3WDGB

Staphylococcus aureus udg / ugi complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
MTLELQLKHYITNLFNLPKDEKWECESIEEIADDILPDQYVRLGALSNKILQTYTYYSDTLHESNIYPFILYYQKQLIAIGYIDENHDMDFLYLHNTIMPLLDQRYLLTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uracil-DNA glycosylase
publication title Staphylococcus aureus protein SAUGI acts as a uracil-DNA glycosylase inhibitor.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase/hydrolase inhibitor
total genus 25
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06106 SAUGI S. aureus uracil DNA glycosylase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.250 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3wdgB00
3WDGB 5AYSC 2KCDA 5AYRB
chains in the Genus database with same CATH superfamily
2CG0A 1B3SA 3KIIA 2RSXA 2UX0A 5IEPA 3CC73 4EV5A 1KD14 1FGOA 1FGRA 4QWTA 3LOYA 3WMDA 1F8NA 1BRSA 2CX1A 2RBIA 1RCKA 1NWWA 4LMIA 4XBXA 2GU1A 1UGHI 1RGKA 2CG1A 1EUIC 2CFGA 1Q9EA 2W9PA 2CWTA 4N3VA 2Q07A 1IQXA 1R4YA 1I3FA 1N5PA 1U8CB 1MGRA 2A15A 4FCZA 3UL6A 1YJ93 3DZLA 2HMOB 3M8CA 3LZAA 2BT3A 2F5MA 4J9AA 1BU4A 1YVSA 5JBSA 1T3BA 2KF6A 1BRKA 1TJDA 2BNGA 3N9HA 5KP3A 3FG1A 5M19A 2GU3A 5IG5A 3X42A 1NDOB 2KAAA 1IVXA 4O8SA 1GS3A 3TDGA 1UI7A 2C4BA 3JUOA 5KP4A 2O3OA 4R9KA 1N9EA 4H61A 4TX4A 4WYKB 3ROBA 2BU4A 3OXAA 4N6UA 1KC84 3VF1A 4LYLB 2F4YA 2WO0A 3DUKA 1HKXA 3HIGA 1MGWA 3BNDA 3F7SA 4HM5B 3S28A 3A76A 4BL2A 1U5OA 3WA2X 1IQYA 1RGCA 2IYJA 5KP1A 1I0XA 1OF5A 2XH9A 3UB1A 3EBYA 4LGQA 4KFFA 2IMJA 4HJLB 1W6CA 1I8VA 4AKZA 1FA3A 1JB4A 1YGWA 2E2VA 1D6UA 2WOFA 1T2IA 2GSPA 4OVMA 3LTCA 3JUMA 4KT3B 3CCE3 2RNTA 3CC23 3BNCA 1DMQA 4LEHA 1UCLA 5ELUA 7STDA 1KQS2 2CFWA 2UUGC 1VQK3 5DRVA 1JBSA 2CFKA 1K8A4 1IVVA 1WNHA 2CWUA 2HMLB 3MPHA 3FF0A 5GSPA 4BTWA 6STDA 2WGQA 1BVIA 1DETA 1JNQA 1GSPA 4J5GA 1I2GA 1BRGA 3EBTA 3ER7A 1B2SA 3F7XA 3T0UA 1UGIA 3G6E3 1EQKA 3UNLA 3Q2PA 1VQ43 3OWUA 1AY7A 3ECFA 3LMLA 1TTOA 3SLUA 1X1UA 4J8TA 4N6TA 3S29A 2MC8A 6RNTA 1HZ1A 1W6YA 2HMNB 3LT9A 1AR0A 4HBRA 1Q7Y4 2OOVC 1FGQA 3CMA3 2V1LA 3B4OA 1VQ83 5M1AA 1SPUA 2KXGA 4N6LA 4K61A 1RN1A 3JVCA 3I553 2GBXB 3GSPA 3V99A 7RNTA 1NB5I 1R4CA 1A2KA 3D5GA 2Z76A 1I3IA 3BLZA 2YFIB 1W01A 2W56A 4WP5A 3SXXA 1BOXA 3EE1A 3GZXB 4BL3A 4RNTA 3DGMA 3ZG0A 3EF8A 2STDA 1RGHA 2OCTA 3MG2A 3WDGB 1OF5B 3NX0A 1BSCA 2CX0A 5RNTA 1N9JA 3EN1B 1B20A 4L7KA 1AVLA 3KZTA 1UDII 3K63A 3ZFZA 1V74A 2ZA4A 1O7PB 1IVUA 3L0RA 4XBTA 3MSOA 1QVG2 5EVHA 5JPUA 1OUNA 4HZBB 4BU4A 1D6ZA 1DVCA 1YJW3 2CK3H 3WR2A 2K0MA 5IERA 1LOYA 1I2EA 1RGLA 1LXEA 1RN7A 1C7HA 2RCDA 2RGQA 3FCSB 4HM8B 3PYJA 3KKGA 2W0QA 1FW7A 5IENA 1TRPA 3GZYB 3MWZA 1RN4A 4JRFA 1Q814 5AYSC 3FF2A 2ZHXB 3LH4A 4EW5A 3EJVA 3F14A 5AIIA 3I563 5ELJA 4XDVA 1OH0A 2QEX3 1GOVA 1SIIA 1OHOA 4L8PA 5EQLA 5AEUB 4N6OB 1LOXA 1TIJA 4HOHA 4JF8A 3AGNA 1I70A 1W6GA 3KFQC 4EBGA 1WQLB 2XFSA 4Q53A 3G4S3 3RGAA 3WOEB 1QALA 3CD63 4R9LA 1IVWA 1I0VA 1E3RA 2O9UX 2KF4A 3Q1CA 4IT7A 4KFDA 5AEWB 1KSIA 3IJEB 3MG3A 2SBLA 3LTDA 3K7CA 4HM0B 4N6V0 3CCJ3 2F56A 3Q90A 3KE7A 2BMQB 3ALAA 5AYRB 1VZZA 5AIGA 1T2HA 4HM1B 3BNEA 1VQ73 3DM8A 4NREA 4ILFA 1QAKA 2QGUA 4GB5A 2W56B 3HZPA 3GAXA 1MOLA 3DGNA 5CLKA 3URPA 4EXRA 5EEOA 1I2FA 2LQVA 2WOHA 5AIHA 4CCVA 3OWYA 1DYUA 1ZO2A 1BNGA 1CH0A 5G2GA 1LQMB 1GY5A 3MKIA 3NUVA 3D79A 5STDA 1A90A 1QAFA 4I5QA 3EN8A 1RGAA 4ORLA 5BU4A 1Q42A 2BMOB 3EQQB 3NBJA 1AVKA 1BSBA 4FCJA 3KCHA 1LOWA 2H0GA 3SOAA 2LYXA 2Y73A 1PFPA 3U1WA 3G0KA 2XF3A 2OOVA 1IU7A 7GSPA 2I9WA 1D6YA 1TU5A 3WHOA 3EB8A 1DE3A 1GY7A 3FGYA 1RJOA 4WWUC 3CME3 2F86B 1EA2A 2YFLB 3NV0A 1WMPA 3QRDA 1IV9A 1SQWA 1O7HB 4FR9A 3DXOA 2P0MA 3CPW2 1B2XA 1TUHA 2B1XB 5D82A 2OQEC 1MWRA 4PEJA 1IT8A 4IIAA 1NU3A 2IY2A 3X3XA 1VQP3 1GD3A 1Q824 1RSNA 3WOFB 1MNLA 1OHSA 3JUNA 3CC43 1QMAA 2BO9B 4MMZB 5IW9A 4O3VA 4FMDA 1N5HA 2CKFB 4OK0A 1EEJA 1Q864 3DGLA 4HM7B 4MMYB 1ROVA 3FG3A 2INXA 3STDA 8CHOA 1NJI4 2XFTA 1FUWA 3PCRA 3FG4A 1GOUA 1UCJA 4CPKA 3EHCA 3RDEA 3SYUA 5BIRA 2CWVA 3AHSA 3MHEA 2FXTA 2Y74A 1BNSA 4O02B 3K5TA 1BSDA 3FKAA 3FLJA 1V58A 2BMRB 1ASKA 1B21A 1YHQ3 1IYYA 3F8XA 1LVNA 2PNCA 3X3ZA 3DMCA 2UGIA 2BIRA 2ZL8A 1SJWA 1BANA 2SARA 1VQ63 5HOHA 1OACA 1YIJ3 3D9RA 2GEYA 1EKMA 4O2HA 4J5KA 1X1YA 1RDSA 1JRQA 3CCQ3 2HOHA 2W6JH 4GHOA 4HM4B 1JZDA 3VSYA 3X40A 3SVAA 1GMPA 3U97A 1JJ22 3PXMA 1CYUA 4EYCA 1AQZA 1BAOA 5LC7A 2XEPA 1BRHA 3B4PA 1W00A 3NQYA 3SX1A 4X2HA 2ML5A 1EG9B 1RRHA 1QVF2 1BNJA 1OCVA 8RNTA 1ISKA 2FNQA 1RLSA 1T5YA 3K9MC 3NV0B 1W02A 4LSOA 4N6MA 2H0HA 1FYSA 3GZRA 5IG3A 3NM2A 1BRNL 1CQSA 1Z1SA 4RNYA 3UJMA 2AAEA 3Q3FA 1YGEA 4K1VA 3UL5A 2JDIH 4KFEA 1NNVA 4HYZA 2Z7AA 3H3HA 4U13A 3B8LA 2YFJB 1RCLA 1W2ZA 2D1WA 2XGNA 2FGTA 5G1KA 1K734 1RMSA 3LT8A 1M904 6GSPA 2M7OA 4I4KA 1VQN3 2CFLA 1A2VA 1AV4A 1G02A 5CF1A 3KN4A 1NB3I 2C10A 2IUKA 2W9QA 3HX8A 4MJDA 1JN5B 1GY6A 1YVBI 1M1XB 3JUPA 1A2PA 2CFDA 4NHFA 5AI1A 4RZMA 3SOYA 1IQ8A 1YJN3 2CHCA 1JBRA 3MG1A 3BNBA 3NHXA 2D42A 2YX9A 3CPOA 1JB2A 1OPYA 1JKGB 4XBYA 2MF7A 5CK6A 1BRJA 1Q40A 1GMRA 3AGOA 1E97A 1FGMA 3CCM3 3H51A 1BUJA 1SARA 2W2CA 1NO3A 4AKYA 2QIYA 1OGXA 4R80A 3FH1A 1B2UA 3JUQA 1V57A 1G96A 4HVNA 1STFI 2IUJA 2OQEA 4XB5A 2R4IA 4HKVB 3CCR3 3GZBA 1DMNA 1OGZA 1VQL3 1FUSA 5IF6A 1Y4KA 3DGOA 1L5GB 1HU9A 3NM7A 1JZOA 5A0OB 3BIRA 2L1SA 3N54B 1G0TA 1ROAA 3G713 3G16A 2F5WA 2KF3A 1W2B2 5FW5A 4AEQA 4N6NB 4RBNA 1IK3A 3B7CA 3FZWA 1O7GB 2P38A 5BXQA 4ZM8A 1M1K4 4WHAA 1VQO3 4BTYA 3CCS3 2XRXB 4R4KA 1GD4A 2KF5A 2JQ5A 3OV4A 3CNMA 1DVDA 4KZ1A 5D83A 1LRAA 2OWPA 1IV7A 1B2ZA 3HOHA 2PZVA 4GSPA 1E3VA 4CJNA 1TFOA 3D4AA 1LQGC 1MWUA 4EV2A 5D81A 3AMOB 1WMNA 2XGLA 1LNHA 3CU3A 2P0XA 1BUQA 1VQ93 1SIHA 4GL6A 1BNRA 1RNTA 1N8QA 2E2UA 3DGYA 3T8UA 3FSDA 4BIRA 4DKIA 2BHMA 1O7WB 1CEWI 4K1UA 4RNZA 4HM3B 2RFRA 1UUWB 3O8YA 3RNTA 3ZG5A 5IG0A 1Q40B 3PGBA 1BNIA 1UCKA 2CIUA 4FMCA 2R41A 3E99A 3IPTA 1W4NA 1RNBA 1TFKA 1VQ53 1UUGB 9RNTA 1RGFA 5CXOA 3HK4A 1WMOA 2P05A 4R1KA 1IT7A 5HGRA 1S5AA 2QA43 2B24B 4HAAA 4IPBA 1JN5A 1US1A 2GXFA 1TRQA 3GWRA 3PS8A 3RGRA 3S5CA 1FGTA 4G1MB 1STDA 5BVBA 2HMMB 3NQZA 1JKGA 1RHLA 3NBBA 3T8NA 1O7NB 1K9M4 1FZUA 2OTJ3 3OX9A 1VQQA 3HIIA 2CW9A 5CF2A 2GBWB 1UCIA 1ZS7A 1HYFA 5JPPA 1RKYA 1JB5A 3NBRA 1W7CA 2HMJB 3SEDA 3LXUX 2KRTA 1S723 4HM2B 3PZWA 2H0IA 4FCMA 3K0ZA 3OW22 3DY5A 2KCDA 4NPBA 4X2OA 3VGNA 1IDPA 4K90B 5I97A 1OHPA 3DH2A 4MEIA 3S27A 5AIFA 3F9SA 2P09A 1LNIA 4OUQA 3V98A 2K3DA 1TP6A 3S67A 3F8HA 1PU4A 1GYBA 1BGSA 1KWIA 2CH9A 2XR8B 4BTXA 1BIRA 1YIT3 3GRDA 3I0YA 2F98A 2HMKB 2CC3A 3G8ZA 1BNEA 3OWSA 4H3UA 5G1LA 3WODG 2XSHB 1J2BA 1O7MB 3KSED 2ZDJA 2ML6A 3EC9A 5LC6A 4CDLA 3BB9A 4KVHA 1WTHA 4HZ9B 1PY3A 2E2TA 1QJGA 1K28A 3D5IA 5M18A 3LYGA 3PCSA 1YI23 4LZIA 2XSOB 2GEXA 4WFOA 1GOYA 3LTBA 1YNVX 3EX9A 1ULIB 2W04A 2WGOA 3HI7A 3AMOA 1X1WA 4FMAA 1RTUA 1W5ZA 1RGEA 1MWTA 3CCL3 1ZX2A 3A5EA 3AHWA 5IG4A 3V92A 1RGGA 5TGNA 5DREA 1BNFA 2C11A 5FGOA 3J7Yd 3N8BA 1B2MA 1VQM3 1DMMA 3WA3A 4HM6B 1MWSA 4STDA 1CYVA 1A67A 4WYKA 3CCV3 2J8XB 4XDWA 1ZGXA 1PYLA 1ULJB 2L4VA 3BU4A 3QK9A 4XM4A 3CXC2 1K41A 1B27A 3X41A 1UI8A 1N8R4 1M9GA 1JBTA 1GMQA 1BSEA 1X1XA 1BSAA 4FMBA 1LOVA 3IMAB 2Z77A 2AADA 3CNXA 4EC6A 3NXJA 2OTL3 1BRIA 4MMXB 3CCU3 2W03A 1UW1A 2Z6BA 1Q7HA 5IEOA 2K54A 1C54A 2F99A 1RRLA 3KSPA 1UUVB 3MYTA 3LTAA 3D3LA 1FUTA 3X3YA 3F40A 4L8OA 1JV2B 2IA7A
chains in the Genus database with same CATH topology
2CG0A 3KIIA 2RSXA 2UX0A 5IEPA 3CC73 4EV5A 1KD14 1FGOA 1FGRA 4QWTA 3LOYA 3WMDA 1F8NA 1NWWA 4LMIA 4XBXA 2GU1A 2CG1A 2CFGA 2W9PA 2CWTA 4N3VA 2Q07A 1IQXA 1U8CB 1N5PA 4FCZA 1YJ93 2A15A 3UL6A 3DZLA 2HMOB 3M8CA 3LZAA 2BT3A 4J9AA 5JBSA 2BNGA 3N9HA 5KP3A 3FG1A 2GU3A 5IG5A 3X42A 1NDOB 4O8SA 1IVXA 1GS3A 3TDGA 1UI7A 3JUOA 5KP4A 2O3OA 4R9KA 1N9EA 4H61A 4TX4A 4WYKB 3ROBA 3OXAA 4N6UA 1KC84 3VF1A 2WO0A 3DUKA 1HKXA 3HIGA 4HM5B 3BNDA 3F7SA 3S28A 3A76A 1U5OA 3WA2X 1IQYA 5KP1A 1OF5A 3UB1A 2XH9A 3EBYA 4LGQA 4KFFA 2IMJA 4HJLB 1W6CA 4AKZA 1FA3A 1JB4A 2E2VA 1D6UA 2WOFA 4OVMA 3LTCA 3JUMA 3CCE3 3CC23 3BNCA 1DMQA 4LEHA 5ELUA 7STDA 1KQS2 2CFWA 1VQK3 5DRVA 2CFKA 1K8A4 1IVVA 1WNHA 2CWUA 2HMLB 3MPHA 3FF0A 4BTWA 6STDA 2WGQA 1JNQA 3ER7A 3EBTA 3F7XA 3T0UA 3G6E3 1EQKA 3UNLA 3Q2PA 1VQ43 3OWUA 3ECFA 3LMLA 3SLUA 4J8TA 4N6TA 3S29A 2MC8A 1W6YA 2HMNB 3LT9A 1AR0A 4HBRA 1Q7Y4 2OOVC 1FGQA 3CMA3 2V1LA 3B4OA 1VQ83 1SPUA 2KXGA 4N6LA 4K61A 3JVCA 3I553 2GBXB 1NB5I 3V99A 1R4CA 1A2KA 2Z76A 3BLZA 2YFIB 1W01A 2W56A 4WP5A 3SXXA 3EE1A 3GZXB 3DGMA 3EF8A 2STDA 3MG2A 2OCTA 3WDGB 1OF5B 3NX0A 1N9JA 3EN1B 4L7KA 1AVLA 3KZTA 3K63A 1V74A 1O7PB 1IVUA 3L0RA 4XBTA 3MSOA 1QVG2 5EVHA 5JPUA 1OUNA 4HZBB 1D6ZA 1DVCA 1YJW3 2CK3H 2K0MA 5IERA 2RGQA 1LXEA 1RN7A 1C7HA 2RCDA 3FCSB 4HM8B 3PYJA 3KKGA 2W0QA 5IENA 3GZYB 3MWZA 4JRFA 1Q814 5AYSC 3FF2A 3LH4A 3I563 3EJVA 3F14A 5AIIA 5ELJA 4XDVA 1OH0A 2QEX3 1SIIA 1OHOA 4L8PA 5EQLA 5AEUB 4N6OB 1LOXA 1TIJA 4JF8A 1W6GA 3KFQC 4EBGA 1WQLB 2XFSA 4Q53A 3G4S3 3RGAA 3WOEB 1QALA 3CD63 4R9LA 1IVWA 1E3RA 2O9UX 3Q1CA 4IT7A 4KFDA 5AEWB 1KSIA 3IJEB 3MG3A 2SBLA 3LTDA 3K7CA 4HM0B 4N6V0 3CCJ3 3Q90A 3KE7A 2BMQB 3ALAA 5AYRB 1VZZA 5AIGA 4HM1B 3BNEA 1VQ73 3DM8A 4NREA 1QAKA 2QGUA 4GB5A 2W56B 3HZPA 3GAXA 1MOLA 3DGNA 5CLKA 4EXRA 5EEOA 2LQVA 2WOHA 5AIHA 4CCVA 3OWYA 1DYUA 1ZO2A 5G2GA 1GY5A 3MKIA 3NUVA 5STDA 1A90A 1QAFA 3EN8A 4ORLA 1Q42A 2BMOB 3EQQB 3NBJA 1AVKA 4FCJA 3SOAA 2LYXA 2Y73A 1PFPA 3U1WA 3G0KA 2XF3A 2OOVA 1IU7A 2I9WA 1D6YA 1TU5A 3EB8A 1GY7A 3FGYA 1RJOA 4WWUC 3CME3 2F86B 1EA2A 2YFLB 3NV0A 1WMPA 3QRDA 1IV9A 1SQWA 1O7HB 4FR9A 3DXOA 2P0MA 3CPW2 2B1XB 1TUHA 5D82A 2OQEC 4PEJA 1IT8A 4IIAA 1NU3A 3X3XA 1VQP3 1Q824 1GD3A 3WOFB 1MNLA 1OHSA 3JUNA 3CC43 1QMAA 2BO9B 4MMZB 5IW9A 4O3VA 4FMDA 1N5HA 2CKFB 4OK0A 1Q864 3DGLA 4HM7B 4MMYB 1ROVA 3FG3A 2INXA 3STDA 8CHOA 1NJI4 2XFTA 1FUWA 3PCRA 3FG4A 3EHCA 3RDEA 2CWVA 3MHEA 2FXTA 2Y74A 4O02B 3K5TA 3FKAA 3FLJA 2BMRB 1ASKA 1YHQ3 3F8XA 1LVNA 2PNCA 3X3ZA 3DMCA 2ZL8A 1SJWA 1VQ63 1OACA 1YIJ3 3D9RA 2GEYA 1EKMA 4O2HA 1JRQA 3CCQ3 2W6JH 4HM4B 3VSYA 3X40A 3SVAA 3U97A 1JJ22 3PXMA 1CYUA 4EYCA 5LC7A 2XEPA 3B4PA 1W00A 3NQYA 3SX1A 4X2HA 2ML5A 1EG9B 1RRHA 1QVF2 1OCVA 1ISKA 2FNQA 3K9MC 1T5YA 3NV0B 4LSOA 1W02A 4N6MA 3GZRA 5IG3A 3NM2A 1CQSA 1Z1SA 4RNYA 3UJMA 4K1VA 1YGEA 3UL5A 2JDIH 4KFEA 4HYZA 2Z7AA 3H3HA 4U13A 3B8LA 2YFJB 1W2ZA 2D1WA 2XGNA 2FGTA 1K734 3LT8A 1M904 2M7OA 4I4KA 1VQN3 2CFLA 1A2VA 1AV4A 5CF1A 3KN4A 1NB3I 2C10A 2IUKA 2W9QA 3HX8A 4MJDA 1JN5B 1GY6A 1YVBI 1M1XB 3JUPA 2CFDA 4NHFA 5AI1A 3SOYA 4RZMA 1IQ8A 1YJN3 2CHCA 3MG1A 3BNBA 3NHXA 2D42A 2YX9A 3CPOA 1JB2A 1OPYA 1JKGB 4XBYA 2MF7A 5CK6A 1Q40A 1E97A 1FGMA 3CCM3 3H51A 2W2CA 1NO3A 4AKYA 2QIYA 1OGXA 4R80A 3FH1A 3JUQA 4HVNA 1G96A 2IUJA 1STFI 2OQEA 4XB5A 2R4IA 4HKVB 3CCR3 3GZBA 1DMNA 1OGZA 1VQL3 5IF6A 1Y4KA 3DGOA 1L5GB 1HU9A 3NM7A 5A0OB 3N54B 1ROAA 3G713 3G16A 1W2B2 5FW5A 4AEQA 4N6NB 4RBNA 1IK3A 3B7CA 3FZWA 1O7GB 2P38A 5BXQA 4ZM8A 1M1K4 4WHAA 1VQO3 4BTYA 3CCS3 2XRXB 4R4KA 1GD4A 2JQ5A 3OV4A 3CNMA 1DVDA 4KZ1A 5D83A 2OWPA 1IV7A 2PZVA 1E3VA 1TFOA 4EV2A 5D81A 3AMOB 1WMNA 2XGLA 1LNHA 3CU3A 2P0XA 1BUQA 1VQ93 1SIHA 4GL6A 1N8QA 2E2UA 3T8UA 3FSDA 2BHMA 1O7WB 1CEWI 4K1UA 4RNZA 4HM3B 2RFRA 1UUWB 3O8YA 5IG0A 1Q40B 3PGBA 2CIUA 4FMCA 3E99A 3IPTA 1W4NA 1TFKA 1VQ53 5CXOA 3HK4A 1WMOA 2P05A 4R1KA 1IT7A 5HGRA 1S5AA 2QA43 2B24B 4IPBA 1JN5A 1US1A 2GXFA 3GWRA 3PS8A 3RGRA 3S5CA 1FGTA 4G1MB 1STDA 5BVBA 2HMMB 3NQZA 1JKGA 1K9M4 3NBBA 3T8NA 1O7NB 2OTJ3 3OX9A 3HIIA 2CW9A 5CF2A 2GBWB 5JPPA 1RKYA 1JB5A 3NBRA 1W7CA 2HMJB 3SEDA 3LXUX 2KRTA 1S723 4HM2B 3PZWA 3OW22 4FCMA 3K0ZA 3DY5A 2KCDA 4X2OA 3VGNA 1IDPA 4K90B 5I97A 1OHPA 4MEIA 3S27A 5AIFA 3F9SA 2P09A 4OUQA 3V98A 1TP6A 3S67A 3F8HA 1PU4A 1GYBA 1KWIA 2CH9A 2XR8B 4BTXA 1YIT3 3GRDA 3I0YA 2F98A 2HMKB 2CC3A 3G8ZA 3OWSA 4H3UA 3WODG 2XSHB 1J2BA 1O7MB 3KSED 2ZDJA 2ML6A 3EC9A 5LC6A 4CDLA 3BB9A 4KVHA 1WTHA 4HZ9B 2E2TA 1QJGA 1K28A 3LYGA 3PCSA 1YI23 4LZIA 2XSOB 2GEXA 4WFOA 3LTBA 3EX9A 1ULIB 2W04A 2WGOA 3HI7A 3AMOA 4FMAA 1W5ZA 3CCL3 1ZX2A 5IG4A 3V92A 5TGNA 5DREA 2C11A 5FGOA 3J7Yd 3N8BA 1VQM3 1DMMA 3WA3A 4HM6B 4STDA 1CYVA 1A67A 4WYKA 3CCV3 4XDWA 1ULJB 2L4VA 3CXC2 3QK9A 4XM4A 1K41A 3X41A 1UI8A 1N8R4 1M9GA 4FMBA 3IMAB 2Z77A 3CNXA 4EC6A 3NXJA 2OTL3 4MMXB 3CCU3 2W03A 1UW1A 2Z6BA 5IEOA 2K54A 2F99A 1RRLA 3KSPA 1UUVB 3MYTA 3LTAA 3D3LA 3X3YA 3F40A 4L8OA 1JV2B 2IA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WDG B;  5AYS C;  2KCD A;  5AYR B; 
#chains in the Genus database with same CATH topology
 2CG0 A;  1B3S A;  3KII A;  2RSX A;  2UX0 A;  5IEP A;  3CC7 3;  4EV5 A;  1KD1 4;  1FGO A;  1FGR A;  4QWT A;  3LOY A;  3WMD A;  1F8N A;  1BRS A;  2CX1 A;  2RBI A;  1RCK A;  1NWW A;  4LMI A;  4XBX A;  2GU1 A;  1UGH I;  1RGK A;  2CG1 A;  1EUI C;  2CFG A;  1Q9E A;  2W9P A;  2CWT A;  4N3V A;  2Q07 A;  1IQX A;  1R4Y A;  1I3F A;  1N5P A;  1U8C B;  1MGR A;  2A15 A;  4FCZ A;  3UL6 A;  1YJ9 3;  3DZL A;  2HMO B;  3M8C A;  3LZA A;  2BT3 A;  2F5M A;  4J9A A;  1BU4 A;  1YVS A;  5JBS A;  1T3B A;  2KF6 A;  1BRK A;  1TJD A;  2BNG A;  3N9H A;  5KP3 A;  3FG1 A;  5M19 A;  2GU3 A;  5IG5 A;  3X42 A;  1NDO B;  2KAA A;  1IVX A;  4O8S A;  1GS3 A;  3TDG A;  1UI7 A;  2C4B A;  3JUO A;  5KP4 A;  2O3O A;  4R9K A;  1N9E A;  4H61 A;  4TX4 A;  4WYK B;  3ROB A;  2BU4 A;  3OXA A;  4N6U A;  1KC8 4;  3VF1 A;  4LYL B;  2F4Y A;  2WO0 A;  3DUK A;  1HKX A;  3HIG A;  1MGW A;  3BND A;  3F7S A;  4HM5 B;  3S28 A;  3A76 A;  4BL2 A;  1U5O A;  3WA2 X;  1IQY A;  1RGC A;  2IYJ A;  5KP1 A;  1I0X A;  1OF5 A;  2XH9 A;  3UB1 A;  3EBY A;  4LGQ A;  4KFF A;  2IMJ A;  4HJL B;  1W6C A;  1I8V A;  4AKZ A;  1FA3 A;  1JB4 A;  1YGW A;  2E2V A;  1D6U A;  2WOF A;  1T2I A;  2GSP A;  4OVM A;  3LTC A;  3JUM A;  4KT3 B;  3CCE 3;  2RNT A;  3CC2 3;  3BNC A;  1DMQ A;  4LEH A;  1UCL A;  5ELU A;  7STD A;  1KQS 2;  2CFW A;  2UUG C;  1VQK 3;  5DRV A;  1JBS A;  2CFK A;  1K8A 4;  1IVV A;  1WNH A;  2CWU A;  2HML B;  3MPH A;  3FF0 A;  5GSP A;  4BTW A;  6STD A;  2WGQ A;  1BVI A;  1DET A;  1JNQ A;  1GSP A;  4J5G A;  1I2G A;  1BRG A;  3EBT A;  3ER7 A;  1B2S A;  3F7X A;  3T0U A;  1UGI A;  3G6E 3;  1EQK A;  3UNL A;  3Q2P A;  1VQ4 3;  3OWU A;  1AY7 A;  3ECF A;  3LML A;  1TTO A;  3SLU A;  1X1U A;  4J8T A;  4N6T A;  3S29 A;  2MC8 A;  6RNT A;  1HZ1 A;  1W6Y A;  2HMN B;  3LT9 A;  1AR0 A;  4HBR A;  1Q7Y 4;  2OOV C;  1FGQ A;  3CMA 3;  2V1L A;  3B4O A;  1VQ8 3;  5M1A A;  1SPU A;  2KXG A;  4N6L A;  4K61 A;  1RN1 A;  3JVC A;  3I55 3;  2GBX B;  3GSP A;  3V99 A;  7RNT A;  1NB5 I;  1R4C A;  1A2K A;  3D5G A;  2Z76 A;  1I3I A;  3BLZ A;  2YFI B;  1W01 A;  2W56 A;  4WP5 A;  3SXX A;  1BOX A;  3EE1 A;  3GZX B;  4BL3 A;  4RNT A;  3DGM A;  3ZG0 A;  3EF8 A;  2STD A;  1RGH A;  2OCT A;  3MG2 A;  3WDG B;  1OF5 B;  3NX0 A;  1BSC A;  2CX0 A;  5RNT A;  1N9J A;  3EN1 B;  1B20 A;  4L7K A;  1AVL A;  3KZT A;  1UDI I;  3K63 A;  3ZFZ A;  1V74 A;  2ZA4 A;  1O7P B;  1IVU A;  3L0R A;  4XBT A;  3MSO A;  1QVG 2;  5EVH A;  5JPU A;  1OUN A;  4HZB B;  4BU4 A;  1D6Z A;  1DVC A;  1YJW 3;  2CK3 H;  3WR2 A;  2K0M A;  5IER A;  1LOY A;  1I2E A;  1RGL A;  1LXE A;  1RN7 A;  1C7H A;  2RCD A;  2RGQ A;  3FCS B;  4HM8 B;  3PYJ A;  3KKG A;  2W0Q A;  1FW7 A;  5IEN A;  1TRP A;  3GZY B;  3MWZ A;  1RN4 A;  4JRF A;  1Q81 4;  5AYS C;  3FF2 A;  2ZHX B;  3LH4 A;  4EW5 A;  3EJV A;  3F14 A;  5AII A;  3I56 3;  5ELJ A;  4XDV A;  1OH0 A;  2QEX 3;  1GOV A;  1SII A;  1OHO A;  4L8P A;  5EQL A;  5AEU B;  4N6O B;  1LOX A;  1TIJ A;  4HOH A;  4JF8 A;  3AGN A;  1I70 A;  1W6G A;  3KFQ C;  4EBG A;  1WQL B;  2XFS A;  4Q53 A;  3G4S 3;  3RGA A;  3WOE B;  1QAL A;  3CD6 3;  4R9L A;  1IVW A;  1I0V A;  1E3R A;  2O9U X;  2KF4 A;  3Q1C A;  4IT7 A;  4KFD A;  5AEW B;  1KSI A;  3IJE B;  3MG3 A;  2SBL A;  3LTD A;  3K7C A;  4HM0 B;  4N6V 0;  3CCJ 3;  2F56 A;  3Q90 A;  3KE7 A;  2BMQ B;  3ALA A;  5AYR B;  1VZZ A;  5AIG A;  1T2H A;  4HM1 B;  3BNE A;  1VQ7 3;  3DM8 A;  4NRE A;  4ILF A;  1QAK A;  2QGU A;  4GB5 A;  2W56 B;  3HZP A;  3GAX A;  1MOL A;  3DGN A;  5CLK A;  3URP A;  4EXR A;  5EEO A;  1I2F A;  2LQV A;  2WOH A;  5AIH A;  4CCV A;  3OWY A;  1DYU A;  1ZO2 A;  1BNG A;  1CH0 A;  5G2G A;  1LQM B;  1GY5 A;  3MKI A;  3NUV A;  3D79 A;  5STD A;  1A90 A;  1QAF A;  4I5Q A;  3EN8 A;  1RGA A;  4ORL A;  5BU4 A;  1Q42 A;  2BMO B;  3EQQ B;  3NBJ A;  1AVK A;  1BSB A;  4FCJ A;  3KCH A;  1LOW A;  2H0G A;  3SOA A;  2LYX A;  2Y73 A;  1PFP A;  3U1W A;  3G0K A;  2XF3 A;  2OOV A;  1IU7 A;  7GSP A;  2I9W A;  1D6Y A;  1TU5 A;  3WHO A;  3EB8 A;  1DE3 A;  1GY7 A;  3FGY A;  1RJO A;  4WWU C;  3CME 3;  2F86 B;  1EA2 A;  2YFL B;  3NV0 A;  1WMP A;  3QRD A;  1IV9 A;  1SQW A;  1O7H B;  4FR9 A;  3DXO A;  2P0M A;  3CPW 2;  1B2X A;  1TUH A;  2B1X B;  5D82 A;  2OQE C;  1MWR A;  4PEJ A;  1IT8 A;  4IIA A;  1NU3 A;  2IY2 A;  3X3X A;  1VQP 3;  1GD3 A;  1Q82 4;  1RSN A;  3WOF B;  1MNL A;  1OHS A;  3JUN A;  3CC4 3;  1QMA A;  2BO9 B;  4MMZ B;  5IW9 A;  4O3V A;  4FMD A;  1N5H A;  2CKF B;  4OK0 A;  1EEJ A;  1Q86 4;  3DGL A;  4HM7 B;  4MMY B;  1ROV A;  3FG3 A;  2INX A;  3STD A;  8CHO A;  1NJI 4;  2XFT A;  1FUW A;  3PCR A;  3FG4 A;  1GOU A;  1UCJ A;  4CPK A;  3EHC A;  3RDE A;  3SYU A;  5BIR A;  2CWV A;  3AHS A;  3MHE A;  2FXT A;  2Y74 A;  1BNS A;  4O02 B;  3K5T A;  1BSD A;  3FKA A;  3FLJ A;  1V58 A;  2BMR B;  1ASK A;  1B21 A;  1YHQ 3;  1IYY A;  3F8X A;  1LVN A;  2PNC A;  3X3Z A;  3DMC A;  2UGI A;  2BIR A;  2ZL8 A;  1SJW A;  1BAN A;  2SAR A;  1VQ6 3;  5HOH A;  1OAC A;  1YIJ 3;  3D9R A;  2GEY A;  1EKM A;  4O2H A;  4J5K A;  1X1Y A;  1RDS A;  1JRQ A;  3CCQ 3;  2HOH A;  2W6J H;  4GHO A;  4HM4 B;  1JZD A;  3VSY A;  3X40 A;  3SVA A;  1GMP A;  3U97 A;  1JJ2 2;  3PXM A;  1CYU A;  4EYC A;  1AQZ A;  1BAO A;  5LC7 A;  2XEP A;  1BRH A;  3B4P A;  1W00 A;  3NQY A;  3SX1 A;  4X2H A;  2ML5 A;  1EG9 B;  1RRH A;  1QVF 2;  1BNJ A;  1OCV A;  8RNT A;  1ISK A;  2FNQ A;  1RLS A;  1T5Y A;  3K9M C;  3NV0 B;  1W02 A;  4LSO A;  4N6M A;  2H0H A;  1FYS A;  3GZR A;  5IG3 A;  3NM2 A;  1BRN L;  1CQS A;  1Z1S A;  4RNY A;  3UJM A;  2AAE A;  3Q3F A;  1YGE A;  4K1V A;  3UL5 A;  2JDI H;  4KFE A;  1NNV A;  4HYZ A;  2Z7A A;  3H3H A;  4U13 A;  3B8L A;  2YFJ B;  1RCL A;  1W2Z A;  2D1W A;  2XGN A;  2FGT A;  5G1K A;  1K73 4;  1RMS A;  3LT8 A;  1M90 4;  6GSP A;  2M7O A;  4I4K A;  1VQN 3;  2CFL A;  1A2V A;  1AV4 A;  1G02 A;  5CF1 A;  3KN4 A;  1NB3 I;  2C10 A;  2IUK A;  2W9Q A;  3HX8 A;  4MJD A;  1JN5 B;  1GY6 A;  1YVB I;  1M1X B;  3JUP A;  1A2P A;  2CFD A;  4NHF A;  5AI1 A;  4RZM A;  3SOY A;  1IQ8 A;  1YJN 3;  2CHC A;  1JBR A;  3MG1 A;  3BNB A;  3NHX A;  2D42 A;  2YX9 A;  3CPO A;  1JB2 A;  1OPY A;  1JKG B;  4XBY A;  2MF7 A;  5CK6 A;  1BRJ A;  1Q40 A;  1GMR A;  3AGO A;  1E97 A;  1FGM A;  3CCM 3;  3H51 A;  1BUJ A;  1SAR A;  2W2C A;  1NO3 A;  4AKY A;  2QIY A;  1OGX A;  4R80 A;  3FH1 A;  1B2U A;  3JUQ A;  1V57 A;  1G96 A;  4HVN A;  1STF I;  2IUJ A;  2OQE A;  4XB5 A;  2R4I A;  4HKV B;  3CCR 3;  3GZB A;  1DMN A;  1OGZ A;  1VQL 3;  1FUS A;  5IF6 A;  1Y4K A;  3DGO A;  1L5G B;  1HU9 A;  3NM7 A;  1JZO A;  5A0O B;  3BIR A;  2L1S A;  3N54 B;  1G0T A;  1ROA A;  3G71 3;  3G16 A;  2F5W A;  2KF3 A;  1W2B 2;  5FW5 A;  4AEQ A;  4N6N B;  4RBN A;  1IK3 A;  3B7C A;  3FZW A;  1O7G B;  2P38 A;  5BXQ A;  4ZM8 A;  1M1K 4;  4WHA A;  1VQO 3;  4BTY A;  3CCS 3;  2XRX B;  4R4K A;  1GD4 A;  2KF5 A;  2JQ5 A;  3OV4 A;  3CNM A;  1DVD A;  4KZ1 A;  5D83 A;  1LRA A;  2OWP A;  1IV7 A;  1B2Z A;  3HOH A;  2PZV A;  4GSP A;  1E3V A;  4CJN A;  1TFO A;  3D4A A;  1LQG C;  1MWU A;  4EV2 A;  5D81 A;  3AMO B;  1WMN A;  2XGL A;  1LNH A;  3CU3 A;  2P0X A;  1BUQ A;  1VQ9 3;  1SIH A;  4GL6 A;  1BNR A;  1RNT A;  1N8Q A;  2E2U A;  3DGY A;  3T8U A;  3FSD A;  4BIR A;  4DKI A;  2BHM A;  1O7W B;  1CEW I;  4K1U A;  4RNZ A;  4HM3 B;  2RFR A;  1UUW B;  3O8Y A;  3RNT A;  3ZG5 A;  5IG0 A;  1Q40 B;  3PGB A;  1BNI A;  1UCK A;  2CIU A;  4FMC A;  2R41 A;  3E99 A;  3IPT A;  1W4N A;  1RNB A;  1TFK A;  1VQ5 3;  1UUG B;  9RNT A;  1RGF A;  5CXO A;  3HK4 A;  1WMO A;  2P05 A;  4R1K A;  1IT7 A;  5HGR A;  1S5A A;  2QA4 3;  2B24 B;  4HAA A;  4IPB A;  1JN5 A;  1US1 A;  2GXF A;  1TRQ A;  3GWR A;  3PS8 A;  3RGR A;  3S5C A;  1FGT A;  4G1M B;  1STD A;  5BVB A;  2HMM B;  3NQZ A;  1JKG A;  1RHL A;  3NBB A;  3T8N A;  1O7N B;  1K9M 4;  1FZU A;  2OTJ 3;  3OX9 A;  1VQQ A;  3HII A;  2CW9 A;  5CF2 A;  2GBW B;  1UCI A;  1ZS7 A;  1HYF A;  5JPP A;  1RKY A;  1JB5 A;  3NBR A;  1W7C A;  2HMJ B;  3SED A;  3LXU X;  2KRT A;  1S72 3;  4HM2 B;  3PZW A;  2H0I A;  4FCM A;  3K0Z A;  3OW2 2;  3DY5 A;  2KCD A;  4NPB A;  4X2O A;  3VGN A;  1IDP A;  4K90 B;  5I97 A;  1OHP A;  3DH2 A;  4MEI A;  3S27 A;  5AIF A;  3F9S A;  2P09 A;  1LNI A;  4OUQ A;  3V98 A;  2K3D A;  1TP6 A;  3S67 A;  3F8H A;  1PU4 A;  1GYB A;  1BGS A;  1KWI A;  2CH9 A;  2XR8 B;  4BTX A;  1BIR A;  1YIT 3;  3GRD A;  3I0Y A;  2F98 A;  2HMK B;  2CC3 A;  3G8Z A;  1BNE A;  3OWS A;  4H3U A;  5G1L A;  3WOD G;  2XSH B;  1J2B A;  1O7M B;  3KSE D;  2ZDJ A;  2ML6 A;  3EC9 A;  5LC6 A;  4CDL A;  3BB9 A;  4KVH A;  1WTH A;  4HZ9 B;  1PY3 A;  2E2T A;  1QJG A;  1K28 A;  3D5I A;  5M18 A;  3LYG A;  3PCS A;  1YI2 3;  4LZI A;  2XSO B;  2GEX A;  4WFO A;  1GOY A;  3LTB A;  1YNV X;  3EX9 A;  1ULI B;  2W04 A;  2WGO A;  3HI7 A;  3AMO A;  1X1W A;  4FMA A;  1RTU A;  1W5Z A;  1RGE A;  1MWT A;  3CCL 3;  1ZX2 A;  3A5E A;  3AHW A;  5IG4 A;  3V92 A;  1RGG A;  5TGN A;  5DRE A;  1BNF A;  2C11 A;  5FGO A;  3J7Y d;  3N8B A;  1B2M A;  1VQM 3;  1DMM A;  3WA3 A;  4HM6 B;  1MWS A;  4STD A;  1CYV A;  1A67 A;  4WYK A;  3CCV 3;  2J8X B;  4XDW A;  1ZGX A;  1PYL A;  1ULJ B;  2L4V A;  3BU4 A;  3QK9 A;  4XM4 A;  3CXC 2;  1K41 A;  1B27 A;  3X41 A;  1UI8 A;  1N8R 4;  1M9G A;  1JBT A;  1GMQ A;  1BSE A;  1X1X A;  1BSA A;  4FMB A;  1LOV A;  3IMA B;  2Z77 A;  2AAD A;  3CNX A;  4EC6 A;  3NXJ A;  2OTL 3;  1BRI A;  4MMX B;  3CCU 3;  2W03 A;  1UW1 A;  2Z6B A;  1Q7H A;  5IEO A;  2K54 A;  1C54 A;  2F99 A;  1RRL A;  3KSP A;  1UUV B;  3MYT A;  3LTA A;  3D3L A;  1FUT A;  3X3Y A;  3F40 A;  4L8O A;  1JV2 B;  2IA7 A; 
#chains in the Genus database with same CATH homology
 2CG0 A;  3KII A;  2RSX A;  2UX0 A;  5IEP A;  3CC7 3;  4EV5 A;  1KD1 4;  1FGO A;  1FGR A;  4QWT A;  3LOY A;  3WMD A;  1F8N A;  1NWW A;  4LMI A;  4XBX A;  2GU1 A;  2CG1 A;  2CFG A;  2W9P A;  2CWT A;  4N3V A;  2Q07 A;  1IQX A;  1U8C B;  1N5P A;  4FCZ A;  1YJ9 3;  2A15 A;  3UL6 A;  3DZL A;  2HMO B;  3M8C A;  3LZA A;  2BT3 A;  4J9A A;  5JBS A;  2BNG A;  3N9H A;  5KP3 A;  3FG1 A;  2GU3 A;  5IG5 A;  3X42 A;  1NDO B;  4O8S A;  1IVX A;  1GS3 A;  3TDG A;  1UI7 A;  3JUO A;  5KP4 A;  2O3O A;  4R9K A;  1N9E A;  4H61 A;  4TX4 A;  4WYK B;  3ROB A;  3OXA A;  4N6U A;  1KC8 4;  3VF1 A;  2WO0 A;  3DUK A;  1HKX A;  3HIG A;  4HM5 B;  3BND A;  3F7S A;  3S28 A;  3A76 A;  1U5O A;  3WA2 X;  1IQY A;  5KP1 A;  1OF5 A;  3UB1 A;  2XH9 A;  3EBY A;  4LGQ A;  4KFF A;  2IMJ A;  4HJL B;  1W6C A;  4AKZ A;  1FA3 A;  1JB4 A;  2E2V A;  1D6U A;  2WOF A;  4OVM A;  3LTC A;  3JUM A;  3CCE 3;  3CC2 3;  3BNC A;  1DMQ A;  4LEH A;  5ELU A;  7STD A;  1KQS 2;  2CFW A;  1VQK 3;  5DRV A;  2CFK A;  1K8A 4;  1IVV A;  1WNH A;  2CWU A;  2HML B;  3MPH A;  3FF0 A;  4BTW A;  6STD A;  2WGQ A;  1JNQ A;  3ER7 A;  3EBT A;  3F7X A;  3T0U A;  3G6E 3;  1EQK A;  3UNL A;  3Q2P A;  1VQ4 3;  3OWU A;  3ECF A;  3LML A;  3SLU A;  4J8T A;  4N6T A;  3S29 A;  2MC8 A;  1W6Y A;  2HMN B;  3LT9 A;  1AR0 A;  4HBR A;  1Q7Y 4;  2OOV C;  1FGQ A;  3CMA 3;  2V1L A;  3B4O A;  1VQ8 3;  1SPU A;  2KXG A;  4N6L A;  4K61 A;  3JVC A;  3I55 3;  2GBX B;  1NB5 I;  3V99 A;  1R4C A;  1A2K A;  2Z76 A;  3BLZ A;  2YFI B;  1W01 A;  2W56 A;  4WP5 A;  3SXX A;  3EE1 A;  3GZX B;  3DGM A;  3EF8 A;  2STD A;  3MG2 A;  2OCT A;  3WDG B;  1OF5 B;  3NX0 A;  1N9J A;  3EN1 B;  4L7K A;  1AVL A;  3KZT A;  3K63 A;  1V74 A;  1O7P B;  1IVU A;  3L0R A;  4XBT A;  3MSO A;  1QVG 2;  5EVH A;  5JPU A;  1OUN A;  4HZB B;  1D6Z A;  1DVC A;  1YJW 3;  2CK3 H;  2K0M A;  5IER A;  2RGQ A;  1LXE A;  1RN7 A;  1C7H A;  2RCD A;  3FCS B;  4HM8 B;  3PYJ A;  3KKG A;  2W0Q A;  5IEN A;  3GZY B;  3MWZ A;  4JRF A;  1Q81 4;  5AYS C;  3FF2 A;  3LH4 A;  3I56 3;  3EJV A;  3F14 A;  5AII A;  5ELJ A;  4XDV A;  1OH0 A;  2QEX 3;  1SII A;  1OHO A;  4L8P A;  5EQL A;  5AEU B;  4N6O B;  1LOX A;  1TIJ A;  4JF8 A;  1W6G A;  3KFQ C;  4EBG A;  1WQL B;  2XFS A;  4Q53 A;  3G4S 3;  3RGA A;  3WOE B;  1QAL A;  3CD6 3;  4R9L A;  1IVW A;  1E3R A;  2O9U X;  3Q1C A;  4IT7 A;  4KFD A;  5AEW B;  1KSI A;  3IJE B;  3MG3 A;  2SBL A;  3LTD A;  3K7C A;  4HM0 B;  4N6V 0;  3CCJ 3;  3Q90 A;  3KE7 A;  2BMQ B;  3ALA A;  5AYR B;  1VZZ A;  5AIG A;  4HM1 B;  3BNE A;  1VQ7 3;  3DM8 A;  4NRE A;  1QAK A;  2QGU A;  4GB5 A;  2W56 B;  3HZP A;  3GAX A;  1MOL A;  3DGN A;  5CLK A;  4EXR A;  5EEO A;  2LQV A;  2WOH A;  5AIH A;  4CCV A;  3OWY A;  1DYU A;  1ZO2 A;  5G2G A;  1GY5 A;  3MKI A;  3NUV A;  5STD A;  1A90 A;  1QAF A;  3EN8 A;  4ORL A;  1Q42 A;  2BMO B;  3EQQ B;  3NBJ A;  1AVK A;  4FCJ A;  3SOA A;  2LYX A;  2Y73 A;  1PFP A;  3U1W A;  3G0K A;  2XF3 A;  2OOV A;  1IU7 A;  2I9W A;  1D6Y A;  1TU5 A;  3EB8 A;  1GY7 A;  3FGY A;  1RJO A;  4WWU C;  3CME 3;  2F86 B;  1EA2 A;  2YFL B;  3NV0 A;  1WMP A;  3QRD A;  1IV9 A;  1SQW A;  1O7H B;  4FR9 A;  3DXO A;  2P0M A;  3CPW 2;  2B1X B;  1TUH A;  5D82 A;  2OQE C;  4PEJ A;  1IT8 A;  4IIA A;  1NU3 A;  3X3X A;  1VQP 3;  1Q82 4;  1GD3 A;  3WOF B;  1MNL A;  1OHS A;  3JUN A;  3CC4 3;  1QMA A;  2BO9 B;  4MMZ B;  5IW9 A;  4O3V A;  4FMD A;  1N5H A;  2CKF B;  4OK0 A;  1Q86 4;  3DGL A;  4HM7 B;  4MMY B;  1ROV A;  3FG3 A;  2INX A;  3STD A;  8CHO A;  1NJI 4;  2XFT A;  1FUW A;  3PCR A;  3FG4 A;  3EHC A;  3RDE A;  2CWV A;  3MHE A;  2FXT A;  2Y74 A;  4O02 B;  3K5T A;  3FKA A;  3FLJ A;  2BMR B;  1ASK A;  1YHQ 3;  3F8X A;  1LVN A;  2PNC A;  3X3Z A;  3DMC A;  2ZL8 A;  1SJW A;  1VQ6 3;  1OAC A;  1YIJ 3;  3D9R A;  2GEY A;  1EKM A;  4O2H A;  1JRQ A;  3CCQ 3;  2W6J H;  4HM4 B;  3VSY A;  3X40 A;  3SVA A;  3U97 A;  1JJ2 2;  3PXM A;  1CYU A;  4EYC A;  5LC7 A;  2XEP A;  3B4P A;  1W00 A;  3NQY A;  3SX1 A;  4X2H A;  2ML5 A;  1EG9 B;  1RRH A;  1QVF 2;  1OCV A;  1ISK A;  2FNQ A;  3K9M C;  1T5Y A;  3NV0 B;  4LSO A;  1W02 A;  4N6M A;  3GZR A;  5IG3 A;  3NM2 A;  1CQS A;  1Z1S A;  4RNY A;  3UJM A;  4K1V A;  1YGE A;  3UL5 A;  2JDI H;  4KFE A;  4HYZ A;  2Z7A A;  3H3H A;  4U13 A;  3B8L A;  2YFJ B;  1W2Z A;  2D1W A;  2XGN A;  2FGT A;  1K73 4;  3LT8 A;  1M90 4;  2M7O A;  4I4K A;  1VQN 3;  2CFL A;  1A2V A;  1AV4 A;  5CF1 A;  3KN4 A;  1NB3 I;  2C10 A;  2IUK A;  2W9Q A;  3HX8 A;  4MJD A;  1JN5 B;  1GY6 A;  1YVB I;  1M1X B;  3JUP A;  2CFD A;  4NHF A;  5AI1 A;  3SOY A;  4RZM A;  1IQ8 A;  1YJN 3;  2CHC A;  3MG1 A;  3BNB A;  3NHX A;  2D42 A;  2YX9 A;  3CPO A;  1JB2 A;  1OPY A;  1JKG B;  4XBY A;  2MF7 A;  5CK6 A;  1Q40 A;  1E97 A;  1FGM A;  3CCM 3;  3H51 A;  2W2C A;  1NO3 A;  4AKY A;  2QIY A;  1OGX A;  4R80 A;  3FH1 A;  3JUQ A;  4HVN A;  1G96 A;  2IUJ A;  1STF I;  2OQE A;  4XB5 A;  2R4I A;  4HKV B;  3CCR 3;  3GZB A;  1DMN A;  1OGZ A;  1VQL 3;  5IF6 A;  1Y4K A;  3DGO A;  1L5G B;  1HU9 A;  3NM7 A;  5A0O B;  3N54 B;  1ROA A;  3G71 3;  3G16 A;  1W2B 2;  5FW5 A;  4AEQ A;  4N6N B;  4RBN A;  1IK3 A;  3B7C A;  3FZW A;  1O7G B;  2P38 A;  5BXQ A;  4ZM8 A;  1M1K 4;  4WHA A;  1VQO 3;  4BTY A;  3CCS 3;  2XRX B;  4R4K A;  1GD4 A;  2JQ5 A;  3OV4 A;  3CNM A;  1DVD A;  4KZ1 A;  5D83 A;  2OWP A;  1IV7 A;  2PZV A;  1E3V A;  1TFO A;  4EV2 A;  5D81 A;  3AMO B;  1WMN A;  2XGL A;  1LNH A;  3CU3 A;  2P0X A;  1BUQ A;  1VQ9 3;  1SIH A;  4GL6 A;  1N8Q A;  2E2U A;  3T8U A;  3FSD A;  2BHM A;  1O7W B;  1CEW I;  4K1U A;  4RNZ A;  4HM3 B;  2RFR A;  1UUW B;  3O8Y A;  5IG0 A;  1Q40 B;  3PGB A;  2CIU A;  4FMC A;  3E99 A;  3IPT A;  1W4N A;  1TFK A;  1VQ5 3;  5CXO A;  3HK4 A;  1WMO A;  2P05 A;  4R1K A;  1IT7 A;  5HGR A;  1S5A A;  2QA4 3;  2B24 B;  4IPB A;  1JN5 A;  1US1 A;  2GXF A;  3GWR A;  3PS8 A;  3RGR A;  3S5C A;  1FGT A;  4G1M B;  1STD A;  5BVB A;  2HMM B;  3NQZ A;  1JKG A;  1K9M 4;  3NBB A;  3T8N A;  1O7N B;  2OTJ 3;  3OX9 A;  3HII A;  2CW9 A;  5CF2 A;  2GBW B;  5JPP A;  1RKY A;  1JB5 A;  3NBR A;  1W7C A;  2HMJ B;  3SED A;  3LXU X;  2KRT A;  1S72 3;  4HM2 B;  3PZW A;  3OW2 2;  4FCM A;  3K0Z A;  3DY5 A;  2KCD A;  4X2O A;  3VGN A;  1IDP A;  4K90 B;  5I97 A;  1OHP A;  4MEI A;  3S27 A;  5AIF A;  3F9S A;  2P09 A;  4OUQ A;  3V98 A;  1TP6 A;  3S67 A;  3F8H A;  1PU4 A;  1GYB A;  1KWI A;  2CH9 A;  2XR8 B;  4BTX A;  1YIT 3;  3GRD A;  3I0Y A;  2F98 A;  2HMK B;  2CC3 A;  3G8Z A;  3OWS A;  4H3U A;  3WOD G;  2XSH B;  1J2B A;  1O7M B;  3KSE D;  2ZDJ A;  2ML6 A;  3EC9 A;  5LC6 A;  4CDL A;  3BB9 A;  4KVH A;  1WTH A;  4HZ9 B;  2E2T A;  1QJG A;  1K28 A;  3LYG A;  3PCS A;  1YI2 3;  4LZI A;  2XSO B;  2GEX A;  4WFO A;  3LTB A;  3EX9 A;  1ULI B;  2W04 A;  2WGO A;  3HI7 A;  3AMO A;  4FMA A;  1W5Z A;  3CCL 3;  1ZX2 A;  5IG4 A;  3V92 A;  5TGN A;  5DRE A;  2C11 A;  5FGO A;  3J7Y d;  3N8B A;  1VQM 3;  1DMM A;  3WA3 A;  4HM6 B;  4STD A;  1CYV A;  1A67 A;  4WYK A;  3CCV 3;  4XDW A;  1ULJ B;  2L4V A;  3CXC 2;  3QK9 A;  4XM4 A;  1K41 A;  3X41 A;  1UI8 A;  1N8R 4;  1M9G A;  4FMB A;  3IMA B;  2Z77 A;  3CNX A;  4EC6 A;  3NXJ A;  2OTL 3;  4MMX B;  3CCU 3;  2W03 A;  1UW1 A;  2Z6B A;  5IEO A;  2K54 A;  2F99 A;  1RRL A;  3KSP A;  1UUV B;  3MYT A;  3LTA A;  3D3L A;  3X3Y A;  3F40 A;  4L8O A;  1JV2 B;  2IA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...