3WBZA

Crystal structure of c. albicans trna(his) guanylyltransferase (thg1) with atp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
266
structure length
244
Chain Sequence
NSKYEYVKLFEKENYLLPDTYIIIRVDGKGFHKFSQFYEFEKPNDLKALQVMNSAAEKLMSKYSDVMLAYGDSDEYSFLLRKNCQLYERREMKLTTLFSSLMSTYYMYFWSQYFPDKPLHIDHLPNFDARAVLYPDFKHIRNYFSWRQVDCHINNLYNTTFWNLVLKLKMTPQQAEQRLMGTVASDKNEILFKECGVNYNNESEMYKKGTIIVREFENYAELKIYHVDIINDDSWWKSRPWLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of reverse nucleotide polymerization
pubmed doi rcsb
source organism Candida albicans
molecule tags Transferase
molecule keywords Likely histidyl tRNA-specific guanylyltransferase
total genus 88
structure length 244
sequence length 266
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.79: tRNA(His) guanylyltransferase.
pdb deposition date 2013-05-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3000 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3wbzA00
3OTEA 3WC2A 4KGKA 3WC0A 3OTDA 5AXLA 5AXKA 3WBZA 5AXMA 5AXNA 3OTBA 4KGMA 3OTCA
chains in the Genus database with same CATH superfamily
1FNOA 1JK9B 2JVRA 5JUMA 2VIHA 1FJCA 1RT6B 2OUGA 5ITHA 2EBGA 2QL7B 4R5PB 3KUHA 2DO4A 3M30A 3RBXA 4A8YA 3HFKA 2EFGA 2B43A 5IM0A 1Z4UA 2AJFE 3P8BB 2VJUA 4UUXA 4EO8A 1UVLA 2NS1B 2VG6B 3MEGB 4U8YA 5IS2A 3G2XA 5FJ4A 4CNZA 3G82B 1FKPA 3MM9A 2R7QA 4HL9A 2J6UA 4MTPA 1NK9A 3J7A1 3K57A 4A47A 3U1NA 5EDWA 1N34J 4FKYA 2ZH6A 4AXIA 3RZAA 2DXFA 4ZVTB 4WFXA 4FS2A 1PYOB 4MYUA 2MY8A 1RTIA 5CYMB 1ELOA 3GFYA 4K7QA 2VFUA 2QGFB 2HFVA 3TJ9A 2CZ4A 3W64A 2CAJA 3UN5A 2VJVA 1YK9A 3A3NB 3I0RB 4J9RA 3GYXB 2UUBF 4FBTA 5HBMA 1S9FA 4DU8A 5KFWA 1UPMB 1QVGR 2UU9F 4ED6A 3MR2A 5A8KA 5DM6Q 4AUKA 2B9XA 1LEOA 3FFIA 2H4WB 3CD7A 3J81j 3GTYX 3NS5A 1OMSA 2DNLA 3DHWC 4EFAC 1LWCA 2DD8S 4KH0B 5HAOA 2FHKA 4ZA1A 2MKHA 4DLEA 5KFSA 2CRLA 1SVDA 4DL6A 3KHLA 2KRRA 4OYMA 1F60B 4QYRA 3OL7A 2MLZA 2OEKA 3R5AA 2R3VA 4ZJQA 4F4AA 4LF6F 3I56S 1SC6A 2IMOA 2YQ1A 4ERDA 3H2LA 1GMUA 2JLFA 1NRKA 3M6WA 3FCVA 4UTGA 3PIPQ 2L41A 4IOCQ 3EDRB 1QVFR 1IKXB 2MPUA 4UUWA 4RBUA 3IR5B 4ZPTR 2MKIA 3P6YC 3H4BA 2XO6A 1BWEA 5KFNA 3HSJA 2MDAA 2JLEA 4NOHA 1UJ5A 1AZSB 1BY9A 2H65B 3R7NB 2F4VJ 1Y3JA 2WW8A 1SJQA 3E8OA 5C25A 2BQUA 1RYRA 3SFUA 2XGPA 2AEMA 2DIVA 1FDNA 2VZ9A 3U7JA 4XDCA 5DGAA 1APSA 2W25A 4LRAA 2DR6A 2FJAB 5KFHA 2YBVA 2CQ1A 3OXFA 4FVMA 5A8WB 4ZITA 1DLOB 4M95A 2HHUA 2NYIA 1AZSA 2HBZB 1WC6A 2MKCA 2DEIA 1FTCA 2XG8A 2NXCA 4NWBA 3BYRA 3ILOA 1PYTA 1SBRA 2NUHA 3NCPA 3OFEA 4YFUA 3F41A 3TRGA 4DV2J 4X66J 1VQNS 5KT6A 5I3UA 3BJYA 5D4LA 3CC2S 1UVKA 1CJUA 2BUNA 3PYFA 1S1XA 3TO8A 2H9ZA 4X4QA 1Q8IA 3MMCA 2HS4A 3GR0A 2G0CA 3GPAA 4QIWD 4F2RA 4B17A 2XGQA 2DPJA 5IWAJ 4EYHB 4FF1A 1ZAWA 1LWXA 1UP1A 2D69A 1XR7A 2Y3YA 4DUZJ 1NNDA 4DSIA 3QIPA 3VAHA 2F8MA 3CF5Q 4FXWA 1O8BA 4M5DA 2HVIA 1PJ6A 3LF0A 5I42B 4ZVRB 4OL8A 4RO0A 3CD5A 3KLIB 4DQRA 3C19A 3PFEA 2CJAA 3FBBA 3R2DJ 1XIQA 4NXMJ 4B9NA 1WG4A 1PG5B 1ZM4A 1RHUB 1XK8A 1IBCB 2ZBCA 2IFXA 3BO4A 4K4XA 4UQTA 1UKUA 1ZA2B 4E98A 3GFZA 4TYAA 1S6QB 4QIFA 4N47A 2KN4A 2HLUA 2VHGA 2IA0A 2A0FB 2N4CA 2YNFA 4KGKA 2C28A 2DHXA 3DDKA 1A7GE 1YJVA 4Q2MA 2DNYA 4M63A 4DQIA 3VAFA 1DTQA 5BR8F 4DPXA 2MZ1A 5KTQA 1R6VA 4BLGA 5C42A 2FJVA 3G82A 2FJBB 4PYAA 4LMZA 1EQMA 2K06A 3CWJA 1O51A 2Z2ZA 1GH8A 2MKSA 1GTHA 3DLJA 1RKJA 4AL6A 1B0PA 1BQMB 2HMIB 5D77A 4BHQA 1RBLA 4KAIA 4LFAJ 1XNRF 1H98A 4QWAA 1S9GA 1NPKA 2HK3A 5LM7E 1TKDA 2PFDA 4O3PA 4QWDA 1BUXA 2QYGA 4CYUB 3AD9C 2CJQA 3QRPA 3I0SB 1GMVA 5J2MB 1XMBA 3IWLA 3UDLA 4DXLA 1WDTA 4DX6A 4ZN1A 1NMEB 1IBLF 1OQ3A 4YHHJ 2RF2A 4QWEA 2LFVA 2WK4A 4WK3A 4RWXA 3AJ2A 3BO2A 3UW1A 1FHTA 3BGFA 5BR8J 2F40A 3TP2A 4UZBA 2ZDOA 4MK7A 1U02A 3MEDB 3TVKA 2CQ3A 3DYAB 4OFZA 2MYFA 1WC5A 2AW0A 4F3MA 2DHAA 4C8YA 2FHMA 1J5EJ 1CJVA 3BR8A 4LR8A 1T0TV 1ZYQA 3HO1A 4LSNA 5LSRA 4OHYA 3Q8UA 5HLFB 1C0TA 4XIUA 1RWUA 5DZ6A 2YNGA 5FLXY 1D1UA 1S1VB 1F5BA 4IFVA 3GONA 5HVGA 2M88A 2YPZA 2UUCJ 3EPIA 2AU0A 5I42A 2K3IA 4HVZA 1T9YA 3MD1A 1RT7B 4DV0F 3PACA 5ETQA 1SL1A 1IWGA 4Q5VA 2O5DA 3CJSA 3MAAA 4X65J 5D0HA 3NGRA 2RDIA 5GAEI 3CJTA 3H42A 2D3OR 3HSDA 2NZ4A 2E1CA 2KYZA 3ZZRA 2J7UA 4PR6A 4EUVA 3HVRA 2VQFF 4GKJJ 5L9NA 2KT2A 3OT9A 6FDRA 1R43A 3QJJA 2OIHA 1FX4A 5G0RB 1FXRA 4CM0A 4J9KA 1TKZA 5G4DA 4DR7F 4PWDA 3CT9A 5I3PA 2ZKTA 8ATCB 2ZM6F 2A2DA 4LRBA 1FWPA 4HLBA 1U0HA 3RG6A 4DS4A 3H2UB 4C4WA 3DGVA 2O67A 4ZN3A 1HNZF 4DX8H 1FRHA 1M1HA 2RDJA 3NGSA 1YHQS 4N5SA 4B3TF 2JNJA 2V4JA 2V2VA 3AB2B 3P96A 4JOUA 4KY3A 3JTNA 2LLZA 2GQCA 1VQLS 4DSEA 1S97A 2VG7A 1VK3A 4Y2KA 5D0EA 2F4VF 2YWEA 2B4UA 4LF1A 1R89A 5G0RA 3TW0A 2EBEA 5E3CA 2YX7A 5I3UB 4JI4F 2JH3A 3D0GE 2YKAA 4W98A 4JV0A 1U26A 4WZQA 1V5IB 2CG4A 3V4MA 4PWWA 3N4WA 3DRRB 4CTAB 3MPUB 2JVOA 1DQ8A 5HJXA 3OSNA 4I1TA 1RT4B 2L9WA 3BGRB 5KT4A 1LWCB 3MDFA 4RNMA 4UOGA 4JV1A 5D3GA 2B9EA 4Y6IA 3QATA 5KFLA 1F9EB 3PDNA 3SIPB 4A48A 4ED1A 2DHSA 2W4CA 2Y1RI 4LUBA 1SQFA 1TK0A 3NMRA 4P9SA 3LWMA 2FY8A 2L3MA 3C14B 4ECTA 3J7Z5 2I2YA 3KTQA 5HBMB 1RAHB 3ZNUA 4GVBB 1EB0A 1BQNB 1WOOA 2EI5A 2M52A 1TZ0A 2W2MP 3VR1A 4CLTA 4I69A 1H38A 2Z2YB 2VPXB 3MEDA 1FO1A 5A6WA 1LW2B 2G1DA 1R8HA 2HS0A 3ZZZA 5LSLA 1YJWS 1SJFA 1MSWD 1EJ7L 1S99A 3MCMA 5BYSA 3L4BC 2B6AA 3N9UC 2EFVA 3K8WA 3R9LA 3S7RA 3WQPA 3OUYA 1VRUB 2C3OA 2QA4G 3BYPA 5FLXU 5FDLA 3RRGA 4RKUC 4DFJA 4Q2LA 1SUQB 4OYZA 4P52A 1TTHB 3S01A 3C46A 2XBPA 4ZPBA 4ZOSA 5LL6d 2GC8A 4CYUA 4F4XA 3BSCA 1TQLA 3GJQB 5HVHA 5J1EB 5KAKA 3KWMA 1U09A 4NCGA 3CJKA 5JMNA 3K5NA 4F4YA 3M8QB 2WVFA 1UA1A 1S72S 3PNIA 2C2NA 4NYPA 4YY3F 1IVZA 1MMDA 4R5PA 2RVJA 3G71S 1N5YB 5EN1A 1X4DA 3DU5A 1SV5B 4WU2A 3TNVA 1TV6A 1ZBTA 2PFFB 2YWGA 5D4NA 2HHHF 1R0AB 2W4PA 2B4PA 2QYCA 1VRUA 2M2BA 3GIRA 4NRUA 3QZ8A 1HBMB 3NCQA 4CLYA 3UQSA 3I6PA 2IDLA 4WU3A 4I7FA 4UF4A 1U4BA 2RU3A 2IC3B 3MGJA 5HJYA 1VMBA 3U1MA 3OHAA 1PC4A 2W9AA 2OEMA 5EUHA 3TA2A 4C3MA 4DL2A 2E9TA 2DGXA 1LK7A 3M8PB 4GVBA 2CQ4A 4IOBA 1S9EA 2YQ0A 5HROB 3VAIA 1RISA 3SQOP 5K8NA 4DI6A 2W7PA 1BQXA 4YQWA 2HVEA 5ETPA 1QLNA 1JXEA 1YVFA 3NOCA 1N5QA 2ZVIA 3FC9A 2LECA 1RT4A 3BGRA 5KT5A 4M5NA 4DUYJ 5J2NA 4A8KA 3CD6S 1F5CA 5A0YB 1C1CB 2OFHX 4FZVA 4FYXB 4G1PA 1VQPS 3TJ8A 1AUSL 2IAJB 1TUGB 1Q86T 2H5IB 2RJZA 4DJBA 2I6WA 1HPZA 4OYIA 4RNOA 3CJ3A 3Q83A 2XI3A 3K5PA 3M8ZA 3R6LB 4U96A 2RKIB 1EHWA 2XMJA 5CHCB 4ILMA 1JLQA 1OJ4A 1RADB 1UWBB 1RHJB 1HHQA 4DPTA 1ZPWX 4OZ2A 1NBEB 2JFKA 2DR5A 1JKHA 5IFMA 5GAHU 2MGZA 1VQSA 1KOOA 4CLWA 1VQ9S 4RR5A 4BBYA 2R8IA 4DL4A 4P75A 1HNIA 1NDKA 2BJ8A 2WRMA 4DR1F 2V5HG 3M2UB 3OXGA 1RHRB 2HZAA 3C6UA 1HLWA 1S7IA 3GSDA 4MMOA 3B78A 3M2RB 2CADA 5KFTA 2RUGA 2H51B 2E7WA 1VLOA 2ZWPA 4ATNA 3Q8RB 4N56A 3HZEA 4BC9A 3CCSS 3M7VA 4RW9A 3LTOA 5KFPA 5LXRA 5DLGA 4H4KC 1PSDA 4IG3B 4LFCJ 3T5JA 4OLOA 1Z2LA 2DHHA 3MMAA 4DHVA 3SCKE 4LF9F 2D3ZA 1HA1A 2LVWA 2XSJA 1MU2B 3CW2C 1CG2A 5ETNA 1R8CA 3RGIA 4EK2A 3PX6A 2WCXA 1N32J 2JHEA 5DDRC 3G6ES 1NK0A 5D8HB 1HQ2A 1YRUA 2EEYA 3SQGA 3CJ0A 1O0PA 1FERA 3BQ1A 3DFEA 1KDNA 2LXUA 2HHTA 1OQ6A 4KSEB 1IUJA 3A3OB 2HFUA 4QYZJ 4WZMA 4C3LA 2EFQA 1EX8A 4JP8A 1YBTA 3EXCX 4PEOA 1HR0F 3N6LA 1XN9A 2HIQA 4AQYF 2ALZA 1TKTA 4K8RA 2IC3A 2RS2A 2X1FA 2OPQB 4W4MA 3T19A 1LOUA 1T11A 2BRKA 2P9EA 4OQJA 2Y1IA 4AT1B 1T3NA 3FJ2A 2R2UA 3PG9A 2MZQA 3DRYA 1KKHA 4A8OA 2GHWA 4ZHRB 3ZFVA 1RT3A 3GIMA 3Q22A 4ENOA 2GVZB 2PSZA 1X9MA 2CPYA 1U6FA 1SV5A 4PKDB 4B3OA 2E1PA 2GS8A 2WSFC 2UV8A 1H6KX 2J7KA 2FJWA 2ZH8A 3TWZA 3IFEA 4JUZA 3M8QA 5DETA 3HDSA 2DNKA 1WI6A 4J9UE 4Z37A 5ETTA 1NHVA 3FCWA 1XJWB 2QJ3A 2QLFB 4OLPA 5IXUA 1WF2A 1FJGF 3KJVA 4B08A 2IJFA 2J8AA 3AA8A 5KG7A 5DGBA 1I94J 3DGPB 2VFRA 4EGLA 1DQ9A 2L9DA 2NCKL 4ZHRA 2OLWA 4DSJA 2R7XA 5F8LA 1B70B 1YX2A 3TI0A 2A1BA 3TAMA 2UVUA 1VQMS 4DR5J 2J9EA 2OPQA 3POTA 2LXIA 3MURP 1F2HA 2CQCA 3I87A 2OD4A 1BQNA 5CYJA 2KT3A 5ETLA 2H5JB 2BOPA 1RE1B 1NB7A 3MR6A 2F9DA 1KFSA 4MFBA 4WP8A 1V3RA 2XS7A 1KP6A 4LF2A 1ZPVA 5KFAA 5HMZA 2ATCB 3DXBA 2CJBA 3EE3A 1VHIA 3BBCA 3CDUA 1TELA 2HNZA 3IAM9 2ATLA 4G3IA 1K1QA 1RTJB 1S1WB 2A2CA 2M8DB 2KHCA 3ZZTA 4B9TA 2MLXA 3B4MA 2DNZA 5E41A 1PBUA 1WI8A 4JI5F 2KFZA 3AHPA 4NEYA 2NYHA 3ENQA 1T9XA 1W2IA 3MMAB 5K20B 3HJVA 1TFYA 2HSEB 4WFAQ 4NE9C 3M6VA 3RR7A 3ZTPA 5CCLA 3IWNC 2HNDB 1ZOTA 3GCXP 1R7IA 1BHNA 3MTKA 5CABA 4FF4A 1GAOA 1QAXA 3K5MA 4ECRA 1RWVB 4ZVSB 4DZDA 5EGYA 1CS4B 2FVPA 1IQTA 1DHMA 3A12A 1KEKA 3A8EA 3V4IB 4USUA 1AXQA 1C4CA 1LW0A 5CZVA 4WTOB 1TK5A 3ILLA 4KV8B 3LP2B 1C1BB 4JI6F 1L5UA 4NYOA 1MLAA 4Q7AA 4QIGA 4ZVOB 1RK8A 1CC8A 2DGUA 2RE1A 2Z4PA 3EZUA 3C6TB 1IKXA 4GO5X 5A76A 2BJ1A 1G7CB 3TUIC 4TU9A 5L1JA 2GHPA 2B56A 3QWUA 3CCES 2D3O1 3T41A 2UUTA 4ID5A 2XO7A 3V6JA 4X4TA 2LKZA 4OJ1A 1HBOA 2FYXA 4DR4F 2IAJA 1VIOA 3PO4A 1KRPA 2W24A 2LQ8A 3M05A 3NG8A 1OY8A 1RTHA 4ANEA 3J7YI 3KLVA 2EC0A 4LF7F 2W2OP 2DEJA 2CNOB 1RTJA 1S1WA 2Q1LA 4XAKA 2AGPA 4DV7F 5LOQA 3W60A 3TAQA 3HM9A 4IH7A 3P5TL 2E44A 4DL5A 2G2OA 5GAHI 2XTJP 3I55S 2B3TB 5J1PA 1IWAA 2ZHBA 1S9EB 3WIVA 4LR7A 5CCMA 5LJ3Y 1N5VA 2AIRB 1DRZA 4DG1A 3DYAA 4M8LA 3OV7A 3CCWA 4K50A 1UJ4A 3POTB 1TL7B 4MIAA 4TY8A 3KLEA 2MZSA 2R7OA 3MFIA 2BE7D 1RSCA 2CJ9A 2UP1A 1GMWA 2HQDA 3K89A 4CNYA 3BGUA 3NS7B 1RGVA 3D67A 4LF4J 3UCZP 3SSSA 4DR6J 3H8YA 2ROGA 3B82A 1NJWA 2GIRA 2ROEA 3MEKA 4MIWA 4PXDA 3I0SA 1TV6B 4WIQA 3TUPA 3VQSA 3KDNA 3D1OA 1M5OC 1U2RA 3JYTB 1J5OB 1KONA 3C16A 3MMBA 4J9VA 1HFEL 2HURA 3LPYA 3HMJG 3G8SA 3T5LA 2B4OA 1RT1B 2CA9A 1ROFA 3H20A 4CO1A 4H54A 4LSLA 4OYWA 3ZO7A 3KLHB 5DG7A 2Y0SD 3NAIA 2NPFA 4CLPA 3D0IE 4ZP9A 4YB1P 3Q23A 1NK7A 2IA6A 5E0OA 3CULA 5F8NA 3J81U 4WKYA 1U45A 4NLGA 5GAEU 4JV5J 2UXDJ 1WG5A 2ZH4A 5E3QA 1X5PA 3NOGA 1FDBA 2L9NA 3BKUA 5HMYA 5BYQA 3MI7X 3QFHA 3MAQA 4X65F 2CPZA 1FF2A 3MCOA 2UV8G 5RUBA 5ETRA 3WHIA 3TZZA 1N48A 4HEA9 3D66A 2AEFA 4ZPVR 2UUWA 1SH3A 3MM8A 3QZ7A 2X1AA 1KVKA 4YS2A 2I38A 1NUEA 2ZNZA 3DLKB 1XBWA 5SUHA 3M32B 2HFZA 3CC7S 2E5GA 5F0WA 2EVZA 4TU7A 3C14A 3KK1A 3KNGA 4ECXA 2KL8A 3BH6B 4Y0FA 1TKXA 4X4UA 4YOEA 4P10A 2W01A 1CC7A 3FBCA 4O3OA 1UJ6A 4M5LA 4O3NA 5GADI 3W2WB 2PDAA 3JSMA 1RUSA 2OPSB 3WZ0A 5IT0A 2H1YA 1LWEB 3M9NB 2RQCA 2GJFA 3F73A 1I51B 3AOBA 4YY3J 4AL7A 1BMQB 3EYZA 3UNGC 2V9KA 2FY1A 1N6QB 3T9ZA 1HBOB 2EPIA 2ZNYA 4A8WA 3BZQA 3IAS9 5KFBA 5K5MA 4F3QA 1HQEA 4FVCA 5D6GA 3KK3B 1RA7A 3D1QA 2NR0A 2BW7A 1GEHA 4RL1A 4KTQA 2QLXA 4LFBJ 3OD2A 2XWYA 3LP2A 2HRYA 3VAJA 1G2EA 1FEHA 2N3LA 4NLWA 4USHA 5A8WA 3GYNA 3W63A 5DG8A 4NL5A 2DXEA 2J6SA 3C2PA 4N41A 3QLHA 3GG0A 2A10A 3HKWA 1EETB 4F2SA 1LK5A 3DHXA 4IRDA 2CJYB 3CIMA 1FEEA 2VG5A 2VPYB 3LAKA 3UD4P 1FFGB 4O4RA 4HDGA 4ILRA 1NO8A 1TMMA 2VDIA 3KK3A 1JLBA 1YJRA 3HVWA 4MH8A 1DY3A 2FGCA 4P71A 3OTDA 2Y1LB 4I64A 3O2IA 2MQOA 4KFBB 4B3MJ 4BC7A 2QSFA 7FD1A 1XWLA 1Y00A 5C24A 3GR1A 4EYIB 4Q43A 3TAPA 5D15A 1IXKA 3HFVA 1VI7A 2OPSA 3UE2A 1OYDA 3QJLA 1FRJA 5MLCV 2CNKB 1N8RT 4ZMMA 2K7KA 1FXLA 4AQYJ 3FSYA 1PAEX 3JSRA 4Y28C 1UETA 2GA7A 2CDRB 2JEIA 2DNPA 4G65A 4EBCA 1SC1B 2VC0A 3ZZYA 4F8RA 1B3TA 1Q16B 1HL6A 1OYEA 2E29A 2WSEC 5BXIA 2UXBJ 3MM8B 3KHRA 2XMUA 2YKOA 5D4PA 4NMLA 1RWNB 3DOLA 4ZVGA 1AT1B 4TNOA 2E1MC 1KLMA 4DQSA 1MROA 3DOMB 4GMKA 4K59A 3LOUA 2JRSA 3GZ7A 3CVKA 3NCRA 3KKFA 2DVIA 2ZVSA 3EUNA 5KFKA 2HIYA 2YQ3A 4QOTA 2YY3A 3PVXA 4DV5J 3GJTB 1S4FA 1UFKA 1XR6A 3DM2B 2HBRB 3C15A 3KDOA 3M8YA 2VQFJ 4GKJF 4MKVA 1FDAA 3QGGA 3CJKB 3TX8A 4I6YA 5L1KA 1XNQF 1Q8KA 3L7OA 1X5SA 4ECYA 4ELVA 1NJZA 3L7PA 2EKNA 4ED2A 2SXLA 2UUCF 4LF6J 4DSFA 2FQQB 4X4PA 3X3UA 5KFMA 3CJ4A 3DRSA 2VBXA 2N7CA 3GQCA 2QL9B 4MKAA 5KFFA 4B3TJ 1RKIA 2CXEA 2VPZB 4ZIWA 5EWGA 2ILZA 4KC5A 1X60A 2X1GA 1H73A 5CQGA 1NDCA 2LQBA 1NKEA 4WE1A 3AD8C 1FESA 2WBRA 1X9WA 3PZPA 5KT3A 3HULA 4I0WA 4CWBA 1NCLA 4U7UK 1EP4A 3ETOA 5KFIA 3GV7B 1GTEA 3QSIA 4OV1A 1JJ4A 3V6KA 1ULRA 2E5IA 2ZUGA 3QT8A 4CO4A 1QE1B 2H54B 2KT5A 4HH1A 3TVYA 3KLIA 8RUCA 1VRTA 5AXNA 4DL0C 2BZ2A 2QA2A 1JLGB 2LU1A 3O44A 2BVZA 1OPZA 3ZZ0A 5HQMA 2IRXA 2AP6A 4URQU 4OHVA 2ZEJA 4IG0B 4M5DB 4CT9A 2KM8B 2XZWA 2KZZA 3QT5A 2H3EB 3AAWB 4QBUA 5M2RA 1L3SA 2HW3A 2ROPA 4WFNQ 5EX0A 2V2ZA 4ID5B 3M6UA 5DO2A 4ZP6A 5DDQC 4RW9B 5AXMA 2V4RA 5LMNF 3VAKA 2X7IA 3R6GB 4K4TA 2HQCA 3R7SB 1K9MT 1KR4A 4CLFA 1CJKA 3P45B 4CLUA 3H98A 3OR1A 2R2TA 5IQQA 1HW8A 2KYXA 1DLOA 4FS1A 3HHNB 2R7UA 2YKNA 2WVDA 4IH5A 3Q0AA 1WOPA 2HWTA 1F6TA 2P6SA 2CPHA 3V4IA 1Q7LB 1JLEA 3ULHA 3NNHA 4UOFA 3QLHB 4LSZB 1P1LA 5EX3A 4NEZA 4C0BA 2OO4A 2MQMA 2EK6A 2LEBA 1JWWA 4L75A 1GK8A 2VDHA 3R97A 4TKTA 3MUMP 3T1HF 2JFDA 1MWQA 4ECUA 3MM7A 2V69A 1NLKL 3I31A 2F1FA 2OD6A 3B4DA 3VGUA 3E2EA 5CAAA 3A13A 2BQRA 1F3VA 5KG5A 1TL1A 1TU0B 1T9TA 2IYIA 1WHXA 2XQCA 1R0CB 3IP0A 2FGOA 3KK2B 5KFRA 4RWWA 4MK8A 4Y2IA 4X64F 4NLUA 2I1RA 4BWJA 1WACA 4DR5F 4FYVB 1YWXA 2DGQA 5A0YA 4F7VA 1VC0A 2DRBA 1RAAB 4DQPA 3OSPA 3LANA 3TYTA 3MFHA 1Y10A 1K1SA 1G3OA 2GCFA 2C3UA 3W2WA 3JSMB 4P2SA 4HKQA 3GCWP 3FGVA 1PILA 3BB5A 4ZP8A 4O3RA 2AJ4A 1HD1A 2ZFHA 4QR2A 1PAUB 2FC9A 3P49B 2YTCA 3W66A 3DLGB 1RTDA 3K59A 1CJVB 2A6MA 4QWBA 5HROA 2BE2A 5THWA 4O0NA 2LQ9A 1H7XA 2PEHA 4KGVB 1H74A 4ES2A 4DF8A 1T03A 4WE1B 4Q8EA 1N36J 4EZ9A 3ZTSA 3NNAA 4UOHA 3TAMB 4DFPA 2PT0A 1U1MA 1VQ8S 2DIUA 3TZYA 3THVA 2HHWA 3QYYA 2BJDA 2RDDA 1H72C 2ZBQA 3JQMA 2MQNA 3FQLA 3TA0A 4M5KA 4QPXA 2KG1A 2J0WA 1UEUA 4IDKA 2R2SA 3QPIA 4HYKA 2V94A 4CLZA 3CSKA 4DN9A 1P9YA 2VKZG 1BGXT 2NUUG 3KJVB 3VALA 1ZETA 1FWKA 1DTTB 2VG6A 2GMHA 1WEYA 3MEGA 3QT7A 4QW9A 4J9PA 1UEVA 4K5RA 5HVFA 2MZJA 5JJBA 1K8AT 4PQUA 4ZVHA 4URGA 2LMIA 2WSCC 5EWEA 4OZNA 4DV5F 3PKMA 3AD7C 3UI3A 3SSRA 3K5LA 2CJKA 4ECQA 1DTTA 1HQUA 4XDDA 2PI5A 4CCHA 3MM6B 2MJNA 2R8HA 1YRTA 1X9SA 4JI3J 3J80Y 2DNGA 4G6VB 2AHOB 2YWHA 1D9AA 2RSQA 3MPWA 2EWHA 3OPKA 5BJRA 2PO4A 3WC2A 2ZD1A 3QGIA 3DOLB 1HNWF 4EBDA 2GIQA 5C7PA 3UR0A 1LW2A 4K4VA 2HQFA 3RAQA 2RT3A 1S6QA 1HBNA 2QN6B 3KMQA 1WF0A 3R5JB 4PABA 1HI8A 2BE2B 2POKA 1Q8BA 1IQZA 3M8RA 1ZS6A 3T1AA 2W9BA 4LQ9A 2YKQA 2GO8A 1GXLA 1KHVA 1S57A 4HHHA 2BJ9A 3EGVA 2FZCB 4OZ5A 3TR5A 1RAOA 4J90A 5L8RC 4DV3F 4IO9Q 3PRVA 4TY9A 1JJ2R 1U1LA 3PJ9A 3UD5A 1TFWA 2XNRA 1NK8A 2YX1A 4KQZA 3J80U 2HZVA 4S0MA 3H0PA 3ZNJ1 3SV3A 1NSQA 1MU2A 5DLFA 1FRXA 2NSCA 1YJ9S 3IBFB 1R27B 1YBUA 4H4OB 1LFWA 4HACB 4HDHA 5KFCA 3PR4A 3S1TA 1VJWA 3CNQP 4KFBA 5DRKA 2AYBA 4IQXA 3KJQB 4OZLA 4JYAF 2LA6A 1SIZA 1SJRA 3MMCB 3KK2A 2JX2A 3I32A 3R3TA 4OHXA 2EW9A 4RW6A 4WK1A 4USMA 1MNEA 3C6TA 2Q6BA 1MWZA 3KJFB 2R2RA 2KVQE 1NK5A 1D9DA 2LQJA 4OX6A 1RAEB 1FA0A 1VQOS 5KT7A 1RT2A 4FYDA 4ZPCA 2G4BA 1RT5B 2APOA 5GMEA 3JAMU 2E7XA 5LSOA 1RT5A 3IRXA 1JKHB 4DUYF 4J9LA 3FDSA 1TAUA 1KWMA 2GQQA 1SQGA 3UD3P 4P7VA 2R7RA 1ZM2A 3LP1A 2HNDA 2M8HA 3PYGA 3PXGa 2BABA 5HQ8A 4L3KA 3G6YA 3DLBA 4IRCA 4IO1A 2RQKA 3WC0A 2AYEA 2CQPA 5KFDA 4PXEA 5HK4A 3HCXA 5HATA 2VONA 1RA6A 4H4OA 4IYQA 2V8DA 3IG1B 2HZCA 3N79A 4ED8A 4X4NA 4USWA 2KJWA 3WDOA 2O66A 2YNIB 3TVZA 2RHQB 1SKWA 4PQAA 2M4MA 5D0RA 2YKMA 3E01B 3U02A 1R8BA 3EJMA 5AE1A 3RRHA 2YNGB 2OTJS 2VU5A 1NJYA 4FNHA 3OTBA 4X4VA 2FLOA 2B5JB 4J9QA 4R8UB 1EP4B 4NXMF 2WB4A 2CPEA 2QA1A 3DI6A 1W2BR 1CEZA 3FSXA 4ZLNA 3H4DA 1VHFA 1JJHA 3IGNA 1NH7A 4O3QA 5HL7Q 1YTYA 5IT9Y 5CYMA 1WHYA 5A8RB 1JXLA 3DN9A 2FLLA 4QR1A 2ZBIA 2ZHOA 2NXUA 5IT4A 2E5LF 4I2PA 3ICLA 1T8EA 3D9BA 4YDDB 3DU6A 3FZ2A 5KFUA 4DSKA 3QSYB 1HARA 2AEJA 3CO9A 4OHZA 3VGTA 3AXKA 3DKDA 4C11B 5I4MA 4KJIA 3FUYA 1M5SA 3JTOA 3BN4A 4H4MA 1D8YA 3PIOQ 5KFXA 2B8PA 5CYQA 2LDIA 2BE9B 3T1YF 4DSLA 4Y2AA 4JI0J 2ZC3A 4NCGB 1URNA 4NXNF 3M30B 3R2CJ 4JI1J 3GJRB 2BJ3A 1WG1A 3LP0A 2GHVC 3NBPB 2WZ1A 2O01C 4WYLA 5AXKA 1JLAB 1W25A 4DCOB 3OBIA 2WONA 4K4YA 3BV8A 3US5A 1YKWA 5KT2A 4DR6F 2FJXA 4KIAA 5FDLB 3BS9A 1SL0A 1RT3B 1X0PA 1DTQB 3VVTA 1NPRA 1RWMB 2ZZMA 4ZKAA 2FHJD 1XMQF 5J1NA 2W9CB 2BMBA 4LJMA 3R1LA 3EVOA 4F26A 3G87A 5HN0A 3AY0A 5A8RA 2AT1B 2NXNA 4MYTA 4TYBA 4DQQA 1WC4A 4DG1B 1TL5A 3QMQA 1U1OA 1F9FA 3FCHA 1CLFA 1LWFA 3OJUA 3PKYA 1KBRA 3VZIA 1QD1A 2AWZA 3H5UA 4KO0A 4L72B 4G1QA 1XEZA 4RJVA 1GQEA 4F02A 1HWLA 4RUBA 4Y3CA 3D6HB 3GU0A 4NZ0A 2BOAA 2HPUA 4TXSA 1RYSA 1YJTA 1LV5A 3OHBA 1IKYB 1GFWB 1VQYA 1HNZJ 2IY5B 1YG0A 1SJ3P 1RTHB 1TK8A 4KR0B 4QZVB 3BPSP 3MR3A 2B9WA 5AT1B 4QW8A 1L3TA 1FD2A 2V50A 2DNNA 2UXBF 1TP7A 2KFNA 3OLBA 5KG1A 2MEWA 1VQ6S 3IR7B 3CDWA 2QE5A 3VTIA 2FVQA 2GVDA 1SQEA 2YVSA 2MMYA 4RW7A 3M2RA 4TLQA 2XS2A 2CQ2A 4KV8A 1AFIA 3MOZA 1I6JA 3FKBA 4ECVA 1AUDA 1LW0B 3TEGA 3N6NA 3DLHA 2ZC4A 1DJ0A 2AJ2A 3AT1B 3Q86A 2FC8A 3ZTRA 2HEKA 1HHTP 3AQPA 4LF5J 1F5AA 2MGZB 2V4QA 1WC3A 5CZXA 4OHWA 4ZCKA 4J9SA 1IR1A 1BWVA 1OWXA 1M5PC 4NZ6A 3TZXA 4JBCA 1FRIA 5L9XA 1VDHA 4BWMA 1SKSA 2DGSA 2OFGX 5T7LA 2XNQA 4DUTA 2RKIA 3DDNA 3M2VB 4RW6B 5DQGA 1U6BA 5KFYA 1YZ6A 2DRAA 1QAYA 4O4GA 2QLWA 2MZTA 1TL4A 2R9LA 3EXYA 4JI5J 2W2NP 3ADAC 4RUHA 2B51A 4ZVFA 2WVBA 4P2MA 1ZH5A 4PG6A 2YPYA 2CQIA 2G1HA 2ZE2A 2B7BB 3ZTQA 4UT4A 5DDOC 1FFSB 1WTBA 2HRTA 3DRPB 2KI2A 3ZZPA 5B0DA 3GP9A 3G6VA 2ZITA 1C2PA 4Z2XA 1VRTB 2BYCA 3UO0A 1X0FA 2UXCF 4NLSA 3BGLA 4R25A 3Q89A 4V19X 3DLEA 1TKXB 4NX9A 5HO4A 4CIOA 4FYYB 3OTCA 4LRCA 3GIJA 5F8JA 4KO0B 4LSNB 4YR0A 1RCOB 2MSSA 1LWFB 2DHGA 2BW2A 3BM7A 3HI9A 1Q1KA 3VHQA 3MEEA 1HBNB 3M4XA 1JB0C 2KH9A 1S77D 1LKZA 4I7FB 1TMJA 3HPOA 2XC9A 1YITS 4DV4J 2PMWA 1HMVA 4O23A 2EG2A 3W9JA 2J76E 3AJ1A 1YGYA 2YNHA 1FFWB 1FKPB 3MM9B 2WONB 5J2MA 2PIIA 4AD6A 4NA3A 4CRJA 1FVQA 3ONQA 4CO0A 1JJCB 3MAHA 4DPOA 1HW9A 2QZ8A 1HWUA 1E6YB 4RW8A 2E9ZA 4DV1F 1M5KC 4KE5A 4QU7A 2DNMA 4B9SA 4IKAA 2OAUA 3PJWA 4GC7A 1T05A 3DM2A 3EDQB 3LGNA 5B0EA 2QT7A 2CVEA 4H4MB 2W1BA 3PRDA 4PAAA 3ET6A 2W4DA 3HD2A 3QWPA 1SH0A 2YKPA 1I3OB 4QIEA 2C3YA 1V9OA 3CEDA 5C42B 3L95X 3RBZA 2DYAA 4QIVA 1KQKA 4KKOB 3G8QA 3SCLE 2CFXA 2HGNA 4U95A 5F8HA 5IWAF 1X7VA 4DL3A 4YR2A 2FHOB 2HHXA 1NM2A 2YH1A 1WNEA 3DLGA 1RTDB 1EKRA 2B5JA 3AOCA 2XMTA 3M6XA 3W8GA 4J91A 3RB0A 1OPIA 4U6PA 4DV2F 4QYZK 3AODA 2J5AA 2QFJA 5CH7B 3CCVS 5KFQA 4RZRA 3NGDA 2ZHAA 4IUFA 2BJEA 2GJ2A 3HVTB 4DMZA 3KUGA 3NY0A 5IC4B 1SKRA 1JQGA 5ADZA 4NCAA 4KHPJ 2XMWA 1IKVB 4MIBA 1UAWA 5D0GA 1T94A 1UWAA 3ZZOA 5KFOA 3W1YC 4C8LA 2PA3A 4K2JA 4EU0A 2GX8A 5A6PA 3CCQS 1HNVA 1C0UB 4NLRA 4ZVUB 2ZH2A 1YDLA 2JEFA 4F0MA 5E33A 1FRMA 4PPZA 1V3ZA 2RUSA 3MM5B 2A3JA 3QAUA 1RU1A 3W7BA 3LGMA 4DL7A 2VPWB 2FLNA 1OY9A 4FDFA 3RAXA 4X84A 3NAHA 2ERRA 2C1EB 3TA1A 3UVJB 3IRXB 4F4KA 1VCTA 1G1XA 2PN6A 1Z2ZA 5FD1A 1BC6A 2PA8D 2DGTA 3RAMA 3Q8QB 3OFGA 3FSIA 2YKNB 5M2PA 1S48A 3RB3A 1SJ4P 3Q2TC 1S6PA 1WUUA 3FEZA 2DR9A 5IT9U 4RNNA 2O3DA 1FRKA 3FVYA 2C42A 3PYDA 2ILYA 3W9IA 1RXOB 4L74A 4ZLPA 2RHSB 2HLTA 2GQ2A 4C8ZA 3GJSB 3HVAA 3MM5A 2CNLB 4JV2A 3CMAS 2DCLA 2IYGA 1PGZA 1U1PA 1NSAA 2IVYA 1EKSA 2B4VA 2XYGB 4QR0A 3MAAB 4ECZA 1IKVA 4K0KF 2DGWA 2QC3A 4KT0C 2V9WA 4N8OA 2A6OA 4GO7X 1FDDA 4ZS6A 2FB0A 5F8IA 1H7WA 3QNWB 2VBZA 1H2VZ 3FFIB 3HZGA 4ETXA 2G13A 3QFWA 3PV8A 5IQ6A 2FVSA 4CH1A 3FBFA 3QBCA 4J5OA 2QMWA 4V1Ak 3VZHA 3GB0A 4DR3J 3EGWB 2JZ5A 4L3NA 2LYVA 4WIIA 1T9WA 1X4HA 2PMHA 3ZZUA 1HKAA 1NJXA 1B0TA 1FRLA 2LA4A 3IC1A 2KHDA 2HWIA 4HTIA 4L73A 2KFYA 2HFNA 3MR5A 1CJTA 3ILIA 3LGHA 4JI2J 1RLCL 1Q5YA 1ZAVA 1HWJA 2ZD1B 2FLPA 1FCAA 1VQ4S 3W3SA 2HHHJ 3JAMY 4DS5A 2CIMA 4ICLA 2BJ7A 4WBFA 1KVIA 2QLJB 2K1RA 1IBLJ 4Z7CA 4J37A 4FNIA 3UN2A 5LMNJ 3OXLA 4F50A 3KMSA 2QA4S 3R27A 5J2QB 1T05B 1SXLA 1U48A 4X2BA 2W2QP 2J9DA 2EXUA 3E3XA 1RT1A 1S0MA 2IHR1 3VGSA 4E8UA 3GV8B 2C22A 2V2QA 3CMQA 1HIYA 2OEJA 4PQUB 3ZTOA 2ZJPQ 5H9FK 4B3OB 2HNYB 3D0HE 4CO2A 1IR2A 2RU9A 3EZOA 5B0BA 5B7WA 1YQHA 3WX4A 1SUQA 1Q8LA 1GMWD 2HWHA 4F4WA 2DNHA 1IBKJ 1OY6A 2ACMA 2YWFA 3LPEA 4BCAA 1XMOF 1X4AA 4OI1A 1Y5LB 3BBBA 5GAGU 1RAIB 2F63A 2OELA 2EKYA 1Q5VA 1OO0B 2LDYA 3NEKA 3P5BP 4LVNP 2PMZD 2BV3A 1WJ9A 2V34A 4UOCA 2CQDA 4FPIA 3KLGB 2GMJA 1X5OA 1UW9A 5JVHQ 4R8UA 3MR7A 2V6AA 4NRTA 3NL0A 3NWRA 5F8GA 1O5JA 2UZAA 4QJVA 2NXEA 4JI8F 2GV1A 2VODA 2J8SA 2YKMB 3BN7A 3E01A 2D74B 5ETMA 5D3GB 1NKCA 4C8OA 1S1TB 1Y5IB 2OP5A 4UW2A 3UDVA 2DGOA 1ZM9A 2GZOA 3KYLA 3THPA 2MQQA 1RHMB 3H5YA 2Q66A 2ZE2B 3SI8A 3IR6B 4OYAA 1AW0A 2W7AA 2PE8A 1ZA1B 3CB4A 1X4FA 2PEBA 3FRYA 1SC3B 1XTZA 3O6QA 2WOMB 3QIDA 4DPYA 1FK9A 1LXJA 4DX5A 4I2QB 3WBZA 1HYSB 1NHKL 2HG4A 4O4GB 3IS9B 5U47A 5EHHA 5HP1A 2LP4A 3OFHA 2ZUAA 3W62A 3EZ5A 4Q0BA 1VQ5S 2EFOA 4UY85 3IWXA 4DEZA 3LP1B 2CZ9A 3J81Y 4KHRA 4GC6A 3H40A 2XM3A 2VG5B 1YBAA 3SCIE 5K8PA 2E5JA 2DO0A 2R8KA 2FVRA 1NB2A 2QFIA 3D54A 2FD2A 5LT5A 2KM8C 4ER8A 1YI2S 3BEGB 1M90T 2AJ0A 2MQPA 2XY6A 3PO5A 2YX4A 1C4AA 4DR7J 1NSPA 2ACYA 2HQGA 4OJHA 4ZPAA 1D3WA 1HHSA 1TKZB 2CYYA 1S0NA 1RWXB 3MECB 2UXDF 4OZ1A 2BQ3A 1REGX 1FI4A 4ELUA 3VAMA 3RBEA 3IMQJ 2Z0GA 2DR8A 2BKOA 1C0UA 1I1GA 3CDAA 3CIZA 3K8VA 2R7VA 4XPCA 3LW5C 4M5IA 1UZHA 2X3GA 2CQGA 3PFOA 4PRFA 4OZJA 3DOKB 1LWEA 1Q81T 3PM9A 1S1TA 3EX7B 3UWTA 3W8PA 2YXLA 4L6V3 1HBUA 3HVTA 2CPFA 3D3BJ 2P2CB 3CTRA 1F2GA 1N36F 4LBIA 4RU9A 1SJ1A 4MJKA 5KG4A 4C8NA 2C2ZB 2XHCA 5HLFA 4DR4J 2X3DA 2JLGA 4X4SA 3GIKA 1N0UA 4YUDA 3O8WA 4PCQA 4DCJB 3I5BA 2DJWA 1A9NB 1XC9A 1RBOB 2KDOA 2UUBJ 4KGXB 3GG1A 3CC4S 3M1VB 4WXOA 4O3SA 2C2OB 2RIJA 2W9CA 2OI2A 2HYIB 1IJFB 2P6TA 4LREA 2MKJA 1HBMA 3JS9A 1R8AA 5E3PA 4ED3A 3MOJB 2W8KA 3NKYA 1RDRA 1U25A 4DR2F 5HSPA 1N34F 4UY8T 1FT8A 1R8PA 3FRZA 2V8HA 2XB2D 5KFVA 1HQUB 2AV5A 2JC0A 2XMMA 3QGPA 1UFLA 4LIRA 4OMFG 1REVB 1V3SA 4PG8A 3TUJC 2XLIA 1S9GB 2QRRA 3U27A 2PI4A 3DCAA 4E0DA 1XNRJ 4K4SA 1B7FA 2J9CA 4GVLA 1WSVA 2OJ3A 3QT6A 1BQMA 5CYQB 5AE2A 2HMIA 2I5JA 4KPYA 1RAGB 3S6EA 3D7SB 3CXCR 2IM2A 3BQ2A 1B64A 1U6ZA 2XMKA 2J0SD 1G6BA 2HAFA 2DISA 1S7HA 1NHUA 2RD5C 3W65A 1S4EA 2G0IA 5IV3A 4NZ7A 4RUAA 1KLMB 2KU7A 3OUYB 1K0VA 3HXMA 1HMVB 2NXJA 5K8MA 3H25A 2UVWA 1XR5A 1NZAA 2AKWB 4DU7A 2J0XA 1X4BA 2D9PA 3HHLA 4CQ1A 4ZPDA 4CLSA 3ETMA 3KLFB 1JIHA 1WEZA 2VQEJ 3MEEB 5H9EJ 1PKUA 3G9CA 4LRFA 4OYOA 1XERA 4PXBA 9ATCB 3RTVA 3V6DA 3MWBA 1S12A 2C2MB 5F3ZA 4PWDB 3DLEB 2IM0A 4F67A 2DY9A 3N0VA 5FIIA 3RW6A 1CBKA 3A4TA 4ZCLA 2IM1A 2FJDB 2MHNA 1XQIA 2RAQA 4M1KA 1NEEA 4KHMA 4ZJOA 3CJQA 3SBMA 1NKBA 2ZJQQ 3DOKA 4OI6A 3UN3A 1B7YB 2KO1A 3A8JA 5I3QA 3CO0P 3HHKA 2E1AA 5C24B 2ASDA 1KVJA 1PJ5A 1FJGJ 4OX9F 2M9KA 2HK2A 4X62J 4LF8J 4IG3A 1S6OA 4K4UA 4X66F 2RRAA 1T7PA 2C2DA 1R6YA 4X4RA 1CJUB 2EG1A 2QIFA 5DM7Q 2E1RA 1Q82T 1S6UA 1EZZB 4DFKA 5T7LB 4JYAJ 3SXLA 3Q8VA 3GYGA 4FP9A 4WP9A 4WTYA 3MM7B 1S1UB 5B0AA 3RUBL 3MPYA 1Q7YT 2CPXA 2V4JB 4KGMA 2Z58B 2ZKUA 3M2UA 2C2EA 2R7SA 4WCEQ 2OPPB 2CVIA 3EWGA 2W7OA 1KTVA 2R4FA 3W2VB 3QAEA 2EC2A 3BDPA 4FF3A 4NLVA 5E5NA 3R5CA 4USVA 2ZH9A 4DF4A 4Z7YA 1KC8T 4LF5F 2X1BA 3UVJA 3PW2A 1XNQJ 3OR1B 2CUYA 1FKOB 3A1YG 2GVDB 3HHLC 4FXVA 4KBIA 1JLQB 1UWBA 4RW7B 4EWTA 5CD4A 1D9FA 2RRNA 1KSPA 4USTA 1T95A 2GJIA 3JSYA 3D6TB 1M0SA 2LEPA 2YWKA 4ED4A 2WOMA 2RMLA 2WB1D 4HACA 1FE0A 1JMTA 1JXVA 2XZTB 3HX9A 4OIXA 2E9RX 4KHPF 3E51A 1KN6A 2WTFA 4IOAQ 3IRWP 4IG0A 4LBHA 1R0BG 3AXMA 2AF6A 3K7RA 1FNXH 3NMAA 2HNZB 4HT5A 5AJ3J 4JI3F 1S49A 4DCPB 2DKOB 2VBWA 4B9MA 3HK2A 1F0XA 3JSBA 1Q78A 5A8KB 2NLWA 4RUCA 1VBYA 1TAQA 1KHWA 1DQAA 1WKJA 3CJRA 4ITSA 1F1BB 2F9JA 4MFBB 3OVSA 3KK1B 1QTMA 1Y5NB 3D6FB 5L39A 4YEAA 5D78A 2R8JA 4HI2A 1M1KT 2KXFA 2V68A 4R0JA 4DBQA 4FF2A 3QRRA 3PW4A 5HANA 4ZP7A 1RI7A 1U1RA 4D3HA 5JVGQ 4YB6A 2DNQA 5BYRA 3PEJA 1S59A 4RBVA 1QDUB 4DR1J 1B0VA 2WHOA 2DR7A 2GW8A 4OYBA 1VS3A 4YR3A 1HI1A 2WAQD 2ZJRQ 4JI8J 1VIXA 1BLUA 2FZKB 5IZHA 3CCTA 1ZM3A 1N5YA 3LP0B 1AYEA 2CJXB 4DV1J 3MPDA 3I9ZA 3KG0A 3BREA 3FEXB 1J5EF 5E7OB 3LUYA 4C7QA 2N7YA 1WKKA 4L76A 4JI0F 2LU2A 2LEAA 2M5YA 4Q45A 3T1YJ 3T5HA 1P1TA 2IIHA 5B0CA 1CULA 4MKBA 1MMNA 4C11A 4EI2A 1X4GA 3N5FA 2YNHB 4TQRA 2DRDA 2ZH1A 1E6VA 1S0OA 2ASYA 4QQBA 4RNFA 1Q53A 3D28A 1N33F 1RABB 3GLJA 3RJMB 4QPTA 4WKRA 1RLDA 1WEXA 1KQGB 4P73A 3M1VA 1R3NA 5KFZA 2D1CA 4CP5A 4X4OA 4UQGA 1TKTB 1UVNA 5IOLA 5EWFA 4JB8B 2XWXA 2B9YA 4NLOA 4NLDA 2JEGA 3RR8A 4RLEA 1H3DA 3ZXWA 4LFAF 2KZMA 2N3OA 4NCBA 3QO9B 1KQSR 2VOPA 2D3UA 2CQHA 2ZZTA 2FPHX 1RJJA 1N5TA 1UCNA 1K73T 2OMOA 5L46A 5J2PB 3B8HA 4CH0S 1G4CA 1HBUB 1W26A 2G9OA 2QTWA 2R42A 2V8PA 4B02A 3ENAA 2YNIA 1VC5A 2MLYA 3RB4A 1TL3A 5KFJA 2I0XA 1P6TA 2RRBA 3CCZA 3MUTP 1NK4A 3DRRA 2X51A 4CTAA 3UR3C 2V8GA 3WX8A 2M3DA 4K4WA 1IBMF 3OTOF 5L1IA 1VRQC 1VQ7S 3K2YA 5K8OA 2F8HA 5F0UA 5KOWA 4B9LA 4C8MA 4DR3F 2Y9HA 1S1XB 2QX0A 3SYZA 3NLCA 3CCLS 2XYPB 4OX8A 1KS2A 4DX7A 5E2QA 4TU8A 2GNKA 1ZTTA 4F0KA 5K14A 3UNYA 2JL9A 4KGZB 4ZJLA 3VWSA 4ILLA 2K3KA 3C6UB 3DMJB 1N52B 3GILA 1HNIB 3SSQA 3OL9A 2VFSA 1EETA 1ITPA 2QV6A 1RWPB 1ZZFA 2OPRA 5DS7A 3J7AN 2CQ0A 1Q4RA 2RH3A 4W92B 3W9HA 5H9EK 4PZVA 3PJXA 5T41A 1URRA 2WVEA 4JV5F 3JTPA 3IXQA 9RUBA 4QWCA 4DFMA 2CZVC 4Q0BB 1B4SA 4WWSA 4LIWA 2FVCA 2NZCA 5AJ3F 1FK9B 2XHWA 3EPGA 1FTRA 1HYSA 3W5XA 1N32F 1U0SA 3O5TB 1HNXF 1DAXA 3I5AA 1JNZB 4DN0A 3CUNA 2Z57B 3W5YA 2I8EA 2VF3A 3R5DA 4A8XA 1S76D 2QMXA 4DLGA 2UVVA 1TL3B 2EFNA 3HT0A 4ZCMA 4WPAA 3ENWA 2N4DA 4F25A 1WDDA 2GAGC 4ED7A 1QSYA 2VD3A 2VASA 3GSIA 4GKKJ 3CCUS 1S1VA 4IFVB 1QE1A 2XMVA 3G86A 5CA5A 5DG9A 1WC0A 3FMWA 3HP6A 3LQVA 4G1IA 4DV3J 1SI9A 3D3CJ 3X1LB 4ZCIA 2DY1A 1GXUA 3H5SA 3M8PA 5B08A 2J0QD 1DFDA 2LXFA 2PC6A 1MMLA 2C3MA 2VH7A 4PYDA 4EBEA 3KLFA 4UZCA 1XMQJ 4QCLA 3NXZA 2IJNA 2AMCB 2HQ3A 3V2UC 3KG4A 3F0NA 2UU9J 1U2FA 3V5RA 2XEXA 1LNQA 2OH2A 2AJQA 2HBQB 3MPVA 4NLXA 5HQLA 3V6HA 3IO1A 3MCSA 1HNWJ 3K5OA 4WJBA 4ZIVA 4IRKA 1K0TA 3WIUA 1GNKA 1LQ9A 2HBYB 3MM6A 1WWHA 3C66A 1CULB 4NXNJ 1KQFB 3IM8A 2BM0A 4O44B 1OSCA 2HQIA 4N77A 1QUPA 2EK1A 1IR0A 2BXJA 2I5JB 1SH2A 3OLAA 1N56A 3PR5B 4EZ6A 2ZZNA 1I5OB 4OJ3A 4AFFA 1RQ0A 4ANDA 4WYWA 4FPRA 4RX6A 3C15B 3DLLQ 1REVA 4JI6J 2MQLA 5B0GA 3CCMS 1RT6A 2FHJA 1D09B 1PBAA 3KXDA 5KG3A 1RWWB 4TLRA 5E3AA 3PW7A 3EGZA 4IDKB 1VQKS 2V8VA 2OTLS 1T02A 2W2PP 2B6AB 3RU0A 3H5XA 4DV0J 3D5MA 1H2UX 3D6MB 5C2GA 3FBEA 3TQ1A 2OHDA 2YNFB 1ACMB 5D4OA 4J9MA 4WFZA 4OYXA 3BR9A 4C2MA 1MW7A 4PG5A 2R7WA 1U2CA 5MAOA 3N28A 5DQIA 3LAMA 4CT8A 1UVIA 1RACB 4CO3A 2P9CA 3T6JA 3VF0B 4D3GA 2P5VA 4AYBD 3OVBA 2M7SA 3IN5A 3OTOJ 5A2QY 1H2TZ 4WXWA 2FIUA 4DV6J 3PX0A 4OX9J 2JC1A 3OJSA 1QJHA 2Y0BB 1PC5A 2JEJA 2XSJB 4DV4F 1IBKF 1Y0HA 4B3SF 3SFGA 2AYMA 2B8QA 1DARA 1WKLA 2D41A 2BRLA 2HRUA 2I9SA 4YB5A 1ZZNA 2Y8YA 3G96A 3THTA 3CCJS 2BANB 3TJAA 3JQKA 2PGCA 4C48A 1NPPA 1HWIA 1YLXA 1S5ZA 2V0NA 3LWLA 3M2VA 5E3RA 4HH0A 4ZPWR 1X4CA 8AT1B 1Y7PA 1FKOA 1N54B 2VL1A 3KHGA 4C98A 1VK8A 3TEHB 2BEFA 2OGUA 5C2CA 1RAFB 1ZTWA 4B3SJ 1Y9OA 2B0GA 3AFGA 1BE4A 2OPRB 2FZGB 1CS4A 2VKRA 1RP5A 3H7HB 4DV6F 3DMJA 3CJ2A 2BX6A 3SEOA 4NI2B 3S8SA 4A8FA 3SCJE 1VOMA 2QEXS 4YB7A 4ETZA 1A6LA 4P2FA 3L3CA 1J27A 2E66A 7AT1B 4W90B 1OSDA 1WELA 4I2QA 1N0VC 3R8YA 1FVSA 3OW2R 4LF4F 5DQHA 1HNVB 2MHEA 4ANCA 1VBZA 4PUOB 1SKUB 2AZ3A 2CPJA 2GGPB 1YJUA 2VFTA 3D68A 5K9FA 4A8MP 3ISNC 4AL5A 3BGOP 3B54A 4CZCA 1IKYA 3CDBA 4J9NA 3UCGA 2MB0B 1U24A 1JLGA 3P4UB 1FX2A 3HSGA 5DZ7A 2N82B 5L38A 2ABYA 4HI1A 1P27B 5ETSA 3FK4A 4ZDNA 4C0HA 3ISND 1FD8A 3QO9A 1N5SA 2XCPA 4ED5A 1QSSA 3JQJA 2DH8A 3CJ8A 4B9VA 1NDLA 2DTJA 1U1KA 3PEHA 4BS2A 2RNEA 4RU2A 2BBEA 1RTIB 4WF9Q 4MK9A 1VFJA 3T3FA 3O1LA 3IGVA 2BKPA 3HF5A 3SZ2A 4NYZA 3EGNA 2DXDA 2DITA 2OSQA 4CDIA 2FUG9 1SPBP 2W8LA 3JB9k 4U7UD 2RF2B 5A2QU 2XLKA 4U9RA 3DGPA 2ZDPA 2VFVA 2Q43A 3M8SA 1VYAA 2Q79A 2JOQA 1JLAA 2CNNB 4ELTA 2HNYA 2ADCA 2Z8QA 3IBWA 5HMXA 3Q2SC 4C9DA 2WW4A 4F04B 5IM0B 4HHUA 1Q0NA 4Y65A 4RW4A 4Y2CA 1DZ5A 1E6YA 4RW8B 3ILJA 4M5JA 3GV5B 3F44A 1FNMA 3PCOB 4B3RJ 1CQMA 2VA2A 3H2VE 4O44A 3W5ZA 1SC4B 2CKWA 5F9LA 2JDJA 2U2FA 2AQ4A 4KH1B 2IVFB 4GKKF 3UFCX 4A4JA 2V63A 2QLBB 4OI4A 4ZVPB 4YP3A 1D0EA 1SIWB 2XMAA 4LF7J 2IM3A 3HFZB 4I4BA 2KKHA 4DZ6A 1IKWA 1NDPA 2Z30B 3CGIA 4DPWA 1T9UA 5HI7A 4HR2A 1TL7A 4PPDA 4TY8B 2EFPA 1IM4A 3DDIA 4LBPA 5KOXA 4ZVQB 1NAQA 1W7WA 3Q8PB 3EICA 4DPUA 3MTJA 2ZM6J 3DI6B 2GFFA 2KRBA 2RILA 4OZ0A 4M5HA 1XMOJ 2GAHC 3I96A 3R5BA 4MAKA 1UPPA 2DH9A 2GMLA 4I6WA 1HI0P 3CPWR 3CMES 2R7TA 1HD0A 3PTWA 4NPOA 3L7UA 3A8KA 3SQGB 3HHEA 2Q3PA 4P74A 5KFGA 2AZ1A 3LH2S 4ES3A 4BDPA 5ETVA 2J6TA 1U47A 1JLCB 1LFPA 1UL3A 1U8WA 2BM1A 2MZRA 3GE9A 4EMDA 2IRYA 3DRPA 3SDEB 4X64J 2HVZA 1UVMA 3ENVA 3TARA 2HHPA 1V5VA 3JXOA 5HMWA 4NLYA 2Y8WA 3Q8YA 2ZH5A 1Z1ZA 2FTRA 2ZWOA 1S0VA 5F41A 2AD9A 2C2RA 1K47A 3N5BA 1RTZA 4ZK7M 2VQEF 3DNCA 4LF9J 2HKEA 1MWYA 3T1HJ 2IRUA 3NGUA 3OFFA 3T9NA 2J9DE 3PYEA 4OZ3A 1IBMJ 2CWKA 2ZBPA 3HD1A 3J7YU 2VICA 1SB6A 4ZLJA 1TUWA 1L3VA 3HHDA 4XK8C 4NMXA 2M70A 3W2VA 2VC1A 2HGLA 4FBUA 4I56A 5C25B 2ZH7A 4JI7J 2F4FA 1M1GA 4OI2A 3GIIA 3F56A 2UUAF 3SMZA 2U1AA 3K17A 4CO5A 5JXSA 1M5VC 3IBCB 2DPIA 4IR1A 4ES1A 2KG0A 3ELHA 2ZOGA 4LFBF 1HQEB 1X8DA 4TN2A 1MN7A 1NU4A 3OL6A 4C8KA 2JWNA 4FYWB 2AYGA 4KPCA 4RPFA 4F3OA 4XTTA 2BANA 2FDNA 4ID8A 4CH7A 3UPFA 4EEYA 4HT7A 3N6MA 5AE3A 3NS6A 2G0JA 2BKNA 3FEYB 4NA1A 3CE8A 3G8TA 2HVHA 4K4ZA 4DUZF 4LR9A 1Y4ZB 1WHWA 6FD1A 1VBKA 2AJ1A 2F65A 4NLQA 3K58A 1JLCA 3MCNA 2Y1JA 2ZBRA 3CJ5A 1F9HA 1GXTA 4YDXA 1I94F 2LCWA 4USKA 1CSJA 1DURA 1WTFA 3MMJA 2D7SA 1WSRA 4ED0A 1U1QA 4A46A 1C0TB 4MKYA 1VLYA 3ISZA 4KYZA 1HWKA 1PJ7A 4JI2F 3PRBA 2VA3A 5KG2A 3H59A 3HHLD 2H4YB 3HSZA 1CQNA 3DLKA 2ZH3A 1EAYC 2BACA 3KUEA 3KLGA 2FJEB 2KTQA 4EO6A 2KJVA 2DGVA 1WHVA 2MXYA 3G4SS 1NXIA 4H4KA 2AX1A 4DDFA 4ECWA 3EVMA 4IFYB 4PG7A 3QGHA 1X31C 2HHVA 3NGTA 1OIAA 2L48A 1N88A 2QG9B 2QMUB 2AX0A 2BA9A 2CWXA 4HTJA 2F5GA 2B7CB 1H0HB 1PO6A 1QAJA 1MG7A 2HFSA 3ET6B 4PG4A 2MJUA 3DRXA 1JLFB 3IA0A 3HJFA 3AB4B 1AROP 3BKTA 2ASJA 4JI4J 4DWIA 2CPIA 4FN5A 1MN9A 3TOQA 2BDPA 4C3KA 1R31A 1RAJA 4RW4B 4LSLB 3KLHA 3R5GA 3LO3A 5J2QA 2E7VA 3AJDA 2D9OA 1WC1A 2HVDA 2OMLA 1YSJA 1JLFA 3JYTA 3R1HA 1J5OA 2DB1A 1NH8A 2K1RB 2XZDB 4FKXA 3Q24A 2V2KA 3OR2A 1PCAA 2F8EX 2F7VA 2Z56B 5F3TA 4J9OA 2VBYA 3QJPA 1Y3KA 3N01A 3HKZD 1P9QC 4N7TA 4B9UA 5KG0A 5ETOA 2GIFA 2C3PA 1QSLA 1Q95G 1T9VA 2NSBA 3I5CA 3NGKA 1KFDA 1RZMA 2CDQA 2A18A 4YN3B 2V67A 3I4PA 4AXJA 2NREA 2HHSA 1FKAF 3PX4A 1A0OB 3KLEB 3TUZC 2IPOB 2K8GA 3BBFA 3D1HA 4RNHA 1S10A 1T03B 2RB7A 1VR6A 4XPEA 3D2WA 3KNAA 4GRSA 1UVJA 2XYHB 4ALZA 3R7BB 4I67A 1M5HA 2NPIA 3BH7B 4MT1A 1RHKB 3OVAA 4Y34A 1NK6A 3VVUA 5LJ5Y 1S79A 3ITHB 3UCUP 1TUVA 4OI0A 5T14A 3AOAA 3M8WA 3MZIA 4CI0B 2DCUB 2WVCA 5IV4A 2KXNB 4A8QA 1IM6A 1ZAXA 1Q79A 4P2XA 5C5JA 3PW5A 1U8SA 3L9ZA 3IG1A 4PUOA 3FZBA 3BSNA 2O1PA 2OSRA 3M9OB 4F0HA 3KHHA 1OS5A 5CD4H 1KNZA 5LXYA 1JLBB 2XI2A 1CVJA 5ETKA 3MECA 1FXDA 5F8MA 3GFXA 3NNCA 4V19J 2E5HA 1V6HA 1RWOB 4X62F 4LF8F 1C1BA 4WFYA 1AFJA 1AB8A 1S6PB 3TANA 2DT9A 2COLA 2XY7A 4OX7A 4YHHF 2YH0A 1KLNA 3GMGA 2J7WA 2IMWP 1RT2B 2OPPA 2RQMA 2PD1A 4LT6A 3G6XA 1D8ZA 2P8IA 1WD6A 5K14B 4OI3A 2MTLA 1QTNB 1RCXB 2L08A 2HAIA 2OKQA 4OJGA 2XS5A 4KRWA 1B99A 1TVRB 3IS9A 4DOZA 5HP1B 3K0JA 1RBAA 1QM9A 2UXCJ 5SZTA 1HPZB 3T5KA 4R0EA 4Y2MA 3VV2B 2UUAJ 4Q8FA 3KJNB 3T6BA 1YJNS 1N6QA 3AA9A 3BQ0A 4FXDA 1WOSA 4Q44A 4WFBQ 2G2ZA 4C0OC 4TQSA 2XCAA 3VCDA 2M0GB 5J2NB 3NWGA 3OL8A 5LMUJ 1RWKB 1KOHA 5LMUF 1PIEA 4F36A 3VAGA 5J2PA 4I6AA 1LXNA 1IN0A 4LQ3A 2QO3A 3ITHA 5GMDA 4CM2A 3TQEA 1FWLA 3UDCA 2W9BB 4M94A 1U49A 2H5EA 3LALA 2UVRA 3MF5A 3M32A 1YJ7A 4CLLA 1EQ0A 4TVAB 3CD0A 4U67Q 2HGMA 3OQ2A 7FDRA 3HLUA 3RW7A 2DNRA 1EARA 1IKWB 1FE4A 3NRBA 1RU2A 4M5GA 4DR2J 3KG1A 4K0KJ 1WF1A 3P3DA 4USIA 5CXTA 1NSKL 2IJRA 1J2VA 3NP5A 5DDPC 1N33J 3OR2B 3PHTA 1WORA 1U7LA 2MY7A 2HFOA 3VGVA 1IJEB 3V81A 2CPDA 3EMTA 3NBPA 2KB2A 1PYSB 3DC2A 4K2XA 5H9FJ 4Y00A 4HHJA 2F3JA 5GADU 2RQ4A 2WBMA 3BSAA 4U7CA 1JX4A 3A8IA 3BF4A 1VBXA 2DK2A 3I9V9 5L1LA 1VC6A 5J1EA 3MHYA 3C16B 3MMBB 1UFWA 2VV5A 3DXSX 3RYLA 3V81B 1X4EA 4NLTA 3KOAA 2BR0A 2HHQA 4WP3A 4ICLB 2GVZA 1YIJS 4XO0A 2G2YA 2CG8A 3PHEA 1MROB 3DOMA 4U8VA 5F9NA 1GX5A 4I2PB 4OYPA 2AGQA 2Q6CA 1QY7A 2MSTA 2Z2LA 4PWUA 3TZWA 4N76A 2P9GA 1CJTB 3BPDA 3FNNA 3MD3A 4CLKA 4IFYA 1CPZA 3PW0A 1K44A 4B3RF 2VUGA 1VGYA 2KXHA 5GVQA 1NJIT 3BO3A 3HT3A 4ZVEA 4OV6A 1ICEB 2VOOA 5B09A 1VJQA 5B0FA 5KG6A 1UA0A 4DV7J 3VQTA 1HR0J 1NZ8A 1QUVA 2ADBA 3MXHP 2DNOA 2ZOMA 1JNRB 2IVMA 3ZC4A 1U1NA 2XLJA 4K5SA 2K7JA 1EIYB 3B6BA 4USJC 3BDEA 3EM1A 3QIPB 1HNXJ 2ZOFA 2GGPA 4JI1F 1UEKA 2C2KB 2CQBA 2H48B 4J7CA 5GMKa 1O6XA 2DH7A 4P72A 2VB6A 3BSOA 2XY5A 1KD1T 3AQOA 3RRKA 4RBTA 4YMEA 1TVRA 1TL1B 1RHQB 2GO9A 3FQKA 4I68A 4LFCF 2K2PA 5DJBA 1VISA 5IC6B 2HS3A 2VG7B 2YWWA 4NI2A 2NQPA 2LQ5A 4LVOP 4QU6A 1YZ7A 2IDEA 4KB7A 3EVWA 5M2UA 2ALYB 3CCRS 3W61A 3RB6A 1N4LA 3Q8SB 1JLEB 3QQCD 3GFHA 1U0HB 4P7TA 1T3OA 1UZDA 4IH6A 4A8SA 1S1UA 4B3MF 2DBBA 1CJKB 4NLPA 5AXLA 1P8GA 4ZLLA 1FJ7A 6AT1B 4NASA 1X5TA 3UDEA 1YRXA 3OTEA 4C6AA 1SL2A 3QRQA 3I82A 5H1SV 3A3PB 1QAIA 1UTAA 3D4JA 3U1LA 3MUVP 1RB0A 4IR9A 1UMJA 4IQMA 2IBOA 3RBDA 2XULA 1C1CA 2MKYA 4P6QA 1DBDA 3SDEA 2ASLA 2E5LJ 1GX6A 1KTQA 4ECSA 1RT7A 2RS8A 3O3LA 1L3KA 3GWCA 1BD6A 3PY8A 1F3FA 4LRDA 2KVIA 3H90A 4O0IA 2QL5B 3IM9A 3LA0A 1L3UA 5KFEA 3L09A 4G1QB 3M9MB 2Z2MA 3CDEA 4F4ZA 1FJEB 3V6DB 4N8NA 1Y11A 3AH6A 2MQ8A 3I0RA 1BXNA 2AGOA 1TR0A 3SV4A 2JJ4D 3I4HX 3HHLB 4URSA 1AA1B 2XSFA 4AE5A 3FMBA 5GAGI 2JSXA 3C8YA 1SCJB 4C97A 3J7ZT 2R8GA 4KKOA 4JI7F 4NA2A 4PXCA 3C3LA 1GT8A 2QSWA 3TX0A 1UW4A 4M5MA 3BKFA 4E2FB 2IBKA 3KFWX 2MKKA 1E6VB 3DRSB 1R0AA
chains in the Genus database with same CATH topology
1FNOA 1JK9B 2JVRA 5JUMA 1RT6B 5ITHA 2EBGA 4R5PB 2DO4A 3M30A 4A8YA 3HFKA 2EFGA 2B43A 5IM0A 1Z4UA 2AJFE 4UUXA 4EO8A 1UVLA 2NS1B 2VG6B 3MEGB 5IS2A 5FJ4A 4CNZA 1FKPA 3MM9A 2R7QA 4HL9A 2J6UA 4MTPA 1NK9A 3J7A1 3K57A 4A47A 3U1NA 5EDWA 2ZH6A 4AXIA 3RZAA 4WFXA 4FS2A 4MYUA 2MY8A 1RTIA 5CYMB 1ELOA 3GFYA 2VFUA 2CZ4A 4J9RA 3I0RB 2UUBF 3GYXB 4FBTA 5HBMA 1S9FA 2UU9F 5KFWA 4ED6A 3MR2A 5A8KA 5DM6Q 4AUKA 2B9XA 3FFIA 3CD7A 3NS5A 2DNLA 3DHWC 4EFAC 1LWCA 2DD8S 2FHKA 4ZA1A 2MKHA 4DLEA 5KFSA 2CRLA 4DL6A 3KHLA 2KRRA 1F60B 4QYRA 3OL7A 3R5AA 4LF6F 3I56S 1SC6A 2IMOA 4ERDA 3H2LA 2JLFA 1NRKA 3M6WA 3PIPQ 2L41A 1QVFR 4IOCQ 1IKXB 2MPUA 4UUWA 4RBUA 3IR5B 4ZPTR 2MKIA 3P6YC 3H4BA 1BWEA 5KFNA 2MDAA 2JLEA 4NOHA 1UJ5A 1BY9A 1Y3JA 2WW8A 1SJQA 3E8OA 5C25A 2BQUA 1RYRA 3SFUA 2XGPA 2DIVA 5DGAA 1FDNA 2VZ9A 3U7JA 4XDCA 1APSA 2W25A 2FJAB 5KFHA 4M95A 2CQ1A 3OXFA 4FVMA 5A8WB 2HHUA 1DLOB 2NYIA 2XG8A 2MKCA 4NWBA 1FTCA 3NCPA 1SBRA 2NUHA 4YFUA 1VQNS 3OFEA 4PWDB 3F41A 3TRGA 5KT6A 3BJYA 5D4LA 3CC2S 1UVKA 2BUNA 4ECWA 2HW3A 1S1XA 3TO8A 2H9ZA 4X4QA 1Q8IA 3MMCA 2HS4A 3GR0A 2G0CA 4QIWD 4F2RA 4B17A 2XGQA 2DPJA 4EYHB 4FF1A 1ZAWA 1UP1A 1XR7A 1NNDA 4DSIA 3QIPA 3VAHA 2F8MA 3CF5Q 4FXWA 1O8BA 4M5DA 2HVIA 3LF0A 5I42B 3CD5A 3KLIB 4DQRA 3PFEA 2CJAA 4B9NA 1WG4A 1ZM4A 1XK8A 2ZBCA 4K4XA 2IFXA 3BO4A 4UQTA 1UKUA 4E98A 3GFZA 4TYAA 1S6QB 4QIFA 4N47A 2KN4A 2HLUA 2IA0A 2N4CA 2YNFA 4KGKA 2C28A 2DHXA 3DDKA 1A7GE 1YJVA 4Q2MA 2DNYA 4M63A 4DQIA 3VAFA 1DTQA 5BR8F 2MZ1A 5KTQA 2FJVA 5C42A 2FJBB 4LMZA 3CWJA 1O51A 1GH8A 2MKSA 1GTHA 3DLJA 1RKJA 4AL6A 1B0PA 1BQMB 2HMIB 5D77A 1XNRF 4KAIA 1H98A 4QWAA 1S9GA 1TKDA 4O3PA 4QWDA 2CJQA 3I0SB 5J2MB 1XMBA 3IWLA 3UDLA 1IBLF 1OQ3A 4QWEA 2RF2A 2WK4A 4WK3A 4RWXA 3AJ2A 3BO2A 3UW1A 1FHTA 3BGFA 2F40A 3TP2A 2ZDOA 4MK7A 3MEDB 3TVKA 2CQ3A 3DYAB 4OFZA 2MYFA 2AW0A 4F3MA 2DHAA 4C8YA 2FHMA 1ZYQA 3BR8A 3HO1A 4LSNA 5LSRA 4OHYA 5HLFB 1C0TA 4XIUA 1RWUA 2YNGA 5FLXY 1D1UA 1S1VB 1F5BA 4IFVA 2M88A 3EPIA 2AU0A 5I42A 2K3IA 4HVZA 3MD1A 1SL1A 1RT7B 4DV0F 3PACA 4Q5VA 2O5DA 2RDIA 5GAEI 2D3OR 2NZ4A 2E1CA 2KYZA 3ZZRA 2J7UA 4PR6A 4EUVA 3HVRA 2VQFF 5L9NA 2KT2A 6FDRA 1R43A 3QJJA 2OIHA 5G0RB 1FXRA 4J9KA 1TKZA 5G4DA 4DR7F 4PWDA 3CT9A 5I3PA 2ZKTA 2ZM6F 2A2DA 4HLBA 4DS4A 4C4WA 3H2UB 2O67A 1HNZF 4DX8H 1FRHA 2RDJA 1YHQS 4N5SA 4B3TF 2V4JA 3AB2B 3P96A 4JOUA 3JTNA 2LLZA 2GQCA 1VQLS 4DSEA 1S97A 2VG7A 1VK3A 4Y2KA 2F4VF 2YWEA 2B4UA 3TW0A 1R89A 5G0RA 2EBEA 5E3CA 2YX7A 5I3UB 4JI4F 2JH3A 3D0GE 2YKAA 4JV0A 1U26A 4WZQA 2CG4A 3V4MA 3N4WA 3DRRB 4CTAB 2JVOA 1DQ8A 3OSNA 4I1TA 1RT4B 2L9WA 3BGRB 5KT4A 1LWCB 3MDFA 4RNMA 4JV1A 5D3GA 4Y6IA 5KFLA 4A48A 3PDNA 4ED1A 2DHSA 2W4CA 2Y1RI 4LUBA 1TK0A 3NMRA 3LWMA 2I2YA 2L3MA 3KTQA 4ECTA 3J7Z5 5HBMB 2EI5A 1BQNB 2M52A 3VR1A 1TZ0A 4I69A 1H38A 2VPXB 3MEDA 1FO1A 5A6WA 1LW2B 2G1DA 1R8HA 2HS0A 3ZZZA 5LSLA 1YJWS 1SJFA 1MSWD 1S99A 5BYSA 2EFVA 2B6AA 3N9UC 3S7RA 3K8WA 3OUYA 2QA4G 3RRGA 1VRUB 2C3OA 5FDLA 4RKUC 4DFJA 4Q2LA 1SUQB 3C46A 3S01A 2XBPA 4ZPBA 4ZOSA 5LL6d 2GC8A 4F4XA 3BSCA 1TQLA 5KAKA 5J1EB 3KWMA 1U09A 4NCGA 3CJKA 3K5NA 4F4YA 3M8QB 1UA1A 1S72S 3PNIA 4NYPA 4YY3F 1MMDA 4R5PA 2RVJA 3G71S 1N5YB 5EN1A 1X4DA 3DU5A 1SV5B 4WU2A 3TNVA 1TV6A 1ZBTA 2YWGA 5D4NA 2HHHF 1R0AB 2W4PA 2B4PA 2QYCA 1VRUA 2M2BA 4NRUA 3QZ8A 1HBMB 3NCQA 3UQSA 3I6PA 4WU3A 4I7FA 1U4BA 2RU3A 2IC3B 3MGJA 3OHAA 1VMBA 3U1MA 1PC4A 2W9AA 3TA2A 5EUHA 4C3MA 2E9TA 4DL2A 2DGXA 1LK7A 3M8PB 5HROB 2CQ4A 4IOBA 1S9EA 3VAIA 1RISA 5K8NA 2W7PA 1BQXA 4YQWA 1QLNA 1JXEA 1YVFA 1N5QA 2LECA 1RT4A 3BGRA 5KT5A 5J2NA 4A8KA 1F5CA 5A0YB 1C1CB 2OFHX 4FZVA 4G1PA 1VQPS 2IAJB 1Q86T 4DJBA 2RJZA 1HPZA 4RNOA 3CJ3A 2XI3A 3K5PA 2RKIB 2XMJA 5CHCB 4ILMA 1JLQA 1UWBB 1ZPWX 2JFKA 2DR5A 1JKHA 5IFMA 5GAHU 2MGZA 1VQSA 1KOOA 1VQ9S 4BBYA 2R8IA 4DL4A 1HNIA 2WRMA 4DR1F 2V5HG 3M2UB 3OXGA 3GSDA 3C6UA 5KFTA 4MMOA 3B78A 3M2RB 2RUGA 2E7WA 4ATNA 3Q8RB 4N56A 3HZEA 4BC9A 3CCSS 4RW9A 5KFPA 5LXRA 5DLGA 4H4KC 1PSDA 4IG3B 3T5JA 4OLOA 1Z2LA 3MMAA 4DHVA 3SCKE 4LF9F 2D3ZA 1HA1A 2LVWA 2XSJA 1MU2B 1CG2A 3PX6A 1R8CA 2WCXA 2JHEA 5DDRC 3G6ES 1NK0A 5D8HB 1YRUA 3SQGA 3CJ0A 1O0PA 1FERA 3BQ1A 3DFEA 2HHTA 2LXUA 1OQ6A 4KSEB 1IUJA 4QYZJ 4WZMA 4C3LA 2EFQA 1HR0F 3EXCX 3N6LA 1XN9A 2HIQA 4AQYF 2ALZA 1TKTA 2IC3A 2X1FA 2OPQB 3T19A 1LOUA 2BRKA 2P9EA 4OQJA 2Y1IA 1T3NA 3FJ2A 2R2UA 2MZQA 3DRYA 4A8OA 2GHWA 4ZHRB 3ZFVA 1RT3A 3GIMA 3Q22A 2PSZA 1X9MA 2CPYA 1U6FA 1SV5A 4PKDB 4B3OA 2WSFC 2UV8A 1H6KX 2J7KA 2FJWA 2ZH8A 3IFEA 4JUZA 3M8QA 5DETA 3HDSA 2DNKA 1WI6A 4Z37A 1NHVA 5IXUA 4OLPA 1WF2A 1FJGF 3KJVA 4B08A 2IJFA 2J8AA 3AA8A 5KG7A 5DGBA 2VFRA 4EGLA 1DQ9A 2L9DA 4ZHRA 2OLWA 4DSJA 2R7XA 5F8LA 3TI0A 2A1BA 3TAMA 2UVUA 1VQMS 2J9EA 2OPQA 3POTA 2LXIA 3MURP 2CQCA 3I87A 2OD4A 1BQNA 5CYJA 2KT3A 2BOPA 1NB7A 3MR6A 2F9DA 1KFSA 4MFBA 1V3RA 2XS7A 5KFAA 1ZPVA 5HMZA 3DXBA 2CJBA 3CDUA 3IAM9 2HNZA 2ATLA 4G3IA 1K1QA 1RTJB 1S1WB 2A2CA 2M8DB 2KHCA 3ZZTA 4B9TA 3B4MA 2DNZA 5E41A 1WI8A 4JI5F 2KFZA 3AHPA 3ENQA 1W2IA 3MMAB 1TFYA 4WFAQ 3M6VA 3RR7A 5CCLA 3IWNC 2HNDB 1ZOTA 3MTKA 1R7IA 4FF4A 1GAOA 1QAXA 3K5MA 4ECRA 5EGYA 2FVPA 1IQTA 1DHMA 1KEKA 3A8EA 3V4IB 5CZVA 1AXQA 1C4CA 1LW0A 1TK5A 4JI6F 4KV8B 3LP2B 1C1BB 1L5UA 4OL8A 4NYOA 4Q7AA 4QIGA 3PV8A 1RK8A 1CC8A 2DGUA 2RE1A 2Z4PA 3EZUA 3C6TB 1IKXA 4GO5X 3KHRA 2RS2A 1G7CB 3TUIC 4TU9A 5L1JA 2GHPA 2B56A 3QWUA 3CCES 2UUTA 4ID5A 2XO7A 3V6JA 4X4TA 2LKZA 4OJ1A 1HBOA 4DR4F 2IAJA 1VIOA 3PO4A 1KRPA 2W24A 3M05A 3NG8A 1RTHA 3KLVA 3J7YI 2EC0A 4LF7F 1RTJA 1S1WA 2Q1LA 4XAKA 2AGPA 4DV7F 3TAQA 3HM9A 4IH7A 3P5TL 2E44A 4DL5A 5GAHI 3I55S 2B3TB 5J1PA 2ZHBA 1S9EB 5CCMA 5LJ3Y 1N5VA 1DRZA 4DG1A 3DYAA 4M8LA 3OV7A 3CCWA 4K50A 1UJ4A 3POTB 4MIAA 4TY8A 3KLEA 2MZSA 2R7OA 3MFIA 2CJ9A 4CNYA 3BGUA 1RGVA 3UCZP 3SSSA 3H8YA 3B82A 2ROGA 1NJWA 2GIRA 2ROEA 3MEKA 4MIWA 4PXDA 3I0SA 1TV6B 3VQSA 1M5OC 3D1OA 1U2RA 3JYTB 1J5OB 1KONA 3MMBA 3G8SA 3HMJG 1HFEL 3LPYA 3T5LA 1SJ3P 3CD6S 2B4OA 1RT1B 2W8LA 1ROFA 3H20A 4CO1A 4H54A 4LSLA 3KLHB 5DG7A 1Q7YT 4RU2A 2Y0SD 3NAIA 2NPFA 4YB1P 3D0IE 4ZP9A 3Q23A 1NK7A 2IA6A 3CULA 5E0OA 5F8NA 4WKYA 1U45A 4NLGA 5GAEU 1WG5A 2ZH4A 5E3QA 1X5PA 1FDBA 2L9NA 5HMYA 5BYQA 3MI7X 3MAQA 4X65F 2CPZA 1FF2A 2UV8G 1N48A 4HEA9 4ZPVR 2UUWA 1SH3A 3MM8A 3QZ7A 2X1AA 2I38A 2ZNZA 3DLKB 1XBWA 5SUHA 3M32B 2HFZA 3CC7S 2E5GA 5F0WA 2EVZA 4TU7A 3KK1A 4ECXA 3KNGA 4Y0FA 1TKXA 4X4UA 4YOEA 1CC7A 4O3OA 1UJ6A 4O3NA 5GADI 3W2WB 2PDAA 3JSMA 2OPSB 3WZ0A 5IT0A 1LWEB 3M9NB 2RQCA 3F73A 4AL7A 3EYZA 3UNGC 2V9KA 2FY1A 1N6QB 3T9ZA 1HBOB 2EPIA 2ZNYA 4A8WA 3BZQA 3IAS9 5KFBA 5K5MA 4F3QA 1HQEA 4FVCA 5D6GA 3KK3B 1RA7A 3D1QA 2NR0A 4KTQA 2QLXA 2XWYA 3LP2A 2HRYA 3VAJA 1G2EA 1FEHA 2N3LA 4NLWA 4USHA 5A8WA 3GYNA 5DG8A 4NL5A 2J6SA 3C2PA 4N41A 3QLHA 3GG0A 2A10A 3HKWA 1EETB 4F2SA 1LK5A 3DHXA 4IRDA 3CIMA 1FEEA 2VG5A 2VPYB 3LAKA 3UD4P 4O4RA 4HDGA 4ILRA 1NO8A 3KK3A 1JLBA 1YJRA 3HVWA 4MH8A 2FGCA 2MQOA 3OTDA 4I64A 3O2IA 4KFBB 4BC7A 2QSFA 7FD1A 1XWLA 1Y00A 5C24A 3GR1A 4EYIB 4Q43A 3TAPA 1IXKA 1VI7A 2OPSA 3UE2A 3QJLA 1FRJA 5MLCV 1N8RT 4ZMMA 2K7KA 1FXLA 3FSYA 3JSRA 4Y28C 1UETA 2GA7A 2JEIA 2DNPA 4EBCA 2VC0A 3ZZYA 4F8RA 1Q16B 1HL6A 2E29A 2WSEC 3MM8B 2XMUA 2YKOA 5D4PA 4NMLA 3DOLA 4ZVGA 4TNOA 2E1MC 1KLMA 4DQSA 1MROA 4GMKA 4K59A 3LOUA 2JRSA 3GZ7A 3CVKA 3NCRA 3KKFA 2DVIA 2ZVSA 3EUNA 5KFKA 2YQ3A 4QOTA 2YY3A 3PVXA 1S4FA 1XR6A 3DM2B 4GKJF 1FDAA 3QGGA 3CJKB 3TX8A 4I6YA 5L1KA 1XNQF 3L7OA 1X5SA 4ECYA 4ELVA 1NJZA 3L7PA 4ED2A 2SXLA 2UUCF 4DSFA 4X4PA 3X3UA 5KFMA 3CJ4A 3DRSA 2VBXA 2N7CA 3GQCA 4MKAA 5KFFA 1RKIA 2VPZB 5EWGA 2ILZA 4KC5A 2X1GA 5CQGA 2LQBA 1NKEA 4WE1A 1FESA 2WBRA 1X9WA 3PZPA 5KT3A 4I0WA 4U7UK 1EP4A 3ETOA 5KFIA 3GV7B 1GTEA 4OV1A 1JJ4A 3V6KA 1ULRA 2E5IA 2ZUGA 4CO4A 1QE1B 2KT5A 4HH1A 3TVYA 4CIOA 3KLIA 5AXNA 1VRTA 2KXNB 4DL0C 2BZ2A 2QA2A 1JLGB 2LU1A 3O44A 2BVZA 1OPZA 3ZZ0A 2IRXA 2AP6A 4URQU 4OHVA 4M5DB 4IG0B 4CT9A 2KM8B 2XZWA 2KZZA 3AAWB 4QBUA 5M2RA 1L3SA 2ROPA 4WFNQ 5EX0A 5DO2A 4ID5B 3M6UA 4ZP6A 5DDQC 4RW9B 5AXMA 2V4RA 5LMNF 3VAKA 4K4TA 1K9MT 1KR4A 2R2TA 3H98A 3OR1A 5IQQA 1HW8A 2KYXA 1DLOA 4FS1A 3HHNB 2R7UA 2YKNA 4IH5A 3Q0AA 3V4IA 2HWTA 2P6SA 3NNHA 2CPHA 1Q7LB 1JLEA 3ULHA 3QLHB 1P1LA 5EX3A 4C0BA 2LEBA 2OO4A 2MQMA 2EK6A 1JWWA 3T1HF 4TKTA 3MUMP 2JFDA 4ECUA 3MM7A 3I31A 2F1FA 2OD6A 3B4DA 2BQRA 5KG5A 1TL1A 3KK2B 1WHXA 2IYIA 2FGOA 5KFRA 4RWWA 4MK8A 4Y2IA 4X64F 4NLUA 2I1RA 4BWJA 1WACA 4DR5F 1VC0A 1YWXA 2DGQA 5A0YA 2DRBA 4DQPA 3OSPA 3LANA 3TYTA 3MFHA 1K1SA 1G3OA 2GCFA 2C3UA 3W2WA 3JSMB 4P2SA 4HKQA 3FGVA 1PILA 3BB5A 4ZP8A 4O3RA 2AJ4A 1HD1A 2ZFHA 4QR2A 2FC9A 3P49B 2YTCA 3DLGB 1RTDA 3K59A 4QWBA 5HROA 2BE2A 5THWA 2LQ9A 1H7XA 2PEHA 4ES2A 4DF8A 1T03A 4WE1B 4EZ9A 3NNAA 3TAMB 4DFPA 2PT0A 1U1MA 1VQ8S 2DIUA 3THVA 2HHWA <