 3P81A 2FTWA 3HG4A 2VFIA 3UWEA 3H7VA 3LK6A 1OC7A 4GRSA 4G7EA 3S2NA 3M5ZA 1W17A 2UWFA 4M0XA 2BY2A 4A21A 1HW6A 4K37A 4HNVA 5MF5A 3MSRA 1GPWA 4CLMA 1XIBA 3NYDA 2YCKX 3TJLA 3THCA 3B03A 2I16A 4M1RA 4K68A 3BXWA 4QR6A 4YHGA 2W62A 4REQA 3K4WA 4HMDA 5D32A 3KP1A 3N6QA 2P0IA 4DYEA 1FCUA 1E4NA 2BY3A 4R27A 4LYPA 4NF7A 3MV11 1RXOB 4DPPA 1F6YA 3I6EA 4L80A 4A3UA 3C0QA 5HUOA 2QUTA 1CXIA 1FH7A 1OC6A 2GDVA 4AVFA 2Y2WA 4JZ5A 2DUZA 4IXHA 1QRQA 3NO5A 1J18A 3MI2A 1VQTA 1NWUA 1ZBKA 5LNUA 2UZ9A 4NI8A 3H2NA 2QPUA 3QPYA 3V1HA 2XWEA 2PWHA 3VGGA 3HFYA 2PDQA 3HPXA 3QV7A 5BROA 3VNKA 5LNSA 4GKLA 2VVNA 1F6KA 2IKIA 5AYYA 3HBLA 3RLGA 2Z29A 4GNKB 1H1ZA 3H7UA 4AB4A 4BI7A 3ZR5A 2WK2A 3KBJA 3GR4A 5LHEA 3GVWA 5U4NA 1ITUA 4P7NA 4OIFA 4RX0A 3O2LA 3PPGA 3EOEA 3VDBA 1A3WA 4IQEA 4UC5A 2ZVIA 3DYOA 4UR8A 2YL5A 3TTQA 2WLZA 3C0LA 1R3YA 2GUBA 4Q7IA 2XTKA 2AQWA 3G24A 1NOFA 4Q7BA 4OV4A 4D6HA 2ACUA 2VCBA 3URNA 1W3HA 4C6QA 3K8LA 1IQ8A 3TW6A 5AB3A 4QSHA 5HJXA 5E70A 4AVOA 2ZE0A 1JCTA 1EC9A 5M1TA 2QJJA 4FXRA 4CD7A 3FN9A 5IXEA 3DN5A 2X7VA 4DPQA 4NU7A 2HV5A 3TJXA 4DUOA 3DG7A 2X42A 1R9YA 3MVIA 2D0FA 4WRHA 3CEUA 4QBXA 5G2WA 1IZKA 2BY0A 4UFJA 4XZLX 4AF0A 1G0CA 5JVLA 5B7YA 2WVVB 3KOXA 3XISA 4ES4A 1J0YA 4LB3A 5LHFA 3W0KA 2XU2A 5T26A 3C8NA 2YCLA 2HJPA 2Z1XA 2I56A 3W2KA 2QVHA 1JUEA 1K02A 1T5AA 3M43A 5BRBA 1E15A 1OYCA 3MJYA 2E6YA 4CQBA 3NEHA 3W88A 3EMCA 1DTNA 3C2EA 1TWSA 4LAOA 1PVNA 3SBFA 1KBLA 2PRLA 4I5RA 2Q09A 2XH7A 3VE9A 1VFHA 2GSHA 4I8DA 1F8MA 3UCQA 5A2CA 1JYWA 2J77A 3VNZA 2DSVA 3G0SA 5C55A 2BVTA 3KHJA 3TJIA 5T8GA 2AKZA 3SJ3A 4OU1A 4M6UA 1AVAA 3DYPA 3WH9A 4LT9A 2CCRA 2R94A 4AC1X 1WZMA 3BOFA 4IUOA 1X8CA 1WKEA 2PWGA 4N42A 1UIOA 3LMZA 1YW1A 2PDHA 2IPGA 1E6RA 1I75A 2PRHA 2RKXA 1H09A 4LNYA 4CCCA 3TA6A 2NXIA 3PN8A 2PS2A 2PSNA 2ZZ6A 2I9EA 1A0EA 2EEXA 3RCMA 3ZJ7A 2O56A 1ZRQA 3DKLA 2AKMA 3TR2A 1O4UA 4P7RA 2IKJA 2HVNA 2XISA 1PB0A 1UOZA 1S39A 1E6ZA 3M5VA 5D8ZA 2QCFA 2DU2A 1HJWA 3I3DA 1H0GA 3ARYA 5I3KA 4DLFA 3P14A 4OUEA 5CC3A 4DB7A 5EMLA 3FA4A 2XUCA 1Y0EA 2JALA 3ZR4A 2VEFA 5A6AA 4V28A 4JPGA 4CQCA 1YTEA 1PJ9A 1O12A 1YNYA 5A95A 1GHSA 2WMHA 4YN5A 1V3KA 3WSUA 4BI5A 4LBRA 3FDKA 2ACRA 1Q6OA 3QJAA 3GY1A 3UWUA 3W1UA 1SZEA 1SZGA 1EJRC 4F0SA 3OGVA 1Z3NA 3MKCA 4QLKA 5F4XA 1Q6EA 4GCAA 1VPYA 1V6UA 1H11A 2NT0A 3EBVA 3GC2A 3M6DA 4ZQNA 4D6FA 4C6NA 4ML9A 1TWDA 3AMGA 4O15A 2E25A 3BLFA 3GC4A 2G4FA 4Z2HA 1E1CB 2OYKA 4YCOA 1P0DA 1FDZA 4E2DA 3W7KA 1A3HA 1NELA 1TKKA 3EDJA 4AZCB 4IMCA 1C93A 3TQ0A 3KVMA 4KBXA 3QZAA 4TX6A 1FH8A 4W8AA 1H51A 1QASA 3WUEA 4IMFA 3QYQA 3TYDA 3ZXWA 3WQ8A 2E6FA 4BZYA 3RX3A 3TMLA 5CGTA 4IFKA 2HTMA 3WO8A 1AMYA 1JXJA 1SR9A 3H55A 1S2WA 1B3XA 4L4LA 1AJZA 2VZOA 3FJLA 3BAXA 3O8AA 4NASA 3TIMA 3ZYZA 3O06A 5FF3A 3M0LA 3W2JA 1K8CA 5FSDC 4AD2A 3U2CA 3CZLA 2XIJA 1OGGA 4B5VA 4MKVA 4CD8A 3TUUA 2XIIA 3FGCB 2J6XA 2Z24A 4ILSA 4ZA0A 3C8FA 4G5DA 3VOIA 4WOZA 5IDIA 5AKQA 3A24A 4XAZA 2NQ9A 1W9XA 4UR7A 2ICSA 4XKMA 2ZZ5A 4K3ZA 2A7PA 3LM3A 3U57A 2SFPA 3K30A 4IIFA 4LCRA 3V7PA 4MY9A 1TV7A 2YXXA 1GZ1A 1EGMA 3CHVA 2G95A 2GWNA 1GK8A 4GABA 4B5SA 3WF1A 1ZCCA 1OD0A 4ROQA 1E0XA 1Z7AA 4RLIA 1VBJA 4HPGA 3EMQA 4W7UA 3QQ0A 1SJAA 3C3NA 4YTQA 4TX9A 1QTWA 1QPNA 4ZTYA 2ZX7A 1LDCA 3SADA 3ITVA 4YLWA 2EKGA 1LL7A 4WOQA 5K3VA 5HPOA 3AMDA 1CLXA 1HXJA 1J2WA 1NDZA 3ERPA 4LX4A 3N6HA 5D9NA 1FWIC 4CNPA 1RD6A 4BR1A 1ADOA 4N2YA 1UP3A 3OGSA 3UG3A 4FNRA 4CEXC 3WLLA 1KFCA 1PCWA 4DN1A 1KKOA 5CXPA 1V93A 2Y8UA 4TO8A 3VD3A 4KGLA 1EDQA 3O07A 4K36A 1DIEA 2OWCA 5CKSA 1P0BA 4H7ZA 4RV8A 1TYGA 3W00A 3UJEA 3WMCA 4XTIA 4LV9A 5AHLA 2PEVA 3PBMA 3TTYA 3RJXA 5C2XA 2V82A 1S3HA 3W73A 3DESA 1G4TA 1JZ8A 4R9OA 3WKZA 3Q37A 3VGBA 2AL2B 3WD3A 3L2LA 2QGYA 1D3HA 1W32A 4RNHA 4C6EA 4Z0JA 1PYMA 3BLIA 1LYXA 4DIAA 3WBEA 3AMLA 4W88A 2V5DA 1XISA 3FXGA 5FF2A 4Y9OA 5DMNA 1K4HA 1XIEA 4ZQMA 5HULA 1AW5A 1SFLA 1A5BA 3ARVA 1XHGA 4AD5A 1TPEA 2OWXA 2YW3A 4J7RA 4DNHA 1EKOA 5E0CA 1XSJA 3PG8A 2YZ5A 3W28A 7REQB 2E0PA 3ZJ6A 2VTFA 2HNEA 1R2RA 2RH9A 3RHGA 5J5DA 3UBPC 2RJHA 1I4NA 3WQWA 1UH3A 3W7JA 4M51A 2ZCGA 4RE3A 5AYXA 3STGA 3DUGA 4L4PA 4L9ZA 3RRXA 1F7BA 2VELA 3B9EA 3LHZA 3DC0A 2OZTA 3OOQA 4IIHA 1MQPA 3WK1A 1A47A 1F74A 7TAAA 3ES7A 4I6KA 3CYJA 5LNVA 1WOAA 1EJWC 1Q6CA 1UD3A 2PWDA 4GUJA 4HOZA 1DE6A 3LHWA 1LCOA 3K5XA 4GUGA 4P61A 2J7FA 1S5TA 4PBEA 5BWAA 1P6BA 4F0LA 1QUMA 4GLEA 3WQFA 3W7IA 1V7YA 1TV2A 2WMFA 1X96A 4PL1A 4IPJA 2QJNA 1JQXA 3IWPA 2E7FA 4HP5A 7A3HA 5L9FA 5IHSA 4DBWA 5A8GA 1LLZA 4PSRA 2V67A 4OUIA 4S3FA 2BTMA 5LKYA 3FYPA 4KCWA 3NZGA 5C2GA 4EWND 4M1BA 4MDOA 1KCKA 6REQA 3BW4A 3ITTA 2FHBA 1MEWA 3QZ6A 6TIMA 1YRRA 2DH3A 3WFAA 1QPQA 1EOMA 4W4QA 3CO4A 3LCHA 4U4MA 5IOBA 3IAQA 4AD1A 1C9DA 3ZWTA 3TN4A 4F0HA 5CEWA 1X38A 4HHPA 2H9AA 1YBQB 3E2VA 3DOPA 1WP6A 3LY0A 2CLIA 1VB9A 3IACA 3PSWA 1OCJA 3O7UA 2QCDB 4HPHA 4XTDA 4GIRA 5K9XA 2BHYA 1EGVA 2XGZA 1F3WA 1Z9AA 1NFBA 3R2GA 1UR1A 3V4BA 4IIEA 3BCDA 4AXKA 5E6YA 1SMDA 1T40A 4GIAA 1JCLA 4NNAA 4GI4A 5AC4A 2BGSA 1C7TA 4A35A 2OSWA 4A4AA 1ISVA 4E8CA 3TEVA 2VEPA 4DLMA 3SUSA 3UFYA 4GNVA 2QUNA 3CHEA 1TJPA 1XIMA 3ZLGA 3Q65A 3TR9A 3GB6A 4A2SA 2OZ3A 2D3NA 5AOUA 2EF9A 3W1AA 2W27A 4HU3A 4XISA 1X8FA 5CC7A 4HNCA 1G4SA 1VKFA 1UWSA 1VEMA 3VINA 2WVTA 3T09A 3WBAA 3L23A 3V0TA 3L0NA 1IWBA 4H01A 3EA1A 4L9YA 1YNPA 2BGNE 3WH7A 1Q6QA 3P8IA 4HN8A 3BV7A 2PRMA 5TAOA 4MUPA 4XQ6A 3S6TA 4NAFB 4DZAA 3UJSA 4UUIA 3HOJA 4ZO6A 5D8WA 3G1XA 3N19B 1I1XA 2B7NA 5EKYA 1FBAA 2IQDA 4AU0A 3H2AA 2ZRZA 1SO6A 4RZ4A 3G1YA 5B7ZA 3QHNA 2HK1A 4F2BA 4G2DA 3FA3A 5D2YA 2YBVA 4QXIA 3RG6A 4JXCA 1JNDA 2WMGA 1TVLA 4AIBA 1J0ZA 3FHAA 1O95A 1XJBA 3L0KA 3K2GA 1KM1A 4KRZA 2NQ5A 2PDFA 3MDWA 3CUXA 1UKQA 4B9YA 4HKPA 4HNUA 2FPTA 4BF9A 2WBGA 4XD6A 5C0QA 3LCIA 1G5AA 2I1OA 4MOZA 4DQWA 1E72M 4G1KA 5HNTA 2CYGA 2P50A 2RHGA 2BNJA 4H9VA 1UG6A 4KWVA 2W5FA 2PTWA 2GZXA 3EKLA 4UFHA 3ZT5A 4C6DA 1J4EA 2FZ9A 1XLEA 4MZ8A 2R1PA 3KE0A 4JFVA 4Y8FA 2V6AA 1YDNA 1GPFA 2WZMA 1RCOB 2XFFA 1JF6A 3PC0A 4P7LA 1QNOA 4KGJA 1CPUA 3VX0A 2LLEA 1RJQA 3TCEA 2VEGA 4N4QA 4LBSA 3NA8A 3LLXA 4NZCA 1KXQA 4EPBC 3E0VA 4MLJA 3S5NA 3COTA 1LORA 2EPNA 1I2RA 2PTYA 1HKJA 1NAL1 1HKKA 1E70M 4JTRA 4GCXA 4IMEA 3DI0A 2WHJA 4BF7A 3B8UA 1FHDA 1GOXA 2F38A 4A6GA 3L5LA 4DI8A 2XVKA 1JCJA 4QS5A 3OODA 2GOUA 3DGBA 4AEFA 3GTFA 4L56A 2DSKA 2HS6A 5BXTA 3GVQA 2ODOA 3LBCA 3S2LA 2D23A 5DO8A 4C6JA 1E73M 4DF2A 4X61A 2QZRA 1QJWA 4OV9A 1K1DA 2GUUA 1I6NA 2D0GA 2ZX6A 4LVGA 3W24A 1WDSA 3MCOA 3WLNA 3FEMA 2GPTA 3QMTA 3TCSA 3FSUA 4MJZA 1S5NA 3N2TA 1SJBA 4JHOA 3QY7A 3AIBA 2XSXA 5HNRA 3B05A 3VNJA 1XYFA 4I6VA 4HK5A 4P8XA 3WMBA 4QSFA 2X0SA 4Q32A 4DJED 1XBZA 3P0XA 2WJZA 4G56A 3PUOA 1Z48A 3JR2A 3GFXA 1TPB1 4L61A 3C61A 2X1UA 2DVTA 3TAKA 4WSKA 4ZCWA 3GH7A 3TXVA 5LXEA 5A8MA 3BK0A 1BVWA 3U3HA 4JTUA 1R6WA 2YW4A 4O54A 1GVRA 2DW7A 2D22A 1R3TA 4H4IA 1PKMA 5BXSA 1EJSC 5EMMA 5LGXA 3FA5A 5KINA 1UUOA 4CGTA 4N6EA 1J6OA 1V02E 5ABFA 1G01A 4XBSA 2BGQA 3CIWA 3C2YA 1EO7A 1WXYA 4FF5A 4C90A 1X39A 1HZYA 1ZUAX 4IGSA 5LIYX 2WZTA 4R7OA 3SGGA 2Q8LA 3OLEA 1S2CA 2C19A 2X30A 5BMWA 5CCZA 1IXNA 3TYAA 3QV8A 3W70A 3PFMA 1ESWA 1AQMA 1OX4A 2VZTA 3WLRA 1AA1B 1QT1A 1O5KA 4JIRA 1BRLA 4XD4A 4QEHA 5EMUA 5F2MA 4YWIA 3EXSA 4H9MA 3P7YA 3IJLA 4MNMA 1EJXC 2IXUA 4F9DA 1NWRA 5LXXA 1AFSA 4KS0A 3MWCA 3VKCA 3MY9A 3T0AA 4ZR8A 4ZL1A 5DCEA 2PBOA 1RP9A 1L6SA 2B7QA 2OYMA 1KFJA 3WJZA 2B4GA 1UKPA 3N9KA 2G41A 3JW7A 4DY1A 1JCNA 3W1TA 1X98A 2INFA 3A3WA 3CWHA 1VC4A 1J10A 1A49A 1DEDA 5EFDA 3TQVA 1EA9C 2EPMX 2G3MA 1UYQA 3BLLA 5AYZA 1A5UA 1QNSA 3W6MA 1XLIA 3WBWA 5J5RA 3OPSA 3HGRA 1DXIA 1QR7A 1XC6A 3AXMA 2PP3A 2FYMA 1TB3A 3MO7A 3T2QA 3B9DA 3DFSA 1NDYA 1UR0A 3NSXA 1ZFJA 1T0OA 2H6RA 3A4AA 1RJRA 3GNXA 4Q8MA 3LX9A 3QZEA 2OEMA 3NQ6A 2YJQA 3OQ8A 5IDZA 1QPKA 2ZE3A 3M0IA 3RLUA 3UXAA 2OX4A 3IJDA 3S1WA 3TJ4A 4MNKA 3S1XA 1GQKA 5AY7A 3MC5A 3L9CA 3T2PA 2WNZA 3EX1A 1AD4A 1MNSA 2MANA 2QQ6A 2Q71A 1MQRA 4J3VA 2PE4A 1DTUA 2PUZA 3H21A 1YE6A 3VMOA 2O9RA 1KQYA 4MAVA 2XDFA 4CKQA 4C6OA 1E6SM 3GTXA 4XAYA 3PUDA 2OOGA 2WZEA 5CC6A 4PC8A 4EE9A 1LWHA 3B04A 4JDBA 2YGYA 3GO2A 4JTAA 4B91A 3AYVA 1KXTA 4LQ1A 4HCLA 5E9XA 4L1XA 4JGDA 4RPPA 1A5AA 3WJWA 1CEOA 2DSZA 1CCWB 2VX7A 2F84A 6PTDA 3POHA 1JRCA 1SFSA 3L21A 3PTQA 2DH2A 2XJ7A 2IKGA 4KEMA 4GXMA 2Z2BA 4HIBA 5JUVA 2F61A 4BFAA 3A9BA 1TZZA 4J2MA 1TMHA 2B31A 1G7UA 4PMYA 5G2HA 4JTCA 1TRDA 1EJVC 1QI2A 3VO0A 4AC7C 2TRSA 3E3HA 3NZRA 2OELA 2JIEA 1XWYA 1LWIA 4DUXA 3R8HA 2WAGA 3OVGA 2R8WA 4JKMA 3R13A 3E2RA 3BCFA 4AYGA 4O57A 4DNMA 3TYBA 4RDWA 4CD5A 3DHFA 4IXXA 3GU9A 3GE7A 3H26A 4QLJA 4AVNA 3OG3A 3VIHA 3ANUA 1M3UA 4QP0A 3CYVA 1R3RA 2VEKA 1HT6A 2OEJA 1GCYA 1N8FA 4JTKA 4C5YA 3R0UA 4HOXA 3CPUA 2PDIA 3W23A 2VFHA 1KR1A 3W7PA 3KTSA 5CPNA 3N18A 4E4PA 2GOKA 2WVVA 1KLZA 1XUZA 1TUXA 3N29A 1TR1A 3B8TA 5G2IA 3QOMA 2C8NA 4HU0A 4L6OA 3FJ6A 2EXOA 4ROPA 1NFPA 3P6LA 1WZAA 1DL3A 5LA2A 1HN1A 1XBVA 3O6YX 3PG9A 3KTCA 2ZQ0A 5L6UA 3APGA 1EL3A 2UY4A 3BW3A 1W91A 1XRSA 3L68A 3WLMA 5RUBA 1VCGA 3LRMA 3PTMA 5TBOA 5IBXC 3AAMA 1D8WA 1CGTA 2ZRYA 2WC4A 4C1KA 2FZDA 3ZWSA 3U0HA 2CLKA 4ZOEA 5DXXA 3STEA 2E68A 2W91A 2WNWA 2A2IA 3MZ2A 4ZSUA 2PLKA 2PF0A 4UTJA 2FHCA 1OQFA 2HBXA 1N7KA 1N8WA 4O1CA 3STCA 4AHQA 4B3LA 1FCVA 2POTA 4FP1A 2WBKA 3BQ5A 3VZYA 2G5WA 1XR2A 2OKTA 4H41A 3R8RA 5D2TA 4CU7A 2PMQA 3F5LA 2A0NA 4Q33A 2KAUC 3SM0A 3W2LA 3LEPA 1PEZA 4PA8A 2HS8A 4UTLA 1ZENA 2JKAA 4HZ6A 1BF2A 4L1WA 3UWZA 4J5NA 4LB4A 1DWAM 3BLKA 4MAZA 3D46A 4NJHA 3OZOA 2V30A 3L4YA 1HKWA 2NW0A 2W3ZA 3G3DA 3OLGA 3IUHA 4HCHA 1A4LA 1BFNA 3OGRA 2J4GA 2VQUA 2H3DA 5HOSA 4OKDA 1MUWA 3D3AA 4OBSA 4D9PA 1AJ2A 3PTKA 1XL9A 2QCMA 1OM0A 3SDOA 4IUGA 1L6GA 1Q13A 1L6WA 3B0YA 3C0JA 2FGZA 3UR8A 5K4ZA 4EPDC 3FYYA 3CO8A 1QOPA 2BMBA 3LOTA 4XUGA 1B4EA 4B4FA 2JKEA 3F4WA 1PTGA 1V3JA 1RAKA 4RDZA 1LWJA 3DENA 2XH2A 4C1LA 3SCQA 1ZU8A 2V5BA 5FEWA 2ACSA 4NJKA 1LT8A 3EKGA 3SCSA 1KM4A 3DEQA 1HL9A 1V08A 3VA8A 4PTXA 2NQHA 2J75A 1K9FA 4FF7A 2BXYA 5CG0A 1WAWA 2PFHA 3NO3A 4C6LA 3RGTA 2ESCA 1YXCA 4N9BA 2GJNA 1E1CA 1CXLA 3QLLA 3F5KA 4EWJA 4FMVA 3PS7A 1F9CA 3DZ1A 1CGYA 1E51A 1BWKA 4AG0A 4AZCA 1E6PA 4GUFA 3OBKA 4MB4A 3P0WA 2QUMA 2O92A 4JN8A 3D6NA 2UY2A 4LALA 3DU0A 4FX6M 3E38A 1JDAA 1X7IA 1HTIA 4MPQA 2FVLA 1HJVA 3BJSA 3E96A 3BC9A 2QULA 4U5KA 1DV7A 3VIJA 3H2EA 1QW7A 4AHPA 4ZOBA 4JKKA 2QDDA 3LPGA 3W81A 3TKFA 5EBUA 1QWGA 3PJTA 2VD8A 3AUOA 5DMYA 4QQUA 2WPBA 1A5SA 2XFWA 3FGCA 1LBFA 3TN6A 3NO1A 4UCFA 1PX8A 3AJXA 1UKOA 3VIMA 4G7FA 3IJIA 3WLHA 3GYCA 1GG1A 2YA0A 4YL2A 1OD8A 1TX0A 1KV8A 3SCPA 1PL9A 3AHZA 1RH9A 2X05A 1WDDA 2Y7GA 3NPUA 4KWOA 3T9PA 1UR9A 4ERGA 3CIVA 3E0FA 1AW1A 3NQGA 1NIUA 4W5UA 1KM2A 1U33A 1LQ2A 1XG3A 2EQDA 4QDPA 1H7WA 1EZWA 2VQTA 3DDMA 3IARA 1LOQA 3H2FA 3U7VA 3CUHA 3FY1A 5AYBA 4MB5A 4YVVA 3UERA 2WNNA 3K8MA 3T1GA 1NEYA 2PDUA