3WBWA

Crystal structure of gox0644 in complex with nadph
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
271
structure length
271
Chain Sequence
b'EAQTVISFHDGHTMPQIGLGVWETPPDETAEVVKEAVKLGYRSVDTARLYKNEEGVGKGLEDHPEIFLTTKLWNDEQGYDSTLRAYEESARLLRRPVLDLYLIHWPMPAQGQYVETWKALVELKKSGRVKSIGVSNFESEHLERIMDATGVVPVVNQIELHPDFQQRALREFHEKHNIRTESWRPLGKGRVLSDERIGKIAEKHSRTPAQVVIRWHLQNGLIVIPKSVNPKRLAENLDVFGFVLDADDMQAIEQMDRKDGRMGADPNTAKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative 2,5-diketo-D-gluconic acid reductase
molecule tags Oxidoreductase
source organism Gluconobacter oxydans
publication title Crystal structure of Gox0644 in complex with NADPH
rcsb
total genus 101
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3wbwA00
3UWEA 3N6QA 1PZ0A 3DN5A 3WBXA 4DBUA 3GUGA 1SM9A 3H4GA 2FZDA 3C3UA 2HDJA 2IPWA 2FZBA 3D3FA 2DUXA 1YNQA 1AH3A 2HVOA 1R38A 4Q7BA 3H7UA 3UZZA 3CASA 4I5XA 1K8CA 3ONBA 4FZIA 2P5NA 4GIEA 2PDYA 2J8TA 1EKOA 1RALA 3BURA 2IKHA 3ERPA 3R43A 2PDPA 4QBXA 3FX4A 1S1PA 4JTQA 4EXAA 3CMFA 3COTA 4LBSA 1ADSA 4OTKA 4JQ3A 2PDQA 3WG6A 4WDUA 5C7HA 4XVDA 3MB9A 1IEIA 3M64A 2IKJA 4EXBA 4JIRA 2C91A 4HMNA 2PDJA 3BV7A 1Z3NA 5HA7A 1EL3A 3DOPA 3F7JA 3EB3A 3RX2A 2ISFA 3O0KA 2PDKA 4WEVX 2PD9A 5LIUX 1HQTA 2BGSA 5JH1A 2ACQA 3N2TA 1XGDA 4FALA 3CAQA 3GHRA 1VP5A 4YU1A 1M9HA 2IPFA 4FA3A 4RPQA 1A80A 2HE8A 4HBKA 1QWKA 4L1WA 1RY8A 1J96A 5HNTA 4H7CA 2PDIA 4PRTA 4JQAA 4LBRA 4JTRA 4PUUA 3M4HA 3LQGA 2ACUA 4GQ0A 3CV6A 4JIIX 3UP8A 4GQGA 3R7MA 3QKZA 3UGRA 2ACRA 3V0TA 1EXBA 3V0SA 4YVVA 2NVDA 4XZIA 4H8NA 4JQ4A 1GVEA 4DZ5A 4G5DA 3NTYA 3GHSA 4ICCX 3Q67A 3Q65A 1PWLA 3UYIA 2VDGA 4FAMA 3G1RA 3UZWA 4LAZA 4YVPA 5M2FX 1YE4A 1X97A 3EAUA 2F2KA 2WZTA 3CAVA 1YE6A 3O3RA 1Z8AA 3GHTA 4WDWA 2HEJA 1UR3M 4DBSA 1XF0A 4YS1A 4GCAA 4DBWA 1AH4A 4LAUA 3T42A 1X98A 1AZ2A 2F38A 1VBJA 2PDXA 1PYFA 5JH2A 1FRBA 4NKCA 4IJRA 4LB4A 3R8HA 4WDXA 1PZ1A 3LN3A 2ACSA 3S3GA 4WGHA 4XVEA 4IJCA 2HVNA 2R9RA 2BP1A 1EF3A 4ZFCA 1S2CA 2INEA 2INZA 2PDHA 3V0UA 2IQDA 3FJNA 1S2AA 3LENA 5LIYX 1T41A 5AZ1A 1X96A 3LBOA 2FZ9A 3R94A 2PZNA 4QR6A 2I17A 1MRQA 1AH0A 3G5EA 3U2CA 4XZLX 2PDNA 2PDGA 3WBYA 2PDCA 2HV5A 4XK2A 4YVXA 2FZ8A 3UFYA 3V35A 2PDWA 4IGSA 4PRRA 5DANA 3R6IA 3RX3A 1Z89A 4F40A 2IKIA 4XZNX 1ZGDA 4XZHA 2PDMA 2PDBA 2PF8A 2A79A 3LZ3A 4WRHA 4GABA 2PEVA 4WDTA 3EB4A 4JQ2A 3LEPA 4XAPA 3WBWA 4XO6A 1AZ1A 3R58A 1Q5MA 3MC5A 2R24A 4R9OA 3UG8A 4XZMX 4LB3A 3H7RA 1IHIA 4GACA 1MZRA 4GA8A 4JTCA 2DUZA 4MHBA 5KETA 1LQAA 1YNPA 4PMJA 1QRQA 1LWIA 3P2VA 4PR4A 1Q13A 4ASTA 2PD5A 3GHUA 2IPJA 3V36A 3B3DA 2WZMA 1XJBA 2IPGA 2CLPA 1ZQ5A 4JTAA 3UZYA 1S1RA 2FVLA 2FGBA 3WCZA 1HW6A 4JIHA 4PUWA 3BUVA 3CV7A 2PDUA 3RX4A 3KRBA 1JEZA 3LD5A 1C9WA 2IS7A 1T40A 4QX4A 2PDLA 4JQ1A 4Q3MA 1RY0A 2AGTA 3LNMA 5LIXX 3UZXA 1MI3A 2HE5A 2IKGA 2NVCA 4AUBA 2PDFA 3ONCA 1AFSA 5LIWX 2QXWA 2PFHA 3R8GA 2DV0A 3LUTA 3LZ5A 4QXIA 5HNUA 4JTDA 2I16A 1ZUAX 3LQLA 4XO7A 1Z9AA 1US0A 2ALRA 3M0IA 3BCJA 1ZSXA 1OG6A 5AZ0A 5LIKX 1PWMA 3VXGA 2IQ0A 4L1XA 2BGQA
chains in the Genus database with same CATH superfamily
3S2JA 3WQ4A 3PANA 2E9BA 4Y6GA 1ZNNA 2FIQA 3CQ0A 3WQOA 1H7NA 2PSNA 5DXYA 5HNRA 4DF2A 3SURA 2IPWA 4Q4QA 3KFTA 1E1CA 2CWXA 1X7IA 3W07A 3W7CA 1NP2A 1HX0A 1MEWA 1B3OA 2HQAA 2VRKA 3UXLA 4Z2IA 2W61A 2DZAA 3LTSA 3ONBA 3SN1A 4XIAA 2PWGA 1TE1A 2E9MA 2E9LA 3WH8A 1W8GA 3W7EA 1NEYA 3G6MA 4ZTXA 2TPSA 4X9YA 1R3RA 3T7VA 5EMUA 3HGJA 2R14A 5A8QA 4LFYA 4KFOA 4LVAA 3DENA 1REQA 1LT7A 4L5ZA 4UB9A 3A3HA 4Y7EA 3UPWA 4UFKA 1SR9A 1BHGA 1FHUA 1ZPTA 3DC0A 3WEOA 5B80A 2PDJA 2DSZA 3BV7A 5HA7A 2Y62A 4H41A 1YXCA 2QJHA 5FAJA 4A35A 3T4WA 4R9XA 3RX2A 2XH7A 2ATSA 2BWGA 2C0HA 2CBJA 3QFEA 5A1AA 2PDKA 3ARQA 1W3KA 5FJTA 1FWNA 2ZVIA 3LPPA 5HATA 4FALA 3KCOA 1ZS2A 1BPLB 2G3JA 4FA3A 2YCIX 1XH0A 1AW1A 3HQNA 5A95A 1PDZA 1KFBA 2PCEA 2IXVA 3ZVIA 2O0TA 1JRCA 4LS0A 4Q4SA 3L4UA 3QPZA 4JN6A 3S9YA 3W7LA 3GAYA 5HQEA 5HBFA 3KDNA 3PWAA 3HG2A 2DSUA 1KBJA 1VJSA 5REQA 1QBAA 3H2OA 3AMDA 4HU0A 4MKVA 1TTJA 1WV2A 2BGNE 2DZWA 1IWPA 4PTXA 1KXTA 5E6ZA 1SO6A 4GLEA 4AD3A 4JL2A 1LDCA 1C91A 5M2FX 4GZJA 3R89A 2WSKA 1ESWA 1EZWA 4M7TA 1WXYA 2QQ6A 1KFLA 3WEZA 3UF9A 5CPOA 3TXZA 4WKHA 3O1NA 4MUZA 5DN1A 3H22A 3QV7A 3FGCB 1X98A 1AZ2A 4BI6A 5HMDA 3VMPA 2PDXA 2BTMA 5LXXA 4LB4A 3TZNA 1KRAC 1X6LA 4KCTA 2D3NA 1DIDA 2RKXA 3H2EA 1N8FA 1KRBC 3TC3A 4HCLA 3HPZA 3M9YA 4P8UA 3ANVA 3EWYA 1WDWA 7ENLA 5J5RA 2ZZ5A 3ECQA 4DEFA 4ADTA 3BOLA 1DWGM 3HG5A 3V16A 3K46A 1TPEA 3DU0A 3IUIA 3SO7A 3DFHA 1EJXC 1JZ6A 3K30A 5G4EA 1JQVA 3P7YA 3ZYZA 3W81A 2B31A 5LIYX 1YRRA 5HQLA 3ZVHA 3LHZA 1R7OA 3SDOA 3WH7A 1OFQA 1JYXA 4BEQA 3VDHA 3N4FA 4TVCA 3LERA 1UB3A 1SPQA 3IUHA 4IFKA 3UR8A 3KVKA 4ERAA 1V6YA 3EPMA 3EWXA 4DB7A 1V4YA 3W7NA 1RA0A 4IGMA 4N6EA 2OXNA 4GZEA 1C8QA 3V35A 1EJWC 3N9RA 4BZYA 2O56A 2OX1A 5FEPA 2AAAA 2YDQA 3ZJ6A 4AIOA 1AG1O 1OFOA 3OVRA 2UWFA 5CPMA 3XINA 2WC4A 1QI0A 4H9XA 4HQVA 4W7UA 4ACYA 5DMYA 2WVTA 2PEVA 4WDTA 3J7HA 4D1JA 1ONWA 1Q7ZA 2FFCA 3N3MA 4X0NA 2DW6A 4MWAA 2EG6A 1NDYA 1E0UA 1EJUC 1QPKA 2OGYA 1KBLA 1M01A 4GA8A 1DXEA 3KAOA 3MA8A 3GVWA 1J2WA 4U28A 4TV6A 2DVUA 3P84A 3KBSA 5M17A 3TSDA 3PZUA 3GU2A 1F6PA 1A0CA 3GG0A 5CC5A 2OJPA 1ZJBA 3S5SA 3AIEA 4H8UA 3M43A 1OK4A 4Z2KA 3NUKA 6REQA 1XH1A 1OYCA 3DGRA 4YTUA 4UR7A 4C6JA 4AQLA 1CNVA 1OQFA 2PI6A 1ISYA 1V6UA 2BY2A 1DTUA 2VFDA 2Q3RA 2GVYA 3W87A 1VBRA 5CC7A 1VHCA 2CXGA 4C6NA 4DBDA 4I7UA 3R2GA 2IS7A 2UY4A 1HIZA 3ZR5A 3OZOA 4QM1A 1EJTC 4R7WA 1I75A 1AD1A 3VGFA 4IQDA 2NQ9A 3TOPA 3BLPX 1PL9A 4O4WA 1V7YA 3WLTA 4JN7A 2C19A 3BQ6A 3EEGA 4H6QA 4O50A 1QHPA 1WKDA 3H26A 2VC9A 4UMCA 5EBAA 4L9YA 3LZ5A 3WUFA 1UD6A 2EPHA 4N7QA 1FWFC 1OG0A 1R9YA 2XFYA 2EJ1A 4X60A 4JTUA 1TTIA 1XH2A 3DXIA 2XJ7A 1V3MA 3GXTA 2OLHA 3MZ2A 1BYCA 1EHAA 3AYSA 1L6FA 4HSNA 2OQHA 3TDFA 3DN5A 1VEPA 1OF8A 1UZHA 3F4CA 4AXNA 1HT6A 1XLDA 4QLKA 3SRFA 1GG0A 4Q4OA 4YYFA 2DGAA 3W1RA 4HA1A 1A5LC 5C0QA 2J9ZA 4YIWA 1LJYA 3D3FA 1ZY9A 1W1YA 2G3MA 3WQFA 1K1DA 2Y7GA 4X0VA 3MMTA 4O4VA 1QCWA 4B5VA 3VOFA 1DV7A 4JKKA 2QVNA 3PM6A 3QYQA 2GGGA 3GG7A 1HKMA 3QY8A 1A49A 1G6CA 4C6OA 2NT0A 4GYPA 4ML4A 3ENLA 3TYZA 4U10A 2IKHA 1A5KC 5CZKA 4HNNA 2QJIA 2O9TA 1VLIA 2ZTKA 3AHVA 1QOXA 3ZLFA 3MB9A 1CXKA 1VLWA 3VMNA 4MF4A 4EPDC 1JDEA 3EXSA 4JIEA 2OFJA 3QOKA 3TCSA 4UBPC 4J2PA 2ZOXA 2FKPA 4Z0SA 3GLCA 4A05A 2UV8G 3OBEA 2FB3A 1E6NA 1DJQA 3LXCA 3E0IA 2P0OA 3T05A 3CPRA 1REQB 2NV2A 3ATYA 2V2CA 1XSIA 4QLJA 3UXKA 1XLCA 3TOYA 4PUDA 2YR1A 1A53A 1PX8A 3FVMA 1TWIA 1UWRA 4C6BA 3C8NA 3N12A 3GTNA 3LDVA 4RW3A 5F2MA 4PUUA 3O9NA 4MGGA 4C1KA 3ANYA 3OOQA 1MYRA 4MVAA 4XZBA 3SAZA 2F6UA 3SZ8A 2CFFA 1XG4A 5F4XA 1Y5VA 1GZ1A 2CETA 3UXIA 4IH3A 1OINA 3ZJKA 3K8MA 4UZUA 1JZ8A 4L9XA 2YBVA 9RUBA 1QATA 4F9JA 4PN2A 2WQPA 4GKLA 3GU9A 3PZIA 1P43A 2X7WA 4S3GA 1EQCA 3URNA 3CZEA 3M7SA 1I0DA 3BVJA 5CJNA 2VM8A 3MV01 2Z1WA 4HHLA 1TX2A 4FAMA 3DFNA 1VKFA 3WNOA 1BXBA 3KBNA 1YE4A 3UW6A 3PN8A 3OZYA 1W1ZA 3GTXA 5D2XA 2BOFX 3PPFA 5FSEC 2BOEX 3A6OA 2AQVA 1AD4A 1B30A 3TKFA 3K1DA 4J1OA 1TPB1 5IFTA 1E56A 4K37A 3O63A 2O4MA 4YL2A 4GXWA 1VBJA 1YXDA 1Q63A 1I9CB 3OIXA 4CNPA 2X8RA 1XIMA 3VDAA 3SUSA 2BG5A 1OFBA 1AODA 3OG3A 5A5WA 5TD4A 4C91A 3PZ9A 2ZRUA 4S3DA 4J4KA 3T78A 3A9IA 4Q8TA 4WXZA 4KRZA 3AIVA 3QHMA 3W1XA 5F7UA 5CG0A 4PSPA 4MJ2A 1WKFA 2GVLA 1MW1A 4O19A 4LRSA 2PDHA 1M68A 4OE7A 1UHVA 4EPBC 1KCZA 2W91A 1EP3A 2W92A 4CQDA 4GOAA 4YPJA 1SMDA 2GJPA 4H1ZA 3S6OA 3VCCA 1E9LA 4XD6A 1GORA 1SZFA 3SCNA 3T1GA 3S5ZA 1CLKA 4OV4A 3KE0A 4XKMA 5HWNA 4NP7A 2NXIA 1GYNA 3MCMA 3GAKA 1FDJA 4ERGA 4RNJA 3B40A 5BOEA 4UCFA 2PDWA 4I9TA 3RU6A 4Z1YA 4MKNA 2Y61A 4PCNA 2D1ZA 3PJTA 3WUEA 5JBFA 4H6EA 4FIRA 2WVUA 3WO8A 1S5MA 1H4PA 2KAUC 2Y88A 5LGZA 5K9DA 4B16A 1R6WA 3TV8A 5CQ1A 2A7PA 2JFEX 2VEPA 2B7NA 4QTGA 2SFPA 1DJXA 4UNIA 3WIJA 4C6CA 3ISIX 4F3HA 1UKSA 3MC5A 3UWUA 3ALGA 3NL3A 3ARPA 4L61A 1M53A 2Q09A 3C3NA 4Y8EA 2WV8A 4WJXA 4UOZA 1EEXA 3GNOA 3B9NA 4ASTA 3QR0A 4CEXC 3QMRA 3CYVA 2GPTA 1GVYA 3MMWA 4WSKA 3U7VA 2ZIDA 3BV4A 3FKKA 2WZMA 2QKFA 2BS9A 2EPOA 3D0CA 2DSVA 4CD5A 1R46A 2Y8KA 2DVXA 2WM0A 1V02E 1W9VA 1GW9A 2CLPA 4XX6A 4MZYA 2ZUVA 3PWGA 2DT0A 1XDLA 1H61A 2J7BA 1UQYA 3VZXA 5AVNA 5HPOA 3R4IA 2HVMA 3PVFA 3TA6A 2XVLA 5F4SA 1U5HA 5H2ZA 1W2PA 2O4QA 4XAFA 4Y9MA 4HK6A 3HV8A 5EGRA 3QTGA 3R11A 3ZXWA 2ESCA 2Q6ZA 3AICA 2YCEA 3VPLA 1RBOB 3KCLA 1PS9A 2VWTA 4E8CA 4X9SA 2G0WA 1TQJA 3TQVA 2GUBA 2WWDA 4D2JA 3DEQA 5TBOA 3TSMA 1H0IA 2BLEA 2DJLA 3JUGA 4TV5A 3K5XA 3S1UA 1EA0A 1TMHA 4A8LA 3K4DA 4PGLA 1MXSA 1WDDA 1VFFA 3ZT7A 1XP3A 3FA3A 3T0TA 2B81A 1KRCC 4LS1A 4J9JA 1IEWA 3NYZA 5G2HA 1OX4A 1GOQA 2PGEA 2ON3A 3RIKA 2MNRA 3IEBA 4N4QA 3G3MA 3HGSA 4FO4A 4AEOA 3CL7A 4CVWA 1CGXA 1BVNP 1QPQA 2GOUA 4Z2JA 3MUIA 1E0VA 1S46A 2FQIA 3NZRA 3E12A 1RJRA 5D37A 2DUXA 1AL7A 4I8YA 4KPLA 5C2GA 5AYIA 2WO5A 1HVQA 3UZZA 6PTDA 3F2DA 2GQ3A 3P14A 1ELSA 1V7AA 4EE9A 4Y9OA 3E6EA 5IDZA 4EANA 4MAVA 4H4IA 1KCKA 3GFXA 3S2CA 1BVWA 4RJEA 1DJHA 3EMCA 1I60A 1WKYA 4AZCB 3M0JA 4EWND 4LBSA 3URQA 1U2YA 4XISA 4L6DA 1VZWA 2O55A 2D0GA 4XVDA 2ABBA 1JAKA 2PCQA 4Y9PA 3QR3A 2PA6A 5AYBA 4V1XA 3BXWA 1S2WA 1Z44A 1ISZA 1GONA 3T08A 1B31A 1O66A 3UJEA 1GHSA 1ICQA 3M0LA 1XGDA 4E2OA 4JTEA 1E0WA 4IWWA 1UZ4A 1QMLA 3W23A 2FFIA 3RILA 4OGZA 4Q22A 2QJMA 4LQ1A 1C8YA 3M4HA 4NHVA 4FX6M 3L4VA 4Z17A 1A5BA 2OSWA 1EP2A 3D47A 5FJPA 3URAA 3QPEA 5I3IA 1BYBA 1ZRQA 1JGIA 3KTCA 1W9PA 3IJIA 5EY5A 1JZ7A 2NVDA 1OCJA 4FXFA 3GC4A 3I7QA 3HPSA 4JXCA 1ZBVA 3NTYA 5BMXA 3GHSA 2RJGA 4I3GA 4ZO7A 1W5QA 2UZ9A 3S8HA 2JALA 5DY2A 3UZWA 2F61A 5MHBA 1ONRA 3FCPA 1O5XA 3CTLA 1M7JA 3RNDA 4CU8A 4R5EA 1YE6A 1W1PA 1XISA 3NQGA 2VURA 3DG3A 4B4FA 1NF0A 2QR6A 4PMVA 5D03A 1UD5A 3CWNA 1I2NA 4HVXA 1OABA 1G01A 1L6WA 4J3UA 3CGTA 3VC6A 4YMZA 3W22A 1TREA 2O7QA 4A3RA 3H6OA 4MWAB 1RCOB 2OYLA 2V5JA 2FPYA 3SGGA 3APGA 3IPWA 1H41A 4OOZA 2WK2A 1WBHA 5FJUA 3UETA 4R7OA 2IUZA 4AAJA 4P7LA 1EPXA 3TTYA 3NQDA 1QI4A 1UD3A 1GYMA 3MO7A 1E4LA 3NEHA 3FJNA 1UD8A 3HJZA 3A64A 4IIBA 2J6VA 3GXDA 2RDXA 3EBVA 4AU0A 1NOWA 1UWSA 3WMLA 2XIIA 2WZIA 3G5EA 1SSDA 2YOCA 3E96A 3KX6A 3PUGA 5HQMA 2YW4A 2EQDA 2PDNA 5F1UA 1VC4A 1VQTA 3BICA 4LYKA 1X6NA 3EDKA 5HDRA 1PYMA 3SCWA 1NIUA 1HJSA 2VL4A 4LUIA 3KOZA 4HOXA 4A3HA 1XW8A 1TJRA 1VPXA 1Z89A 5EMJA 3M0KA 1JFXA 2X30A 3W6YA 2WKLA 5A8GA 3WMCA 2PF8A 3IJ9A 3TIMA 3A47A 5DELA 4LYPA 3P6LA 3RO6A 4RDZA 3GR7A 3BAYA 3JRKA 4Q8PA 4M6PA 4HPGA 4YNGA 4GMEA 3WK3A 3HJEA 3LNPA 1E4NA 1R3VA 2X05A 3OBKA 1R3TA 4OWGA 2NUXA 4PUEA 4XAZA 2A1YA 4Z1DA 1F05A 1SGJA 4AWUA 4DXXA 3W7GA 5A6KA 4ZQMA 1OX6A 2G3IA 5KETA 5FSDC 1LQAA 4U5IA 3WDIA 4RDWA 5FF4A 3OJGA 3DH7A 3HTWA 4GPNA 4J27A 1NWTA 3ARYA 3B06A 5LNSA 3WK1A 1NWRA 1WNOA 2XN1A 2AL2A 2NV9A 4IMEA 3CO4A 1XLIA 2BHZA 4JTAA 4NZ3A 3M0YA 4A6GA 2CC0A 4D6IA 3OA5A 4QIUA 2DT2A 3QLDA 3PBYA 2OTDA 1QPOA 3QV6A 3IGUA 3PBGA 1DOSA 3IIOA 4W8AA 4JD4A 1FXPA 4RXGA 3QOMA 1IF2A 2BBFA 4H6RA 3DIPA 3URBA 3RK8A 3E0LA 4D72A 4ZQCA 1VFMA 3LCWA 1JVNA 3CAKA 1ZLPA 5KITA 4JFUA 2J7GA 1OC5A 2VZVA 3MUZ1 4C1NB 4K8HA 3NO5A 2WAGA 4OFCA 4NYYA 2OYKA 1TPH1 3W82A 3HG4A 1MZHA 1VPYA 4B4HA 2CNCA 2WNWA 2X1RA 3WMBA 3ABZA 4RCXA 1A5NC 3AIWA 2JIEA 2JIWA 1UKPA 1TPDA 4N6FA 4LEFA 2XM2A 3B97A 3H55A 1K6WA 3ZT6A 5DBUA 2WPGA 1HF6A 4H3DA 2OZTA 5I02A 4QG8A 1MQQA 3UY7A 2NQJA 4LH8A 3P82A 5EPDA 3T2QA 3NSNA 8TIMA 1XV8A 1UUMA 1C7TA 2E28A 3R5EA 4B3LA 2BY3A 5DRIA 4B5TA 4KS0A 3HBLA 1AMYA 4GUGA 2C6QA 4TO8A 5F2GA 4IMGA 2A3CA 2RHGA 1E6ZA 3W85A 1BRLA 1LOQA 1BTMA 2JQXA 1DYSA 1PJ9A 3PZOA 3IVSA 1EJ7L 4UTHA 3GDMA 4GJJA 3VNJA 3KBJA 1XYZA 3UJSA 2BV9A 4QE4A 4PH6A 3WUGA 4P2VA 1ZB5A 3C6CA 3BOFA 3VMOA 2YDAA 4H7ZA 4C6PA 3COTA 5DMLA 2WSQA 2V6AA 4UWMA 3VI2A 1XD0A 1SJDA 4XD5A 1EX1A 3VVGA 1CIUA 3VDBA 4CCZA 4PMOA 2JGQA 3VOIA 3N6JA 1QT1A 4GCXA 2Q02A 4BQ3A 5CZTA 3TWAA 1WUEA 3LRMA 2YBUA 2DH3A 3O0KA 4M7SA 4M5PA 3T2OA 4HGXA 4RDYA 2HJPA 3UWZA 5H8PA 3R12A 3N9SA 4KRUA 3S1VA 2CLMA 4O8RA 7A3HA 4JPGA 5HR6A 2BOGX 3DHDA 1W9DM 2XVGA 2CLHA 2E6YA 4GGBA 3H53A 3B8WA 3BLKA 4PRTA 1XIEA 1P7TB 2ZFAA 4LYRA 4GKTA 1F76A 2XH2A 4JIIX 3VE7A 3OW1A 5I3HA 3KOYA 4Q8WA 4GQGA 5A8PA 3BW3A 2ZE0A 2UY3A 4JL1A 1TKKA 1HJWA 2BZNA 1Y5WA 1WZKA 4Q32A 1BQCA 3W24A 1OADA 4OUIA 1WDSA 1XYAA 3CQIA 3G1HA 5EMLA 2D24A 2ASHA 3QZAA 4CU7A 4DJEA 4AHOA 4FLSA 1XI3A 1H2JA 3Q67A 3ZVHB 3BDKA 4PODA 2V9DA 2OKTA 3B8IA 4QRNA 1DXIA 2YZ5A 1W3TA 2P3ZA 1FCQA 3SQLA 5A6LA 3AS3A 4DY1A 1GZJA 1UR8A 3WF2A 3WNLA 1WCGA 2FYMA 4ZTYA 4JGDA 1UROA 1HKKA 3P67A 3LHTA 1LLZA 2OO6A 1XRVA 2CHRA 2DZVA 2J7EA 3N25A 1V0LA 3QLLA 4HA0A 2QV5A 3FOKA 1FH9A 4NXSA 3FN9A 3CEUA 1ZL1A 2GWNA 3OP2A 3GD6A 3S3GA 4QJ5B 1I2PA 3AS0A 4WGHA 4LGXA 5A8OA 4DF0A 4XVEA 3L9CA 1ZAHA 2RUSA 2HVNA 4I7VA 4KF1A 4H6KA 4MB5A 4ZFCA 1S2CA 5HJLA 3G3DA 3TXVA 4GIAA 4WOQA 1EEPA 1W5MA 3E0VA 3UA3A 4X63A 4B3KA 4H00A 4RLIA 5SWUA 3VX1A 1R5YA 1J8VA 4RW5A 4GY1A 3CQKA 3OPSA 4U5KA 3CT2A 1GCYA 4XUGA 3KTSA 2FH6A 4AISA 3WH6A 3BGGA 4XWUA 2XIOA 2ISDA 4I7WA 4ATWA 3FEQA 3LOTA 4PB5A 5HUPA 4IOTA 1OFAA 3LRKA 3IIVA 3RM9A 1K9TA 4IGSA 3PS7A 4D8LA 1KGWA 1W5NA 3KWXA 2NLIA 1TUFA 3M5YA 1TV8A 3CQHA 4CQAA 4AEEA 3STCA 4JHOA 2YGYA 3EX4A 1F74A 7XIMA 2VD8A 4WQ6A 3GTHA 1K77A 1YDNA 4HOWA 1R86A 3LS9A 4P7RA 3E74A 4PUNA 1CGTA 3VX0A 1JYNA 4DM2A 4U3AA 3MHFA 2EPLX 5CBIA 3EKGA 4LB3A 3UD6A 5DX7A 1MZRA 4DO7A 4MHBA 3MUXA 3P2VA 4HN4A 1TJ0A 1JD7A 4K3ZA 3G24A 2CXEA 3VCRA 2WBGA 4O10A 1JYVA 6XIMA 3TYBA 1QUMA 4Q8UA 1ADDA 4GYFA 1KWKA 3QMTA 1SZEA 2V82A 1EDGA 2X40A 4MLRA 1ZQ5A 2CESA 3ARRA 3FV9A 2OCZA 3BUVA 5I79A 3A3XA 1OBAA 3V4BA 3GWQA 3LI0A 2QJNA 4I5UA 5AC5A 1DIEA 1IE7C 1UWIA 2X7VA 2DT3A 3STGA 4JDBA 2ZYFA 3GVVA 4XKYB 3TCEA 1YDVA 1ICPA 1F7BA 4KWSA 4GJ1A 1DJWA 3OHIA 3S5OA 1GVOA 1DQUA 1YTDA 1Z48A 1MDRA 1R3WA 2FB2A 1HL8A 4CEUC 1SZNA 4DJED 4GK8A 5E09A 4XV0A 5AHLA 2QXWA 4K68A 1LWHA 3LYEA 2P1FA 2JK2A 2RDWA 3RG6A 1BYAA 4C6DA 4HOZA 4JY8A 1FY6A 3GDBA 5BWFA 2XIBA 3VZZA 1GHRA 3DDMA 1R3YA 4UTIA 3G22A 1L9WA 4UOQA 4HD5A 5D9NA 1ZCOA 2X42A 1WUFA 3OTRA 5LNVA 4IPIA 1TPC1 2C7FA 3GNNA 3DECA 4OBSA 2O9RA 3LHVA 4AB4A 3ZZ1A 3U2OA 1LG1A 2E6DA 4GC3A 4UQ9A 3N19B 5ABGA 1LL4A 1OT1A 3CIWA 3VABA 4HHHA 7REQB 2Y89A 3SN4A 2CZVA 4F79A 4C6MA 1CWYA 2J8GA 3TFCA 3NYDA 1V6WA 3SRHA 2ADAA 3DG7A 1PX4A 2PDYA 1CDGA 1J0JA 1KGUA 2GGIA 3BURA 3R43A 2Z1KA 1FUYA 2O9OA 3QHOA 3UGVA 1EYWA 1U1HA 2WYSA 3OVQA 3WG6A 3BZJA 4Z2GA 1KFEA 1BLIA 1JCJA 1XQLA 4LU0A 4PTWA 2ZRWA 3KRSA 4LV4A 2GJXA 3OU8A 4WR3A 5T8GA 3MW7A 2Y6ZA 4AWTA 3WH5A 4CQ8A 1UOZA 1O94A 1EO5A 2VENA 1VCGA 3NVTA 4QS6A 4S3CA 3EA2A 1OEPA 3WJYA 1LLWA 3NQ2A 3VU2A 3AI0A 5DFAA 1WXJA 3CHCA 1G69A 2IPFA 3HG3A 3W1PA 2FZNA 4JCLA 1UJQA 1MW2A 1QWKA 1PXGA 1KR1A 1MSSA 4AIEA 3ZR4A 4UC5A 1ECQA 3SY8A 1NDVA 5C2XA 2PDIA 3UXDA 4JTRA 2ISVA 3BWWA 4ZFMA 3O05A 4HB7A 4RPPA 3MKKA 3MUY1 1S2TA 1PKYA 5DMNA 1XGZA 3H21A 4UQAA 3PULA 4AW7A 4I9MA 1EXBA 4J3TA 3P8JA 2RFGA 2YXGA 2YCLA 1TIWA 4C6FA 1MNSA 1JI1A 1VHNA 4M6QA 7TAAA 5L9FA 2VDGA 3LA4A 3PZVA 5CZJA 4UTMA 1TPFA 4ZQRA 3LCGA 1OCBA 1O1ZA 4H2CA 2OR2A 1A3WA 4KWVA 1TTPA 2CKSA 5A6TC 1JYWA 5GQBA 1W9XA 4US5A 1PTGA 3CJPA 2VT0A 3NL2A 4NSBA 5JMUA 4MNKA 2RGLA 1RJPA 5HR7A 4MB1A 4RE3A 2XINA 2G3FA 1U5VA 5KZEA 3T2PA 1PZ1A 1QK2A 4NX0A 1T96A 3B9AA 1TWDA 8A3HA 4ZE5A 1UR2A 3EMQA 2A5HA 2YDSA 3IAQA 3S2LA 5LHFA 2BSLA 4RX0A 1V3LA 2PLKA 3F5LA 5CJ5A 4AZHA 3VKAA 4NAFA 1XWYA 3POHA 3TR9A 2VO5A 5I77A 3LX9A 1XSJA 4LXFA 1OGSA 3SR7A 4J7RA 1C9DA 2VGIA 2RJHA 2DIKA 2J25A 4ORMA 4OVXA 2VEMA 3S46A 4OUEA 4BK9A 3N2CA 4KIRA 3O2LA 4CCEA 3PUOA 1JD9A 3TN5A 4X22A 1KM2A 4GYPC 1CGYA 5ABFB 3M07A 1I6NA 5D2VA 3EX3A 4IMAA 2WLYA 1K8XA 4M81A 4L6OA 5TQLA 1H51A 3PY2A 4DPQA 3R6IA 3I6TA 4R33A 4CNNA 4IG2B 2QPSA 4K8GA 3G1XA 4XUYA 1IV8A 3CBWA 4HYWA 2OYMA 2WMHA 5KZMA 3TSBA 2R1KA 2NX1A 2GUUA 3TLLA 3V75A 1V02A 1QI5A 5XINA 2J7DA 3BH4A 4D6GA 2DQXA 2OOFA 1SO5A 1B0IA 1GQLA 1SQ7A 2WPBA 1TR9A 4DRSA 1TUXA 2P8BA 2PAJA 1FHVA 2R24A 3UG8A 4XZMX 2QCDB 1UIOA 2Z27A 3RCNA 1I0BA 2VC5A 2AQOA 4KCVA 5I3KA 4O8AA 2YJQA 1TG7A 4ML9A 1GVSA 1LWIA 2XGIA 4OHQA 3BAWA 4GBDA 1OFDA 1PAMA 2VQTA 4JNYA 2QF7A 4A22A 2IPJA 4B5WA 4LTSA 1US3A 1YBQB 4CKQA 9CGTA 1MXGA 2ZWYA 5RUBA 3LBMA 5HOSA 2NV1A 1G4EA 1HTIA 3GW3A 1XRSA 3OYXA 2FGBA 3SB0A 4B90A 4YWSA 4HNUA 3SQMA 1FX6A 1O7AA 4NAFB 4GWEA 4KFNA 3EWBX 3CXOA 5JUVA 1QJWA 4C90A 5EMMA 1P48A 3WDRA 3EOOA 1Z6KA 4TU1A 3SIMA 1DQWA 2HS8A 2ZXAA 3LCXA 3ABRA 2YDRA 3EA1A 3USBA 1G4TA 3PZQA 4PB3A 1RY0A 1XIGA 2NQLA 3NXFA 3BPWA 1IR1A 2VGGA 1YX1A 1TPUA 3RAOA 2NZLA 4AD2A 1OB0A 2WVVB 3W0KA 4NY2A 2ZVRA 1TR1A 1Z7AA 3GC5A 4FNSA 4IZGA 4DJDC 3L65A 3U7BA 4QXIA 5A6BD 3VIPA 3IRSA 5ECUA 2CKRA 3H23A 1L8NA 4ZB2A 2PRMA 4O57A 4REQA 4G9PA 1VCVA 2P3EA 5IBXC 2BGQA 3UWEA 4UMBA 2ZX5A 3VOGA 2ZZ7A 1W37A 2CPUA 3NIYA 3GS6A 3I3DA 1IGSA 1GUVA 2IMRA 4BI5A 1VIZA 3FNDA 3W38A 2FZBA 4V33A 3O0FA 3NM1A 3S2MA 5EFDA 2Z24A 1VRDA 3ATZA 4S1FA 3MI2A 2Z1XA 3ZSSA 1D8WA 3THQA 4JNZA 4GVGA 3PNUA 2PRHA 3AMLA 1T8QA 4KWUA 1JJKA 3KRUA 2WJZA 4R34A 2R6OA 3E02A 2J74A 1IWAA 3HGRA 3GY1A 4TTGA 2NLYA 1VYPX 3RR4A 4L7ZA 1D3HA 4HU3A 1CLXA 2YL8A 4XBSA 1EA9C 3TN3A 4NAEA 1I2RA 2ZXBA 3UXAA 3TQPA 4Q8MA 2Z29A 5XIMA 1M5WA 5I78A 3CK5A 3ES7A 4Q4RA 4V27A 3LXAA 4JFVA 2NQ5A 3GK0A 4LSBA 2C18A 1Z3NA 2FMOA 2L5HA 1F9CA 5TF0A 5BOFA 3U0HA 1EC8A 2QJJA 1TMLA 4FEZA 3WLMA 4EP8C 1Q2SA 4RPQA 2Q3OA 5T9CE 2GQ8A 1I2OA 2QCNA 4WKAA 4FMVA 4ES4A 4OU1A 2GVGA 1W9BM 2HRWA 4ENLA 2V2HA 1P0DA 3EWWA 1T6MA 5PTDA 2E7FA 6A3HA 2FHCA 4KWOA 2A2IA 2OU4A 4GH3A 4CD6A 2D2HA 3OB8A 3QKZA 4LAOA 2I5QA 1JG9A 4GO9A 1PIIA 1XLMA 1RLCL 1XGEA 1ME7A 4ZOEA 1GVFA 1XPGA 4E4PA 3L4ZA 4FNTA 2C71A 1TX0A 1YBQA 4AWSA 3LG3A 2XFFA 4BFAA 2TAAA 4QDWA 2E1DA 4C7GA 2R94A 3F4WA 2GYIA 3S1WA 4IP4A 3DFPA 3G1RA 4J3XA 2C79A 4IP5A 5FEZA 3EXRA 3TN4A 1MXDA 4H9ZA 1EP1A 1HJQA 2XG9A 4UOJA 3S4TA 3AMKA 3VINA 3AJ7A 4W4QA 2J78A 2CLOA 3GFYA 1QNRA 1H7OA 4ADUA 4CQ9A 2ZDRA 1YDOA 2CERA 3VYLA 4C6EA 3CIVA 3EOSA 1YEYA 1OSEA 4DJFD 5IDIA 3TR2A 4UFIA 3GUWA 3KHDA 3R0KA 1UOKA 3P62A 5FI8A 4IMCA 4KGJA 1EJRC 4ECLA 3MKVA 2ZA3A 4PUMA 5AHEA 1E5NA 4UNLA 4LCRA 3RRXA 4HZ6A 3C2FA 1ISWA 2QMKA 1DE5A 3G0XA 1ME8A 3KBVA 4D71A 3PZNA 4DAFA 3QQWA 3CT7A 4BI7A 4BA0A 3BE7A 2J47A 4HPXA 1MQRA 1UR9A 2W6RA 3O7UA 4OIFA 4MOZA 5AZ1A 4P8WA 1P1XA 2WW5A 2FZ9A 3R94A 4X61A 1RVKA 4GGHA 4JTKA 2XHYA 4XZLX 4FNPA 4KQNA 3PBWA 3WBYA 4XK2A 4XZWA 3GH4A 1XRTA 4UTTC 3F03K 5I06A 4XSLA 1FXQA 5I0DA 3AROA 1XINA 3I6RA 5JIWA 3EWDA 1FFQA 2BX7A 4NXKA 1DWIM 3IK4A 2P8CA 3GE7A 2GOKA 2Z26A 3ICJA 1CXEA 1MFVA 1FHLA 2WCSA 4LBUA 3GZAA 1R7AA 4GJIA 1GKQA 3BO9A 4JYEA 1K9EA 1H11A 3WQPA 1S5WA 4GI9A 1B4KA 3ELFA 3PZGA 3FXYA 3E1F1 3P80A 4M6UA 2YFNA 1Q5MA 2Z6IA 3MBFA 1HO4A 2H8XA 3W1UA 1WAWA 4FNQA 1CLVA 3QW3A 1ZBCA 4NF7A 3OEXA 5BXTA 4PBGA 3H7RA 1IHIA 2DZUA 3N11A 3IK2A 2VRQA 4KIEA 3PNZA 1Z69A 2BVTA 3I68A 3SFKA 1WP6A 3CWHA 5BROA 3WQ8A 1UCWA 2Z0IA 3IVUA 2PD5A 2V81A 2FDMA 3EDFA 2EBNA 4S23A 4ZR8A 3FDGA 4GISA 2YL9A 1VJZA 4X2RA 1UD2A 3ES8A 1B3WA 3LM7A 4QCEA 2HISA 3BLDA 4AD4A 1P0KA 3SSZA 4PUWA 3SN0A 4RZBA 4PTMA 4ACZA 1UH2A 4B9ZA 1GEHA 3E3HA 1E1EA 4RNFA 1DJYA 5A69A 3PBMA 2OO0A 1NELA 3S83A 1XYFA 4EK7A 3K8KA 1JNEA 3KL5A 2PGRA 1IGWA 4RV3A 1A5AA 4F0HA 3EKLA 2D3LA 1C3FA 1MQPA 1RK6A 4AUBA 2F6KA 3K2GA 3WEMA 4HN8A 4V15A 2E09A 2OODA 4W93A 1QNVA 4UQCA 1BKSA 4HPJA 4HZ7A 3FJ4A 1AQMA 4Y9AA 3OGSA 4DX3A 1ZSXA 2DIEA 3KS6A 5D33A 1TRIA 3DGBA 1NARA 1R9ZA 1QFEA 4K36A 4LCSA 5FKYA 4PBFA 4GX8A 1RK5A 4H19A 5BRBA 1PEZA 1RP8A 3N9KA 3AU2A 1DHKA 5BWAA 4QROA 1XYBA 1SM9A 3QZEA 4HPNA 1GT8A 1OD8A 5E1QA 3GG8A 4IFOA 2YB1A 4ZB5A 1E73M 2PTWA 3W6LA 3BJSA 1WDRA 3WY1A 4F4RA 3UCQA 5FL1A 3UBPC 4E0CA 4FZIA 3LGGA 1ITCA 3IJQA 3TP4A 5ABHA 2DQWA 2VFHA 3L2LA 1EH9A 1TJPA 4IQEA 3ZR6A 1O5RA 4ZEPA 4A29A 3T07A 3DC8A 4M6VA 3FX4A 5T91A 2QUNA 1HKWA 2QCHA 4D6FA 5ABTA 3BLEA 3UWYA 5H8MA 4AF0B 4YWIA 3BMVA 3PJXA 1A0EA 3TJ4A 3QYSA 3NG3A 2PGFA 4C1LA 1E4MM 2O7SA 1FQ0A 2ZX9A 4HMNA 4PMDA 3P5ZA 4YHEA 1WE5A 3AMGA 1H49A 4WUIA 1BWKA 1TQXA 4H04A 2EF9A 1L8PA 4M24A 2ZUTA 2ISFA 3OHMB 4O1BA 4G7FA 3WK0A 3RJYA 1G4PA 1SW3A 4K39A 1X1ZA 3GHRA 2V68A 4GVFA 1UKOA 1GOXA 2Y70A 5LSMA 4F0LA 3UWVA 1VBHA 1NWUA 1UH4A 2DVTA 3A5FA 3ZM8A 5A6SA 3LHYA 2J77A 4NZCA 1PV8A 2VP8A 3WD0A 3CV6A 2Q8ZA 2OKOA 1Q66A 3HQPA 4E4FA 2GJLA 2QZRA 2ZZ2A 3LV6A 1IIHA 4TMBA 1PPIA 3A22A 2DSKA 1A5UA 3CUJA 3AALA 1KM0A 4LWWA 2VXNA 3D6NA 4LEQA 4C6KA 5CGMA 3W7MA 1DTNA 3KDOA 3L4XA 4C5YA 3MTWA 1TJ2A 4PMQA 4UNKA 2W9MA 2VCAA 2Y5SA 4J40A 3O06A 1XSKA 3EAUA 3LHWA 4DBEA 2PC4A 1BSIA 4NNCA 1IXOA 2BDQA 4RE0A 2NUYA 2HEJA 3LTPA 4U3CA 2XIMA 3NZPA 5M5DA 2J27A 1UYQA 1L6SA 1JPKA 2WHMA 3IGHX 3TW7A 2V8ZA 1P0EA 2J4GA 4EPEC 1B90A 3ZWSA 3GDLA 3UZ5A 4UR8A 4AXKA 4TOQA 3DESA 3WMSA 3CZLA 2D69A 1WOAA 3GDKA 4G6CA 5FF3A 3NPXA 1A3HA 1BGGA 1WZMA 2X2GA 2WXDM 4V1YA 5I2UA 4EACA 1T7LA 3KXQA 4W5UA 1SZGA 1ZJHA 1V08A 3ZLHA 2KX9A 1D3GA 1VF8A 4I9JA 2WWCA 4DIAA 3T55A 5CGTA 3HGOA 4AY1A 1W5PA 2INEA 3NURA 2DDXA 2INZA 4NVTA 1LBFA 2I5GA 4KGLA 1S38A 3MSDA 2DPEA 2PLMA 1LOSA 1KO0A 4R7JA 3TONA 4MJZA 3V5CA 3BQ5A 2VQUA 1X96A 1YMYA 2PZNA 3THCA 4OJYA 2H90A 3WLLA 2R82A 3UJFA 4I6VA 5DCEA 1EO7A 4PZVA 1AL8A 1YADA 4IGHA 5AYYA 4DZAA 3V7PA 1ITXA 1LWJA 3SJ3A 2OT1A 3BMXA 4IPPA 2GVJA 1EBGA 4RUBA 1O60A 3A21A 1HXJA 2E5BA 1PB0A 1FWCC 3VIFA 2V3FA 2VTFA 2A6LA 5AC4A 1E72M 3GKAA 2YBTA 1KBKA 3LCLA 4DYJA 1ZU8A 4MY1A 2HWGA 2RH9A 2Z2BA 2FTYA 2POTA 2HBVA 5C8BB 4UTUA 1WPCA 4QJ4B 1TJ1A 3NR0A 5CZSA 4IXHA 2CBUA 2X41A 4PUJA 1W54A 1GTHA 4ZSTA 3FAXA 3N2XA 3N73A 3WELA 1PIGA 1SU5A 3H12A 1A4LA 5CEWA 4YTSA 1Q13A 1FWRA 3NWRA 5M03A 2QF8A 2ISWA 1GKPA 2MANA 2Y8UA 4NAEB 2G50A 2J66A 2AQWA 3MANA 4ZXOA 4QG6A 3GG1A 1XJBA 3F4NA 1IIGA 1E15A 3DCPA 4JIHA 4HMDA 2YCLB 4O12A 4EF8A 1P7TA 4UIOA 1OC6A 4MWAC 4F2BA 1UA7A 5A6JA 3LXBA 4L4LA 2Y7DA 1UW9A 3FA5A 3AIBA 3DYOA 2GGHA 1CBGA 5JBDA 4LRTA 3UNTA 2PWHA 4Q3MA 3UVAA 1B1YA 1YDYA 4P7OA 1JPIA 3EZ4A 5BXRA 1A5SA 3UCCA 1NU5A 2YKKA 3ITLA 3VIGA 2TRSA 4ZOBA 1LRQA 2VZSA 2CYGA 3MPGA 3ALFA 3M47A 1V6VA 1ZUAX 4TIMA 1Z9AA 5FEWA 1JGMA 1ZAJA 2VELA 3LI1A 4O1DA 5AOUA 1EDQA 1PE1A 2VZTA 3FJLA 1X7FA 4LANA 1FCUA 5D8ZA 2NXGA 3TC6A 3AAMA 1QDSA 5DQPA 1JZ3A 3QY6A 1AK5A 3WBXA 3TMQA 2WVVA 4ZENA 1OHLA 3KL0A 3E2VA 1EB3A 5G5IA 3EX2A 4EOUA 2G96A 4LC6A 4AX7A 3H2FA 4HNOA 2DZTA 1AH3A 3UR5A 3T0AA 3KOFA 3TQKA 5C7VA 3CUFA 4GI4A 4DO4A 4AY7A 1XKYA 3Q37A 4ZOAA 1UR0A 4U33A 3VGEA 3M44A 1WDPA 3HM7A 3WNKA 4S2BA 2DW7A 1TCMA 3PP7A 1ADSA 7REQA 1XUUA 2GDVA 2ZKMX 2G97A 5C7HA 2WNZA 2Z4GA 1XFCA 2AGKA 3BLIA 3LMZA 1MW0A 4PCFA 1PCKA 4B15A 3F7JA 3EWCA 1BEUA 1QOQA 2POZA 3TH6A 1S3HA 5A2AA 1ONEA 4YTRA 2B7OA 2XYLA 1KCXA 3A24A 2PD9A 3APTA 1Q2RA 1OGGA 1CPUA 2O9PA 4RZ4A 1UMYA 2FZMA 2PWFA 3P60A 1W56A 1VP5A 2GQ9A 4GXMA 2EKCA 2EPNA 3B0XA 2OEMA 4DWDA 4PMNA 1DXFA 2X1TA 2JF6A 4CD8A 4H7CA 5ECVA 3DHPA 2XTKA 5BZAA 1JR1A 4XBKA 1BWLA 4IG2A 3SFWA 3CZKA 2B7QA 4LVGA 3WD1A 1KD0A 3W71A 3BL3A 4F2UA 5FF0A 3QQ0A 3B8TA 4Z08A 2XN0A 2E4TA 4QEHA 1RSCA 4Q8VA 3L68A 4YVVA 3P61A 3WBEA 1UKQA 1EZ2A 2I1OA 2YL5A 2XGBA 4F0KA 5XIAA 2H8ZA 3WLIA 3NQ7A 5DLCA 3SADA 2QDDA 5HNNA 4F9DA 2X1IA 3PUEA 3UZJA 3UR7A 1HKVA 1JCLA 4PSRA 3RPMA 3PG9A 3N6HA 4ZO6A 4AC1X 1RBLA 3CS2A 4W85A 4DJDA 1TE6A 4PCTA 4HPHA 5D4YA 5FAGA 3WQ5A 7TIMA 1EF2A 4MB3A 1P6CA 4LNCA 5DRCA 3R8HA 5CZ0A 2X09A 4NZ5A 3VC5A 1FDZA 3ITGA 2QCEA 4W87A 2QAFA 2D73A 4WZHA 4GUHA 4K1WA 2VYOA 3TYEA 2ZTJA 4MYXA 1R8LA 3VDGA 4NT0A 4D6EA 1LLOA 2VKZG 2GGJA 1VPQA 3T9PA 1IZKA 4P8XA 1O5KA 3PBVA 1QHZA 2YYTA 4FOKA 1XRFA 4Z1BA 1S2AA 3LENA 4J2MA 4XZ9A 1NDZA 3W2LA 4AZBA 1CEOA 4AWEA 3G1VA 1XXXA 4UFJA 2V69A 1S2UA 3WF4A 1KM6A 1YXYA 3T0DA 5AHIA 1RZMA 2RDUA 3OGVA 2DT1A 3VIIA 2A7NA 2WANA 2WHKA 1WAUA 3EA3A 3ITYA 4H9UA 3VNZA 3QSTA 3SY1A 3VM5A 2W62A 3MVIA 3CHVA 1PDYA 3AXKA 2PGWA 2V5KA 4AHQA 3SJNA 3VKBA 5U7SA 1DWHM 2EEXA 2ZC1A 3GRIA 2BXYA 2WNQA 1UWQA 5EU9A 2DZPA 3XIMA 5EKYA 5EBUA 4B3ZA 1XICA 3SI9A 3BAIA 4BWLA 5DMMA 4GO8A 1H1NA 3LSCA 3MU7A 8XIMA 1MWOA 4NL1A 4PMRA 3IJ8A 3F4DA 3NCOA 3W7DA 3KUMA 4LUYA 4K8EA 4D8AA 4GUFA 4Z2HA 1A5CA 2QLYA 4PTDA 1EJVC 3W7HA 1QK0A 4RNIA 3DKLA 2CLEA 3DERA 4IUGA 5FJJA 4HK7A 4E4UA 4NZJA 2V30A 1K8YA 1DBTA 3WLRA 1G7UA 2QS8A 3BARA 2VVNA 2J6XA 1S1RA 3WSUA 3CL6A 5EA9A 1V03A 3VFCA 3AHTA 2HSAA 4S39A 3BTNA 4N2YA 3B8DA 1GQNA 4MLJA 1B9ZA 5DF0A 2VFIA 3W7PA 4LV9A 1M04A 4PEEA 1ISXA 4M1BA 1QTWA 1U33A 5CBJA 4BHYA 4CN6A 1LYXA 3PTQA 4KKXA 3FSUA 1E9ZB 2BB0A 4I8DA 3RYSA 3VK5A 4QX4A 4BR1A 4YTQA 1KKOA 4KESA 3TX9A 2AGTA 4TR9A 4E38A 4I9AA 1LUCB 1YTKA 3BJTA 3USZA 4XQ6A 1V8EA 2AKMA 3C2YA 3UZXA 4UZSA 3W70A 2QCMA 3UWWA 3DFSA 3PJWA 3TROA 4N9CA 1YKWA 1UUOA 2V67A 5GNZA 1CZ1A 4NIRA 5HK4A 4GQBA 3EDJA 4H8HA 2I56A 3KP0A 3TJXA 3BCJA 1CXFA 1M65A 1ME9A 1ZFJA 3CM4A 3M0ZA 3VXGA 4AZGA 2OOGA 2WHJA 3W26A 4QDMA 4GUJA 1PZ0A 5A6AA 5K9CA 3KOWA 4JHZA 3GUGA 3TWBA 4UTWC 2E40A 3GKFA 3RN6A 1YHTA 4QNEA 4GZ7A 4A2RA 1XM3A 5E5CA 4ATDA 1Q6FA 4ILSA 5HINA 4WOZA 2G5WA 1DL3A 1MUCA 1VYSX 3GVGA 2HVOA 5I3DA 4W5ZA 2ZWZA 2WMKA 5FA5A 3GR8A 2FGZA 4Q8NA 2AMGA 4HHMA 2P5NA 1W31A 5I24A 1I1XA 4TUFA 2C16A 4E5TA 5DY3A 4UTTA 4ZVJA 2CLFA 1CXHA 1V93A 4O18A 3CMFA 3S1XA 1L6GA 3KTXA 1NP0A 4JTJA 5DO8A 1GK8A 1R47A 3BOXA 1L6YA 3IV3A 3L4WA 1RXOB 2Z6JA 3MZNA 1HG3A 3AS1A 3WLNA 1JFHA 1IT7A 1MEHA 4ZGYA 2C91A 4ICMA 1TVPA 4WCJA 5KZ6A 4DUOA 3DOPA 4PFHA 3IJ7A 3Q2DA 2R1NA 3FJ6A 3MV11 2J9YA 4P7QA 4JFSA 3THAA 4A3QA 4ZMGA 1IT8A 1FHDA 3RM8A 1DJIA 4WEVX 5C71A 3TYCA 4DF1A 1M03A 3O07A 2RAGA 1E51A 1HQTA 3S6DA 3S9ZA 4UTLA 3CAQA 4NJHA 4RE2A 1A0DA 2VX6A 2VRJA 3CB8A 3NVDA 4EPKA 4G2DA 4MNMA 2D0HA 2ZQ0A 3KHJA 1XCFA 1AJ0A 2IW0A 1J5SA 1RAKA 5HNTA 4ZZ9A 2WM1A 3AXHA 4C1NA 1A5MC 2GQAA 1E0XA 3G77A 5C2CA 1HJVA 3LQGA 3HPFA 3SCSA 2J9XA 1B3ZA 3TYAA 3HQOA 1ML1A 1HJUA 4BQ2A 4GBUA 1GG1A 2V3EA 1EC7A 2BHUA 4P8VA 4D8ZA 3V0TA 3QHNA 1JF6A 1CB7B 1HVXA 3CMJA 5EMKA 4AYSA 1F61A 3APYA 4BWLC 5D9OA 4G5DA 2D20A 2OLAA 1A47A 3Q65A 4MB4A 4F0RA 3IGXA 4MNLA 3CQJA 4YCOA 3RHGA 4UFHA 5JQ9A 4WLCA 2AL2B 3D3AA 4CN4A 2A3HA 4G56A 2HPIA 4IX2A 3EOUA 3GHTA 1EDTA 4O15A 3ID7A 4FLRA 5D32A 5D8WA 3E2RA 1UZDA 4J28A 1AH4A 3WBAA 1TIMA 3RLUA 2CBIA 3PAJA 3DBPA 1P6WA 1Q6QA 4MYAA 1F5ZA 4WY0B 4Z1AA 3U48A 5JH2A 1FRBA 4ERIA 2FHBA 4M51A 4G7EA 3WQ6A 5CAHA 2Z1VA 1O95A 4B91A 1E6RA 1JUEA 4PULA 1IEXA 3HPXA 3O6CA 3QH2A 1WKEA 2W27A 4Y90A 1GOOA 2I57A 1J0IA 3R25A 3WQVA 1GJUA 5E6YA 1H09A 2R9RA 3QGKC 2PLCA 3TW6A 3GSMA 1ODZA 4MM1A 2OSYA 3I4KA 4FXJA 1NOFA 4YXGA 3BG3A 3UR2A 3GQYA 3LK6A 1LOLA 4E2BA 5HUOA 3W7KA 1G5AA 3WD3A 4XSMA 4UFLA 4RDVA 3I4EA 3FKRA 3OLIA 6REQB 3ORWA 3QRHA 1O12A 4AHPA 4WD0A 4MPQA 1J6OA 3U2CA 2B7PA 4IIEA 1TA3B 1QHOA 3PK7A 4QP0A 4L4OA 3SQSA 3B0PA 5I3JA 4X2PA 4Q33A 5K7JA 2QJGA 3OODA 1VBGA 4L4MA 4N42A 1F8IA 2W5FA 4JEQA 4IGNA 3VKDA 1KQZA 1N55A 1W0MA 4F40A 1KBIA 1ZGDA 3DG6A 3F2CA 1OD0A 3BGJA 2PDMA 3FHAA 1VFUA 4UXDA 1KFKA 2ZXDA 1KR0A 2VOMA 2OWCA 4I5RA 4O53A 3JU2A 3S1GA 4QDPA 4PE8A 1J0HA 4XO6A 3EYPA 3R58A 2VFEA 3W2KA 3PSWA 3LCFA 4DXKA 1KM3A 1RCQA 3U2ZA 4AZ5A 2UBPC 1HP4A 5CLTA 4H9YA 3LU2A 3KL3A 1QRQA 2JEQA 2VEFA 2VDHA 2YYUA 5A2BA 4LF2A 4CVUA 1UWUA 3IANA 1PKNA 1OY0A 5ENLA 2ATMA 1Q6CA 3U2EA 2CEQA 2WMGA 1WX0A 5G4WA 3NPVA 3UZYA 2FVLA 1NFGA 1TV4A 3CHEA 3BAJA 3RCMA 2WKJA 3EWZA 4L80A 4H9TA 4H83A 1HGWA 3NA8A 3MO4A 2ZDSA 4DN1A 4W7VA 5HPCA 5DCDA 2E1WA 1KWGA 1G0CA 5M1TA 1V6XA 3GB6A 4YCPA 2WQDA 1Q8JA 2GJRA 3ZO9A 4ZQPA 1BRLB 2J7FA 1RH9A 1FKWA 4PTVA 1JZ2A 3HU7A 4OV9A 5GVJA 3AWNA 1MVYA 3LNMA 3G1AA 1CXIA 2I7GA 2Z7GA 3BAXA 1XC4A 3ARWA 5LNUA 1Q3NA 3N1AA 2ZA1A 3TZFA 5LIWX 3WJXA 3R8GA 4H8VA 2X0HA 3U4AA 4C7DA 1NAL1 1A3XA 2ALRA 3ZQ9A 3UJ2A 5AZ0A 1WBJA 3KZPA 5LIKX 1OFPA 2IQ0A 1BSLA 1H63A 2Y5JA 3KP1A 1NY1A 1VRXA 2HXUA 3II1A 5CH9A 1FWDC 1NFPA 5BU6A 4DBUA 1E3XA 3MJMA 2I5IA 2VCCA 5BW6A 3V5OA 5CPNA 3VCNA 3WLKX 2OZ8A 1GNXA 2HDJA 1C92A 1KGXA 2XM1A 6CGTA 5KZDA 1V51A 5F2IA 5AC8A 1H3GA 3MYPA 3WD2A 1PCWA 3R8RA 1CB2A 3D5HA 5DT7A 4L56A 3B03A 1R0MA 4FXSA 4I5XA 4IHCA 2FMNA 4NASA 4IF2A 2ZADA 4D6HA 3U5YA 3W73A 5A8NA 3GNDA 3BANA 2YCJA 2C0AA 2PDPA 5H6HA 3U4FA 3VA8A 3VAVA 1D8CA 1OT2A 3W28A 4JCMA 4JTQA 3A23A 3WN6A 3GXFA 1R2RA 1I45A 3L0KA 5CSRA 2NWRA 1G7VA 3NL5A 3LPGA 3GIQA 1UKTA 3LV5A 3MSGA 4GFIA 3M64A 4EAYA 1POJA 5CSUA 3REQB 3W2NA 5LKYA 1SMAA 4ALDA 1JCYA 1AQHA 1IQ8A 1OX4B 2CLKA 2RGMA 5J8LA 1C93A 1W17A 4M82A 5AHMA 3H2CA 4FHAA 1UQZA 1Z42A 2EG8A 3FHQA 4IUOA 2ABAA 3CUZA 2GK1A 4CNSA 2ZRZA 3AXIA 3O8AA 4Z42C 1KKRA 1KW1A 3L2IA 3NSXA 3WLJA 1E5JA 4FLOA 3L67A 1JDDA 2D2GA 1G1YA 1N2VA 3M0XA 1K3UA 4ZQNA 3ITTA 2JKEA 1GOMA 2ZICA 4IICA 3NPWA 4E6MA 4LT9A 1Y0EA 2WBKA 2ACRA 4XTIA 1RA5A 1E1CB 4M0XA 3PZTA 3V0SA 1EOKA 3IUDA 4H8NA 1XLJA 4TQTA 3VOJA 6XIAA 3TFXA 3E2SA 2ZA2A 3EWUA 3UYIA 2BXZA 2GSJA 2AMXA 5C9WA 1I1WA 1RD5A 1EXPA 4DLMA 4US6A 2F2KA 4M19A 3SEPA 1QO5A 3VIHA 2ANUA 3PWIA 5AFDA 3ITCA 3LB0A 4YTTA 2WJFA 3N2OA 1TCDA 1GGOA 4NZ4A 2F2HA 3RCYA 2X0YA 3ZT5A 4DBWA 3ZWTA 3DFYA 3W00A 4OKDA 4MTVA 5IXEA 4CQCA 1XYCA 1W2VA 1WB0A 3QV9A 4LALA 3B4YA 2PTXA 5AECA 2ZRVA 3LRLA 1RJQA 4NU7A 3W01A 5TIMA 3QC3A 2NT1A 2ACSA 3PB2A 1BF6A 1RVGA 3B8UA 3CZ8A 4O0KA 4JTTA 1EYEA 1P5BA 3VGHA 4AZIA 2WLZA 3PFRA 1RQHA 1FH8A 5GNYA 3NFUA 5C6MA 1EF3A 2XPKA 2ZRYA 2QDEA 2OVLA 3SCQA 1XD1A 4IPJA 3RLVA 1KXHA 4DXVA 3M7WA 1J4EA 1BXNA 3W1QA 4CUCA 3LMYA 2FGLA 2XN2A 2QW5A 1Q4NX 3MHGA 2HPMA 4ROPA 1P1MA 3RJXA 3N18A 3S5NA 1J0KA 5CC3A 2TMDA 1FWWA 2GDQA 3EDDA 2WCAA 3O6AA 1D2KA 1MEIA 5LZLA 1DWFM 3VO0A 3G0SA 1B9BA 4E8GA 2PDGA 2PBOA 2QCGA 2R91A 3CIXA 4B2DD 4E2DA 2ALDA 3NDYA 3WFLA 1W1B1 5HJXA 4AVNA 3CAWA 4US5D 1V3IA 1X8FA 1OWQA 5D30A 3P81A 3RLHA 3FLUA 1ZBWA 1XLHA 3VIKA 2FLIA 1QWGA 3G6LA 4DYKA 3QZ6A 5DXXA 4GC4A 1FKXA 3A5VA 1DHPA 2CZDA 3PSVA 1TZ7A 4WY0A 4CNOA 3WLSA 4O52A 1PTAA 1LL6A 3MWCA 5G1MA 2QEZA 3FGCA 3UWQA 1RLDA 1E3ZA 1VBUA 3OGRA 5DEZA 3UYCA 4M29A 4GX9A 1M1BA 3SECA 4N9EA 4ZXLA 3A9BA 3NQEA 3IGSA 1UR1A 5F4WA 1QBBA 1T8XA 2DH2A 3UCDA 3CUGA 4PC8A 2R1PA 3HMCA 4DI8A 5AY7A 4JAWA 3THUA 5T9BG 3SCTA 5E0CA 4PEKA 2V5CA 2BVWA 1GEQA 1CECA 3VD3A 3AYTA 2ZXQA 4U2YA 2R1LA 4XIMA 1BWVA 4KH2A 5CPLA 1G4SA 1E6XM 2O92A 4HT3A 5D2TA 1RV8A 4O54A 5E9XA 4Q6XA 3FY1A 2PRLA 7ODCA 4AFYA 3K4WA 4MMWA 4CNUA 3NXLA 1RQBA 3T6CA 1PUDA 2EPKX 1J6PA 3MI3A 2PB1A 1NF7A 5A2CA 3V1PA 3EPOA 1D7FA 4F48A 2XFRA 5H1WA 2R8WA 3UG3A 1W1A1 2I14A 1Q6RA 2FPTA 3WLQA 3F1QA 2PDLA 1UPMB 3MCNA 3A4JA 1BG4A 1B4EA 4QITA 3SGZA 1MI3A 4XTDA 1CTNA 1J01A 1FBAA 1TTQA 2IKGA 3Q94A 1S39A 3MT1A 2NVCA 3G1DA 4CGTA 4IQLA 5CGQA 2PDFA 1TZ9A 2FVMA 3IIPA 3A13A 1CX9A 1T0OA 3NPUA 4ZBCA 2HXTA 1LL7A 3BCDA 2DORA 4O16A 4S38A 4GY0A 4PMUA 3ITXA 5I03A 3NQ6A 4JDYA 3DI0A 5FF7A 2VFFA 5BRPA 1KTCA 2I9UA 1V0KA 2F6XA 3HA1A 3M0IA 4OZOA 3GXPA 5I07A 4HTBA 5I5RA 4ZSUA 4ZA0A 1S5VA 1PWMA 3BCFA 3UQNA 4L1XA 3KVLA 5A3HA 3HO8A 1F3WA 4EF9A 1SVDA 3LHUA 3CH0A 4XD4A 2GDUA 5F2LA 4WKFA 2NSXA 1M41A 2QV4A 2V5LA 5BRQA 4K38A 4LNYA 1WZAA 4NZ1A 2PF0A 3IIZA 1KNWA 5H91A 4FIQA 2Y0FA 1ZCCA 4S2CA 1V0MA 4DPPA 4CN1A 3ARXA 1VS1A 3RU8X 9XIAA 1QW9A 2Q8XA 1EIBA 5EFFA 1M6JA 4JTIA 2Q71A 1JPMA 1LQ2A 3BG9A 4MWAD 3CL8A 1JZ4A 1K6AA 1JUBA 4IQJA 2J8TA 2YA1A 2HK1A 2P10A 1KLYA 4UFMA 1U30A 4BF7A 4TVUA 3A4WA 3WLHA 3OQEA 3WQCA 4RR4A 1RP9A 1SW7A 4OTKA 3W2UA 4UTKA 1NFBA 3FYPA 2QDHA 1Q4WA 4JIRA 4LAMA 3CHFA 5FOOA 5K2ZA 4GQRA 3QKEA 3W7JA 2OG9A 3LLXA 3L21A 5MKGB 4JTHA 3C86A 2PU0A 4WHBA 1TSIA 3IIXA 4QQUA 4WSHA 3NZQA 3PPHA 3SBFA 4QE5A 1DVJA 1EWEA 1O6IA 1JL8A 3C0LA 1SFTA 1RY8A 4GINA 1LCOA 2C8NA 3EMZA 4L6HA 4GRSA 1K7FA 4AYGA 4IIFA 2ACUA 4JYDA 3P0WA 4J5NA 3QV8A 4QS5A 1K02A 1YLVA 4GNJA 1KLZA 4JNMA 2Y2WA 1H1ZA 3K1GA 4UTJA 4TMCA 4JQ4A 1EUNA 3W1AA 3HB9A 2QPXA 2E67A 2HS6A 1E9IA 4BEUA 2BY1A 4DQWA 1PWLA 3FFSA 1ISVA 1OVDA 4LVBA 4DI9A 4PB4A 5I6SA 3MSRA 1RCXB 4QJ1A 1DQXA 3L4YA 2Z25A 3Q58A 3RM4A 3GH7A 2WCGA 4ZB0A 3AO0A 3STPA 3O3RA 1Z8AA 4HNVA 1K9DA 1JAEA 3KLKA 1KFCA 4WDWA 4A8NA 4DBSA 3HIJA 1XF0A 4MUPA 1TVNA 5LYRA 4DVOA 3L12A 1WXZA 4LAUA 2YPIA 1FP8A 1KCLA 3EDEA 1J93A 1GOKA 1VCFA 1IXPA 4WX2A 5DBTA 3LCHA 3STFA 5K9XA 2ZUSA 5GJNA 1P6BA 2V63A 3C2EA 2AAMA 4NYUA 1VFTA 2XIQA 4CNTA 1QXLA 3PTMA 2XZ7A 3VDCA 1CGWA 4Q6JA 1NJJA 1FOBA 8RUCA 2DU2A 3V0UA 1T99A 4TX6A 2Q01A 1XLLA 1V0NA 2VVSA 3VKCA 1T41A 2VWSA 3OYZA 1J2BA 4W7WA 6ALDA 2I17A 2HNHA 3VUSA 3PG8A 3VOCA 3TYUA 4J3VA 3TK7A 4K7VA 1I8JA 3JVAA 3HURA 1JPDX 3A3WA 2QYGA 5F1VA 2AOSA 4XB3A 3W3OA 1Y5XA 2OLSA 3ZOAA 4ZODA 1ZENA 2H9AB 5I3GA 1VJIA 3L0NA 3GVQA 1UC4A 3TAKA 4LPCA 2VZOA 4H7VA 2PTDA 4K2SA 3G1FA 3P8IA 3PHAA 2FDSA 4P7NA 1NH6A 2P76A 3BW2A 2ZZ3A 3RITA 2A0NA 3EB4A 3B0UX 1BGAA 3WL0A 3FSTA 2E68A 2GK1B 3WNNA 4OOUA 5IBXA 3GTIA 3NQAA 4KCWA 1X1NA 4G7EB 2HTMA 4URIA 4FP1A 3G2GA 2DUZA 1BF2A 1IT0A 1BG9A 4QLLA 3KVJA 3REQA 1GVQA 3CPUA 3QTPA 1H62A 1H5YA 1QPNA 1VH7A 2GJNA 4A8IA 4A3YA 5KEZA 1EJSC 2YSWA 1V3HA 5CC6A 5K4XA 2VEIA 3QPYA 3LPOA 4W88A 3KZSA 3TU9A 2GUYA 4Y2WA 4PYSA 3TEVA 4MJMA 1OX5A 2YXOA 2EHHA 3MJYA 2VOTA 1TYGA 2A4AA 1NM9A 4GFSA 2QIWA 3HFTA 4PCPA 3NEVA 1X8CA 5REQB 3G18A 1C7SA 3EOEA 2V0TA 1IEQA 3G1SA 1C9WA 4HCDA 2CU0A 1T40A 1UR4A 3SIZA 4JQ1A 3JS3A 1VFOA 1N82A 1V77A 3AMCA 5LIXX 2E5DA 3P3BA 2PWUA 3UA4A 2P53A 3VGDA 3PJUA 1HKJA 2C1HA 1XIIA 4J3ZA 2XVNA 3E2QA 2F8QA 2BXVA 4K7YA 4XD3A 4H9MA 5LXEA 2WJEA 3OA3A 1OFEA 3E9AA 2PMQA 3THDA 4LCQA 5AHNA 2I9EA 3BK0A 1TV3A 3TYDA 4LYQA 4MSSA 3L7RA 4MZ8A 4XAYA 1YIXA 4TTUA 3ARSA 4FR1A 3GNXA 1POKA 3GTFA 2NWSA 2WZEA 4LF1A 3UERA 4QAIA 1FDYA 3N6QA 2PWVA 3WDQA 2NQHA 4C5ZA 4DWSA 8XIAA 1K70A 3N14A 3H4GA 1CXLA 1DIOA 2YL6A 1GKRA 4MY9A 1Z32X 2QDGA 4IJBA 5GJPA 1F3XA 1FWAC 3EX1A 4ROQA 2H3DA 1ECEA 3W7RA 3I3EA 1QASA 2DSWA 3E5PA 3IARA 1SJAA 3CASA 1H60A 2PP3A 4D6JA 1OYBA 4GIEA 4I90A 1KBBA 1TZZA 2QIIA 4GVIA 4OQVA 4K1GA 4K6AA 1FWEC 3UESA 3RPTA 4QBXA 1SSGA 1S1PA 3HQ1A 4KRTA 2PDQA 4WDUA 3Q4DA 3AHXA 4JFWA 1XFBA 4FX7A 1IEIA 3BJFA 3MI6A 2HK0A 4LW7A 1D3CA 1FH7A 3C2RA 4Y96A 4QG9A 5BMWA 1XC6A 5HMFA 3ZJ8A 4I6KA 2VDIA 4WY0F 3SUTA 4IT1A 2XSBA 4LUTA 4V28A 4PRWA 1GQIA 1US2A 2REQB 3K13A 3RDKA 1J79A 2A6NA 1IXNA 5JH1A 1CW2A 1P0NA 3DAQA 3VNYA 1K4GA 1A80A 2TODA 1E43A 3AWOA 3R13A 1KRMA 1QNOA 2ZCGA 4LUJA 4AY8A 4LBRA 3DHFA 1K7XA 4MY8A 1LUCA 5H8UA 5G1TA 3UP8A 2Z1BA 3AZTA 1YNYA 1JULA 3T81A 3UVIA 2DFAA 3WNMA 3AZRA 1DKWA 4AG0A 2OQYA 3AIQA 2Y4SA 4XZIA 4IFKB 4DO6A 4MDOA 3AXMA 1TA3A 4DJFA 1EGVA 3SSJA 3MDWA 3AYRA 1XLFA 3MP3A 2CHOA 2YX0A 2OGJA 4JTSA 4LAZA 4YVPA 2QNEA 4DUVA 3UPMA 4WVXA 1DP0A 3H54A 4G1KA 4RKAA 3P0XA 3WL1A 2H3BA 2ZZ4A 2HZGA 2JGYA 4QHRA 2XISA 3W88A 5I00A 5CSYA 2PTYA 4BF5A 3WKZA 3V5FA 1YW1A 3QW4B 4W86A 3GBDA 3MUCA 3NZGA 3M6DA 4GUIA 4ATLA 1EQPA 3SRKA 1JCNA 2OPJA 2Q8LA 1PZ2A 1PYFA 2IQTA 1F6YA 1L0PA 4FNUA 4DJFC 4FB7A 2B0MA 5FJOA 4XG1A 3CNYA 3F2BA 4B5UA 4EAMA 2QUTA 4O1CA 3FIGA 5CCZA 2WSYA 1OYAA 3BSMA 4E2VA 5BYWA 3POCA 4D6CA 1C29A 1AQ0A 1TV7A 3VIMA 2GLKA 1XBZA 3W25A 2OWXA 5GPRA 3M16A 2BMBA 2BVDA 1LZOA 1XLGA 4QFUA 4O0QA 3NDZA 3TA9A 4ACZB 3GXNA 1F6KA 4X3ZA 3UY8A 1IWBA 3GBEA 1THFD 1N7KA 4YJ5A 2D2OA 5D02A 2EG7A 5BOOA 3B0VC 4OT7A 1H1YA 4DWSD 1W3LA 3WQGA 3WFAA 2F9RA 3ZMRA 1LQ0A 4NZFA 2QUVA 2J8FA 3BGAA 1H0GA 2INFA 3HZ3A 4ZOCA 1U22A 3T09A 4Z2LA 2VX5A 4LAKA 4W8LA 1XX1A 1UD4A 1TFVA 3VZYA 1HN1A 1OJXA 3LCIA 1GWJA 3GFZA 3LTYA 3TUUA 1DPMA 1K9FA 2LLEA 5CSSA 4A8RA 3RMEA 4PBEA 4M8UA 3NQ8A 5HJYA 1RUSA 3W9ZA 1OIFA 1QNQA 3GX9A 1UPPA 4RXFA 4ICNA 1R30A 1K4HA 1MFUA 2XUCA 3UEQA 3BSGA 1J0ZA 5G2IA 1MUWA 2VUYA 1NSJA 1HL2A 3QGAC 4PMZA 3VM7A 2A3EA 1M7PA 1WZLA 1UC5A 4PMJA 5LA2A 4O0ZA 5G1YA 3PB0A 3W74A 4BF9A 3WFZA 3WF0A 3M5ZA 4DNMA 3SCUA 4FLQA 1LROA 3B3DA 3STEA 1B57A 1BQGA 5D9PA 4JZ5A 3BMWA 1N8WA 3TMLA 4HYVA 3N15A 3ARUA 4DM1A 5IHRA 5G4HC 1YPIA 3CV2A 4GE8A 5LNWA 1KM4A 3QM3A 4WGXA 2OQLA 4PMYA 1D9EA 5L6UA 1AA1B 5I3FA 3RLGA 2P88A 3KOXA 3IAPA 1H7RA 3BG5A 5GJMA 3MHUA 1ZBKA 1J12A 4S3JA 1HL9A 2F84A 4F0MA 3M0VA 1NQKA 2DJXA 3L23A 2QAPA 4GI8A 3IS4A 2XVPA 1E1FA 5I23A 5B7YA 3W72A 4KMQA 3M1ZA 2C3ZA 1R9XA 3DFOA 3SCPA 5HNUA 1DEDA 1VFSA 4G1NA 1MMFA 5C9UA 3LQLA 4NJIA 3ZIZA 1XR2A 1ZJAA 5LNRA 4G8TA 1IR2A 3KRZA 3W2JA 2G4FA 1ONXA 1Q65A 5JIPA 3MDUA 3MSYA 3S2NA 3W6MA 1VEMA 3RO8A 2PU1A 1JUKA 1E71M 1RPXA 4NI3A 4HJFA 3V1HA 1PZ3A 3WF1A 1VIWA 1FWTA 1FWIC 2C13A 2J79A 1UMLA 4H01A 3QMSA 1GOIA 4MADA 4DZHA 3FVDA 3NQMA 4Y8FA 4KETA 3RR1A 5TAOA 4PTNA 3N13A 2J7HA 3NO1A 5E70A 2CZEA 3E0WA 1AJ2A 3D46A 4Q4PA 4EKJA 2V38A 1XBVA 5CLWA 4CCDA 1K8CA 4N4PA 5CPSA 4IM4A 3U5UA 1VFLA 3MWAA 4HZMA 3IJ6A 2YA0A 3ERPA 3U8GA 2CW6A 2BASA 5KSWA 3QBUA 2CIPA 5KMYA 3R0UA 3W02A 2OEJA 4ZO9A 3B8SA 4HK5A 5TNVA 4EXBA 1WA3A 2NSOA 3SCRA 3QQ1A 4HU8A 1ZTVA 1EPVA 4BS0A 1TVLA 5KTLA 3WZ0E 1LF1A 1PX3A 2DEPA 4U4MA 1BAGA 1HP5A 2BHYA 3AHYA 4J35A 3QGVA 1LP6A 4WK9A 4INFA 3G1YA 3WDHA 4Q7NA 3PTKA 5LIUX 4KEUA 2WZHA 1FWJC 4U2ZA 5FL0A 4FNRA 2PLJA 4HSOA 4XBJA 3N2TA 1TO3A 4Y9NA 2V3DA 5BNKA 4QE1A 5EL1A 2PODA 4PL1A 2Y8VA 4W9TA 1EX5A 1H7WA 5GNXA 1O5QA 4L1WA 3GO2A 4C7FA 3AC0A 4PL2A 3LM3A 1HNYA 3N04A 3KLLA 2PZ0A 1SJCA 4DWSC 1SO4A 4JIQA 4DUWA 1QVBA 2E3ZA 3MVTA 2QHAA 3WJZA 3W27A 3GU1A 4R88A 1GVIA 4HIBA 1DWJM 3C52A 4JIPA 2XVKA 4DZ5A 3T8QA 2GWGA 5IHSA 4ICCX 3NJ3A 1OCQA 2PP0A 4NILA 1TRDA 3CLMA 1C8VA 3KS5A 4F2TA 3T8LA 3WLPA 4NJJA 5C5YA 3W37A 1X6UA 1TWSA 3FK4A 1F4HA 1K7EA 1W3JA 3HN3A 2ZZ6A 3CAVA 3MUAA 1ZHAA 4KEVA 1QI3A 2CHNA 2VEGA 1KTBA 1A4MA 4LUSB 2GL5A 1QOPA 2DZBA 2MUCA 1W91A 2FTWA 4RV8A 3DHUA 1KFJA 4IJRA 3WUBA 3TTEA 4M1RA 5CG7A 3KW3A 3RGTA 4F66A 4HYRA 4HNLA 2FTPA 5E93A 1S3TC 3NO3A 3W7QA 3OLGA 5D2WA 4IJCA 3U6WA 2WMIB 4Q4MA 3UG4A 4JOMA 4GNKB 2JBMA 4KEZA 4HNTA 3GNPA 2IQDA 4JTFA 4EWJA 2BFGA 2OWWA 1JXKA 6TIMA 1X1OA 1XUZA 3FYOA 1UUQA 3LBOA 2PURA 3F4VA 3ITOA 1AH0A 3U3HA 3AOFA 3CU2A 1SJBA 1KM5A 2VR4A 1SYTA 4BKNA 3PFMA 3ITVA 3W53A 3VNDA 4ORIA 3QXBA 2DIJA 2UY2A 4NRRA 1UWTA 4GIRA 1PHQA 2P0IA 4UQDA 1IZCA 4PFMA 1PO9A 3I3BA 2GVEA 2A21A 1XIBA 2QCDA 3IWPA 2RDTA 1XLBA 4XZHA 5HAOA 2QGHA 3LZ3A 1G94A 4FXRA 2QUUA 2DZXA 1ZZMA 3BLFA 4D9PA 4QGCA 2NUWA 4DJEC 5FD0A 4ZQOA 3O6YX 1MUMA 1XIFA 2C1IA 4EX4A 5CJMA 4GIYA 1FWGC 1KB3A 2E77A 1VENA 3AHZA 3DFQA 5CPQA 1R2SA 3VNMA 4C6LA 1UP2A 2Z7KA 3DI1A 1YNPA 4HMEA 4JX4A 4FPSA 5ABFA 3F5JA 5C9RA 2PBGA 3EEZA 2X0SA 3M5XA 4JHMA 4PR4A 2IXUA 4HZ8A 5HMSA 3GHUA 7CGTA 3H8AA 3VNIA 3IVTA 1J0YA 2VUNA 3VTRA 2FHFA 1YTEA 4Q8OA 3L5LA 1J9YA 4HKPA 3WH9A 1XG3A 2OELA 3ABQA 3NL6A 2IPGA 3TVAA 4RZ6A 2HBXA 1KFWA 1GW1A 3VFLA 3EX6A 4UUIA 4HA4A 3QY7A 4V2XA 1HKIA 3MBDA 2CBVA 3TJLA 4FSAA 1I4NA 4DAIA 1PHWA 1GJPA 1KC7A 1ALDA 3W76A 5IM51 3W29A 1W3NA 2VNCA 1HFBA 2CZFA 3PUDA 2HE5A 3O16A 3Q45A 3WJSA 4JY9A 1P4CA 4CQBA 3VILA 3PC0A 2PFHA 3HV9A 4GHRA 1ODUA 2G37A 3L2MA 4IL2A 5CBBA 4RE4A 3B0YA 4BY3A 3MP5A 4S3BA 2A3LA 2VGFA 3HFYA 3E0FA 1US0A 3UJRA 1WO2A 1GQJA 2B4GA 5EMYA 5CPTA 1S2VA 1O4UA 5JBEA 3NQVA 4BCEA 1O68A 5LGXA 2YXXA 3PF3A 3DFTA 1ZAIA 3JZEA 1YYAA 1P0BA 5A6MA 2ZRXA 1F73A 1H50A 6TAAA 4B2DA 3CO8A 4QISA 4AVOA 1V3KA 2XH4A 1E0TA 1Q6LA 1W8SA 1UP3A 3TE9A 1ZP4A 2VZUA 4IXXA 3SW6A 1V6TA 3N3TA 1OCNA 4Q7BA 4Q4KA 3H7UA 3DZ1A 4WIWA 1UBSA 4HNCA 3VKJA 1CYGA 1RPKA 3ABXA 3R0DA 5AC6A 3ZJ7A 1BYDA 2OSXA 1IEVA 3CLWA 1S5TA 4REQB 3TTQA 3GZ3A 1Y8BA 4OBTA 3VE9A 1XS2A 1Q6DA 3DBNA 5CKSA 5AB3A 1WQ5A 3NQBA 3JZUA 2IKJA 2WHLA 2XFWA 5K4ZA 2G8ZA 2YCKX 5C9ZA 1M7XA 1EFZA 4HSHA 1F3TA 1QPRA 3P74A 4MNJA 2NX9A 3VUPA 3VIJA 5FESA 2VFGA 1Q6GA 1FWSA 4L1GA 3VGBA 1QU4A 2Z2AA 4U31A 4W89A 3G8RA 4C6IA 3MS8A 1DE6A 3CWOX 1Q7MA 2ACQA 1X39A 5HWMA 4WF7A 1HZYA 3UNDA 5MF5A 3VD9A 1EUAA 5DT5A 1J96A 1XLEA 3RPDA 4JQAA 4QCFA 1TPVA 4O13A 5C54A 1EWDA 1QNSA 4JKLA 2W0UA 4JICA 1JCXA 3B04A 1CT5A 1R3QA 5FIPA 1H7PA 3IACA 1CGUA 3L0GA 3WQDA 2CITA 1AMKA 3UU0A 3NAVA 3W7IA 5D38A 3ARTA 2G95A 2Z00A 4WSJA 1GVEA 4UCGA 3SRDA 4AVFA 1SUXA 3T0BA 4IIHA 2PS2A 2FVKA 2WC7A 4NX5A 1W1IE 3HMJG 3AS2A 4MZ1A 2PPGA 3ARZA 3CZGA 3E49A 1DJNA 5HXMA 4S3KA 1UIPA 2W79A 1LG2A 1OZQA 1Q45A 3N4EA 1GVRA 1G9HA 4L9ZA 3N2BA 2VCBA 4GCAA 1F07A 5AYZA 5CXPA 3B9DA 3T42A 3W1LA 2E8YA 2ZUWA 5HANA 2F38A 1VAHA 2Y7EA 2WNNA 3KWSA 4IIGA 1CCWB 1AQFA 1F4AA 4AD1A 4Q7IA 4POCA 4YHGA 2ZUMA 4WDXA 5FJIA 3FXGA 3LN3A 3CHDA 2FH8A 4HMCA 3QN3A 3RRAA 3TNBA 3CPGA 2XH0A 5FF2A 3OLEA 4M3PA 2EKGA 2BP1A 3S9IA 4P5UA 1PKMA 1MNZA 3B9OA 3NM3A 3VNKA 3TN6A 5JXQA 1LTDA 2PP1A 4QSHA 4LS2A 2OZ3A 3G8EA 2XSAA 1VEOA 1NVMA 1MDLA 4WJEA 3RUBL 2BODX 3BW4A 2D22A 4O17A 4TXEA 3BZGA 4JTGA 3MKCA 2WMIA 4YVXA 2FZ8A 4DLFA 3WENA 4IPNB 2WMJA 3CYJA 1W32A 1EBHA 2J24A 3V3WA 1PKLA 1FWBC 4DYEA 2DUAA 3AUOA 1ITUA 1QW7A 5J5DA 3L5MA 5E9AA 5DANA 1VGAA 4AZ7A 2AKZA 3QC0A 2OMAA 2NVAA 4GYKA 1Q6OA 1RBAA 2QMJA 3EGJA 3R10A 2IKIA 2ODOA 1UJPA 1JF5A 2PDBA 3A4AA 2A79A 5IFPA 3I10A 1XCXA 2TYSA 3M6YA 1AUSL 4HU4A 1Y65A 3M41A 3CUHA 1E55A 4XAPA 2Y5EA 2PTZA 1BFNA 1LT8A 3ME3A 3DYMA 1R2TA 4QNWA 1HGYA 1M3UA 3MMDA 4HHPA 3E5BA 1B3XA 1FFRA 4AX6A 4JTCA 4UTWA 3C61A 2VC6A 3L5AA 5AVHA 4XAGA 1E6PA 1RHCA 1KQYA 3WD4A 3GVRA 1GQKA 2PE4A 3DKJA 3AU6A 5C70A 3W1MA 3V36A 4FOJA 1R87A 4D6DA 2KZHA 4AF0A 1SFLA 2ICSA 3SCVA 2CZ5A 1TWZA 3U9IA 4PA8A 2Y1HA 1BTCA 4IX0A 3H7VA 1KXVA 4FX8A 1W3IA 1F3EA 2BNJA 3WQWA 1TPWA 1VB9A 2PDUA 3WNPA 2BVYA 1GTEA 4IP7A 3RX4A 1JXJA 3W1TA 3WQEA 3DYPA 5U4NA 1W5OA 3GXMA 1PVNA 3LD5A 1HO1A 1O1HA 1XDMA 3VOHA 4YLWA 4PMXA 4O11A 1WDQA 1AW2A 3PZMA 2ZE3A 1XBXA 1JDFA 4EVZA 3OVGA 5HMEA 1IZJA 3CV1A 4UQEA 3GIPA 3R79A 4N0RA 3ZLGA 2WJDA 3RF9A 3LUTA 2A3AA 2W4XA 4JX6A 1FCBA 1KV5A 3S0CA 3G0UA 3WDJA 1PBGA 2E25A 3I65A 3AIRA 1I2QA 4B5NA 4O1AA 5D2YA 4EXQA 4A4AA 3NOEA 1DJZA 3KBMA 4C6QA 2OX4A 1B3YA 5E0KA 4MDPA 3WF3A 1EHNA 1C90A 3A12A 3KEHA 2VMFA 2FZDA 4NQ1A 2HNEA 4KT2A 5HULA 1FCVA 2VGBA 1QI2A 1KM1A 4IPLA 1OFRA 4FF5A 2E0PA 4AH7A 2A3BA 3LSBA 1R38A 4M56A 3KM8A 3BLOA 4QJ3B 3M0MA 4H9VA