3WCWA

The structure of a deoxygenated 400 kda hemoglobin provides a more accurate description of the cooperative mechanism of giant hemoglobins: mg bound form
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
146
structure length
146
Chain Sequence
DCNILQRLKVKMQWAKAYGFGTERAKFGNSLWTSIFNYAPDARDLFKSVKSEDMRSPQFKAHIARVIGGLDRVISMFDNEDALNADLEHLKSQHDPRGLDALNFVVFGKALFATVGGQFGVCFDLPAWESCYKVIAMGITGNDMFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a deoxygenated 400 kDa haemoglobin reveals ternary- and quaternary-structural changes of giant haemoglobins
pubmed doi rcsb
molecule tags Oxygen transport
molecule keywords A1 globin chain of giant V2 hemoglobin
total genus 60
structure length 146
sequence length 146
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 3wcwA00
3V2VA 5JDOF 1DUKA 1LA6B 5E83B 1HBBB 1DXUA 4MPMA 5SW7B 1H1XA 1V4XA 2MBWA 1IRDB 1CP0A 3AT6A 1NPGA 5HY8B 3QJCB 3GDJB 3S1JA 1J7SA 3WCWD 4ROLB 5KDQA 5JDOE 2EVPA 3A59A 3TM9A 1YIHB 3R0GA 1QXDA 1CIKA 4JACA 3WCPA 3GOUA 3UHWA 5D1VA 1ABWB 2QSPB 1HBIA 3D17B 3QJEA 4KJTA 1M6MA 1MYGA 3NFEA 2ZSXA 4KN3A 3PELB 3G4WA 2GRZA 1MLJA 2RAOA 1CO8A 1HGCB 1Y46B 3HRWB 1Y7GB 1V5HA 3NG6B 1Y4GB 3QQQA 1DUOA 1FSLA 2VHBA 4ESAB 3ZOLA 1YZIB 5EOHA 1Y0DB 3HENA 2MYCA 1XYEB 1SI4A 3M38A 1NQPB 4F6IA 4HHBB 1YE0A 5B85A 2ZFOA 1NZ3A 4YU3A 1CQ2A 2FRFA 1YEVB 1PMBA 3MJPA 1AJ9A 1DO1A 1R1YB 2VEBA 1J40A 3A5AA 1V07A 2FRKX 3MN0A 2R80A 1UX9A 3E4NA 1Y4QB 1V4WB 1A0ZB 1JP9A 1VRFA 1Y31B 1LJWB 3AQ7A 1V9QA 2H8FB 3MJPB 3E5OA 3PT8A 4PQ6A 1CH1A 1ECNA 1HBHA 3G4UA 2DN1B 2W6XA 5CNCA 2ZT2A 5CNFA 3KUOA 3UHGA 3MKBA 1MLLA 3VREB 3ONZA 1SDLB 1XYEA 3PI3A 4FC3A 3RJ6A 3W4UA 5EYSA 4ZVBA 1O1NB 1Y0CA 1Y0AA 1O1JB 3IC2B 1IDRA 1YENB 4N7PA 1MLKA 2Z85A 3ZJPA 1VXHA 3OO5B 4M4BB 1J7YA 1IBEA 4C0NA 1AJ9B 3UH7A 2MGHA 1NWNA 1BIJA 1Y4GA 3QM6A 1NAZA 1HDAA 2V1GA 2V1HA 1Y31A 2BLJM 2XKIA 1Y4QA 1C7DA 1MWBA 2ZSYA 1YIEB 2IG3A 3OJ1A 3QQRA 1NEJB 3GYSB 3BOMA 1DTMA 4B3WA 4N7NA 3NFEB 1YFFB 2WTGA 1R1XB 1XZVA 3ECLA 1OUUB 1J52A 3BOMB 1NWIA 2NX0A 5AZRA 1YDZA 1R1YA 3W4UB 1ABYA 3U3EA 3MYMA 1MYZA 1BABA 4L7YA 3RJNB 1JEBB 1A0ZA 3G52A 2W6WA 1LH7A 1CQXA 2VLZA 4MQJA 2MYAA 1A3OA 1NZ4A 3LB4A 1WLAA 1YMAA 1GDKA 2GNWA 1YOHA 1LFYB 3OZVA 2G3HA 1HGAB 1MYMA 3VRFB 4HRTB 3WTGA 1S61A 1C7BB 2DXMA 1V4WA 1LHTA 1SDLA 2V1EA 3ASEA 1IWHA 2AA1B 3HXNB 5CNGA 1XQ5A 1BZ0A 1Z8UB 1Y83A 1HBHB 3A0GB 1EMYA 1S0HA 4DC8A 1N9XA 1Y8HB 1MBSA 2QSSB 2LH5A 3LB1A 5CN8A 2GTLC 5JOMA 3ONZB 5EV5A 1HLMA 2ZSPA 4YU4A 2MGBA 3AT5A 1YGFA 3PT7A 2QLSA 3WCWA 3G53A 1CH5A 1GCWB 1XZ4A 4TYXA 1LFQA 1YHEB 1Y7CA 4ESAA 1HACB 1QSHB 2LHBA 2ZT3A 1K1KB 5EYJA 1YG5A 1DXVB 1EW6A 1DXUB 2AA1A 3UHHA 5E83A 1V75A 1FAWB 1OFJA 1F5PA 102MA 4IROA 1K0YB 4M4AA 3ZJNA 4UURA 2G14A 4KMWA 1S5YA 1O1OA 3BA2A 1Y0CB 1JY7A 3WFXA 4IT8A 3IC2A 3QZZA 1DO7A 4U8UA 2ZFOD 1F65A 1MYTA 1RQAA 2ZLWA 4MQHB 2NRMA 5HU6A 1QPWB 3PI9B 5KKKA 1HV4B 2OHAA 1NS9A 1VXAA 1LFQB 3UHCA 4PQCA 1CMYB 1O1KA 1MBCA 1T1NA 6HBWB 3WCVA 3VRGB 2ZS0C 3AQ5A 1AJHA 3K9ZA 1FN3B 105MA 104MA 1LFTB 3HYUB 2HZ1A 2VYZA 2MYBA 1COHB 3BJ3A 3GK9A 5CNDA 1X46A 3DHTA 1CG8B 1B0BA 4XDIA 3D1KB 4MQGB 1YVQA 1O1LA 2GTLD 3H58A 1YG5B 1HGBB 3M39A 1HBRA 5HBIA 2O5TX 1A00B 2ZS0B 3CY5A 4BJAA 3ZJQA 1Y0TA 1NQPA 1S6AA 4F68A 4XS0A 1FHJA 2HBFA 1O1IB 2EF2A 3M3AA 1RQ4B 1CH2A 3NMMB 1O1KB 1T1NB 1Y5KA 1HV4A 2AV0A 4VHBA 2HBDA 3ARKA 1Y5FA 1TU9A 3HYUA 2MYDA 1VXBA 1A6KA 3WHMB 2JHOA 1JF4A 1Y7CB 1BVDA 2NSRA 3DR9A 2ZFBB 1HSYA 4N7OB 3IC0B 2ZFOC 1PBXB 1MOBA 1GBUA 2ZLXB 1S69A 2D60B 1RQAB 2ZLWB 106MA 1K1KA 3UI0A 2PGHB 1AZIA 1Y35B 4ILZA 3LHBA 1OR6A 5CN5A 3SDNA 3MJUA 1NZ2A 2GL3A 1ABWA 3BJ2B 1Y7ZA 5CHQA 1JF3A 1QI8B 2HBDB 1C7BA 2W31A 1J3FA 4MQHA 2HHBB 1C7DB 1BVCA 2BKMA 3KMFC 3HHBA 1GLIA 1S5XA 5HAVA 3WFTA 2CMMA 1U7RA 1HJTA 3BJ1A 108MA 2D5XA 3GQPA 1YVQB 2DN1A 3UHVA 1VXFA 1ECDA 1UVYA 1KFRA 3AT6B 5HY8A 1CH3A 1BZZA 1DWSA 3MVCA 5EQMA 4MBNA 1GDLA 3HEOA 4MQCB 4N8TB 1MBDA 1LH6A 3S66B 1MLNA 1GZXA 3A59B 1LHSA 3BCQA 2ZLUA 1MOCA 1HGAA 1YEUB 1QXEB 3R5IB 1DLWA 5EE4D 2EB9A 1CH7A 1DKEB 1UIWB 1YE2B 1XZ5B 1S56A 1OUTA 5D5RA 3ARJA 3WCUB 1GBVA 1Y83B 2ZWJA 5CMVA 1Y4RA 2VYYA 1YZIA 4MQKA 107MA 4N7NB 2VLXA 1CPWA 2D2NA 2GKMA 2QMBB 2DN3A 1G0BB 1J7WB 1VXDA 1Y09B 1O1JA 3PI8A 4NK1A 2FRIX 2HBEA 2V1JA 5ILMA 4WJG1 2AV3A 4LPIA 1Y8WA 3QJEB 2YRSB 1IT2A 1BIJB 3WCTC 4U8UD 1MLRA 2G0VA 1MNOA 3OO4A 4F4OB 1CBMA 3PI9A 1WMUA 3WHMA 1GCVB 3O89A 1WVPA 1BINA 2GRHA 1UC3A 1VXGA 1J3ZB 1Y45B 2W6VB 1LJWA 1G09A 1UFJA 4N7OA 3LR7A 3UHTA 4M4AB 1LTWA 3SZKA 3LQDB 1MBNA 3ZJJA 3HC9A 5JGGB 5CNEA 2M6ZA 1JY7B 3VREA 1X9FA 1MBAA 3KMFA 3UHRA 1BZ1A 1J3YB 2R4ZA 5B84A 1GDJA 4TWVA 2B7HA 4AVEA 3K3UA 2QLSB 3VHBA 1NS6B 2V1IA 3UHKA 3HF4A 2AUOA 2R4YA 1DXTA 3G4QA 1ECOA 3ZHWA 2HBSA 1COHA 1J3ZA 1L2KA 1FLPA 5CN4A 4NI0B 5C6EB 1X9FC 1EBTA 3GQGB 2AURA 1KR7A 1MGNA 2G0RA 4ZVAA 1A01A 4MAXA 2MGKA 3GLNA 3NL7A 4NXAA 2G0XA 2D6CA 1J41B 3AG0A 4FH7A 4NI1B 2GRFA 3UHUA 2O5SX 1MNIA 1C40B 1GBVB 3DUTB 2LH2A 1Y8IB 3P5QA 1FHJB 1X9FB 3UHYA 4MQKB 2G11A 3DHRA 1HHOA 1X9FD 1X3KA 4F69A 1C40A 1V4UA 1HDAB 2ZFOB 2MGIA 1RSEA 1CH4A 1RVWA 101MA 1JEBA 3CIUB 3DHRB 3ZJSA 2OLPA 1A6GA 2RI4B 1G0AA 2DN2A 3V2ZA 3OVUC 1CO9A 1F63A 5JGGA 1O16A 3LB2A 3UH3A 2M6ZB 2ZLXA 1A0UB 4O4TA 1GBUB 2ZLVA 3NL7B 1Y4VB 2OH8A 1Y2ZB 3D1KA 1ABSA 1YEQB 3EU1B 2R4XA 1NEJA 3QM8A 1VWTB 1Y09A 3PI8B 1J7WA 1V4XB 4FWXA 1Y8HA 1LH2A 3A0GA 1MLMA 2EKUA 2IN4A 1M9PA 5EUIB 1OUUA 2HBSB 3A9MA 4HBIA 1YIHA 1O1IA 2FRJX 3UBVA 3PT7B 1YGFB 3WCTD 1G08A 1XY0B 4MU5A 1MYJA 1G0AB 3HHBB 3TLDA 1SHRA 2Z6NB 1MTKA 3TM3A 1QSHA 2MGDA 1YIEA 3QM9A 1YH9B 3K8BA 4GZGA 2D2NC 1XQ5B 2ZSQA 1HABA 2HCOA 1ITHA 4SDHA 1MLOA 2HHEA 3H57A 2PEGB 3LQDA 3UHSA 1JP8A 3OZUA 4ODCA 2V1FA 2R1HA 1BZZB 1IT3A 1FCSA 2D2NB 3UHIA 3WCUC 1QSIB 1HCOA 1JZMA 1LH1A 2VYWA 1FSXB 1SWMA 3FH9A 3PELA 3HF4B 2GDMA 110MA 2ZLUB 1YHRB 4UIQA 3D1AB 4H2LA 2YRSA 4ROLA 4UZVA 5KDQB 1YE2A 1UIWA 1FN3A 3UH6A 3PI1A 2MGGA 1LFZA 3PI4A 3EOKA 5M3SA 1Y0DA 5HLXA 5F2AA 1I3EA 1MLQA 3WCTB 1LH5A 1FDHA 2O5LX 1O1LB 3HXNA 1SPGB 3UHZA 5CN6A 1YOGA 4U8UB 2VRYA 3LB3A 3QJCA 1DO4A 2HBEB 2GLNA 2ZS1A 1O1NA 2H8DA 4MBAA 1JDOA 1MOHA 3VAUA 1EBCA 3WCVC 4TWUA 1XZUB 3ZOMA 3OO5A 1BUWA 2QSPA 2D2MB 2G12A 2QU0A 5F0BA 4MQIA 2DC3A 1Y45A 2W6VA 4U8UC 1Y4PA 3AQ9A 3AQ6A 2EVKA 1G09B 1CH9A 3ORDA 4NK2A 4X0LB 1VXCA 1XZ2A 1YHUA 1Y5FB 2HBCA 1OR4A 1Y8IA 3BJ1B 1Y2ZA 3S65A 3S48C 1NPFA 2D2MC 1DXVA 2XKHA 1MCYA 2ZSTA 4HRTA 3IC0A 2VLYA 2H8FA 1YH9A 3K8BB 2MGJA 1O1OB 1A6MA 1BZ6A 1J3YA 1BZ1B 1BZRA 2PGHA 3QZXA 1YEOB 4MXLA 1B86B 2QMBA 2R1HB 2Z6SA 111MA 1G9VA 1Y0TB 1NS6A 4MQIB 1GZXB 3G4YA 2QU0B 1MKOA 4OODA 2BK9A 1BUWB 1YEOA 1QI8A 1ASHA 4XS0B 1SHRB 1Y4PB 3WTGB 2MGLA 1XZVB 1IOPA 3ARLA 3BJ3B 1MBIA 1H97A 3IXFA 3S65B 1YGDA 1HBGA 1Y22A 3LR9A 3OK5A 4G51A 5EUIA 1UVXA 1XZ7A 3HRWA 3QJDB 3ODQB 2QSSA 1QPWA 3WI8A 1MYHA 4F6GA 1W92A 2BW9M 2O5OX 1LFTA 3MBAA 3E55A 1MNJA 1Y5KB 2LH6A 1XZUA 4FH6A 4QAUA 2DN2B 3UBCA 1A3NA 1Y46A 1O1PA 1XY0A 1DKEA 3R5IA 3VRGA 3UHDA 1Y4VA 1F5OA 1FAWA 2D5ZB 1MYFA 1K0YA 3G4VA 1V75B 3WCUD 4NS2A 2LH7A 1SPEA 3SDHA 1CIOA 2O5BX 1G0BA 2AUQA 4DC7A 5KERA 3B75B 5IKSA 112MA 1YEVA 2D2MA 2W72C 1HCOB 4HRRA 1DWRA 1MWDA 5MBNA 1Y22B 1CLSB 3E5IA 2SPNA 1XZ2B 1JWNA 1A9WE 2DXMB 3A5BA 3ODQA 4DWUA 2RI4A 1NIHA 1Y4BA 5CN7A 2BLHA 3WCWC 2D5ZA 1MWCA 1M6CA 1HBAA 2HHDB 3GKVA 4ODCB 3NG6A 1Y0WA 3UHQA 1HGBA 1BBBB 1MYIA 1HBSA 1RQ3A 3ZJRA 5ILEA 1D8UA 1HHOB 3UHBA 2MB5A 1HDSB 2R80B 2C0KA 1XZ7B 1UX8A 1LFYA 2Z6TA 1S5YB 3D1AA 103MA 2EKTA 6HBIA 4HSWA 1Y8KA 1YHRA 3AQ8A 2Z8AA 1MZ0A 1YHEA 2ZSNA 2V1KA 2G10A 2MGCA 1Y7DB 2ZS0D 3A5GA 2WY4A 1JZKA 1NXFA 2W6YA 4PQBA 1BABB 4L7YB 1MODA 2ZLTB 1MNHA 1CP5A 2ZS1C 3ECXA 1HGCA 3EOKB 1CLSA 2OHBA 3EDBA 3WFUA 2D5XB 1JL6A 1HACA 3WCVB 2HHDA 4G51B 1NIHB 1Y4BB 2R50A 2W72A 5JDOC 2O58X 2HCOB 1YHUC 2H8DB 1HBSB 1RQ3B 4F6JA 3ECZA 2DN3B 1HDSA 2LH1A 3G46A 4PNJA 1U7SA 1Y35A 4H07A 4FWYA 3UH5A 2MHBB 3SZKB 1IRDA 4O2GA 2G0ZA 1DM1A 3BCQB 3WFWA 5CN9A 1MDNA 1V4UB 5CNBA 1A3OB 1C7CB 1Y8KB 1NGKA 1LUEA 1NZ5A 5AZQA 3D7OA 5MBAA 1CBLA 1THBA 2DHBB 4ROMB 1TESA 2ZLTA 1GCVA 1WMUB 3QJBA 4B4YA 2O5MX 4WCHD 2WTHA 2VM0A 3MKBB 2HZ2A 2XKGA 3DUTA 3FS4A 5EU2A 2HBGA 1VHBA 1GJNA 3GDJA 1Y5JB 1A0UA 2ZFBA 1YFFA 2SPMA 3UHXA 4JYQA 2OIFA 1Y8WB 1QSIA 1A01B 2SPOA 1A4FB 2FAMA 3KUNA 2ZT1A 1BJEA 2QRWA 1I3DA 2ZT4A 1MLFA 1JPBA 2QFKA 2AUPA 4OF9A 3HEPA 3ZJLA 3OO4B 4F4OA 1C7CA 3NMMA 4MQCA 4N8TA 4HRRB 4KMVA 1MTJA 1YE0B 1Y85B 2ZSOA 3O7NA 1LFLA 1DO3A 1Y7GA 1J40B 4NI0A 2NRLA 3MYNA 1OBMA 1ECAA 4DWTA 2BMMA 1XXTB 1DXDA 1PBXA 1Y0WB 2HHEB 3DHTB 1Y5JA 1Y4RB 1HABB 1YVTA 4NXCA 3AT5B 1YDZB 1DTIA 2B7HB 1KD2A 1ABYB 1YMCA 5SW7A 1DWTA 1J7SB 1YVTB 5EE4C 4HSXA 1QXEA 1FDHG 3EU1A 1UMOA 3OZWA 1VWTA 1UFPA 1G9VB 1DXCA 1Y7DA 1HDBA 3GOUB 2HBFB 3WCPB 3ZJHA 2EB8A 1M9PB 3FS4B 2QFNA 3PT8B 1O1PB 2GTLA 3VRFA 2KSCA 5E29A 4IROB 4H0BA 4F6DA 3G4RA 4AVDA 1DXTB 3GQRA 2W72B 3D7OB 1A00A 2ZS0A 3CY5B 1HBRB 1N9FA 109MA 1XXTA 3WCTA 5HLUA 1MLSA 2ZLVB 4WJGA 1LH3A 3GKTA 1YGDB 5ILPA 1Y0AB 3QM5A 1MTIA 1Y4FB 2MGFA 1MLHA 1HLBA 2BNLA 1Y85A 1SDKB 1MLGA 1SI4B 3ED9A 3A2GA 3RGKA 3WCWB 2GKNA 1N9IA 3PI2A 1BZPA 1XZ4B 1HDBB 1MNKA 2XYKA 2R4WA 7HBIA 2LH3A 3S66A 1URVA 4O35A 3QJBB 1CG5B 5C6EA 2ZSZA 3WR1B 3GQPB 4X0LA 1MOAA 3GQGA 3D4XB 1Y01B 3CIUA 5AB8A 2NSSA 3GKVB 2ZSRA 3QJDA 3GQRB 1BBBA 1YHUD 1GVHA 1LA6A 1OJ6A 3UHNA 2ZS1B 4G1VA 4F6BA 3D4XA 1RQ4A 5JDOD 1RPSA 3ZJMA 1JZLA 3QMAA 4FC3B 3S1IA 1Q1FA 2H35A 4G1BA 2D2MD 1Y7ZB 2D2ND 5ILRA 1O1MA 3OGBA 5C6YA 1MLUA 1IBEB 2ZS1D 1JL7A 5KERB 4O1TA 4YU4B 1YHUB 3WCUA 1CG5A 2HBCB 4MXKA 3WR1A 4MQGA 5EETA 1GLIB 1CG8A 1S5XB 1UT0A 1LFZB 5HLQA 1URYA 1YEUA 3EDAA 3MOUA 4ROMA 3UGZA 1BZ0B 4L2MA 3PIAB 2MYEA 4FWZA 3WCVD 1HRMA 1SDKA 2O5QX 3BJ2A 1QXDB 2FALA 4N7PB 1KD2B 1YOIA 1RTEA 4F6FA 1RPSB 2VEEA 5E6EB 1Y4FA 1HBBA 2HHBA 1AJGA 1VXEA 2GNVA 1YCAA 2HZ3A 3M3BA 2SPLA 4O4ZA 4YU3B 1NS9B 1LFVA 4C44A 5E6EA 1A9WA 5HU6B 1YENA 1B86A 1RTXA 1FSXA 2G0SA 5E29B 1XZ5A 1YCBA 1OUTB 1SPGA 2Z6NA 3ZH0A 1YEQA 4NZIA 3ZJIA 1A3NB 4H2LB 3D17A 3ZJOA 1DLYA 3UGYA 2D60A 1HBAB 2E2YA 1VREA 1J41A 3PIAA 1IWHB 4NI1A 2PEGA 2H35B 3NMLA 1YMBA 2ZT0A 3GYSA 2MGAA 1A4FA 2BLIA 3MJUB 2MGMA 1EWAA 3P5QB 1S0HB 5CHRA 2ZSSA 1CMYA 3IA3B 1R1XA 4MQJB 1OFKA 1A6NA 3UHEA 1RVWB 1N9HA 3FH9B 1IRCA 1LFVB 3B75A 1J7YB 6HBWA 4M4BA 2MHBA 1GCWA 1MKOB 2BWHA 4HHBA 1LFLB 1O1MB 2MGEA 1MBOA 2OH9A 1JP6A 2RAOB 3QM7A 1THBB 2DHBA 1JW8A 1XCHA 1G08B 1GDIA 2GTLB
chains in the Genus database with same CATH superfamily
3V2VA 5JDOF 1DUKA 1LA6B 5E83B 1HBBB 1DXUA 4MPMA 5SW7B 1H1XA 1V4XA 2MBWA 1IRDB 1CP0A 3AT6A 1NPGA 5HY8B 3QJCB 3GDJB 3S1JA 1J7SA 3WCWD 4ROLB 5KDQA 5JDOE 2EVPA 3A59A 3TM9A 1YIHB 3R0GA 1QXDA 1CIKA 4PO5B 3PMDA 4JACA 3WCPA 4F0TB 3GOUA 3UHWA 5D1VA 1ABWB 2QSPB 1F99A 1KTPB 1HBIA 3D17B 3QJEA 4KJTA 1M6MA 1MYGA 3NFEA 2ZSXA 4KN3A 3PELB 3G4WA 4Z8KA 2GRZA 1MLJA 2RAOA 1CO8A 1HGCB 1Y46B 3HRWB 2DKAA 1Y7GB 1V5HA 3NG6B 1Y4GB 3QQQA 2JLFA 1DUOA 1FSLA 2VHBA 4ESAB 3ZOLA 1YZIB 5EOHA 1Y0DB 3HENA 2MYCA 1XYEB 1HA7B 1SI4A 3M38A 1NQPB 4F6IA 4HHBB 1YE0A 5B85A 2ZFOA 1NZ3A 3MWNA 3NUHB 4YU3A 1CQ2A 2FRFA 1YEVB 3V57B 1PMBA 3MJPA 1AJ9A 1DO1A 1R1YB 2VEBA 1J40A 3A5AA 1V07A 2FRKX 3MN0A 4LMSB 2R80A 1UX9A 3E4NA 1Y4QB 1V4WB 1A0ZB 1JP9A 1B33A 1VRFA 1Y31B 1LJWB 3AQ7A 1V9QA 2H8FB 3MJPB 3E5OA 3PT8A 4PQ6A 1CH1A 1ECNA 1HBHA 3G4UA 2DN1B 2W6XA 5CNCA 2ZT2A 5CNFA 3KUOA 3UHGA 3MKBA 1MLLA 3VREB 3ONZA 1SDLB 1XYEA 3PI3A 4FC3A 3RJ6A 3W4UA 5EYSA 4ZVBA 1O1NB 1Y0CA 1Y0AA 1O1JB 1KTPA 3IC2B 1IDRA 1YENB 4N7PA 1MLKA 2Z85A 3ZJPA 1VXHA 3OO5B 4M4BB 1J7YA 1IBEA 4C0NA 2V8AB 1AJ9B 3UH7A 2MGHA 1NWNA 1BIJA 1Y4GA 3QM6A 1NAZA 1HDAA 2V1GA 2V1HA 1Y31A 2BLJM 2XKIA 1Y4QA 1C7DA 1MWBA 4GY3B 2ZSYA 1ON7B 1YIEB 2IG3A 3BRPB 3OJ1A 3QQRA 1NEJB 3GYSB 4H0MA 3BOMA 1DTMA 4B3WA 4N7NA 3NFEB 4RMPA 1YFFB 2WTGA 1R1XB 1XZVA 3ECLA 1OUUB 1J52A 3BOMB 1NWIA 2NX0A 5AZRA 1YDZA 1R1YA 3W4UB 1ABYA 3U3EA 3MYMA 1MYZA 1BABA 4L7YA 5FVBA 2X4AA 3RJNB 1JEBB 1A0ZA 3G52A 2W6WA 1LH7A 1CQXA 4ERVA 2VLZA 4BS9A 3PMCA 2X49A 2MYAA 1A3OA 1NZ4A 4MQJA 4AE0A 3LB4A 1COLA 1WLAA 1YMAA 1GDKA 2GNWA 1YOHA 1LFYB 3OZVA 2G3HA 1HGAB 1MYMA 3VRFB 4HRTB 3WTGA 1S61A 1C7BB 2DXMA 1V4WA 1LHTA 1SDLA 2V1EA 3ASEA 1UVIA 1IWHA 2AA1B 3HXNB 4LMXB 5CNGA 1XQ5A 1BZ0A 1GH0B 1Z8UB 1Y83A 3O18B 1HBHB 3A0GB 1EMYA 1S0HA 4DC8A 1N9XA 1Y8HB 1MBSA 2QSSB 3O2CB 2LH5A 2JLGA 3LB1A 5CN8A 4A8OA 2GTLC 5JOMA 3ONZB 1HHTP 5EV5A 1HLMA 2ZSPA 4YU4A 2MGBA 3AT5A 1YGFA 3FEWX 3PT7A 2QLSA 3WCWA 3G53A 3V57A 1CH5A 1GCWB 1XZ4A 4TYXA 1LFQA 1YHEB 1Y7CA 4ESAA 1HACB 1QSHB 2LHBA 1MDTA 2ZT3A 1K1KB 5EYJA 1YG5A 1DXVB 1EW6A 1DXUB 1KN1A 4F0UB 2AA1A 3UHHA 5E83A 1V75A 1FAWB 1OFJA 1F5PA 2VMLA 102MA 4IROA 1K0YB 4M4AA 3ZJNA 4UURA 2G14A 4KMWA 1S5YA 1O1OA 3VNCA 3BA2A 1Y0CB 1JY7A 3WFXA 4IT8A 4Q70A 3IC2A 3QZZA 1DO7A 4U8UA 2ZFOD 1F65A 1MYTA 1RQAA 2ZLWA 4MQHB 2NRMA 5HU6A 1QPWB 3PI9B 5KKKA 1HV4B 2OHAA 1NS9A 1VXAA 1LFQB 3UHCA 4PQCA 1CMYB 1O1KA 1MBCA 1T1NA 1UVMA 6HBWB 3WCVA 3VRGB 2ZS0C 3AQ5A 1AJHA 3K9ZA 1FN3B 105MA 104MA 1LFTB 3HYUB 2HZ1A 2VYZA 2MYBA 1COHB 1JBOA 1EYXB 3BJ3A 3GK9A 5CNDA 1X46A 3DHTA 1CG8B 1B0BA 4XDIA 3D1KB 4MQGB 1YVQA 1O1LA 2GTLD 3H58A 1YG5B 1HGBB 3M39A 1HBRA 5HBIA 2O5TX 1A00B 2ZS0B 3CY5A 4BJAA 4AE1A 3ZJQA 1RH1A 1Y0TA 1NQPA 1S6AA 4F68A 4XS0A 1FHJA 2HBFA 1O1IB 2EF2A 3M3AA 1RQ4B 1CH2A 3NMMB 1O1KB 1T1NB 3L0FA 1Y5KA 1HV4A 2AV0A 4VHBA 2HBDA 1LIAB 2C7KB 1XG0C 3ARKA 1Y5FA 4A8QA 1TU9A 3HYUA 2MYDA 1VXBA 1A6KA 3WHMB 2JHOA 1JF4A 1Y7CB 1BVDA 2NSRA 5B13A 3DR9A 2ZFBB 1HSYA 4N7OB 3IC0B 2ZFOC 1PBXB 1MOBA 1GBUA 2VJRB 2ZLXB 1S69A 2D60B 1RQAB 2ZLWB 106MA 1K1KA 3UI0A 2PGHB 1AZIA 1Y35B 4ILZA 1UVJA 3LHBA 1OR6A 1XF6C 5CN5A 4ETUA 3SDNA 3MJUA 1NZ2A 2GL3A 1ABWA 3BJ2B 4XXKA 1Y7ZA 5CHQA 4ETVA 3L0FB 1JF3A 1QI8B 2HBDB 1C7BA 2W31A 1J3FA 4MQHA 2HHBB 1C7DB 1BVCA 1B8DA 2BKMA 3KMFC 3HHBA 1GLIA 1S5XA 5HAVA 3WFTA 2CMMA 1DDTA 1U7RA 1HJTA 3BJ1A 108MA 4A8FA 2D5XA 3GQPA 1YVQB 2DN1A 4HH1A 3UHVA 1VXFA 1ECDA 1UVYA 1KFRA 1I7YB 3AT6B 5HY8A 1CH3A 1BZZA 4L1EB 1DWSA 3MVCA 5EQMA 4MBNA 1GDLA 3HEOA 4MQCB 4N8TB 1MBDA 1LH6A 3S66B 1MLNA 1GZXA 3A59B 1LHSA 3BCQA 2ZLUA 1MOCA 1HGAA 1YEUB 1QXEB 3R5IB 1DLWA 5EE4D 2EB9A 1CH7A 5AQDM 1DKEB 1UIWB 1YE2B 1XZ5B 2VJHA 1S56A 1ALLA 1OUTA 5D5RA 3ARJA 1LIAA 3WCUB 1GBVA 1Y83B 3O18A 2ZWJA 5CMVA 1Y4RA 2VYYA 1YZIA 4MQKA 107MA 4LM6B 4N7NB 2VLXA 2JL9A 1CPWA 2D2NA 2GKMA 2QMBB 2DN3A 1CIIA 1G0BB 1J7WB 1VXDA 1Y09B 4NK1A 1O1JA 3PI8A 2FRIX 2HBEA 2V1JA 2UUNA 2VJRA 5ILMA 4WJG1 2AV3A 4LPIA 1Y8WA 3QJEB 4ERTA 2YRSB 1IT2A 1BIJB 3WCTC 4U8UD 2DKDA 1MLRA 2G0VA 2C7LA 5AQDA 1MNOA 3OO4A 4F4OB 1CBMA 3PI9A 1WMUA 3WHMA 1GCVB 3O89A 1WVPA 1BINA 1ON7A 2GRHA 3ZTAA 1UC3A 1VXGA 1J3ZB 1Y45B 2W6VB 1LJWA 1G09A 1UFJA 2VMLB 4N7OA 3LR7A 3UHTA 4M4AB 1LTWA 3SZKA 3LQDB 1MBNA 3ZJJA 3HC9A 2UULA 5JGGB 5CNEA 2M6ZA 1JY7B 3VREA 1X9FA 1MBAA 3KMFA 3UHRA 1BZ1A 1J3YB 2R4ZA 5B84A 1GDJA 4TWVA 4GXEB 2B7HA 4AVEA 3K3UA 2QLSB 3VHBA 1NS6B 2V1IA 3UHKA 3HF4A 2AUOA 2C7JA 2R4YA 1DXTA 3G4QA 1ECOA 3ZHWA 2HBSA 1COHA 1J3ZA 1L2KA 1FLPA 5CN4A 4NI0B 5C6EB 1X9FC 1EBTA 3GQGB 2AURA 1KR7A 1MGNA 2G0RA 4ZVAA 1A01A 4MAXA 2MGKA 3GLNA 3NL7A 4NXAA 2G0XA 2D6CA 1J41B 3AG0A 4FH7A 4NI1B 2GRFA 3UHUA 2O5SX 1MNIA 1C40B 1GBVB 4TMAB 3DUTB 2LH2A 1Y8IB 3P5QA 1FHJB 1X9FB 3UHYA 4MQKB 2G11A 3DHRA 1HHOA 1X9FD 1X3KA 4F69A 1C40A 4XXIA 1V4UA 1HDAB 2ZFOB 1XDTT 2MGIA 1RSEA 1CH4A 1RVWA 101MA 1JEBA 2J96A 3CIUB 3DHRB 3ZJSA 2OLPA 4A8WA 1A6GA 2RI4B 1G0AA 2DN2A 3V2ZA 3OVUC 2UUMX 4ZIZA 1CO9A 1F63A 1CPCB 5JGGA 1O16A 3LB2A 3UH3A 2M6ZB 2ZLXA 1A0UB 4O4TA 1GBUB 2ZLVA 3NL7B 1Y4VB 2OH8A 1Y2ZB 3D1KA 1ABSA 1YEQB 3EU1B 2R4XA 1NEJA 3QM8A 1VWTB 1Y09A 3PI8B 1J7WA 1V4XB 4FWXA 1Y8HA 2UUNB 1LH2A 3A0GA 1MLMA 2EKUA 2IN4A 2VJTB 1M9PA 5EUIB 1OUUA 2HBSB 3A9MA 4HBIA 1YIHA 1O1IA 2FRJX 3UBVA 3PT7B 1YGFB 3WCTD 1G08A 1XY0B 4MU5A 1MYJA 3KVSB 1G0AB 3HHBB 1WACA 3TLDA 1SHRA 2Z6NB 1MTKA 3TM3A 1QSHA 2MGDA 1YIEA 3QM9A 4GY3A 1YH9B 3K8BA 4GZGA 2D2NC 1XQ5B 2ZSQA 1HABA 2HCOA 1ITHA 4SDHA 1HI1A 1MLOA 2HHEA 3H57A 2PEGB 3LQDA 3UHSA 1JP8A 1KN1B 1UVLA 3OZUA 4ODCA 4N6SB 2V1FA 2R1HA 1BZZB 1IT3A 3DBJB 1FCSA 2D2NB 3UHIA 3WCUC 1QSIB 1HCOA 1JZMA 1LH1A 2VYWA 1FSXB 1SWMA 5FVBM 3FH9A 3PELA 3HF4B 2GDMA 110MA 2ZLUB 1YHRB 4UIQA 3DBJA 3D1AB 4H2LA 2VJHB 2YRSA 4ROLA 4UZVA 5KDQB 1YE2A 1UIWA 1FN3A 3UH6A 3PI1A 2MGGA 1LFZA 3PI4A 3EOKA 5M3SA 1Y0DA 5HLXA 1F99B 5F2AA 1I3EA 1MLQA 3WCTB 1LH5A 1FDHA 2O5LX 1O1LB 3HXNA 1SPGB 3UHZA 5CN6A 1YOGA 4U8UB 2VRYA 3LB3A 3QJCA 1DO4A 2HBEB 2GLNA 2ZS1A 1O1NA 2H8DA 4MBAA 1JDOA 1MOHA 3VAUA 1EBCA 3WCVC 2V8AA 4TWUA 1XZUB 3ZOMA 3OO5A 1BUWA 2QSPA 2D2MB 2G12A 2QU0A 5F0BA 4MQIA 2DC3A 1Y45A 2W6VA 4U8UC 1Y4PA 3AQ9A 3AQ6A 2EVKA 1G09B 1CH9A 3ORDA 4NK2A 4X0LB 1VXCA 1XZ2A 1YHUA 1Y5FB 2HBCA 1OR4A 1Y8IA 4BJUA 3BJ1B 1Y2ZA 3S65A 3S48C 1NPFA 2D2MC 1DXVA 2XKHA 2YSKA 1MCYA 2ZSTA 4HRTA 3IC0A 2VLYA 2H8FA 1YH9A 3K8BB 2MGJA 4GXEA 1O1OB 1A6MA 1BZ6A 1J3YA 1BZ1B 1BZRA 2PGHA 3QZXA 1YEOB 4MXLA 1B86B 2QMBA 2R1HB 2Z6SA 111MA 1G9VA 1Y0TB 1NS6A 4MQIB 1GZXB 3G4YA 2QU0B 1MKOA 4OODA 2BK9A 1BUWB 1YEOA 1QI8A 1ASHA 4XS0B 1SHRB 1Y4PB 3WTGB 2MGLA 1XZVB 1IOPA 3ARLA 1EYXA 3BJ3B 1JBOB 1MBIA 1H97A 3IXFA 3S65B 1YGDA 4A8MP 1HBGA 1Y22A 3LR9A 3OK5A 4G51A 5EUIA 3BRPA 1UVXA 1XZ7A 3HRWA 3QJDB 1HI0P 3ODQB 2QSSA 1QPWA 3WI8A 1MYHA 3O2CA 4F6GA 1W92A 2BW9M 2O5OX 1LFTA 2C7LB 3MBAA 3E55A 1MNJA 1Y5KB 2LH6A 1XZUA 4FH6A 4QAUA 2DN2B 3UBCA 1A3NA 1Y46A 1O1PA 1XY0A 1DKEA 3R5IA 3VRGA 3UHDA 1Y4VA 1F5OA 1FAWA 2D5ZB 1MYFA 1K0YA 3G4VA 1V75B 3WCUD 4NS2A 2LH7A 1SPEA 4L1EA 3SDHA 1CIOA 2O5BX 2VJTA 1G0BA 2AUQA 2WCQA 4DC7A 5KERA 3B75B 5IKSA 112MA 1YEVA 2D2MA 2W72C 1HCOB 4HRRA 1DWRA 1MWDA 5MBNA 1Y22B 1CLSB 3E5IA 2SPNA 1XZ2B 1JWNA 1A9WE 1UVNA 1HI8A 2DXMB 3A5BA 4A8SA 4ZIZB 3ODQA 4DWUA 2RI4A 1NIHA 1Y4BA 5CN7A 2BLHA 3WCWC 2D5ZA 1MWCA 1M6CA 1HBAA 2HHDB 3GKVA 4ODCB 3NG6A 1Y0WA 3UHQA 1HGBA 1BBBB 1MYIA 1HBSA 1RQ3A 3ZJRA 5ILEA 1D8UA 1HHOB 3UHBA 2MB5A 1HDSB 2R80B 2C0KA 1XZ7B 1UX8A 1LFYA 2Z6TA 4PO5A 1S5YB 3D1AA 103MA 2EKTA 6HBIA 4HSWA 1Y8KA 1YHRA 2BV8A 3AQ8A 2Z8AA 1MZ0A 1YHEA 2ZSNA 2V1KA 2G10A 2MGCA 1Y7DB 2ZS0D 3A5GA 2WY4A 1JZKA 1NXFA 2W6YA 4PQBA 1BABB 4L7YB 2UUMA 4HH0A 1MNHA 2ZLTB 1MODA 1CP5A 2ZS1C 3ECXA 1HGCA 3EOKB 1CLSA 2OHBA 3EDBA 3WFUA 2D5XB 1JL6A 1HACA 3WCVB 1HHSA 2HHDA 4G51B 1NIHB 1Y4BB 2R50A 2W72A 5JDOC 4F0UA 2O58X 2HCOB 1YHUC 2H8DB 1HBSB 1RQ3B 4F6JA 3ECZA 2DN3B 1HDSA 2LH1A 3G46A 4PNJA 1U7SA 1Y35A 4H07A 4FWYA 3UH5A 2MHBB 3SZKB 1IRDA 4O2GA 2G0ZA 1DM1A 3BCQB 3WFWA 5CN9A 1MDNA 1V4UB 5CNBA 1A3OB 1C7CB 1Y8KB 2BV8B 1NGKA 1LUEA 1NZ5A 5AZQA 3D7OA 5MBAA 1CBLA 1THBA 2DHBB 4ROMB 1TESA 2ZLTA 1GCVA 1WMUB 3QJBA 4B4YA 2O5MX 4WCHD 2WTHA 2C7KA 2VM0A 3MKBB 2HZ2A 2XKGA 3DUTA 3FS4A 5EU2A 1QGWC 2HBGA 4H0MB 1VHBA 1GJNA 3GDJA 1Y5JB 1A0UA 2ZFBA 1YFFA 2SPMA 3UHXA 4JYQA 2OIFA 1Y8WB 1QSIA 1A01B 2SPOA 1A4FB 2FAMA 3KUNA 2ZT1A 1BJEA 1I7YA 2QRWA 4YJJB 1I3DA 2ZT4A 1MLFA 1JPBA 2QFKA 2AUPA 4OF9A 3HEPA 3ZJLA 3OO4B 4B02A 4F4OA 1C7CA 3NMMA 4MQCA 4N8TA 4HRRB 4KMVA 1MTJA 1YE0B 1Y85B 4ESUA 2ZSOA 3O7NA 1LFLA 1DO3A 1Y7GA 1J40B 4NI0A 2UULD 2NRLA 3MYNA 1OBMA 1ECAA 4DWTA 2BMMA 1XXTB 2UULB 1DXDA 1PBXA 1Y0WB 2HHEB 3DHTB 1Y5JA 4A8YA 1Y4RB 1HABB 1YVTA 4NXCA 3AT5B 1YDZB 1DTIA 2B7HB 1HA7A 1KD2A 4Q70B 1ABYB 1YMCA 5SW7A 1DWTA 1J7SB 1YVTB 5EE4C 4HSXA 2UULC 1QXEA 1FDHG 3EU1A 1SGKA 1UMOA 3OZWA 2I88A 1VWTA 1UFPA 1G9VB 1DXCA 1Y7DA 3GUQA 1HDBA 3GOUB 2HBFB 3WCPB 3ZJHA 2EB8A 1M9PB 3FS4B 2QFNA 1B8DB 3PT8B 1O1PB 2GTLA 3VRFA 2KSCA 5E29A 4IROB 4H0BA 4F6DA 3G4RA 4AVDA 1UVKA 3GIOA 1DXTB 3GQRA 2W72B 3D7OB 1A00A 2ZS0A 3CY5B 1HBRB 1N9FA 109MA 1XXTA 3WCTA 5HLUA 1MLSA 2ZLVB 4WJGA 1LH3A 3GKTA 1YGDB 5ILPA 1Y0AB 3QM5A 1MTIA 1Y4FB 2MGFA 1MLHA 1HLBA 2BNLA 1Y85A 1SDKB 1MLGA 1SI4B 3ED9A 3A2GA 3RGKA 3WCWB 2GKNA 1N9IA 3PI2A 1BZPA 1XZ4B 1PHNA 1TOXA 1HDBB 1MNKA 2XYKA 2R4WA 7HBIA 2LH3A 3S66A 1URVA 4O35A 3QJBB 1CG5B 5C6EA 2ZSZA 3WR1B 3GQPB 4X0LA 2UUMB 1MOAA 3GQGA 3D4XB 1Y01B 3CIUA 5AB8A 2NSSA 3GKVB 2ZSRA 3QJDA 3GQRB 1BBBA 1YHUD 1GVHA 1LA6A 1OJ6A 3UHNA 2ZS1B 4G1VA 4F6BA 3D4XA 1RQ4A 2DKCA 5JDOD 2WCRA 1RPSA 3ZJMA 1JZLA 3QMAA 4FC3B 3S1IA 1Q1FA 3RQRA 2H35A 4G1BA 2D2MD 1Y7ZB 2D2ND 5ILRA 1O1MA 3OGBA 5C6YA 1MLUA 3V58A 1IBEB 1PHNB 1JL7A 2ZS1D 4A8KA 4F0TA 5KERB 4O1TA 4YU4B 2UUND 1YHUB 3WCUA 1CG5A 2HBCB 4MXKA 3WR1A 4MQGA 5EETA 1GLIB 1CG8A 1S5XB 1UT0A 1LFZB 5HLQA 1URYA 1YEUA 3EDAA 3MOUA 4ROMA 2C7JB 3UGZA 1BZ0B 1GH0A 4L2MA 3PIAB 2MYEA 4FWZA 3WCVD 1HRMA 4RMPB 1SDKA 2O5QX 3BJ2A 1QXDB 2FALA 4N7PB 1KD2B 1YOIA 1RTEA 4F6FA 1RPSB 2VEEA 5E6EB 1Y4FA 1HBBA 2HHBA 1AJGA 1VXEA 2UULH 2GNVA 3V58B 1YCAA 1A87A 2HZ3A 3M3BA 2SPLA 4O4ZA 4YU3B 1NS9B 1LFVA 4C44A 5E6EA 1A9WA 5HU6B 1YENA 1B86A 1RTXA 1FSXA 2G0SA 5E29B 1XZ5A 1YCBA 1ALLB 1OUTB 1B33B 1SPGA 2Z6NA 3ZH0A 1YEQA 4NZIA 3ZJIA 1A3NB 4H2LB 3D17A 3ZJOA 1DLYA 3UGYA 1NY9A 1HBAB 2D60A 2E2YA 1VREA 1J41A 3PIAA 1IWHB 4NI1A 2PEGA 2H35B 4YJJA 1CPCA 3NMLA 1YMBA 2ZT0A 3GYSA 2MGAA 1A4FA 2BLIA 3MJUB 2MGMA 1EWAA 3P5QB 1S0HB 5CHRA 2ZSSA 1CMYA 3IA3B 1R1XA 4MQJB 3KVSA 1OFKA 1A6NA 5B13G 3UHEA 1RVWB 1N9HA 3FH9B 1IRCA 1LFVB 3B75A 1J7YB 4ETTA 6HBWA 4M4BA 2MHBA 1GCWA 1MKOB 2BWHA 4HHBA 1LFLB 1O1MB 2MGEA 1MBOA 2OH9A 1JP6A 2RAOB 3QM7A 4Z8KB 4N6SA 1THBB 2DHBA 1JW8A 1XCHA 1G08B 1GDIA 3LQ9A 2GTLB 1F0LA
chains in the Genus database with same CATH topology
3V2VA 5JDOF 1DUKA 1LA6B 5E83B 1HBBB 1DXUA 4MPMA 5SW7B 1H1XA 1V4XA 2MBWA 1IRDB 1CP0A 3AT6A 1NPGA 5HY8B 3QJCB 3GDJB 3S1JA 1J7SA 3WCWD 4ROLB 5KDQA 5JDOE 2EVPA 3A59A 3TM9A 1YIHB 3R0GA 1QXDA 1CIKA 4JACA 3WCPA 3GOUA 3UHWA 5D1VA 1ABWB 2QSPB 1HBIA 3D17B 3QJEA 4KJTA 1M6MA 1MYGA 3NFEA 2ZSXA 4KN3A 3PELB 3G4WA 2GRZA 1MLJA 2RAOA 1CO8A 1HGCB 1Y46B 3HRWB 1Y7GB 1V5HA 3NG6B 1Y4GB 3QQQA 1DUOA 1FSLA 2VHBA 4ESAB 3ZOLA 1YZIB 5EOHA 1Y0DB 3HENA 2MYCA 1XYEB 1SI4A 3M38A 1NQPB 4F6IA 4HHBB 1YE0A 5B85A 2ZFOA 1NZ3A 4YU3A 1CQ2A 2FRFA 1YEVB 1PMBA 3MJPA 1AJ9A 1DO1A 1R1YB 2VEBA 1J40A 3A5AA 1V07A 2FRKX 3MN0A 2R80A 1UX9A 3E4NA 1Y4QB 1V4WB 1A0ZB 1JP9A 1VRFA 1Y31B 1LJWB 3AQ7A 1V9QA 2H8FB 3MJPB 3E5OA 3PT8A 4PQ6A 1CH1A 1ECNA 1HBHA 3G4UA 2DN1B 2W6XA 5CNCA 2ZT2A 5CNFA 3KUOA 3UHGA 3MKBA 1MLLA 3VREB 3ONZA 1SDLB 1XYEA 3PI3A 4FC3A 3RJ6A 3W4UA 5EYSA 4ZVBA 1O1NB 1Y0CA 1Y0AA 1O1JB 3IC2B 1IDRA 1YENB 4N7PA 1MLKA 2Z85A 3ZJPA 1VXHA 3OO5B 4M4BB 1J7YA 1IBEA 4C0NA 1AJ9B 3UH7A 2MGHA 1NWNA 1BIJA 1Y4GA 3QM6A 1NAZA 1HDAA 2V1GA 2V1HA 1Y31A 2BLJM 2XKIA 1Y4QA 1C7DA 1MWBA 2ZSYA 1YIEB 2IG3A 3OJ1A 3QQRA 1NEJB 3GYSB 3BOMA 1DTMA 4B3WA 4N7NA 3NFEB 1YFFB 2WTGA 1R1XB 1XZVA 3ECLA 1OUUB 1J52A 3BOMB 1NWIA 2NX0A 5AZRA 1YDZA 1R1YA 3W4UB 1ABYA 3U3EA 3MYMA 1MYZA 1BABA 4L7YA 3RJNB 1JEBB 1A0ZA 3G52A 2W6WA 1LH7A 1CQXA 2VLZA 4MQJA 2MYAA 1A3OA 1NZ4A 3LB4A 1WLAA 1YMAA 1GDKA 2GNWA 1YOHA 1LFYB 3OZVA 2G3HA 1HGAB 1MYMA 3VRFB 4HRTB 3WTGA 1S61A 1C7BB 2DXMA 1V4WA 1LHTA 1SDLA 2V1EA 3ASEA 1IWHA 2AA1B 3HXNB 5CNGA 1XQ5A 1BZ0A 1Z8UB 1Y83A 1HBHB 3A0GB 1EMYA 1S0HA 4DC8A 1N9XA 1Y8HB 1MBSA 2QSSB 2LH5A 3LB1A 5CN8A 2GTLC 5JOMA 3ONZB 5EV5A 1HLMA 2ZSPA 4YU4A 2MGBA 3AT5A 1YGFA 3PT7A 2QLSA 3WCWA 3G53A 1CH5A 1GCWB 1XZ4A 4TYXA 1LFQA 1YHEB 1Y7CA 4ESAA 1HACB 1QSHB 2LHBA 2ZT3A 1K1KB 5EYJA 1YG5A 1DXVB 1EW6A 1DXUB 2AA1A 3UHHA 5E83A 1V75A 1FAWB 1OFJA 1F5PA 102MA 4IROA 1K0YB 4M4AA 3ZJNA 4UURA 2G14A 4KMWA 1S5YA 1O1OA 3BA2A 1Y0CB 1JY7A 3WFXA 4IT8A 3IC2A 3QZZA 1DO7A 4U8UA 2ZFOD 1F65A 1MYTA 1RQAA 2ZLWA 4MQHB 2NRMA 5HU6A 1QPWB 3PI9B 5KKKA 1HV4B 2OHAA 1NS9A 1VXAA 1LFQB 3UHCA 4PQCA 1CMYB 1O1KA 1MBCA 1T1NA 6HBWB 3WCVA 3VRGB 2ZS0C 3AQ5A 1AJHA 3K9ZA 1FN3B 105MA 104MA 1LFTB 3HYUB 2HZ1A 2VYZA 2MYBA 1COHB 3BJ3A 3GK9A 5CNDA 1X46A 3DHTA 1CG8B 1B0BA 4XDIA 3D1KB 4MQGB 1YVQA 1O1LA 2GTLD 3H58A 1YG5B 1HGBB 3M39A 1HBRA 5HBIA 2O5TX 1A00B 2ZS0B 3CY5A 4BJAA 3ZJQA 1Y0TA 1NQPA 1S6AA 4F68A 4XS0A 1FHJA 2HBFA 1O1IB 2EF2A 3M3AA 1RQ4B 1CH2A 3NMMB 1O1KB 1T1NB 1Y5KA 1HV4A 2AV0A 4VHBA 2HBDA 3ARKA 1Y5FA 1TU9A 3HYUA 2MYDA 1VXBA 1A6KA 3WHMB 2JHOA 1JF4A 1Y7CB 1BVDA 2NSRA 3DR9A 2ZFBB 1HSYA 4N7OB 3IC0B 2ZFOC 1PBXB 1MOBA 1GBUA 2ZLXB 1S69A 2D60B 1RQAB 2ZLWB 106MA 1K1KA 3UI0A 2PGHB 1AZIA 1Y35B 4ILZA 3LHBA 1OR6A 5CN5A 3SDNA 3MJUA 1NZ2A 2GL3A 1ABWA 3BJ2B 1Y7ZA 5CHQA 1JF3A 1QI8B 2HBDB 1C7BA 2W31A 1J3FA 4MQHA 2HHBB 1C7DB 1BVCA 2BKMA 3KMFC 3HHBA 1GLIA 1S5XA 5HAVA 3WFTA 2CMMA 1U7RA 1HJTA 3BJ1A 108MA 2D5XA 3GQPA 1YVQB 2DN1A 3UHVA 1VXFA 1ECDA 1UVYA 1KFRA 3AT6B 5HY8A 1CH3A 1BZZA 1DWSA 3MVCA 5EQMA 4MBNA 1GDLA 3HEOA 4MQCB 4N8TB 1MBDA 1LH6A 3S66B 1MLNA 1GZXA 3A59B 1LHSA 3BCQA 2ZLUA 1MOCA 1HGAA 1YEUB 1QXEB 3R5IB 1DLWA 5EE4D 2EB9A 1CH7A 1DKEB 1UIWB 1YE2B 1XZ5B 1S56A 1OUTA 5D5RA 3ARJA 3WCUB 1GBVA 1Y83B 2ZWJA 5CMVA 1Y4RA 2VYYA 1YZIA 4MQKA 107MA 4N7NB 2VLXA 1CPWA 2D2NA 2GKMA 2QMBB 2DN3A 1G0BB 1J7WB 1VXDA 1Y09B 1O1JA 3PI8A 4NK1A 2FRIX 2HBEA 2V1JA 5ILMA 4WJG1 2AV3A 4LPIA 1Y8WA 3QJEB 2YRSB 1IT2A 1BIJB 3WCTC 4U8UD 1MLRA 2G0VA 1MNOA 3OO4A 4F4OB 1CBMA 3PI9A 1WMUA 3WHMA 1GCVB 3O89A 1WVPA 1BINA 2GRHA 1UC3A 1VXGA 1J3ZB 1Y45B 2W6VB 1LJWA 1G09A 1UFJA 4N7OA 3LR7A 3UHTA 4M4AB 1LTWA 3SZKA 3LQDB 1MBNA 3ZJJA 3HC9A 5JGGB 5CNEA 2M6ZA 1JY7B 3VREA 1X9FA 1MBAA 3KMFA 3UHRA 1BZ1A 1J3YB 2R4ZA 5B84A 1GDJA 4TWVA 2B7HA 4AVEA 3K3UA 2QLSB 3VHBA 1NS6B 2V1IA 3UHKA 3HF4A 2AUOA 2R4YA 1DXTA 3G4QA 1ECOA 3ZHWA 2HBSA 1COHA 1J3ZA 1L2KA 1FLPA 5CN4A 4NI0B 5C6EB 1X9FC 1EBTA 3GQGB 2AURA 1KR7A 1MGNA 2G0RA 4ZVAA 1A01A 4MAXA 2MGKA 3GLNA 3NL7A 4NXAA 2G0XA 2D6CA 1J41B 3AG0A 4FH7A 4NI1B 2GRFA 3UHUA 2O5SX 1MNIA 1C40B 1GBVB 3DUTB 2LH2A 1Y8IB 3P5QA 1FHJB 1X9FB 3UHYA 4MQKB 2G11A 3DHRA 1HHOA 1X9FD 1X3KA 4F69A 1C40A 1V4UA 1HDAB 2ZFOB 2MGIA 1RSEA 1CH4A 1RVWA 101MA 1JEBA 3CIUB 3DHRB 3ZJSA 2OLPA 1A6GA 2RI4B 1G0AA 2DN2A 3V2ZA 3OVUC 1CO9A 1F63A 5JGGA 1O16A 3LB2A 3UH3A 2M6ZB 2ZLXA 1A0UB 4O4TA 1GBUB 2ZLVA 3NL7B 1Y4VB 2OH8A 1Y2ZB 3D1KA 1ABSA 1YEQB 3EU1B 2R4XA 1NEJA 3QM8A 1VWTB 1Y09A 3PI8B 1J7WA 1V4XB 4FWXA 1Y8HA 1LH2A 3A0GA 1MLMA 2EKUA 2IN4A 1M9PA 5EUIB 1OUUA 2HBSB 3A9MA 4HBIA 1YIHA 1O1IA 2FRJX 3UBVA 3PT7B 1YGFB 3WCTD 1G08A 1XY0B 4MU5A 1MYJA 1G0AB 3HHBB 3TLDA 1SHRA 2Z6NB 1MTKA 3TM3A 1QSHA 2MGDA 1YIEA 3QM9A 1YH9B 3K8BA 4GZGA 2D2NC 1XQ5B 2ZSQA 1HABA 2HCOA 1ITHA 4SDHA 1MLOA 2HHEA 3H57A 2PEGB 3LQDA 3UHSA 1JP8A 3OZUA 4ODCA 2V1FA 2R1HA 1BZZB 1IT3A 1FCSA 2D2NB 3UHIA 3WCUC 1QSIB 1HCOA 1JZMA 1LH1A 2VYWA 1FSXB 1SWMA 3FH9A 3PELA 3HF4B 2GDMA 110MA 2ZLUB 1YHRB 4UIQA 3D1AB 4H2LA 2YRSA 4ROLA 4UZVA 5KDQB 1YE2A 1UIWA 1FN3A 3UH6A 3PI1A 2MGGA 1LFZA 3PI4A 3EOKA 5M3SA 1Y0DA 5HLXA 5F2AA 1I3EA 1MLQA 3WCTB 1LH5A 1FDHA 2O5LX 1O1LB 3HXNA 1SPGB 3UHZA 5CN6A 1YOGA 4U8UB 2VRYA 3LB3A 3QJCA 1DO4A 2HBEB 2GLNA 2ZS1A 1O1NA 2H8DA 4MBAA 1JDOA 1MOHA 3VAUA 1EBCA 3WCVC 4TWUA 1XZUB 3ZOMA 3OO5A 1BUWA 2QSPA 2D2MB 2G12A 2QU0A 5F0BA 4MQIA 2DC3A 1Y45A 2W6VA 4U8UC 1Y4PA 3AQ9A 3AQ6A 2EVKA 1G09B 1CH9A 3ORDA 4NK2A 4X0LB 1VXCA 1XZ2A 1YHUA 1Y5FB 2HBCA 1OR4A 1Y8IA 3BJ1B 1Y2ZA 3S65A 3S48C 1NPFA 2D2MC 1DXVA 2XKHA 1MCYA 2ZSTA 4HRTA 3IC0A 2VLYA 2H8FA 1YH9A 3K8BB 2MGJA 1O1OB 1A6MA 1BZ6A 1J3YA 1BZ1B 1BZRA 2PGHA 3QZXA 1YEOB 4MXLA 1B86B 2QMBA 2R1HB 2Z6SA 111MA 1G9VA 1Y0TB 1NS6A 4MQIB 1GZXB 3G4YA 2QU0B 1MKOA 4OODA 2BK9A 1BUWB 1YEOA 1QI8A 1ASHA 4XS0B 1SHRB 1Y4PB 3WTGB 2MGLA 1XZVB 1IOPA 3ARLA 3BJ3B 1MBIA 1H97A 3IXFA 3S65B 1YGDA 1HBGA 1Y22A 3LR9A 3OK5A 4G51A 5EUIA 1UVXA 1XZ7A 3HRWA 3QJDB 3ODQB 2QSSA 1QPWA 3WI8A 1MYHA 4F6GA 1W92A 2BW9M 2O5OX 1LFTA 3MBAA 3E55A 1MNJA 1Y5KB 2LH6A 1XZUA 4FH6A 4QAUA 2DN2B 3UBCA 1A3NA 1Y46A 1O1PA 1XY0A 1DKEA 3R5IA 3VRGA 3UHDA 1Y4VA 1F5OA 1FAWA 2D5ZB 1MYFA 1K0YA 3G4VA 1V75B 3WCUD 4NS2A 2LH7A 1SPEA 3SDHA 1CIOA 2O5BX 1G0BA 2AUQA 4DC7A 5KERA 3B75B 5IKSA 112MA 1YEVA 2D2MA 2W72C 1HCOB 4HRRA 1DWRA 1MWDA 5MBNA 1Y22B 1CLSB 3E5IA 2SPNA 1XZ2B 1JWNA 1A9WE 2DXMB 3A5BA 3ODQA 4DWUA 2RI4A 1NIHA 1Y4BA 5CN7A 2BLHA 3WCWC 2D5ZA 1MWCA 1M6CA 1HBAA 2HHDB 3GKVA 4ODCB 3NG6A 1Y0WA 3UHQA 1HGBA 1BBBB 1MYIA 1HBSA 1RQ3A 3ZJRA 5ILEA 1D8UA 1HHOB 3UHBA 2MB5A 1HDSB 2R80B 2C0KA 1XZ7B 1UX8A 1LFYA 2Z6TA 1S5YB 3D1AA 103MA 2EKTA 6HBIA 4HSWA 1Y8KA 1YHRA 3AQ8A 2Z8AA 1MZ0A 1YHEA 2ZSNA 2V1KA 2G10A 2MGCA 1Y7DB 2ZS0D 3A5GA 2WY4A 1JZKA 1NXFA 2W6YA 4PQBA 1BABB 4L7YB 1MODA 2ZLTB 1MNHA 1CP5A 2ZS1C 3ECXA 1HGCA 3EOKB 1CLSA 2OHBA 3EDBA 3WFUA 2D5XB 1JL6A 1HACA 3WCVB 2HHDA 4G51B 1NIHB 1Y4BB 2R50A 2W72A 5JDOC 2O58X 2HCOB 1YHUC 2H8DB 1HBSB 1RQ3B 4F6JA 3ECZA 2DN3B 1HDSA 2LH1A 3G46A 4PNJA 1U7SA 1Y35A 4H07A 4FWYA 3UH5A 2MHBB 3SZKB 1IRDA 4O2GA 2G0ZA 1DM1A 3BCQB 3WFWA 5CN9A 1MDNA 1V4UB 5CNBA 1A3OB 1C7CB 1Y8KB 1NGKA 1LUEA 1NZ5A 5AZQA 3D7OA 5MBAA 1CBLA 1THBA 2DHBB 4ROMB 1TESA 2ZLTA 1GCVA 1WMUB 3QJBA 4B4YA 2O5MX 4WCHD 2WTHA 2VM0A 3MKBB 2HZ2A 2XKGA 3DUTA 3FS4A 5EU2A 2HBGA 1VHBA 1GJNA 3GDJA 1Y5JB 1A0UA 2ZFBA 1YFFA 2SPMA 3UHXA 4JYQA 2OIFA 1Y8WB 1QSIA 1A01B 2SPOA 1A4FB 2FAMA 3KUNA 2ZT1A 1BJEA 2QRWA 1I3DA 2ZT4A 1MLFA 1JPBA 2QFKA 2AUPA 4OF9A 3HEPA 3ZJLA 3OO4B 4F4OA 1C7CA 3NMMA 4MQCA 4N8TA 4HRRB 4KMVA 1MTJA 1YE0B 1Y85B 2ZSOA 3O7NA 1LFLA 1DO3A 1Y7GA 1J40B 4NI0A 2NRLA 3MYNA 1OBMA 1ECAA 4DWTA 2BMMA 1XXTB 1DXDA 1PBXA 1Y0WB 2HHEB 3DHTB 1Y5JA 1Y4RB 1HABB 1YVTA 4NXCA 3AT5B 1YDZB 1DTIA 2B7HB 1KD2A 1ABYB 1YMCA 5SW7A 1DWTA 1J7SB 1YVTB 5EE4C 4HSXA 1QXEA 1FDHG 3EU1A 1UMOA 3OZWA 1VWTA 1UFPA 1G9VB 1DXCA 1Y7DA 1HDBA 3GOUB 2HBFB 3WCPB 3ZJHA 2EB8A 1M9PB 3FS4B 2QFNA 3PT8B 1O1PB 2GTLA 3VRFA 2KSCA 5E29A 4IROB 4H0BA 4F6DA 3G4RA 4AVDA 1DXTB 3GQRA 2W72B 3D7OB 1A00A 2ZS0A 3CY5B 1HBRB 1N9FA 109MA 1XXTA 3WCTA 5HLUA 1MLSA 2ZLVB 4WJGA 1LH3A 3GKTA 1YGDB 5ILPA 1Y0AB 3QM5A 1MTIA 1Y4FB 2MGFA 1MLHA 1HLBA 2BNLA 1Y85A 1SDKB 1MLGA 1SI4B 3ED9A 3A2GA 3RGKA 3WCWB 2GKNA 1N9IA 3PI2A 1BZPA 1XZ4B 1HDBB 1MNKA 2XYKA 2R4WA 7HBIA 2LH3A 3S66A 1URVA 4O35A 3QJBB 1CG5B 5C6EA 2ZSZA 3WR1B 3GQPB 4X0LA 1MOAA 3GQGA 3D4XB 1Y01B 3CIUA 5AB8A 2NSSA 3GKVB 2ZSRA 3QJDA 3GQRB 1BBBA 1YHUD 1GVHA 1LA6A 1OJ6A 3UHNA 2ZS1B 4G1VA 4F6BA 3D4XA 1RQ4A 5JDOD 1RPSA 3ZJMA 1JZLA 3QMAA 4FC3B 3S1IA 1Q1FA 2H35A 4G1BA 2D2MD 1Y7ZB 2D2ND 5ILRA 1O1MA 3OGBA 5C6YA 1MLUA 1IBEB 2ZS1D 1JL7A 5KERB 4O1TA 4YU4B 1YHUB 3WCUA 1CG5A 2HBCB 4MXKA 3WR1A 4MQGA 5EETA 1GLIB 1CG8A 1S5XB 1UT0A 1LFZB 5HLQA 1URYA 1YEUA 3EDAA 3MOUA 4ROMA 3UGZA 1BZ0B 4L2MA 3PIAB 2MYEA 4FWZA 3WCVD 1HRMA 1SDKA 2O5QX 3BJ2A 1QXDB 2FALA 4N7PB 1KD2B 1YOIA 1RTEA 4F6FA 1RPSB 2VEEA 5E6EB 1Y4FA 1HBBA 2HHBA 1AJGA 1VXEA 2GNVA 1YCAA 2HZ3A 3M3BA 2SPLA 4O4ZA 4YU3B 1NS9B 1LFVA 4C44A 5E6EA 1A9WA 5HU6B 1YENA 1B86A 1RTXA 1FSXA 2G0SA 5E29B 1XZ5A 1YCBA 1OUTB 1SPGA 2Z6NA 3ZH0A 1YEQA 4NZIA 3ZJIA 1A3NB 4H2LB 3D17A 3ZJOA 1DLYA 3UGYA 2D60A 1HBAB 2E2YA 1VREA 1J41A 3PIAA 1IWHB 4NI1A 2PEGA 2H35B 3NMLA 1YMBA 2ZT0A 3GYSA 2MGAA 1A4FA 2BLIA 3MJUB 2MGMA 1EWAA 3P5QB 1S0HB 5CHRA 2ZSSA 1CMYA 3IA3B 1R1XA 4MQJB 1OFKA 1A6NA 3UHEA 1RVWB 1N9HA 3FH9B 1IRCA 1LFVB 3B75A 1J7YB 6HBWA 4M4BA 2MHBA 1GCWA 1MKOB 2BWHA 4HHBA 1LFLB 1O1MB 2MGEA 1MBOA 2OH9A 1JP6A 2RAOB 3QM7A 1THBB 2DHBA 1JW8A 1XCHA 1G08B 1GDIA 2GTLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2V A;  5JDO F;  1DUK A;  1LA6 B;  5E83 B;  1HBB B;  1DXU A;  4MPM A;  5SW7 B;  1H1X A;  1V4X A;  2MBW A;  1IRD B;  1CP0 A;  3AT6 A;  1NPG A;  5HY8 B;  3QJC B;  3GDJ B;  3S1J A;  1J7S A;  3WCW D;  4ROL B;  5KDQ A;  5JDO E;  2EVP A;  3A59 A;  3TM9 A;  1YIH B;  3R0G A;  1QXD A;  1CIK A;  4JAC A;  3WCP A;  3GOU A;  3UHW A;  5D1V A;  1ABW B;  2QSP B;  1HBI A;  3D17 B;  3QJE A;  4KJT A;  1M6M A;  1MYG A;  3NFE A;  2ZSX A;  4KN3 A;  3PEL B;  3G4W A;  2GRZ A;  1MLJ A;  2RAO A;  1CO8 A;  1HGC B;  1Y46 B;  3HRW B;  1Y7G B;  1V5H A;  3NG6 B;  1Y4G B;  3QQQ A;  1DUO A;  1FSL A;  2VHB A;  4ESA B;  3ZOL A;  1YZI B;  5EOH A;  1Y0D B;  3HEN A;  2MYC A;  1XYE B;  1SI4 A;  3M38 A;  1NQP B;  4F6I A;  4HHB B;  1YE0 A;  5B85 A;  2ZFO A;  1NZ3 A;  4YU3 A;  1CQ2 A;  2FRF A;  1YEV B;  1PMB A;  3MJP A;  1AJ9 A;  1DO1 A;  1R1Y B;  2VEB A;  1J40 A;  3A5A A;  1V07 A;  2FRK X;  3MN0 A;  2R80 A;  1UX9 A;  3E4N A;  1Y4Q B;  1V4W B;  1A0Z B;  1JP9 A;  1VRF A;  1Y31 B;  1LJW B;  3AQ7 A;  1V9Q A;  2H8F B;  3MJP B;  3E5O A;  3PT8 A;  4PQ6 A;  1CH1 A;  1ECN A;  1HBH A;  3G4U A;  2DN1 B;  2W6X A;  5CNC A;  2ZT2 A;  5CNF A;  3KUO A;  3UHG A;  3MKB A;  1MLL A;  3VRE B;  3ONZ A;  1SDL B;  1XYE A;  3PI3 A;  4FC3 A;  3RJ6 A;  3W4U A;  5EYS A;  4ZVB A;  1O1N B;  1Y0C A;  1Y0A A;  1O1J B;  3IC2 B;  1IDR A;  1YEN B;  4N7P A;  1MLK A;  2Z85 A;  3ZJP A;  1VXH A;  3OO5 B;  4M4B B;  1J7Y A;  1IBE A;  4C0N A;  1AJ9 B;  3UH7 A;  2MGH A;  1NWN A;  1BIJ A;  1Y4G A;  3QM6 A;  1NAZ A;  1HDA A;  2V1G A;  2V1H A;  1Y31 A;  2BLJ M;  2XKI A;  1Y4Q A;  1C7D A;  1MWB A;  2ZSY A;  1YIE B;  2IG3 A;  3OJ1 A;  3QQR A;  1NEJ B;  3GYS B;  3BOM A;  1DTM A;  4B3W A;  4N7N A;  3NFE B;  1YFF B;  2WTG A;  1R1X B;  1XZV A;  3ECL A;  1OUU B;  1J52 A;  3BOM B;  1NWI A;  2NX0 A;  5AZR A;  1YDZ A;  1R1Y A;  3W4U B;  1ABY A;  3U3E A;  3MYM A;  1MYZ A;  1BAB A;  4L7Y A;  3RJN B;  1JEB B;  1A0Z A;  3G52 A;  2W6W A;  1LH7 A;  1CQX A;  2VLZ A;  4MQJ A;  2MYA A;  1A3O A;  1NZ4 A;  3LB4 A;  1WLA A;  1YMA A;  1GDK A;  2GNW A;  1YOH A;  1LFY B;  3OZV A;  2G3H A;  1HGA B;  1MYM A;  3VRF B;  4HRT B;  3WTG A;  1S61 A;  1C7B B;  2DXM A;  1V4W A;  1LHT A;  1SDL A;  2V1E A;  3ASE A;  1IWH A;  2AA1 B;  3HXN B;  5CNG A;  1XQ5 A;  1BZ0 A;  1Z8U B;  1Y83 A;  1HBH B;  3A0G B;  1EMY A;  1S0H A;  4DC8 A;  1N9X A;  1Y8H B;  1MBS A;  2QSS B;  2LH5 A;  3LB1 A;  5CN8 A;  2GTL C;  5JOM A;  3ONZ B;  5EV5 A;  1HLM A;  2ZSP A;  4YU4 A;  2MGB A;  3AT5 A;  1YGF A;  3PT7 A;  2QLS A;  3WCW A;  3G53 A;  1CH5 A;  1GCW B;  1XZ4 A;  4TYX A;  1LFQ A;  1YHE B;  1Y7C A;  4ESA A;  1HAC B;  1QSH B;  2LHB A;  2ZT3 A;  1K1K B;  5EYJ A;  1YG5 A;  1DXV B;  1EW6 A;  1DXU B;  2AA1 A;  3UHH A;  5E83 A;  1V75 A;  1FAW B;  1OFJ A;  1F5P A;  102M A;  4IRO A;  1K0Y B;  4M4A A;  3ZJN A;  4UUR A;  2G14 A;  4KMW A;  1S5Y A;  1O1O A;  3BA2 A;  1Y0C B;  1JY7 A;  3WFX A;  4IT8 A;  3IC2 A;  3QZZ A;  1DO7 A;  4U8U A;  2ZFO D;  1F65 A;  1MYT A;  1RQA A;  2ZLW A;  4MQH B;  2NRM A;  5HU6 A;  1QPW B;  3PI9 B;  5KKK A;  1HV4 B;  2OHA A;  1NS9 A;  1VXA A;  1LFQ B;  3UHC A;  4PQC A;  1CMY B;  1O1K A;  1MBC A;  1T1N A;  6HBW B;  3WCV A;  3VRG B;  2ZS0 C;  3AQ5 A;  1AJH A;  3K9Z A;  1FN3 B;  105M A;  104M A;  1LFT B;  3HYU B;  2HZ1 A;  2VYZ A;  2MYB A;  1COH B;  3BJ3 A;  3GK9 A;  5CND A;  1X46 A;  3DHT A;  1CG8 B;  1B0B A;  4XDI A;  3D1K B;  4MQG B;  1YVQ A;  1O1L A;  2GTL D;  3H58 A;  1YG5 B;  1HGB B;  3M39 A;  1HBR A;  5HBI A;  2O5T X;  1A00 B;  2ZS0 B;  3CY5 A;  4BJA A;  3ZJQ A;  1Y0T A;  1NQP A;  1S6A A;  4F68 A;  4XS0 A;  1FHJ A;  2HBF A;  1O1I B;  2EF2 A;  3M3A A;  1RQ4 B;  1CH2 A;  3NMM B;  1O1K B;  1T1N B;  1Y5K A;  1HV4 A;  2AV0 A;  4VHB A;  2HBD A;  3ARK A;  1Y5F A;  1TU9 A;  3HYU A;  2MYD A;  1VXB A;  1A6K A;  3WHM B;  2JHO A;  1JF4 A;  1Y7C B;  1BVD A;  2NSR A;  3DR9 A;  2ZFB B;  1HSY A;  4N7O B;  3IC0 B;  2ZFO C;  1PBX B;  1MOB A;  1GBU A;  2ZLX B;  1S69 A;  2D60 B;  1RQA B;  2ZLW B;  106M A;  1K1K A;  3UI0 A;  2PGH B;  1AZI A;  1Y35 B;  4ILZ A;  3LHB A;  1OR6 A;  5CN5 A;  3SDN A;  3MJU A;  1NZ2 A;  2GL3 A;  1ABW A;  3BJ2 B;  1Y7Z A;  5CHQ A;  1JF3 A;  1QI8 B;  2HBD B;  1C7B A;  2W31 A;  1J3F A;  4MQH A;  2HHB B;  1C7D B;  1BVC A;  2BKM A;  3KMF C;  3HHB A;  1GLI A;  1S5X A;  5HAV A;  3WFT A;  2CMM A;  1U7R A;  1HJT A;  3BJ1 A;  108M A;  2D5X A;  3GQP A;  1YVQ B;  2DN1 A;  3UHV A;  1VXF A;  1ECD A;  1UVY A;  1KFR A;  3AT6 B;  5HY8 A;  1CH3 A;  1BZZ A;  1DWS A;  3MVC A;  5EQM A;  4MBN A;  1GDL A;  3HEO A;  4MQC B;  4N8T B;  1MBD A;  1LH6 A;  3S66 B;  1MLN A;  1GZX A;  3A59 B;  1LHS A;  3BCQ A;  2ZLU A;  1MOC A;  1HGA A;  1YEU B;  1QXE B;  3R5I B;  1DLW A;  5EE4 D;  2EB9 A;  1CH7 A;  1DKE B;  1UIW B;  1YE2 B;  1XZ5 B;  1S56 A;  1OUT A;  5D5R A;  3ARJ A;  3WCU B;  1GBV A;  1Y83 B;  2ZWJ A;  5CMV A;  1Y4R A;  2VYY A;  1YZI A;  4MQK A;  107M A;  4N7N B;  2VLX A;  1CPW A;  2D2N A;  2GKM A;  2QMB B;  2DN3 A;  1G0B B;  1J7W B;  1VXD A;  1Y09 B;  1O1J A;  3PI8 A;  4NK1 A;  2FRI X;  2HBE A;  2V1J A;  5ILM A;  4WJG 1;  2AV3 A;  4LPI A;  1Y8W A;  3QJE B;  2YRS B;  1IT2 A;  1BIJ B;  3WCT C;  4U8U D;  1MLR A;  2G0V A;  1MNO A;  3OO4 A;  4F4O B;  1CBM A;  3PI9 A;  1WMU A;  3WHM A;  1GCV B;  3O89 A;  1WVP A;  1BIN A;  2GRH A;  1UC3 A;  1VXG A;  1J3Z B;  1Y45 B;  2W6V B;  1LJW A;  1G09 A;  1UFJ A;  4N7O A;  3LR7 A;  3UHT A;  4M4A B;  1LTW A;  3SZK A;  3LQD B;  1MBN A;  3ZJJ A;  3HC9 A;  5JGG B;  5CNE A;  2M6Z A;  1JY7 B;  3VRE A;  1X9F A;  1MBA A;  3KMF A;  3UHR A;  1BZ1 A;  1J3Y B;  2R4Z A;  5B84 A;  1GDJ A;  4TWV A;  2B7H A;  4AVE A;  3K3U A;  2QLS B;  3VHB A;  1NS6 B;  2V1I A;  3UHK A;  3HF4 A;  2AUO A;  2R4Y A;  1DXT A;  3G4Q A;  1ECO A;  3ZHW A;  2HBS A;  1COH A;  1J3Z A;  1L2K A;  1FLP A;  5CN4 A;  4NI0 B;  5C6E B;  1X9F C;  1EBT A;  3GQG B;  2AUR A;  1KR7 A;  1MGN A;  2G0R A;  4ZVA A;  1A01 A;  4MAX A;  2MGK A;  3GLN A;  3NL7 A;  4NXA A;  2G0X A;  2D6C A;  1J41 B;  3AG0 A;  4FH7 A;  4NI1 B;  2GRF A;  3UHU A;  2O5S X;  1MNI A;  1C40 B;  1GBV B;  3DUT B;  2LH2 A;  1Y8I B;  3P5Q A;  1FHJ B;  1X9F B;  3UHY A;  4MQK B;  2G11 A;  3DHR A;  1HHO A;  1X9F D;  1X3K A;  4F69 A;  1C40 A;  1V4U A;  1HDA B;  2ZFO B;  2MGI A;  1RSE A;  1CH4 A;  1RVW A;  101M A;  1JEB A;  3CIU B;  3DHR B;  3ZJS A;  2OLP A;  1A6G A;  2RI4 B;  1G0A A;  2DN2 A;  3V2Z A;  3OVU C;  1CO9 A;  1F63 A;  5JGG A;  1O16 A;  3LB2 A;  3UH3 A;  2M6Z B;  2ZLX A;  1A0U B;  4O4T A;  1GBU B;  2ZLV A;  3NL7 B;  1Y4V B;  2OH8 A;  1Y2Z B;  3D1K A;  1ABS A;  1YEQ B;  3EU1 B;  2R4X A;  1NEJ A;  3QM8 A;  1VWT B;  1Y09 A;  3PI8 B;  1J7W A;  1V4X B;  4FWX A;  1Y8H A;  1LH2 A;  3A0G A;  1MLM A;  2EKU A;  2IN4 A;  1M9P A;  5EUI B;  1OUU A;  2HBS B;  3A9M A;  4HBI A;  1YIH A;  1O1I A;  2FRJ X;  3UBV A;  3PT7 B;  1YGF B;  3WCT D;  1G08 A;  1XY0 B;  4MU5 A;  1MYJ A;  1G0A B;  3HHB B;  3TLD A;  1SHR A;  2Z6N B;  1MTK A;  3TM3 A;  1QSH A;  2MGD A;  1YIE A;  3QM9 A;  1YH9 B;  3K8B A;  4GZG A;  2D2N C;  1XQ5 B;  2ZSQ A;  1HAB A;  2HCO A;  1ITH A;  4SDH A;  1MLO A;  2HHE A;  3H57 A;  2PEG B;  3LQD A;  3UHS A;  1JP8 A;  3OZU A;  4ODC A;  2V1F A;  2R1H A;  1BZZ B;  1IT3 A;  1FCS A;  2D2N B;  3UHI A;  3WCU C;  1QSI B;  1HCO A;  1JZM A;  1LH1 A;  2VYW A;  1FSX B;  1SWM A;  3FH9 A;  3PEL A;  3HF4 B;  2GDM A;  110M A;  2ZLU B;  1YHR B;  4UIQ A;  3D1A B;  4H2L A;  2YRS A;  4ROL A;  4UZV A;  5KDQ B;  1YE2 A;  1UIW A;  1FN3 A;  3UH6 A;  3PI1 A;  2MGG A;  1LFZ A;  3PI4 A;  3EOK A;  5M3S A;  1Y0D A;  5HLX A;  5F2A A;  1I3E A;  1MLQ A;  3WCT B;  1LH5 A;  1FDH A;  2O5L X;  1O1L B;  3HXN A;  1SPG B;  3UHZ A;  5CN6 A;  1YOG A;  4U8U B;  2VRY A;  3LB3 A;  3QJC A;  1DO4 A;  2HBE B;  2GLN A;  2ZS1 A;  1O1N A;  2H8D A;  4MBA A;  1JDO A;  1MOH A;  3VAU A;  1EBC A;  3WCV C;  4TWU A;  1XZU B;  3ZOM A;  3OO5 A;  1BUW A;  2QSP A;  2D2M B;  2G12 A;  2QU0 A;  5F0B A;  4MQI A;  2DC3 A;  1Y45 A;  2W6V A;  4U8U C;  1Y4P A;  3AQ9 A;  3AQ6 A;  2EVK A;  1G09 B;  1CH9 A;  3ORD A;  4NK2 A;  4X0L B;  1VXC A;  1XZ2 A;  1YHU A;  1Y5F B;  2HBC A;  1OR4 A;  1Y8I A;  3BJ1 B;  1Y2Z A;  3S65 A;  3S48 C;  1NPF A;  2D2M C;  1DXV A;  2XKH A;  1MCY A;  2ZST A;  4HRT A;  3IC0 A;  2VLY A;  2H8F A;  1YH9 A;  3K8B B;  2MGJ A;  1O1O B;  1A6M A;  1BZ6 A;  1J3Y A;  1BZ1 B;  1BZR A;  2PGH A;  3QZX A;  1YEO B;  4MXL A;  1B86 B;  2QMB A;  2R1H B;  2Z6S A;  111M A;  1G9V A;  1Y0T B;  1NS6 A;  4MQI B;  1GZX B;  3G4Y A;  2QU0 B;  1MKO A;  4OOD A;  2BK9 A;  1BUW B;  1YEO A;  1QI8 A;  1ASH A;  4XS0 B;  1SHR B;  1Y4P B;  3WTG B;  2MGL A;  1XZV B;  1IOP A;  3ARL A;  3BJ3 B;  1MBI A;  1H97 A;  3IXF A;  3S65 B;  1YGD A;  1HBG A;  1Y22 A;  3LR9 A;  3OK5 A;  4G51 A;  5EUI A;  1UVX A;  1XZ7 A;  3HRW A;  3QJD B;  3ODQ B;  2QSS A;  1QPW A;  3WI8 A;  1MYH A;  4F6G A;  1W92 A;  2BW9 M;  2O5O X;  1LFT A;  3MBA A;  3E55 A;  1MNJ A;  1Y5K B;  2LH6 A;  1XZU A;  4FH6 A;  4QAU A;  2DN2 B;  3UBC A;  1A3N A;  1Y46 A;  1O1P A;  1XY0 A;  1DKE A;  3R5I A;  3VRG A;  3UHD A;  1Y4V A;  1F5O A;  1FAW A;  2D5Z B;  1MYF A;  1K0Y A;  3G4V A;  1V75 B;  3WCU D;  4NS2 A;  2LH7 A;  1SPE A;  3SDH A;  1CIO A;  2O5B X;  1G0B A;  2AUQ A;  4DC7 A;  5KER A;  3B75 B;  5IKS A;  112M A;  1YEV A;  2D2M A;  2W72 C;  1HCO B;  4HRR A;  1DWR A;  1MWD A;  5MBN A;  1Y22 B;  1CLS B;  3E5I A;  2SPN A;  1XZ2 B;  1JWN A;  1A9W E;  2DXM B;  3A5B A;  3ODQ A;  4DWU A;  2RI4 A;  1NIH A;  1Y4B A;  5CN7 A;  2BLH A;  3WCW C;  2D5Z A;  1MWC A;  1M6C A;  1HBA A;  2HHD B;  3GKV A;  4ODC B;  3NG6 A;  1Y0W A;  3UHQ A;  1HGB A;  1BBB B;  1MYI A;  1HBS A;  1RQ3 A;  3ZJR A;  5ILE A;  1D8U A;  1HHO B;  3UHB A;  2MB5 A;  1HDS B;  2R80 B;  2C0K A;  1XZ7 B;  1UX8 A;  1LFY A;  2Z6T A;  1S5Y B;  3D1A A;  103M A;  2EKT A;  6HBI A;  4HSW A;  1Y8K A;  1YHR A;  3AQ8 A;  2Z8A A;  1MZ0 A;  1YHE A;  2ZSN A;  2V1K A;  2G10 A;  2MGC A;  1Y7D B;  2ZS0 D;  3A5G A;  2WY4 A;  1JZK A;  1NXF A;  2W6Y A;  4PQB A;  1BAB B;  4L7Y B;  1MOD A;  2ZLT B;  1MNH A;  1CP5 A;  2ZS1 C;  3ECX A;  1HGC A;  3EOK B;  1CLS A;  2OHB A;  3EDB A;  3WFU A;  2D5X B;  1JL6 A;  1HAC A;  3WCV B;  2HHD A;  4G51 B;  1NIH B;  1Y4B B;  2R50 A;  2W72 A;  5JDO C;  2O58 X;  2HCO B;  1YHU C;  2H8D B;  1HBS B;  1RQ3 B;  4F6J A;  3ECZ A;  2DN3 B;  1HDS A;  2LH1 A;  3G46 A;  4PNJ A;  1U7S A;  1Y35 A;  4H07 A;  4FWY A;  3UH5 A;  2MHB B;  3SZK B;  1IRD A;  4O2G A;  2G0Z A;  1DM1 A;  3BCQ B;  3WFW A;  5CN9 A;  1MDN A;  1V4U B;  5CNB A;  1A3O B;  1C7C B;  1Y8K B;  1NGK A;  1LUE A;  1NZ5 A;  5AZQ A;  3D7O A;  5MBA A;  1CBL A;  1THB A;  2DHB B;  4ROM B;  1TES A;  2ZLT A;  1GCV A;  1WMU B;  3QJB A;  4B4Y A;  2O5M X;  4WCH D;  2WTH A;  2VM0 A;  3MKB B;  2HZ2 A;  2XKG A;  3DUT A;  3FS4 A;  5EU2 A;  2HBG A;  1VHB A;  1GJN A;  3GDJ A;  1Y5J B;  1A0U A;  2ZFB A;  1YFF A;  2SPM A;  3UHX A;  4JYQ A;  2OIF A;  1Y8W B;  1QSI A;  1A01 B;  2SPO A;  1A4F B;  2FAM A;  3KUN A;  2ZT1 A;  1BJE A;  2QRW A;  1I3D A;  2ZT4 A;  1MLF A;  1JPB A;  2QFK A;  2AUP A;  4OF9 A;  3HEP A;  3ZJL A;  3OO4 B;  4F4O A;  1C7C A;  3NMM A;  4MQC A;  4N8T A;  4HRR B;  4KMV A;  1MTJ A;  1YE0 B;  1Y85 B;  2ZSO A;  3O7N A;  1LFL A;  1DO3 A;  1Y7G A;  1J40 B;  4NI0 A;  2NRL A;  3MYN A;  1OBM A;  1ECA A;  4DWT A;  2BMM A;  1XXT B;  1DXD A;  1PBX A;  1Y0W B;  2HHE B;  3DHT B;  1Y5J A;  1Y4R B;  1HAB B;  1YVT A;  4NXC A;  3AT5 B;  1YDZ B;  1DTI A;  2B7H B;  1KD2 A;  1ABY B;  1YMC A;  5SW7 A;  1DWT A;  1J7S B;  1YVT B;  5EE4 C;  4HSX A;  1QXE A;  1FDH G;  3EU1 A;  1UMO A;  3OZW A;  1VWT A;  1UFP A;  1G9V B;  1DXC A;  1Y7D A;  1HDB A;  3GOU B;  2HBF B;  3WCP B;  3ZJH A;  2EB8 A;  1M9P B;  3FS4 B;  2QFN A;  3PT8 B;  1O1P B;  2GTL A;  3VRF A;  2KSC A;  5E29 A;  4IRO B;  4H0B A;  4F6D A;  3G4R A;  4AVD A;  1DXT B;  3GQR A;  2W72 B;  3D7O B;  1A00 A;  2ZS0 A;  3CY5 B;  1HBR B;  1N9F A;  109M A;  1XXT A;  3WCT A;  5HLU A;  1MLS A;  2ZLV B;  4WJG A;  1LH3 A;  3GKT A;  1YGD B;  5ILP A;  1Y0A B;  3QM5 A;  1MTI A;  1Y4F B;  2MGF A;  1MLH A;  1HLB A;  2BNL A;  1Y85 A;  1SDK B;  1MLG A;  1SI4 B;  3ED9 A;  3A2G A;  3RGK A;  3WCW B;  2GKN A;  1N9I A;  3PI2 A;  1BZP A;  1XZ4 B;  1HDB B;  1MNK A;  2XYK A;  2R4W A;  7HBI A;  2LH3 A;  3S66 A;  1URV A;  4O35 A;  3QJB B;  1CG5 B;  5C6E A;  2ZSZ A;  3WR1 B;  3GQP B;  4X0L A;  1MOA A;  3GQG A;  3D4X B;  1Y01 B;  3CIU A;  5AB8 A;  2NSS A;  3GKV B;  2ZSR A;  3QJD A;  3GQR B;  1BBB A;  1YHU D;  1GVH A;  1LA6 A;  1OJ6 A;  3UHN A;  2ZS1 B;  4G1V A;  4F6B A;  3D4X A;  1RQ4 A;  5JDO D;  1RPS A;  3ZJM A;  1JZL A;  3QMA A;  4FC3 B;  3S1I A;  1Q1F A;  2H35 A;  4G1B A;  2D2M D;  1Y7Z B;  2D2N D;  5ILR A;  1O1M A;  3OGB A;  5C6Y A;  1MLU A;  1IBE B;  2ZS1 D;  1JL7 A;  5KER B;  4O1T A;  4YU4 B;  1YHU B;  3WCU A;  1CG5 A;  2HBC B;  4MXK A;  3WR1 A;  4MQG A;  5EET A;  1GLI B;  1CG8 A;  1S5X B;  1UT0 A;  1LFZ B;  5HLQ A;  1URY A;  1YEU A;  3EDA A;  3MOU A;  4ROM A;  3UGZ A;  1BZ0 B;  4L2M A;  3PIA B;  2MYE A;  4FWZ A;  3WCV D;  1HRM A;  1SDK A;  2O5Q X;  3BJ2 A;  1QXD B;  2FAL A;  4N7P B;  1KD2 B;  1YOI A;  1RTE A;  4F6F A;  1RPS B;  2VEE A;  5E6E B;  1Y4F A;  1HBB A;  2HHB A;  1AJG A;  1VXE A;  2GNV A;  1YCA A;  2HZ3 A;  3M3B A;  2SPL A;  4O4Z A;  4YU3 B;  1NS9 B;  1LFV A;  4C44 A;  5E6E A;  1A9W A;  5HU6 B;  1YEN A;  1B86 A;  1RTX A;  1FSX A;  2G0S A;  5E29 B;  1XZ5 A;  1YCB A;  1OUT B;  1SPG A;  2Z6N A;  3ZH0 A;  1YEQ A;  4NZI A;  3ZJI A;  1A3N B;  4H2L B;  3D17 A;  3ZJO A;  1DLY A;  3UGY A;  2D60 A;  1HBA B;  2E2Y A;  1VRE A;  1J41 A;  3PIA A;  1IWH B;  4NI1 A;  2PEG A;  2H35 B;  3NML A;  1YMB A;  2ZT0 A;  3GYS A;  2MGA A;  1A4F A;  2BLI A;  3MJU B;  2MGM A;  1EWA A;  3P5Q B;  1S0H B;  5CHR A;  2ZSS A;  1CMY A;  3IA3 B;  1R1X A;  4MQJ B;  1OFK A;  1A6N A;  3UHE A;  1RVW B;  1N9H A;  3FH9 B;  1IRC A;  1LFV B;  3B75 A;  1J7Y B;  6HBW A;  4M4B A;  2MHB A;  1GCW A;  1MKO B;  2BWH A;  4HHB A;  1LFL B;  1O1M B;  2MGE A;  1MBO A;  2OH9 A;  1JP6 A;  2RAO B;  3QM7 A;  1THB B;  2DHB A;  1JW8 A;  1XCH A;  1G08 B;  1GDI A;  2GTL B; 
#chains in the Genus database with same CATH topology
 3V2V A;  5JDO F;  1DUK A;  1LA6 B;  5E83 B;  1HBB B;  1DXU A;  4MPM A;  5SW7 B;  1H1X A;  1V4X A;  2MBW A;  1IRD B;  1CP0 A;  3AT6 A;  1NPG A;  5HY8 B;  3QJC B;  3GDJ B;  3S1J A;  1J7S A;  3WCW D;  4ROL B;  5KDQ A;  5JDO E;  2EVP A;  3A59 A;  3TM9 A;  1YIH B;  3R0G A;  1QXD A;  1CIK A;  4PO5 B;  3PMD A;  4JAC A;  3WCP A;  4F0T B;  3GOU A;  3UHW A;  5D1V A;  1ABW B;  2QSP B;  1F99 A;  1KTP B;  1HBI A;  3D17 B;  3QJE A;  4KJT A;  1M6M A;  1MYG A;  3NFE A;  2ZSX A;  4KN3 A;  3PEL B;  3G4W A;  4Z8K A;  2GRZ A;  1MLJ A;  2RAO A;  1CO8 A;  1HGC B;  1Y46 B;  3HRW B;  2DKA A;  1Y7G B;  1V5H A;  3NG6 B;  1Y4G B;  3QQQ A;  2JLF A;  1DUO A;  1FSL A;  2VHB A;  4ESA B;  3ZOL A;  1YZI B;  5EOH A;  1Y0D B;  3HEN A;  2MYC A;  1XYE B;  1HA7 B;  1SI4 A;  3M38 A;  1NQP B;  4F6I A;  4HHB B;  1YE0 A;  5B85 A;  2ZFO A;  1NZ3 A;  3MWN A;  3NUH B;  4YU3 A;  1CQ2 A;  2FRF A;  1YEV B;  3V57 B;  1PMB A;  3MJP A;  1AJ9 A;  1DO1 A;  1R1Y B;  2VEB A;  1J40 A;  3A5A A;  1V07 A;  2FRK X;  3MN0 A;  4LMS B;  2R80 A;  1UX9 A;  3E4N A;  1Y4Q B;  1V4W B;  1A0Z B;  1JP9 A;  1B33 A;  1VRF A;  1Y31 B;  1LJW B;  3AQ7 A;  1V9Q A;  2H8F B;  3MJP B;  3E5O A;  3PT8 A;  4PQ6 A;  1CH1 A;  1ECN A;  1HBH A;  3G4U A;  2DN1 B;  2W6X A;  5CNC A;  2ZT2 A;  5CNF A;  3KUO A;  3UHG A;  3MKB A;  1MLL A;  3VRE B;  3ONZ A;  1SDL B;  1XYE A;  3PI3 A;  4FC3 A;  3RJ6 A;  3W4U A;  5EYS A;  4ZVB A;  1O1N B;  1Y0C A;  1Y0A A;  1O1J B;  1KTP A;  3IC2 B;  1IDR A;  1YEN B;  4N7P A;  1MLK A;  2Z85 A;  3ZJP A;  1VXH A;  3OO5 B;  4M4B B;  1J7Y A;  1IBE A;  4C0N A;  2V8A B;  1AJ9 B;  3UH7 A;  2MGH A;  1NWN A;  1BIJ A;  1Y4G A;  3QM6 A;  1NAZ A;  1HDA A;  2V1G A;  2V1H A;  1Y31 A;  2BLJ M;  2XKI A;  1Y4Q A;  1C7D A;  1MWB A;  4GY3 B;  2ZSY A;  1ON7 B;  1YIE B;  2IG3 A;  3BRP B;  3OJ1 A;  3QQR A;  1NEJ B;  3GYS B;  4H0M A;  3BOM A;  1DTM A;  4B3W A;  4N7N A;  3NFE B;  4RMP A;  1YFF B;  2WTG A;  1R1X B;  1XZV A;  3ECL A;  1OUU B;  1J52 A;  3BOM B;  1NWI A;  2NX0 A;  5AZR A;  1YDZ A;  1R1Y A;  3W4U B;  1ABY A;  3U3E A;  3MYM A;  1MYZ A;  1BAB A;  4L7Y A;  5FVB A;  2X4A A;  3RJN B;  1JEB B;  1A0Z A;  3G52 A;  2W6W A;  1LH7 A;  1CQX A;  4ERV A;  2VLZ A;  4BS9 A;  3PMC A;  2X49 A;  2MYA A;  1A3O A;  1NZ4 A;  4MQJ A;  4AE0 A;  3LB4 A;  1COL A;  1WLA A;  1YMA A;  1GDK A;  2GNW A;  1YOH A;  1LFY B;  3OZV A;  2G3H A;  1HGA B;  1MYM A;  3VRF B;  4HRT B;  3WTG A;  1S61 A;  1C7B B;  2DXM A;  1V4W A;  1LHT A;  1SDL A;  2V1E A;  3ASE A;  1UVI A;  1IWH A;  2AA1 B;  3HXN B;  4LMX B;  5CNG A;  1XQ5 A;  1BZ0 A;  1GH0 B;  1Z8U B;  1Y83 A;  3O18 B;  1HBH B;  3A0G B;  1EMY A;  1S0H A;  4DC8 A;  1N9X A;  1Y8H B;  1MBS A;  2QSS B;  3O2C B;  2LH5 A;  2JLG A;  3LB1 A;  5CN8 A;  4A8O A;  2GTL C;  5JOM A;  3ONZ B;  1HHT P;  5EV5 A;  1HLM A;  2ZSP A;  4YU4 A;  2MGB A;  3AT5 A;  1YGF A;  3FEW X;  3PT7 A;  2QLS A;  3WCW A;  3G53 A;  3V57 A;  1CH5 A;  1GCW B;  1XZ4 A;  4TYX A;  1LFQ A;  1YHE B;  1Y7C A;  4ESA A;  1HAC B;  1QSH B;  2LHB A;  1MDT A;  2ZT3 A;  1K1K B;  5EYJ A;  1YG5 A;  1DXV B;  1EW6 A;  1DXU B;  1KN1 A;  4F0U B;  2AA1 A;  3UHH A;  5E83 A;  1V75 A;  1FAW B;  1OFJ A;  1F5P A;  2VML A;  102M A;  4IRO A;  1K0Y B;  4M4A A;  3ZJN A;  4UUR A;  2G14 A;  4KMW A;  1S5Y A;  1O1O A;  3VNC A;  3BA2 A;  1Y0C B;  1JY7 A;  3WFX A;  4IT8 A;  4Q70 A;  3IC2 A;  3QZZ A;  1DO7 A;  4U8U A;  2ZFO D;  1F65 A;  1MYT A;  1RQA A;  2ZLW A;  4MQH B;  2NRM A;  5HU6 A;  1QPW B;  3PI9 B;  5KKK A;  1HV4 B;  2OHA A;  1NS9 A;  1VXA A;  1LFQ B;  3UHC A;  4PQC A;  1CMY B;  1O1K A;  1MBC A;  1T1N A;  1UVM A;  6HBW B;  3WCV A;  3VRG B;  2ZS0 C;  3AQ5 A;  1AJH A;  3K9Z A;  1FN3 B;  105M A;  104M A;  1LFT B;  3HYU B;  2HZ1 A;  2VYZ A;  2MYB A;  1COH B;  1JBO A;  1EYX B;  3BJ3 A;  3GK9 A;  5CND A;  1X46 A;  3DHT A;  1CG8 B;  1B0B A;  4XDI A;  3D1K B;  4MQG B;  1YVQ A;  1O1L A;  2GTL D;  3H58 A;  1YG5 B;  1HGB B;  3M39 A;  1HBR A;  5HBI A;  2O5T X;  1A00 B;  2ZS0 B;  3CY5 A;  4BJA A;  4AE1 A;  3ZJQ A;  1RH1 A;  1Y0T A;  1NQP A;  1S6A A;  4F68 A;  4XS0 A;  1FHJ A;  2HBF A;  1O1I B;  2EF2 A;  3M3A A;  1RQ4 B;  1CH2 A;  3NMM B;  1O1K B;  1T1N B;  3L0F A;  1Y5K A;  1HV4 A;  2AV0 A;  4VHB A;  2HBD A;  1LIA B;  2C7K B;  1XG0 C;  3ARK A;  1Y5F A;  4A8Q A;  1TU9 A;  3HYU A;  2MYD A;  1VXB A;  1A6K A;  3WHM B;  2JHO A;  1JF4 A;  1Y7C B;  1BVD A;  2NSR A;  5B13 A;  3DR9 A;  2ZFB B;  1HSY A;  4N7O B;  3IC0 B;  2ZFO C;  1PBX B;  1MOB A;  1GBU A;  2VJR B;  2ZLX B;  1S69 A;  2D60 B;  1RQA B;  2ZLW B;  106M A;  1K1K A;  3UI0 A;  2PGH B;  1AZI A;  1Y35 B;  4ILZ A;  1UVJ A;  3LHB A;  1OR6 A;  1XF6 C;  5CN5 A;  4ETU A;  3SDN A;  3MJU A;  1NZ2 A;  2GL3 A;  1ABW A;  3BJ2 B;  4XXK A;  1Y7Z A;  5CHQ A;  4ETV A;  3L0F B;  1JF3 A;  1QI8 B;  2HBD B;  1C7B A;  2W31 A;  1J3F A;  4MQH A;  2HHB B;  1C7D B;  1BVC A;  1B8D A;  2BKM A;  3KMF C;  3HHB A;  1GLI A;  1S5X A;  5HAV A;  3WFT A;  2CMM A;  1DDT A;  1U7R A;  1HJT A;  3BJ1 A;  108M A;  4A8F A;  2D5X A;  3GQP A;  1YVQ B;  2DN1 A;  4HH1 A;  3UHV A;  1VXF A;  1ECD A;  1UVY A;  1KFR A;  1I7Y B;  3AT6 B;  5HY8 A;  1CH3 A;  1BZZ A;  4L1E B;  1DWS A;  3MVC A;  5EQM A;  4MBN A;  1GDL A;  3HEO A;  4MQC B;  4N8T B;  1MBD A;  1LH6 A;  3S66 B;  1MLN A;  1GZX A;  3A59 B;  1LHS A;  3BCQ A;  2ZLU A;  1MOC A;  1HGA A;  1YEU B;  1QXE B;  3R5I B;  1DLW A;  5EE4 D;  2EB9 A;  1CH7 A;  5AQD M;  1DKE B;  1UIW B;  1YE2 B;  1XZ5 B;  2VJH A;  1S56 A;  1ALL A;  1OUT A;  5D5R A;  3ARJ A;  1LIA A;  3WCU B;  1GBV A;  1Y83 B;  3O18 A;  2ZWJ A;  5CMV A;  1Y4R A;  2VYY A;  1YZI A;  4MQK A;  107M A;  4LM6 B;  4N7N B;  2VLX A;  2JL9 A;  1CPW A;  2D2N A;  2GKM A;  2QMB B;  2DN3 A;  1CII A;  1G0B B;  1J7W B;  1VXD A;  1Y09 B;  4NK1 A;  1O1J A;  3PI8 A;  2FRI X;  2HBE A;  2V1J A;  2UUN A;  2VJR A;  5ILM A;  4WJG 1;  2AV3 A;  4LPI A;  1Y8W A;  3QJE B;  4ERT A;  2YRS B;  1IT2 A;  1BIJ B;  3WCT C;  4U8U D;  2DKD A;  1MLR A;  2G0V A;  2C7L A;  5AQD A;  1MNO A;  3OO4 A;  4F4O B;  1CBM A;  3PI9 A;  1WMU A;  3WHM A;  1GCV B;  3O89 A;  1WVP A;  1BIN A;  1ON7 A;  2GRH A;  3ZTA A;  1UC3 A;  1VXG A;  1J3Z B;  1Y45 B;  2W6V B;  1LJW A;  1G09 A;  1UFJ A;  2VML B;  4N7O A;  3LR7 A;  3UHT A;  4M4A B;  1LTW A;  3SZK A;  3LQD B;  1MBN A;  3ZJJ A;  3HC9 A;  2UUL A;  5JGG B;  5CNE A;  2M6Z A;  1JY7 B;  3VRE A;  1X9F A;  1MBA A;  3KMF A;  3UHR A;  1BZ1 A;  1J3Y B;  2R4Z A;  5B84 A;  1GDJ A;  4TWV A;  4GXE B;  2B7H A;  4AVE A;  3K3U A;  2QLS B;  3VHB A;  1NS6 B;  2V1I A;  3UHK A;  3HF4 A;  2AUO A;  2C7J A;  2R4Y A;  1DXT A;  3G4Q A;  1ECO A;  3ZHW A;  2HBS A;  1COH A;  1J3Z A;  1L2K A;  1FLP A;  5CN4 A;  4NI0 B;  5C6E B;  1X9F C;  1EBT A;  3GQG B;  2AUR A;  1KR7 A;  1MGN A;  2G0R A;  4ZVA A;  1A01 A;  4MAX A;  2MGK A;  3GLN A;  3NL7 A;  4NXA A;  2G0X A;  2D6C A;  1J41 B;  3AG0 A;  4FH7 A;  4NI1 B;  2GRF A;  3UHU A;  2O5S X;  1MNI A;  1C40 B;  1GBV B;  4TMA B;  3DUT B;  2LH2 A;  1Y8I B;  3P5Q A;  1FHJ B;  1X9F B;  3UHY A;  4MQK B;  2G11 A;  3DHR A;  1HHO A;  1X9F D;  1X3K A;  4F69 A;  1C40 A;  4XXI A;  1V4U A;  1HDA B;  2ZFO B;  1XDT T;  2MGI A;  1RSE A;  1CH4 A;  1RVW A;  101M A;  1JEB A;  2J96 A;  3CIU B;  3DHR B;  3ZJS A;  2OLP A;  4A8W A;  1A6G A;  2RI4 B;  1G0A A;  2DN2 A;  3V2Z A;  3OVU C;  2UUM X;  4ZIZ A;  1CO9 A;  1F63 A;  1CPC B;  5JGG A;  1O16 A;  3LB2 A;  3UH3 A;  2M6Z B;  2ZLX A;  1A0U B;  4O4T A;  1GBU B;  2ZLV A;  3NL7 B;  1Y4V B;  2OH8 A;  1Y2Z B;  3D1K A;  1ABS A;  1YEQ B;  3EU1 B;  2R4X A;  1NEJ A;  3QM8 A;  1VWT B;  1Y09 A;  3PI8 B;  1J7W A;  1V4X B;  4FWX A;  1Y8H A;  2UUN B;  1LH2 A;  3A0G A;  1MLM A;  2EKU A;  2IN4 A;  2VJT B;  1M9P A;  5EUI B;  1OUU A;  2HBS B;  3A9M A;  4HBI A;  1YIH A;  1O1I A;  2FRJ X;  3UBV A;  3PT7 B;  1YGF B;  3WCT D;  1G08 A;  1XY0 B;  4MU5 A;  1MYJ A;  3KVS B;  1G0A B;  3HHB B;  1WAC A;  3TLD A;  1SHR A;  2Z6N B;  1MTK A;  3TM3 A;  1QSH A;  2MGD A;  1YIE A;  3QM9 A;  4GY3 A;  1YH9 B;  3K8B A;  4GZG A;  2D2N C;  1XQ5 B;  2ZSQ A;  1HAB A;  2HCO A;  1ITH A;  4SDH A;  1HI1 A;  1MLO A;  2HHE A;  3H57 A;  2PEG B;  3LQD A;  3UHS A;  1JP8 A;  1KN1 B;  1UVL A;  3OZU A;  4ODC A;  4N6S B;  2V1F A;  2R1H A;  1BZZ B;  1IT3 A;  3DBJ B;  1FCS A;  2D2N B;  3UHI A;  3WCU C;  1QSI B;  1HCO A;  1JZM A;  1LH1 A;  2VYW A;  1FSX B;  1SWM A;  5FVB M;  3FH9 A;  3PEL A;  3HF4 B;  2GDM A;  110M A;  2ZLU B;  1YHR B;  4UIQ A;  3DBJ A;  3D1A B;  4H2L A;  2VJH B;  2YRS A;  4ROL A;  4UZV A;  5KDQ B;  1YE2 A;  1UIW A;  1FN3 A;  3UH6 A;  3PI1 A;  2MGG A;  1LFZ A;  3PI4 A;  3EOK A;  5M3S A;  1Y0D A;  5HLX A;  1F99 B;  5F2A A;  1I3E A;  1MLQ A;  3WCT B;  1LH5 A;  1FDH A;  2O5L X;  1O1L B;  3HXN A;  1SPG B;  3UHZ A;  5CN6 A;  1YOG A;  4U8U B;  2VRY A;  3LB3 A;  3QJC A;  1DO4 A;  2HBE B;  2GLN A;  2ZS1 A;  1O1N A;  2H8D A;  4MBA A;  1JDO A;  1MOH A;  3VAU A;  1EBC A;  3WCV C;  2V8A A;  4TWU A;  1XZU B;  3ZOM A;  3OO5 A;  1BUW A;  2QSP A;  2D2M B;  2G12 A;  2QU0 A;  5F0B A;  4MQI A;  2DC3 A;  1Y45 A;  2W6V A;  4U8U C;  1Y4P A;  3AQ9 A;  3AQ6 A;  2EVK A;  1G09 B;  1CH9 A;  3ORD A;  4NK2 A;  4X0L B;  1VXC A;  1XZ2 A;  1YHU A;  1Y5F B;  2HBC A;  1OR4 A;  1Y8I A;  4BJU A;  3BJ1 B;  1Y2Z A;  3S65 A;  3S48 C;  1NPF A;  2D2M C;  1DXV A;  2XKH A;  2YSK A;  1MCY A;  2ZST A;  4HRT A;  3IC0 A;  2VLY A;  2H8F A;  1YH9 A;  3K8B B;  2MGJ A;  4GXE A;  1O1O B;  1A6M A;  1BZ6 A;  1J3Y A;  1BZ1 B;  1BZR A;  2PGH A;  3QZX A;  1YEO B;  4MXL A;  1B86 B;  2QMB A;  2R1H B;  2Z6S A;  111M A;  1G9V A;  1Y0T B;  1NS6 A;  4MQI B;  1GZX B;  3G4Y A;  2QU0 B;  1MKO A;  4OOD A;  2BK9 A;  1BUW B;  1YEO A;  1QI8 A;  1ASH A;  4XS0 B;  1SHR B;  1Y4P B;  3WTG B;  2MGL A;  1XZV B;  1IOP A;  3ARL A;  1EYX A;  3BJ3 B;  1JBO B;  1MBI A;  1H97 A;  3IXF A;  3S65 B;  1YGD A;  4A8M P;  1HBG A;  1Y22 A;  3LR9 A;  3OK5 A;  4G51 A;  5EUI A;  3BRP A;  1UVX A;  1XZ7 A;  3HRW A;  3QJD B;  1HI0 P;  3ODQ B;  2QSS A;  1QPW A;  3WI8 A;  1MYH A;  3O2C A;  4F6G A;  1W92 A;  2BW9 M;  2O5O X;  1LFT A;  2C7L B;  3MBA A;  3E55 A;  1MNJ A;  1Y5K B;  2LH6 A;  1XZU A;  4FH6 A;  4QAU A;  2DN2 B;  3UBC A;  1A3N A;  1Y46 A;  1O1P A;  1XY0 A;  1DKE A;  3R5I A;  3VRG A;  3UHD A;  1Y4V A;  1F5O A;  1FAW A;  2D5Z B;  1MYF A;  1K0Y A;  3G4V A;  1V75 B;  3WCU D;  4NS2 A;  2LH7 A;  1SPE A;  4L1E A;  3SDH A;  1CIO A;  2O5B X;  2VJT A;  1G0B A;  2AUQ A;  2WCQ A;  4DC7 A;  5KER A;  3B75 B;  5IKS A;  112M A;  1YEV A;  2D2M A;  2W72 C;  1HCO B;  4HRR A;  1DWR A;  1MWD A;  5MBN A;  1Y22 B;  1CLS B;  3E5I A;  2SPN A;  1XZ2 B;  1JWN A;  1A9W E;  1UVN A;  1HI8 A;  2DXM B;  3A5B A;  4A8S A;  4ZIZ B;  3ODQ A;  4DWU A;  2RI4 A;  1NIH A;  1Y4B A;  5CN7 A;  2BLH A;  3WCW C;  2D5Z A;  1MWC A;  1M6C A;  1HBA A;  2HHD B;  3GKV A;  4ODC B;  3NG6 A;  1Y0W A;  3UHQ A;  1HGB A;  1BBB B;  1MYI A;  1HBS A;  1RQ3 A;  3ZJR A;  5ILE A;  1D8U A;  1HHO B;  3UHB A;  2MB5 A;  1HDS B;  2R80 B;  2C0K A;  1XZ7 B;  1UX8 A;  1LFY A;  2Z6T A;  4PO5 A;  1S5Y B;  3D1A A;  103M A;  2EKT A;  6HBI A;  4HSW A;  1Y8K A;  1YHR A;  2BV8 A;  3AQ8 A;  2Z8A A;  1MZ0 A;  1YHE A;  2ZSN A;  2V1K A;  2G10 A;  2MGC A;  1Y7D B;  2ZS0 D;  3A5G A;  2WY4 A;  1JZK A;  1NXF A;  2W6Y A;  4PQB A;  1BAB B;  4L7Y B;  2UUM A;  4HH0 A;  1MNH A;  2ZLT B;  1MOD A;  1CP5 A;  2ZS1 C;  3ECX A;  1HGC A;  3EOK B;  1CLS A;  2OHB A;  3EDB A;  3WFU A;  2D5X B;  1JL6 A;  1HAC A;  3WCV B;  1HHS A;  2HHD A;  4G51 B;  1NIH B;  1Y4B B;  2R50 A;  2W72 A;  5JDO C;  4F0U A;  2O58 X;  2HCO B;  1YHU C;  2H8D B;  1HBS B;  1RQ3 B;  4F6J A;  3ECZ A;  2DN3 B;  1HDS A;  2LH1 A;  3G46 A;  4PNJ A;  1U7S A;  1Y35 A;  4H07 A;  4FWY A;  3UH5 A;  2MHB B;  3SZK B;  1IRD A;  4O2G A;  2G0Z A;  1DM1 A;  3BCQ B;  3WFW A;  5CN9 A;  1MDN A;  1V4U B;  5CNB A;  1A3O B;  1C7C B;  1Y8K B;  2BV8 B;  1NGK A;  1LUE A;  1NZ5 A;  5AZQ A;  3D7O A;  5MBA A;  1CBL A;  1THB A;  2DHB B;  4ROM B;  1TES A;  2ZLT A;  1GCV A;  1WMU B;  3QJB A;  4B4Y A;  2O5M X;  4WCH D;  2WTH A;  2C7K A;  2VM0 A;  3MKB B;  2HZ2 A;  2XKG A;  3DUT A;  3FS4 A;  5EU2 A;  1QGW C;  2HBG A;  4H0M B;  1VHB A;  1GJN A;  3GDJ A;  1Y5J B;  1A0U A;  2ZFB A;  1YFF A;  2SPM A;  3UHX A;  4JYQ A;  2OIF A;  1Y8W B;  1QSI A;  1A01 B;  2SPO A;  1A4F B;  2FAM A;  3KUN A;  2ZT1 A;  1BJE A;  1I7Y A;  2QRW A;  4YJJ B;  1I3D A;  2ZT4 A;  1MLF A;  1JPB A;  2QFK A;  2AUP A;  4OF9 A;  3HEP A;  3ZJL A;  3OO4 B;  4B02 A;  4F4O A;  1C7C A;  3NMM A;  4MQC A;  4N8T A;  4HRR B;  4KMV A;  1MTJ A;  1YE0 B;  1Y85 B;  4ESU A;  2ZSO A;  3O7N A;  1LFL A;  1DO3 A;  1Y7G A;  1J40 B;  4NI0 A;  2UUL D;  2NRL A;  3MYN A;  1OBM A;  1ECA A;  4DWT A;  2BMM A;  1XXT B;  2UUL B;  1DXD A;  1PBX A;  1Y0W B;  2HHE B;  3DHT B;  1Y5J A;  4A8Y A;  1Y4R B;  1HAB B;  1YVT A;  4NXC A;  3AT5 B;  1YDZ B;  1DTI A;  2B7H B;  1HA7 A;  1KD2 A;  4Q70 B;  1ABY B;  1YMC A;  5SW7 A;  1DWT A;  1J7S B;  1YVT B;  5EE4 C;  4HSX A;  2UUL C;  1QXE A;  1FDH G;  3EU1 A;  1SGK A;  1UMO A;  3OZW A;  2I88 A;  1VWT A;  1UFP A;  1G9V B;  1DXC A;  1Y7D A;  3GUQ A;  1HDB A;  3GOU B;  2HBF B;  3WCP B;  3ZJH A;  2EB8 A;  1M9P B;  3FS4 B;  2QFN A;  1B8D B;  3PT8 B;  1O1P B;  2GTL A;  3VRF A;  2KSC A;  5E29 A;  4IRO B;  4H0B A;  4F6D A;  3G4R A;  4AVD A;  1UVK A;  3GIO A;  1DXT B;  3GQR A;  2W72 B;  3D7O B;  1A00 A;  2ZS0 A;  3CY5 B;  1HBR B;  1N9F A;  109M A;  1XXT A;  3WCT A;  5HLU A;  1MLS A;  2ZLV B;  4WJG A;  1LH3 A;  3GKT A;  1YGD B;  5ILP A;  1Y0A B;  3QM5 A;  1MTI A;  1Y4F B;  2MGF A;  1MLH A;  1HLB A;  2BNL A;  1Y85 A;  1SDK B;  1MLG A;  1SI4 B;  3ED9 A;  3A2G A;  3RGK A;  3WCW B;  2GKN A;  1N9I A;  3PI2 A;  1BZP A;  1XZ4 B;  1PHN A;  1TOX A;  1HDB B;  1MNK A;  2XYK A;  2R4W A;  7HBI A;  2LH3 A;  3S66 A;  1URV A;  4O35 A;  3QJB B;  1CG5 B;  5C6E A;  2ZSZ A;  3WR1 B;  3GQP B;  4X0L A;  2UUM B;  1MOA A;  3GQG A;  3D4X B;  1Y01 B;  3CIU A;  5AB8 A;  2NSS A;  3GKV B;  2ZSR A;  3QJD A;  3GQR B;  1BBB A;  1YHU D;  1GVH A;  1LA6 A;  1OJ6 A;  3UHN A;  2ZS1 B;  4G1V A;  4F6B A;  3D4X A;  1RQ4 A;  2DKC A;  5JDO D;  2WCR A;  1RPS A;  3ZJM A;  1JZL A;  3QMA A;  4FC3 B;  3S1I A;  1Q1F A;  3RQR A;  2H35 A;  4G1B A;  2D2M D;  1Y7Z B;  2D2N D;  5ILR A;  1O1M A;  3OGB A;  5C6Y A;  1MLU A;  3V58 A;  1IBE B;  1PHN B;  1JL7 A;  2ZS1 D;  4A8K A;  4F0T A;  5KER B;  4O1T A;  4YU4 B;  2UUN D;  1YHU B;  3WCU A;  1CG5 A;  2HBC B;  4MXK A;  3WR1 A;  4MQG A;  5EET A;  1GLI B;  1CG8 A;  1S5X B;  1UT0 A;  1LFZ B;  5HLQ A;  1URY A;  1YEU A;  3EDA A;  3MOU A;  4ROM A;  2C7J B;  3UGZ A;  1BZ0 B;  1GH0 A;  4L2M A;  3PIA B;  2MYE A;  4FWZ A;  3WCV D;  1HRM A;  4RMP B;  1SDK A;  2O5Q X;  3BJ2 A;  1QXD B;  2FAL A;  4N7P B;  1KD2 B;  1YOI A;  1RTE A;  4F6F A;  1RPS B;  2VEE A;  5E6E B;  1Y4F A;  1HBB A;  2HHB A;  1AJG A;  1VXE A;  2UUL H;  2GNV A;  3V58 B;  1YCA A;  1A87 A;  2HZ3 A;  3M3B A;  2SPL A;  4O4Z A;  4YU3 B;  1NS9 B;  1LFV A;  4C44 A;  5E6E A;  1A9W A;  5HU6 B;  1YEN A;  1B86 A;  1RTX A;  1FSX A;  2G0S A;  5E29 B;  1XZ5 A;  1YCB A;  1ALL B;  1OUT B;  1B33 B;  1SPG A;  2Z6N A;  3ZH0 A;  1YEQ A;  4NZI A;  3ZJI A;  1A3N B;  4H2L B;  3D17 A;  3ZJO A;  1DLY A;  3UGY A;  1NY9 A;  1HBA B;  2D60 A;  2E2Y A;  1VRE A;  1J41 A;  3PIA A;  1IWH B;  4NI1 A;  2PEG A;  2H35 B;  4YJJ A;  1CPC A;  3NML A;  1YMB A;  2ZT0 A;  3GYS A;  2MGA A;  1A4F A;  2BLI A;  3MJU B;  2MGM A;  1EWA A;  3P5Q B;  1S0H B;  5CHR A;  2ZSS A;  1CMY A;  3IA3 B;  1R1X A;  4MQJ B;  3KVS A;  1OFK A;  1A6N A;  5B13 G;  3UHE A;  1RVW B;  1N9H A;  3FH9 B;  1IRC A;  1LFV B;  3B75 A;  1J7Y B;  4ETT A;  6HBW A;  4M4B A;  2MHB A;  1GCW A;  1MKO B;  2BWH A;  4HHB A;  1LFL B;  1O1M B;  2MGE A;  1MBO A;  2OH9 A;  1JP6 A;  2RAO B;  3QM7 A;  4Z8K B;  4N6S A;  1THB B;  2DHB A;  1JW8 A;  1XCH A;  1G08 B;  1GDI A;  3LQ9 A;  2GTL B;  1F0L A; 
#chains in the Genus database with same CATH homology
 3V2V A;  5JDO F;  1DUK A;  1LA6 B;  5E83 B;  1HBB B;  1DXU A;  4MPM A;  5SW7 B;  1H1X A;  1V4X A;  2MBW A;  1IRD B;  1CP0 A;  3AT6 A;  1NPG A;  5HY8 B;  3QJC B;  3GDJ B;  3S1J A;  1J7S A;  3WCW D;  4ROL B;  5KDQ A;  5JDO E;  2EVP A;  3A59 A;  3TM9 A;  1YIH B;  3R0G A;  1QXD A;  1CIK A;  4JAC A;  3WCP A;  3GOU A;  3UHW A;  5D1V A;  1ABW B;  2QSP B;  1HBI A;  3D17 B;  3QJE A;  4KJT A;  1M6M A;  1MYG A;  3NFE A;  2ZSX A;  4KN3 A;  3PEL B;  3G4W A;  2GRZ A;  1MLJ A;  2RAO A;  1CO8 A;  1HGC B;  1Y46 B;  3HRW B;  1Y7G B;  1V5H A;  3NG6 B;  1Y4G B;  3QQQ A;  1DUO A;  1FSL A;  2VHB A;  4ESA B;  3ZOL A;  1YZI B;  5EOH A;  1Y0D B;  3HEN A;  2MYC A;  1XYE B;  1SI4 A;  3M38 A;  1NQP B;  4F6I A;  4HHB B;  1YE0 A;  5B85 A;  2ZFO A;  1NZ3 A;  4YU3 A;  1CQ2 A;  2FRF A;  1YEV B;  1PMB A;  3MJP A;  1AJ9 A;  1DO1 A;  1R1Y B;  2VEB A;  1J40 A;  3A5A A;  1V07 A;  2FRK X;  3MN0 A;  2R80 A;  1UX9 A;  3E4N A;  1Y4Q B;  1V4W B;  1A0Z B;  1JP9 A;  1VRF A;  1Y31 B;  1LJW B;  3AQ7 A;  1V9Q A;  2H8F B;  3MJP B;  3E5O A;  3PT8 A;  4PQ6 A;  1CH1 A;  1ECN A;  1HBH A;  3G4U A;  2DN1 B;  2W6X A;  5CNC A;  2ZT2 A;  5CNF A;  3KUO A;  3UHG A;  3MKB A;  1MLL A;  3VRE B;  3ONZ A;  1SDL B;  1XYE A;  3PI3 A;  4FC3 A;  3RJ6 A;  3W4U A;  5EYS A;  4ZVB A;  1O1N B;  1Y0C A;  1Y0A A;  1O1J B;  3IC2 B;  1IDR A;  1YEN B;  4N7P A;  1MLK A;  2Z85 A;  3ZJP A;  1VXH A;  3OO5 B;  4M4B B;  1J7Y A;  1IBE A;  4C0N A;  1AJ9 B;  3UH7 A;  2MGH A;  1NWN A;  1BIJ A;  1Y4G A;  3QM6 A;  1NAZ A;  1HDA A;  2V1G A;  2V1H A;  1Y31 A;  2BLJ M;  2XKI A;  1Y4Q A;  1C7D A;  1MWB A;  2ZSY A;  1YIE B;  2IG3 A;  3OJ1 A;  3QQR A;  1NEJ B;  3GYS B;  3BOM A;  1DTM A;  4B3W A;  4N7N A;  3NFE B;  1YFF B;  2WTG A;  1R1X B;  1XZV A;  3ECL A;  1OUU B;  1J52 A;  3BOM B;  1NWI A;  2NX0 A;  5AZR A;  1YDZ A;  1R1Y A;  3W4U B;  1ABY A;  3U3E A;  3MYM A;  1MYZ A;  1BAB A;  4L7Y A;  3RJN B;  1JEB B;  1A0Z A;  3G52 A;  2W6W A;  1LH7 A;  1CQX A;  2VLZ A;  4MQJ A;  2MYA A;  1A3O A;  1NZ4 A;  3LB4 A;  1WLA A;  1YMA A;  1GDK A;  2GNW A;  1YOH A;  1LFY B;  3OZV A;  2G3H A;  1HGA B;  1MYM A;  3VRF B;  4HRT B;  3WTG A;  1S61 A;  1C7B B;  2DXM A;  1V4W A;  1LHT A;  1SDL A;  2V1E A;  3ASE A;  1IWH A;  2AA1 B;  3HXN B;  5CNG A;  1XQ5 A;  1BZ0 A;  1Z8U B;  1Y83 A;  1HBH B;  3A0G B;  1EMY A;  1S0H A;  4DC8 A;  1N9X A;  1Y8H B;  1MBS A;  2QSS B;  2LH5 A;  3LB1 A;  5CN8 A;  2GTL C;  5JOM A;  3ONZ B;  5EV5 A;  1HLM A;  2ZSP A;  4YU4 A;  2MGB A;  3AT5 A;  1YGF A;  3PT7 A;  2QLS A;  3WCW A;  3G53 A;  1CH5 A;  1GCW B;  1XZ4 A;  4TYX A;  1LFQ A;  1YHE B;  1Y7C A;  4ESA A;  1HAC B;  1QSH B;  2LHB A;  2ZT3 A;  1K1K B;  5EYJ A;  1YG5 A;  1DXV B;  1EW6 A;  1DXU B;  2AA1 A;  3UHH A;  5E83 A;  1V75 A;  1FAW B;  1OFJ A;  1F5P A;  102M A;  4IRO A;  1K0Y B;  4M4A A;  3ZJN A;  4UUR A;  2G14 A;  4KMW A;  1S5Y A;  1O1O A;  3BA2 A;  1Y0C B;  1JY7 A;  3WFX A;  4IT8 A;  3IC2 A;  3QZZ A;  1DO7 A;  4U8U A;  2ZFO D;  1F65 A;  1MYT A;  1RQA A;  2ZLW A;  4MQH B;  2NRM A;  5HU6 A;  1QPW B;  3PI9 B;  5KKK A;  1HV4 B;  2OHA A;  1NS9 A;  1VXA A;  1LFQ B;  3UHC A;  4PQC A;  1CMY B;  1O1K A;  1MBC A;  1T1N A;  6HBW B;  3WCV A;  3VRG B;  2ZS0 C;  3AQ5 A;  1AJH A;  3K9Z A;  1FN3 B;  105M A;  104M A;  1LFT B;  3HYU B;  2HZ1 A;  2VYZ A;  2MYB A;  1COH B;  3BJ3 A;  3GK9 A;  5CND A;  1X46 A;  3DHT A;  1CG8 B;  1B0B A;  4XDI A;  3D1K B;  4MQG B;  1YVQ A;  1O1L A;  2GTL D;  3H58 A;  1YG5 B;  1HGB B;  3M39 A;  1HBR A;  5HBI A;  2O5T X;  1A00 B;  2ZS0 B;  3CY5 A;  4BJA A;  3ZJQ A;  1Y0T A;  1NQP A;  1S6A A;  4F68 A;  4XS0 A;  1FHJ A;  2HBF A;  1O1I B;  2EF2 A;  3M3A A;  1RQ4 B;  1CH2 A;  3NMM B;  1O1K B;  1T1N B;  1Y5K A;  1HV4 A;  2AV0 A;  4VHB A;  2HBD A;  3ARK A;  1Y5F A;  1TU9 A;  3HYU A;  2MYD A;  1VXB A;  1A6K A;  3WHM B;  2JHO A;  1JF4 A;  1Y7C B;  1BVD A;  2NSR A;  3DR9 A;  2ZFB B;  1HSY A;  4N7O B;  3IC0 B;  2ZFO C;  1PBX B;  1MOB A;  1GBU A;  2ZLX B;  1S69 A;  2D60 B;  1RQA B;  2ZLW B;  106M A;  1K1K A;  3UI0 A;  2PGH B;  1AZI A;  1Y35 B;  4ILZ A;  3LHB A;  1OR6 A;  5CN5 A;  3SDN A;  3MJU A;  1NZ2 A;  2GL3 A;  1ABW A;  3BJ2 B;  1Y7Z A;  5CHQ A;  1JF3 A;  1QI8 B;  2HBD B;  1C7B A;  2W31 A;  1J3F A;  4MQH A;  2HHB B;  1C7D B;  1BVC A;  2BKM A;  3KMF C;  3HHB A;  1GLI A;  1S5X A;  5HAV A;  3WFT A;  2CMM A;  1U7R A;  1HJT A;  3BJ1 A;  108M A;  2D5X A;  3GQP A;  1YVQ B;  2DN1 A;  3UHV A;  1VXF A;  1ECD A;  1UVY A;  1KFR A;  3AT6 B;  5HY8 A;  1CH3 A;  1BZZ A;  1DWS A;  3MVC A;  5EQM A;  4MBN A;  1GDL A;  3HEO A;  4MQC B;  4N8T B;  1MBD A;  1LH6 A;  3S66 B;  1MLN A;  1GZX A;  3A59 B;  1LHS A;  3BCQ A;  2ZLU A;  1MOC A;  1HGA A;  1YEU B;  1QXE B;  3R5I B;  1DLW A;  5EE4 D;  2EB9 A;  1CH7 A;  1DKE B;  1UIW B;  1YE2 B;  1XZ5 B;  1S56 A;  1OUT A;  5D5R A;  3ARJ A;  3WCU B;  1GBV A;  1Y83 B;  2ZWJ A;  5CMV A;  1Y4R A;  2VYY A;  1YZI A;  4MQK A;  107M A;  4N7N B;  2VLX A;  1CPW A;  2D2N A;  2GKM A;  2QMB B;  2DN3 A;  1G0B B;  1J7W B;  1VXD A;  1Y09 B;  1O1J A;  3PI8 A;  4NK1 A;  2FRI X;  2HBE A;  2V1J A;  5ILM A;  4WJG 1;  2AV3 A;  4LPI A;  1Y8W A;  3QJE B;  2YRS B;  1IT2 A;  1BIJ B;  3WCT C;  4U8U D;  1MLR A;  2G0V A;  1MNO A;  3OO4 A;  4F4O B;  1CBM A;  3PI9 A;  1WMU A;  3WHM A;  1GCV B;  3O89 A;  1WVP A;  1BIN A;  2GRH A;  1UC3 A;  1VXG A;  1J3Z B;  1Y45 B;  2W6V B;  1LJW A;  1G09 A;  1UFJ A;  4N7O A;  3LR7 A;  3UHT A;  4M4A B;  1LTW A;  3SZK A;  3LQD B;  1MBN A;  3ZJJ A;  3HC9 A;  5JGG B;  5CNE A;  2M6Z A;  1JY7 B;  3VRE A;  1X9F A;  1MBA A;  3KMF A;  3UHR A;  1BZ1 A;  1J3Y B;  2R4Z A;  5B84 A;  1GDJ A;  4TWV A;  2B7H A;  4AVE A;  3K3U A;  2QLS B;  3VHB A;  1NS6 B;  2V1I A;  3UHK A;  3HF4 A;  2AUO A;  2R4Y A;  1DXT A;  3G4Q A;  1ECO A;  3ZHW A;  2HBS A;  1COH A;  1J3Z A;  1L2K A;  1FLP A;  5CN4 A;  4NI0 B;  5C6E B;  1X9F C;  1EBT A;  3GQG B;  2AUR A;  1KR7 A;  1MGN A;  2G0R A;  4ZVA A;  1A01 A;  4MAX A;  2MGK A;  3GLN A;  3NL7 A;  4NXA A;  2G0X A;  2D6C A;  1J41 B;  3AG0 A;  4FH7 A;  4NI1 B;  2GRF A;  3UHU A;  2O5S X;  1MNI A;  1C40 B;  1GBV B;  3DUT B;  2LH2 A;  1Y8I B;  3P5Q A;  1FHJ B;  1X9F B;  3UHY A;  4MQK B;  2G11 A;  3DHR A;  1HHO A;  1X9F D;  1X3K A;  4F69 A;  1C40 A;  1V4U A;  1HDA B;  2ZFO B;  2MGI A;  1RSE A;  1CH4 A;  1RVW A;  101M A;  1JEB A;  3CIU B;  3DHR B;  3ZJS A;  2OLP A;  1A6G A;  2RI4 B;  1G0A A;  2DN2 A;  3V2Z A;  3OVU C;  1CO9 A;  1F63 A;  5JGG A;  1O16 A;  3LB2 A;  3UH3 A;  2M6Z B;  2ZLX A;  1A0U B;  4O4T A;  1GBU B;  2ZLV A;  3NL7 B;  1Y4V B;  2OH8 A;  1Y2Z B;  3D1K A;  1ABS A;  1YEQ B;  3EU1 B;  2R4X A;  1NEJ A;  3QM8 A;  1VWT B;  1Y09 A;  3PI8 B;  1J7W A;  1V4X B;  4FWX A;  1Y8H A;  1LH2 A;  3A0G A;  1MLM A;  2EKU A;  2IN4 A;  1M9P A;  5EUI B;  1OUU A;  2HBS B;  3A9M A;  4HBI A;  1YIH A;  1O1I A;  2FRJ X;  3UBV A;  3PT7 B;  1YGF B;  3WCT D;  1G08 A;  1XY0 B;  4MU5 A;  1MYJ A;  1G0A B;  3HHB B;  3TLD A;  1SHR A;  2Z6N B;  1MTK A;  3TM3 A;  1QSH A;  2MGD A;  1YIE A;  3QM9 A;  1YH9 B;  3K8B A;  4GZG A;  2D2N C;  1XQ5 B;  2ZSQ A;  1HAB A;  2HCO A;  1ITH A;  4SDH A;  1MLO A;  2HHE A;  3H57 A;  2PEG B;  3LQD A;  3UHS A;  1JP8 A;  3OZU A;  4ODC A;  2V1F A;  2R1H A;  1BZZ B;  1IT3 A;  1FCS A;  2D2N B;  3UHI A;  3WCU C;  1QSI B;  1HCO A;  1JZM A;  1LH1 A;  2VYW A;  1FSX B;  1SWM A;  3FH9 A;  3PEL A;  3HF4 B;  2GDM A;  110M A;  2ZLU B;  1YHR B;  4UIQ A;  3D1A B;  4H2L A;  2YRS A;  4ROL A;  4UZV A;  5KDQ B;  1YE2 A;  1UIW A;  1FN3 A;  3UH6 A;  3PI1 A;  2MGG A;  1LFZ A;  3PI4 A;  3EOK A;  5M3S A;  1Y0D A;  5HLX A;  5F2A A;  1I3E A;  1MLQ A;  3WCT B;  1LH5 A;  1FDH A;  2O5L X;  1O1L B;  3HXN A;  1SPG B;  3UHZ A;  5CN6 A;  1YOG A;  4U8U B;  2VRY A;  3LB3 A;  3QJC A;  1DO4 A;  2HBE B;  2GLN A;  2ZS1 A;  1O1N A;  2H8D A;  4MBA A;  1JDO A;  1MOH A;  3VAU A;  1EBC A;  3WCV C;  4TWU A;  1XZU B;  3ZOM A;  3OO5 A;  1BUW A;  2QSP A;  2D2M B;  2G12 A;  2QU0 A;  5F0B A;  4MQI A;  2DC3 A;  1Y45 A;  2W6V A;  4U8U C;  1Y4P A;  3AQ9 A;  3AQ6 A;  2EVK A;  1G09 B;  1CH9 A;  3ORD A;  4NK2 A;  4X0L B;  1VXC A;  1XZ2 A;  1YHU A;  1Y5F B;  2HBC A;  1OR4 A;  1Y8I A;  3BJ1 B;  1Y2Z A;  3S65 A;  3S48 C;  1NPF A;  2D2M C;  1DXV A;  2XKH A;  1MCY A;  2ZST A;  4HRT A;  3IC0 A;  2VLY A;  2H8F A;  1YH9 A;  3K8B B;  2MGJ A;  1O1O B;  1A6M A;  1BZ6 A;  1J3Y A;  1BZ1 B;  1BZR A;  2PGH A;  3QZX A;  1YEO B;  4MXL A;  1B86 B;  2QMB A;  2R1H B;  2Z6S A;  111M A;  1G9V A;  1Y0T B;  1NS6 A;  4MQI B;  1GZX B;  3G4Y A;  2QU0 B;  1MKO A;  4OOD A;  2BK9 A;  1BUW B;  1YEO A;  1QI8 A;  1ASH A;  4XS0 B;  1SHR B;  1Y4P B;  3WTG B;  2MGL A;  1XZV B;  1IOP A;  3ARL A;  3BJ3 B;  1MBI A;  1H97 A;  3IXF A;  3S65 B;  1YGD A;  1HBG A;  1Y22 A;  3LR9 A;  3OK5 A;  4G51 A;  5EUI A;  1UVX A;  1XZ7 A;  3HRW A;  3QJD B;  3ODQ B;  2QSS A;  1QPW A;  3WI8 A;  1MYH A;  4F6G A;  1W92 A;  2BW9 M;  2O5O X;  1LFT A;  3MBA A;  3E55 A;  1MNJ A;  1Y5K B;  2LH6 A;  1XZU A;  4FH6 A;  4QAU A;  2DN2 B;  3UBC A;  1A3N A;  1Y46 A;  1O1P A;  1XY0 A;  1DKE A;  3R5I A;  3VRG A;  3UHD A;  1Y4V A;  1F5O A;  1FAW A;  2D5Z B;  1MYF A;  1K0Y A;  3G4V A;  1V75 B;  3WCU D;  4NS2 A;  2LH7 A;  1SPE A;  3SDH A;  1CIO A;  2O5B X;  1G0B A;  2AUQ A;  4DC7 A;  5KER A;  3B75 B;  5IKS A;  112M A;  1YEV A;  2D2M A;  2W72 C;  1HCO B;  4HRR A;  1DWR A;  1MWD A;  5MBN A;  1Y22 B;  1CLS B;  3E5I A;  2SPN A;  1XZ2 B;  1JWN A;  1A9W E;  2DXM B;  3A5B A;  3ODQ A;  4DWU A;  2RI4 A;  1NIH A;  1Y4B A;  5CN7 A;  2BLH A;  3WCW C;  2D5Z A;  1MWC A;  1M6C A;  1HBA A;  2HHD B;  3GKV A;  4ODC B;  3NG6 A;  1Y0W A;  3UHQ A;  1HGB A;  1BBB B;  1MYI A;  1HBS A;  1RQ3 A;  3ZJR A;  5ILE A;  1D8U A;  1HHO B;  3UHB A;  2MB5 A;  1HDS B;  2R80 B;  2C0K A;  1XZ7 B;  1UX8 A;  1LFY A;  2Z6T A;  1S5Y B;  3D1A A;  103M A;  2EKT A;  6HBI A;  4HSW A;  1Y8K A;  1YHR A;  3AQ8 A;  2Z8A A;  1MZ0 A;  1YHE A;  2ZSN A;  2V1K A;  2G10 A;  2MGC A;  1Y7D B;  2ZS0 D;  3A5G A;  2WY4 A;  1JZK A;  1NXF A;  2W6Y A;  4PQB A;  1BAB B;  4L7Y B;  1MOD A;  2ZLT B;  1MNH A;  1CP5 A;  2ZS1 C;  3ECX A;  1HGC A;  3EOK B;  1CLS A;  2OHB A;  3EDB A;  3WFU A;  2D5X B;  1JL6 A;  1HAC A;  3WCV B;  2HHD A;  4G51 B;  1NIH B;  1Y4B B;  2R50 A;  2W72 A;  5JDO C;  2O58 X;  2HCO B;  1YHU C;  2H8D B;  1HBS B;  1RQ3 B;  4F6J A;  3ECZ A;  2DN3 B;  1HDS A;  2LH1 A;  3G46 A;  4PNJ A;  1U7S A;  1Y35 A;  4H07 A;  4FWY A;  3UH5 A;  2MHB B;  3SZK B;  1IRD A;  4O2G A;  2G0Z A;  1DM1 A;  3BCQ B;  3WFW A;  5CN9 A;  1MDN A;  1V4U B;  5CNB A;  1A3O B;  1C7C B;  1Y8K B;  1NGK A;  1LUE A;  1NZ5 A;  5AZQ A;  3D7O A;  5MBA A;  1CBL A;  1THB A;  2DHB B;  4ROM B;  1TES A;  2ZLT A;  1GCV A;  1WMU B;  3QJB A;  4B4Y A;  2O5M X;  4WCH D;  2WTH A;  2VM0 A;  3MKB B;  2HZ2 A;  2XKG A;  3DUT A;  3FS4 A;  5EU2 A;  2HBG A;  1VHB A;  1GJN A;  3GDJ A;  1Y5J B;  1A0U A;  2ZFB A;  1YFF A;  2SPM A;  3UHX A;  4JYQ A;  2OIF A;  1Y8W B;  1QSI A;  1A01 B;  2SPO A;  1A4F B;  2FAM A;  3KUN A;  2ZT1 A;  1BJE A;  2QRW A;  1I3D A;  2ZT4 A;  1MLF A;  1JPB A;  2QFK A;  2AUP A;  4OF9 A;  3HEP A;  3ZJL A;  3OO4 B;  4F4O A;  1C7C A;  3NMM A;  4MQC A;  4N8T A;  4HRR B;  4KMV A;  1MTJ A;  1YE0 B;  1Y85 B;  2ZSO A;  3O7N A;  1LFL A;  1DO3 A;  1Y7G A;  1J40 B;  4NI0 A;  2NRL A;  3MYN A;  1OBM A;  1ECA A;  4DWT A;  2BMM A;  1XXT B;  1DXD A;  1PBX A;  1Y0W B;  2HHE B;  3DHT B;  1Y5J A;  1Y4R B;  1HAB B;  1YVT A;  4NXC A;  3AT5 B;  1YDZ B;  1DTI A;  2B7H B;  1KD2 A;  1ABY B;  1YMC A;  5SW7 A;  1DWT A;  1J7S B;  1YVT B;  5EE4 C;  4HSX A;  1QXE A;  1FDH G;  3EU1 A;  1UMO A;  3OZW A;  1VWT A;  1UFP A;  1G9V B;  1DXC A;  1Y7D A;  1HDB A;  3GOU B;  2HBF B;  3WCP B;  3ZJH A;  2EB8 A;  1M9P B;  3FS4 B;  2QFN A;  3PT8 B;  1O1P B;  2GTL A;  3VRF A;  2KSC A;  5E29 A;  4IRO B;  4H0B A;  4F6D A;  3G4R A;  4AVD A;  1DXT B;  3GQR A;  2W72 B;  3D7O B;  1A00 A;  2ZS0 A;  3CY5 B;  1HBR B;  1N9F A;  109M A;  1XXT A;  3WCT A;  5HLU A;  1MLS A;  2ZLV B;  4WJG A;  1LH3 A;  3GKT A;  1YGD B;  5ILP A;  1Y0A B;  3QM5 A;  1MTI A;  1Y4F B;  2MGF A;  1MLH A;  1HLB A;  2BNL A;  1Y85 A;  1SDK B;  1MLG A;  1SI4 B;  3ED9 A;  3A2G A;  3RGK A;  3WCW B;  2GKN A;  1N9I A;  3PI2 A;  1BZP A;  1XZ4 B;  1HDB B;  1MNK A;  2XYK A;  2R4W A;  7HBI A;  2LH3 A;  3S66 A;  1URV A;  4O35 A;  3QJB B;  1CG5 B;  5C6E A;  2ZSZ A;  3WR1 B;  3GQP B;  4X0L A;  1MOA A;  3GQG A;  3D4X B;  1Y01 B;  3CIU A;  5AB8 A;  2NSS A;  3GKV B;  2ZSR A;  3QJD A;  3GQR B;  1BBB A;  1YHU D;  1GVH A;  1LA6 A;  1OJ6 A;  3UHN A;  2ZS1 B;  4G1V A;  4F6B A;  3D4X A;  1RQ4 A;  5JDO D;  1RPS A;  3ZJM A;  1JZL A;  3QMA A;  4FC3 B;  3S1I A;  1Q1F A;  2H35 A;  4G1B A;  2D2M D;  1Y7Z B;  2D2N D;  5ILR A;  1O1M A;  3OGB A;  5C6Y A;  1MLU A;  1IBE B;  2ZS1 D;  1JL7 A;  5KER B;  4O1T A;  4YU4 B;  1YHU B;  3WCU A;  1CG5 A;  2HBC B;  4MXK A;  3WR1 A;  4MQG A;  5EET A;  1GLI B;  1CG8 A;  1S5X B;  1UT0 A;  1LFZ B;  5HLQ A;  1URY A;  1YEU A;  3EDA A;  3MOU A;  4ROM A;  3UGZ A;  1BZ0 B;  4L2M A;  3PIA B;  2MYE A;  4FWZ A;  3WCV D;  1HRM A;  1SDK A;  2O5Q X;  3BJ2 A;  1QXD B;  2FAL A;  4N7P B;  1KD2 B;  1YOI A;  1RTE A;  4F6F A;  1RPS B;  2VEE A;  5E6E B;  1Y4F A;  1HBB A;  2HHB A;  1AJG A;  1VXE A;  2GNV A;  1YCA A;  2HZ3 A;  3M3B A;  2SPL A;  4O4Z A;  4YU3 B;  1NS9 B;  1LFV A;  4C44 A;  5E6E A;  1A9W A;  5HU6 B;  1YEN A;  1B86 A;  1RTX A;  1FSX A;  2G0S A;  5E29 B;  1XZ5 A;  1YCB A;  1OUT B;  1SPG A;  2Z6N A;  3ZH0 A;  1YEQ A;  4NZI A;  3ZJI A;  1A3N B;  4H2L B;  3D17 A;  3ZJO A;  1DLY A;  3UGY A;  2D60 A;  1HBA B;  2E2Y A;  1VRE A;  1J41 A;  3PIA A;  1IWH B;  4NI1 A;  2PEG A;  2H35 B;  3NML A;  1YMB A;  2ZT0 A;  3GYS A;  2MGA A;  1A4F A;  2BLI A;  3MJU B;  2MGM A;  1EWA A;  3P5Q B;  1S0H B;  5CHR A;  2ZSS A;  1CMY A;  3IA3 B;  1R1X A;  4MQJ B;  1OFK A;  1A6N A;  3UHE A;  1RVW B;  1N9H A;  3FH9 B;  1IRC A;  1LFV B;  3B75 A;  1J7Y B;  6HBW A;  4M4B A;  2MHB A;  1GCW A;  1MKO B;  2BWH A;  4HHB A;  1LFL B;  1O1M B;  2MGE A;  1MBO A;  2OH9 A;  1JP6 A;  2RAO B;  3QM7 A;  1THB B;  2DHB A;  1JW8 A;  1XCH A;  1G08 B;  1GDI A;  2GTL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...