3WDGB

Staphylococcus aureus udg / ugi complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
MTLELQLKHYITNLFNLPKDEKWECESIEEIADDILPDQYVRLGALSNKILQTYTYYSDTLHESNIYPFILYYQKQLIAIGYIDENHDMDFLYLHNTIMPLLDQRYLLTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Staphylococcus aureus protein SAUGI acts as a uracil-DNA glycosylase inhibitor.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Uracil-DNA glycosylase
total genus 25
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06106 SAUGI S. aureus uracil DNA glycosylase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.250 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3wdgB00
2KCDA 5AYRB 5AYSC 3WDGB
chains in the Genus database with same CATH superfamily
5KP4A 1IT7A 1UUGB 3MG2A 3NV0B 3T8NA 7STDA 1RGKA 3GZBA 1D6ZA 2HOHA 4HZ9B 1US1A 4N6LA 1R4CA 3WOFB 1YGWA 2XGNA 1YJ93 1YVBI 2F4YA 3GSPA 4RBNA 1RN4A 4HVNA 3ECFA 5AIGA 4BTYA 4FCZA 1MGWA 2J8XB 3T8UA 4K90B 3JUNA 2FXTA 1BSAA 1RTUA 3G16A 4WHAA 1V74A 1UCJA 4JF8A 1W6CA 4ILFA 5IG3A 2KCDA 1IU7A 1MOLA 1GMPA 1MWSA 1OHOA 3F7SA 4NPBA 4R9LA 2E2TA 3RNTA 2IA7A 1O7HB 1T3BA 1IYYA 3EQQB 1GOVA 2K0MA 2R41A 2XR8B 3CC73 1RN7A 1LQGC 3B8LA 3LOYA 4HKVB 7RNTA 1N8R4 2CG0A 2W2CA 3CD63 1NWWA 1O7MB 1AVLA 4HM7B 3G6E3 1AV4A 2RFRA 2CWVA 3UB1A 4KFFA 2CFGA 4GL6A 1VQQA 1S723 3CME3 1CH0A 2BNGA 1RGAA 4O2HA 1BIRA 4J5GA 3LTBA 1JB2A 2JDIH 3I563 2SARA 2CX0A 3KN4A 3F14A 3AMOA 3TDGA 1BNRA 4EYCA 5RNTA 5AIIA 3EHCA 2KF3A 1I70A 4R80A 3G4S3 1BNJA 3V92A 1HYFA 5JPUA 1BNSA 1EQKA 2QEX3 1JKGB 5D81A 5ELJA 1B21A 1LOXA 1F8NA 3FCSB 3MPHA 3SVAA 5KP1A 3WMDA 4I4KA 5AI1A 5G1LA 2P05A 1QVF2 4GSPA 3D3LA 3UL6A 1FUTA 1DVCA 1ZS7A 4AKYA 2CFWA 3KIIA 5CK6A 2YFIB 1SQWA 3DGOA 4BTXA 1E97A 4RNTA 3K5TA 1STDA 1BGSA 5A0OB 2F5MA 3CC43 1BUJA 1LXEA 2JQ5A 3NBRA 2QGUA 3NV0A 3KE7A 1EKMA 1Q9EA 3EF8A 3DM8A 4GB5A 3IMAB 1RHLA 2RCDA 2CFKA 1B27A 1BSCA 5M18A 1M1XB 3FZWA 1B3SA 3WODG 1SPUA 3HK4A 2FNQA 1CEWI 1RMSA 5CXOA 2CFDA 1G96A 1RKYA 3EN1B 1BU4A 4WYKB 3WA2X 1A2KA 4XBTA 1BNEA 1GOYA 1BRIA 4RNYA 2P38A 4OK0A 1M904 1DETA 2F98A 3FG1A 4K1VA 3HX8A 4XBXA 1K734 1Q814 1UI8A 2XEPA 3KZTA 3GRDA 3N9HA 7GSPA 1L5GB 4FCMA 1KQS2 5LC7A 3MYTA 4R9KA 1GMRA 1N8QA 2L4VA 1CQSA 1U5OA 4H61A 1LNIA 2WOHA 1EA2A 1W02A 3OWUA 3K7CA 1X1YA 4IT7A 1A2VA 1GMQA 1BRSA 1NNVA 1FGRA 2KF4A 4NHFA 2WOFA 3LTAA 1UGHI 1GYBA 2CFLA 2Y73A 1M9GA 1ULIB 4N6MA 5G1KA 3SYUA 3H51A 1UGIA 2CHCA 1BNIA 5BU4A 1PU4A 3S27A 1JN5A 1RNBA 4XM4A 2W6JH 3FLJA 3EB8A 1LOWA 2IMJA 1TTOA 2M7OA 2OWPA 3AGNA 1JKGA 1RN1A 3GZRA 4L7KA 5AYSC 5AEWB 4AEQA 1FZUA 2AADA 3LH4A 1V58A 4O3VA 3WR2A 2E2UA 1BRHA 2HMNB 2I9WA 1FGOA 1PYLA 1V57A 2K3DA 1M1K4 1BSBA 3PXMA 2CH9A 3OXAA 2K54A 1GY7A 2LQVA 1BSEA 2Z77A 3D79A 1VQL3 4HM6B 2E2VA 1WNHA 1BANA 2W0QA 1EUIC 3SXXA 1YNVX 3GWRA 1VQ73 1OGXA 1KWIA 3LT8A 1CYVA 3G0KA 3NHXA 1OF5B 1K28A 2STDA 5CLKA 3FKAA 2IUKA 3T0UA 1W4NA 3UJMA 2CC3A 2ZA4A 1W6YA 1OPYA 2HMKB 2UGIA 2WGOA 3B4PA 3SX1A 5AIHA 3CCL3 2QA43 3BNDA 1VQ53 4LEHA 4MMZB 2KRTA 4MJDA 1DMQA 3O8YA 1VQ83 2PZVA 4KZ1A 1LOYA 2OOVC 1JB5A 3E99A 3KSPA 3LZAA 1FGTA 1KSIA 4ORLA 3S67A 1VQM3 1NU3A 1RGFA 2XFTA 2OCTA 3H3HA 3MG1A 3F40A 4KFDA 2OQEC 2IY2A 3UL5A 1IVUA 3HOHA 3S5CA 1OF5A 5D83A 2FGTA 1EEJA 4HM8B 2XFSA 4LSOA 2L1SA 2HMOB 2KAAA 4IIAA 2CWTA 2OTL3 4L8OA 1RSNA 2YX9A 1PFPA 4Q53A 8CHOA 3CCV3 3NX0A 3ZG0A 3CPW2 2C11A 1Q40B 1SJWA 2CX1A 1STFI 1AY7A 1WQLB 1GSPA 3BIRA 1JV2B 3N8BA 3CCE3 1SIIA 1RCLA 2XSHB 2GXFA 4BL2A 2BMQB 2KF5A 1K9M4 1QMAA 1WMPA 3KSED 3MWZA 1TRPA 4RZMA 1BOXA 1FW7A 3RGAA 1BSDA 4MMYB 4KVHA 5ELUA 4XB5A 3DGLA 1VZZA 3LYGA 2RSXA 1TFKA 1MNLA 1ZGXA 4HM3B 4LZIA 5AIFA 3DGMA 4EV5A 4AKZA 1Q864 1VQ63 3EE1A 5D82A 2CK3H 2ZL8A 1B20A 5FW5A 1RCKA 1W7CA 1I8VA 1DMMA 4OUQA 5IG4A 5M19A 2B1XB 1LVNA 2OTJ3 3FG3A 3U97A 4FMAA 1RNTA 6STDA 4K1UA 4WFOA 3EJVA 1RDSA 3F8HA 5BIRA 3ZG5A 1DE3A 1ISKA 1HZ1A 1AR0A 1LNHA 1OH0A 1VQN3 3FF2A 1RLSA 1DYUA 1GD4A 3J7Yd 1W6GA 5EQLA 1Q824 1TU5A 2RBIA 3B4OA 5GSPA 3OX9A 3OW22 3D5GA 1YGEA 3KCHA 1KD14 4XDVA 2RGQA 2W56A 5IEPA 1W2B2 4R4KA 2B24B 1GOUA 1JZDA 3HI7A 4EXRA 3HIIA 1B2SA 2ML5A 3BU4A 3CU3A 4X2HA 2F99A 2CG1A 1RJOA 3DZLA 1UCLA 5G2GA 4O8SA 1J2BA 2GBWB 1YJN3 2YFJB 3GAXA 3FG4A 3CCM3 3S29A 4CJNA 3MHEA 4N6OB 3DGNA 1TFOA 2H0GA 4OVMA 2BIRA 3NQYA 1IV7A 1B2MA 1JBTA 1IVVA 1BNGA 1W00A 5I97A 3CPOA 3SEDA 1G02A 1LOVA 3G713 2Z7AA 1JN5B 1X1XA 3AHSA 1O7PB 3MSOA 2IYJA 3F9SA 1OHPA 3CCQ3 4XBYA 3F8XA 2ZHXB 3CC23 4R1KA 3PS8A 3DY5A 1I0XA 1N5PA 1OCVA 4L8PA 3NXJA 1IQYA 4HOHA 2QIYA 1TIJA 3LT9A 4BIRA 1MGRA 1NB3I 1K41A 3D5IA 2F56A 4HM5B 5IW9A 1E3VA 5KP3A 1CYUA 3RDEA 3RGRA 1I0VA 3AGOA 4GHOA 1TP6A 3HIGA 4EW5A 3BLZA 1QAFA 3WHOA 1RGCA 2XF3A 1MWRA 2P0XA 4FCJA 4PEJA 1B2ZA 4LGQA 2WO0A 1UCIA 1X1UA 3EX9A 1Z1SA 1NDOB 2HMJB 3EBTA 4CDLA 1YIT3 1HKXA 1N5HA 2OOVA 1C54A 1TUHA 4CCVA 1FYSA 3IPTA 3Q90A 3U1WA 5FGOA 1N9JA 3X3YA 1VQP3 3EN8A 1T2IA 4KFEA 2P0MA 4BU4A 1IV9A 1RRHA 1IK3A 3CXC2 4STDA 4HM1B 3EBYA 3JUQA 4I5QA 3X41A 4NREA 1RGLA 1WTHA 2F5WA 3K9MC 1YHQ3 1VQO3 1JBRA 3X42A 1N9EA 1QVG2 1LQMB 4J9AA 3CCU3 1BAOA 3VF1A 1IQ8A 1FUWA 2C4BA 2CW9A 4EC6A 3AHWA 3OV4A 4FR9A 2GSPA 3ALAA 1A90A 2PNCA 1GY5A 4HM0B 4KT3B 1GD3A 3FSDA 2ZDJA 3K0ZA 3DUKA 5CF1A 4WYKA 2Q07A 4N6UA 1PY3A 4K61A 1YI23 3A5EA 1WMNA 2CWUA 4FMCA 4HM2B 2MF7A 4HBRA 3CNMA 1TRQA 6RNTA 2SBLA 3EC9A 3MG3A 4HYZA 2UUGC 1FGQA 1T5YA 2D1WA 2V1LA 3NM2A 1IDPA 5IENA 3LTCA 4CPKA 1T2HA 4WWUC 1JZOA 2HMLB 5LC6A 1O7GB 2BT3A 3VGNA 1D6UA 5HGRA 1I2EA 3SOYA 4J5KA 2AAEA 3PGBA 1U8CB 1R4YA 1SIHA 2W56B 3G8ZA 3NQZA 4X2OA 3KKGA 1ZO2A 4HAAA 2O3OA 1ZX2A 1RGGA 4BTWA 3K63A 2GEYA 3VSYA 1RRLA 3Q2PA 3STDA 3BNEA 3D4AA 1VQ43 2OQEA 3SLUA 3BB9A 2W9QA 1X1WA 1OGZA 2GU1A 3CCR3 3QK9A 3ZFZA 1BRNL 1YJW3 4H3UA 1OHSA 3HZPA 3SOAA 5BVBA 4O02B 3D9RA 3QRDA 3WOEB 2A15A 2CKFB 1I2GA 3AMOB 3F7XA 3GZXB 4HZBB 3OWSA 1A2PA 3X3ZA 4ZM8A 1ULJB 2IUJA 1ROAA 3PZWA 2WGQA 4N6V0 2HMMB 5JPPA 1NJI4 3BNCA 3LXUX 1EG9B 2CIUA 1IT8A 3N54B 2H0IA 2P09A 3Q3FA 1Q7Y4 3OWYA 1I3IA 1ROVA 2W9PA 3NBJA 1BRJA 1MWUA 2XH9A 2YFLB 2R4IA 3S28A 3B7CA 4JRFA 1RGEA 4RNZA 4WP5A 3V99A 3WDGB 4TX4A 1UCKA 1B2XA 2F86B 5IEOA 1FUSA 1BRGA 8RNTA 1DVDA 1W01A 2Y74A 4FMDA 2GEXA 2KXGA 1UUWB 1Q7HA 1OACA 3CCS3 1D6YA 2BU4A 3BNBA 3JUMA 3LMLA 5EEOA 2BHMA 2H0HA 3UNLA 3CCJ3 1B2UA 1NO3A 4N6NB 3X3XA 1VQK3 4FMBA 2MC8A 1AVKA 1JBSA 5DREA 3Q1CA 1HU9A 1RGHA 4BL3A 2XRXB 3L0RA 4J8TA 3X40A 5IF6A 3FH1A 3WA3A 1IVWA 2BMRB 2UX0A 5IG0A 3JUPA 1JRQA 6GSPA 1WMOA 2GBXB 3NM7A 1UW1A 1YIJ3 2W03A 3CMA3 2Z6BA 2RNTA 2BO9B 1LRAA 1UI7A 4G1MB 3DMCA 1JJ22 1UUVB 3LTDA 5DRVA 1DMNA 2INXA 3ER7A 3DH2A 1BRKA 2D42A 4QWTA 5TGNA 4HM4B 1FA3A 1BNFA 1QAKA 1ASKA 1S5AA 2C10A 1I3FA 5HOHA 5IG5A 5STDA 3KFQC 3PCSA 3PYJA 3M8CA 5AYRB 1NB5I 4LYLB 3GZYB 1KC84 1TJDA 1BVIA 1QJGA 1VQ93 5CF2A 3FF0A 3JUOA 2O9UX 1YVSA 3I0YA 1W5ZA 5EVHA 1O7WB 4HJLB 4XDWA 5M1AA 5JBSA 1A67A 1GY6A 2ML6A 3FGYA 3I553 2LYXA 4LMIA 1GS3A 5IERA 1JB4A 1UDII 3IJEB 3A76A 1C7HA 4MMXB 1Q42A 1JNQA 1MWTA 2W04A 1QALA 2XSOB 3CNXA 3JVCA 3NBBA 4N3VA 4N6TA 3V98A 4DKIA 1SARA 1BUQA 1FGMA 3MKIA 2BMOB 3DXOA 1K8A4 1OUNA 1E3RA 1AQZA 4IPBA 4U13A 2KF6A 4EV2A 9RNTA 5AEUB 2Z76A 1O7NB 1W2ZA 5BXQA 2XGLA 3URPA 1IQXA 3NUVA 4EBGA 1G0TA 1I2FA 1Q40A 3PCRA 4MEIA 1Y4KA 3DGYA 2GU3A 1IVXA 3ROBA
chains in the Genus database with same CATH topology
5KP4A 1IT7A 3NV0B 3MG2A 3T8NA 7STDA 3GZBA 1D6ZA 4HZ9B 1US1A 4N6LA 1R4CA 3WOFB 1YJ93 2XGNA 1YVBI 4RBNA 4HVNA 3ECFA 5AIGA 4BTYA 4FCZA 3T8UA 4K90B 3JUNA 2FXTA 3G16A 4WHAA 1V74A 4JF8A 1W6CA 5IG3A 2KCDA 1IU7A 1MOLA 1OHOA 3F7SA 4R9LA 2E2TA 2IA7A 1O7HB 3EQQB 2K0MA 3CC73 2XR8B 1RN7A 3B8LA 3LOYA 4HKVB 3CD63 1N8R4 2CG0A 2W2CA 1NWWA 1O7MB 1AVLA 4HM7B 3G6E3 1AV4A 2RFRA 2CWVA 3UB1A 4KFFA 2CFGA 4GL6A 1S723 3CME3 2BNGA 4O2HA 3LTBA 1JB2A 2JDIH 3I563 3KN4A 3F14A 3AMOA 3TDGA 4EYCA 5AIIA 3EHCA 4R80A 3G4S3 3V92A 5JPUA 1EQKA 2QEX3 1JKGB 5D81A 5ELJA 1LOXA 1F8NA 3FCSB 3MPHA 3SVAA 5KP1A 3WMDA 4I4KA 5AI1A 2P05A 1QVF2 3D3LA 3UL6A 1DVCA 4AKYA 2CFWA 3KIIA 5CK6A 2YFIB 1SQWA 3DGOA 4BTXA 1E97A 3K5TA 1STDA 5A0OB 3CC43 1LXEA 2JQ5A 3NBRA 2QGUA 3NV0A 3KE7A 1EKMA 3EF8A 3DM8A 4GB5A 3IMAB 2RCDA 2CFKA 1M1XB 3FZWA 3WODG 1SPUA 3HK4A 2FNQA 1CEWI 5CXOA 2CFDA 1G96A 1RKYA 3EN1B 4WYKB 3WA2X 1A2KA 4XBTA 4RNYA 1M904 2P38A 4OK0A 2F98A 3FG1A 4K1VA 3HX8A 4XBXA 1K734 1Q814 1UI8A 2XEPA 3KZTA 3GRDA 3N9HA 1L5GB 4FCMA 1KQS2 5LC7A 3MYTA 4R9KA 2L4VA 1N8QA 4H61A 1CQSA 1U5OA 2WOHA 1EA2A 1W02A 3OWUA 3K7CA 4IT7A 1A2VA 1FGRA 4NHFA 2WOFA 3LTAA 1GYBA 2CFLA 2Y73A 1M9GA 1ULIB 4N6MA 3H51A 2CHCA 1PU4A 3S27A 1JN5A 4XM4A 2W6JH 3FLJA 3EB8A 2IMJA 2M7OA 2OWPA 1JKGA 3GZRA 4L7KA 5AYSC 5AEWB 3LH4A 4O3VA 2E2UA 2HMNB 2I9WA 1FGOA 1M1K4 3PXMA 2CH9A 3OXAA 2K54A 1GY7A 2LQVA 2Z77A 1VQL3 4HM6B 2E2VA 1WNHA 2W0QA 3SXXA 3GWRA 1VQ73 1OGXA 1KWIA 3LT8A 1CYVA 3G0KA 3NHXA 1OF5B 1K28A 2STDA 5CLKA 3FKAA 2IUKA 3T0UA 1W4NA 3UJMA 2CC3A 1W6YA 1OPYA 2HMKB 2WGOA 3B4PA 3SX1A 5AIHA 3CCL3 2QA43 3BNDA 1VQ53 4LEHA 4MMZB 2KRTA 4MJDA 1DMQA 3O8YA 1VQ83 2PZVA 4KZ1A 2OOVC 1JB5A 3E99A 3KSPA 3LZAA 1FGTA 1KSIA 4ORLA 3S67A 1VQM3 1NU3A 2XFTA 3H3HA 2OCTA 3MG1A 4KFDA 3F40A 4WFOA 2OQEC 3UL5A 1IVUA 3S5CA 1OF5A 5D83A 2FGTA 4HM8B 2XFSA 4LSOA 4IIAA 2HMOB 2OTL3 2CWTA 4L8OA 2YX9A 1PFPA 4Q53A 8CHOA 3CCV3 3NX0A 3CPW2 2C11A 1Q40B 1SJWA 1STFI 1WQLB 1JV2B 3N8BA 3CCE3 1SIIA 2XSHB 2GXFA 2BMQB 1K9M4 1QMAA 1WMPA 3KSED 3MWZA 4RZMA 3RGAA 4MMYB 4KVHA 5ELUA 4XB5A 3DGLA 1VZZA 3LYGA 2RSXA 1TFKA 1MNLA 4HM3B 4LZIA 5AIFA 3DGMA 4EV5A 4AKZA 1Q864 1VQ63 3EE1A 5D82A 2CK3H 2ZL8A 5FW5A 1W7CA 1DMMA 4OUQA 5IG4A 2B1XB 1LVNA 2OTJ3 3FG3A 3U97A 4FMAA 6STDA 4K1UA 3EJVA 3F8HA 1ISKA 1AR0A 1LNHA 1OH0A 1VQN3 3FF2A 1DYUA 1GD4A 3J7Yd 1W6GA 5EQLA 1Q824 1TU5A 3B4OA 3OX9A 3OW22 1YGEA 1KD14 4XDVA 2RGQA 2W56A 5IEPA 1W2B2 4R4KA 2B24B 3HI7A 4EXRA 3HIIA 2ML5A 3CU3A 4X2HA 2F99A 2CG1A 1RJOA 3DZLA 5G2GA 4O8SA 1J2BA 2GBWB 1YJN3 2YFJB 3GAXA 3FG4A 3CCM3 3S29A 3MHEA 4N6OB 3DGNA 1TFOA 4OVMA 3NQYA 1IV7A 1IVVA 5I97A 1W00A 3CPOA 3SEDA 3G713 2Z7AA 1JN5B 1O7PB 3MSOA 3F9SA 1OHPA 3CCQ3 4XBYA 3F8XA 3CC23 4R1KA 3PS8A 3DY5A 1N5PA 1OCVA 4L8PA 3NXJA 1IQYA 2QIYA 1TIJA 3LT9A 1NB3I 5IW9A 1K41A 1CYUA 4HM5B 1E3VA 5KP3A 3RDEA 3RGRA 1TP6A 3HIGA 3BLZA 1QAFA 2XF3A 2P0XA 4FCJA 4PEJA 4LGQA 2WO0A 3EX9A 1Z1SA 1NDOB 2HMJB 3EBTA 4CDLA 1YIT3 1HKXA 1N5HA 2OOVA 1TUHA 4CCVA 3IPTA 3Q90A 3U1WA 5FGOA 1N9JA 3X3YA 1VQP3 3EN8A 4KFEA 1IK3A 2P0MA 1IV9A 1RRHA 3CXC2 4STDA 4HM1B 3EBYA 3JUQA 3X41A 4NREA 1WTHA 1YHQ3 3K9MC 1VQO3 3X42A 1N9EA 1QVG2 4J9AA 3CCU3 3VF1A 1IQ8A 1FUWA 2CW9A 4EC6A 3OV4A 4FR9A 3ALAA 1A90A 2PNCA 1GY5A 4HM0B 1GD3A 3FSDA 2ZDJA 3K0ZA 3DUKA 5CF1A 4WYKA 2Q07A 4N6UA 4K61A 1YI23 4HM2B 1WMNA 2CWUA 4FMCA 2MF7A 4HBRA 3CNMA 2SBLA 3EC9A 3MG3A 4HYZA 1FGQA 1T5YA 2D1WA 2V1LA 3NM2A 1IDPA 5IENA 3LTCA 4WWUC 2HMLB 5LC6A 1O7GB 2BT3A 3VGNA 1D6UA 5HGRA 3SOYA 3PGBA 1U8CB 2W56B 1SIHA 3G8ZA 3NQZA 4X2OA 3KKGA 1ZO2A 2O3OA 1ZX2A 4BTWA 3K63A 2GEYA 3VSYA 1RRLA 3Q2PA 3STDA 3BNEA 1VQ43 2OQEA 3SLUA 3BB9A 2W9QA 2GU1A 1OGZA 3CCR3 3QK9A 1YJW3 4H3UA 1OHSA 3HZPA 3SOAA 5BVBA 4O02B 3D9RA 3QRDA 3WOEB 2A15A 2CKFB 3AMOB 3F7XA 3GZXB 4HZBB 3OWSA 4ZM8A 3X3ZA 1ULJB 2IUJA 1ROAA 3PZWA 2WGQA 4N6V0 2HMMB 5JPPA 1NJI4 3BNCA 3LXUX 1EG9B 2CIUA 1IT8A 3N54B 1Q7Y4 2P09A 3OWYA 1ROVA 2W9PA 3NBJA 3S28A 4AEQA 2XH9A 2YFLB 2R4IA 1FA3A 3B7CA 4JRFA 4WP5A 4RNZA 3V99A 3WDGB 4TX4A 2F86B 5IEOA 1DVDA 1W01A 2Y74A 4FMDA 2GEXA 2KXGA 1UUWB 1OACA 3CCS3 1D6YA 3BNBA 3LMLA 3JUMA 5EEOA 2BHMA 3UNLA 3CCJ3 1NO3A 4N6NB 3X3XA 1VQK3 4FMBA 2MC8A 1AVKA 5DREA 3Q1CA 1HU9A 2XRXB 3L0RA 4J8TA 3X40A 5IF6A 3FH1A 3WA3A 1IVWA 2BMRB 2UX0A 5IG0A 3JUPA 1JRQA 1WMOA 2GBXB 3NM7A 1UW1A 1YIJ3 2W03A 3CMA3 2Z6BA 2BO9B 4G1MB 1UI7A 3DMCA 1JJ22 1UUVB 3LTDA 5DRVA 1DMNA 2INXA 3ER7A 2D42A 4QWTA 5TGNA 4HM4B 1QAKA 1ASKA 1S5AA 2C10A 5IG5A 5STDA 3KFQC 3PCSA 3PYJA 3M8CA 5AYRB 1NB5I 1KC84 3GZYB 1QJGA 1VQ93 5CF2A 3FF0A 3JUOA 2O9UX 3I0YA 5EVHA 1W5ZA 5JBSA 1O7WB 4HJLB 4XDWA 1A67A 1GY6A 2ML6A 3FGYA 3I553 2LYXA 4LMIA 1GS3A 5IERA 1JB4A 3IJEB 3A76A 1C7HA 4MMXB 1Q42A 1JNQA 2W04A 1QALA 2XSOB 3CNXA 3JVCA 3NBBA 4N3VA 4N6TA 3V98A 1BUQA 1FGMA 3MKIA 2BMOB 3DXOA 1K8A4 1E3RA 1OUNA 4IPBA 4U13A 4EV2A 5AEUB 2Z76A 1O7NB 1W2ZA 5BXQA 2XGLA 1IQXA 3NUVA 4EBGA 1Q40A 3PCRA 4MEIA 1Y4KA 2GU3A 1IVXA 3ROBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCD A;  5AYR B;  5AYS C;  3WDG B; 
#chains in the Genus database with same CATH topology
 5KP4 A;  1IT7 A;  1UUG B;  3MG2 A;  3NV0 B;  3T8N A;  7STD A;  1RGK A;  3GZB A;  1D6Z A;  2HOH A;  4HZ9 B;  1US1 A;  4N6L A;  1R4C A;  3WOF B;  1YGW A;  2XGN A;  1YJ9 3;  1YVB I;  2F4Y A;  3GSP A;  4RBN A;  1RN4 A;  4HVN A;  3ECF A;  5AIG A;  4BTY A;  4FCZ A;  1MGW A;  2J8X B;  3T8U A;  4K90 B;  3JUN A;  2FXT A;  1BSA A;  1RTU A;  3G16 A;  4WHA A;  1V74 A;  1UCJ A;  4JF8 A;  1W6C A;  4ILF A;  5IG3 A;  2KCD A;  1IU7 A;  1MOL A;  1GMP A;  1MWS A;  1OHO A;  3F7S A;  4NPB A;  4R9L A;  2E2T A;  3RNT A;  2IA7 A;  1O7H B;  1T3B A;  1IYY A;  3EQQ B;  1GOV A;  2K0M A;  2R41 A;  2XR8 B;  3CC7 3;  1RN7 A;  1LQG C;  3B8L A;  3LOY A;  4HKV B;  7RNT A;  1N8R 4;  2CG0 A;  2W2C A;  3CD6 3;  1NWW A;  1O7M B;  1AVL A;  4HM7 B;  3G6E 3;  1AV4 A;  2RFR A;  2CWV A;  3UB1 A;  4KFF A;  2CFG A;  4GL6 A;  1VQQ A;  1S72 3;  3CME 3;  1CH0 A;  2BNG A;  1RGA A;  4O2H A;  1BIR A;  4J5G A;  3LTB A;  1JB2 A;  2JDI H;  3I56 3;  2SAR A;  2CX0 A;  3KN4 A;  3F14 A;  3AMO A;  3TDG A;  1BNR A;  4EYC A;  5RNT A;  5AII A;  3EHC A;  2KF3 A;  1I70 A;  4R80 A;  3G4S 3;  1BNJ A;  3V92 A;  1HYF A;  5JPU A;  1BNS A;  1EQK A;  2QEX 3;  1JKG B;  5D81 A;  5ELJ A;  1B21 A;  1LOX A;  1F8N A;  3FCS B;  3MPH A;  3SVA A;  5KP1 A;  3WMD A;  4I4K A;  5AI1 A;  5G1L A;  2P05 A;  1QVF 2;  4GSP A;  3D3L A;  3UL6 A;  1FUT A;  1DVC A;  1ZS7 A;  4AKY A;  2CFW A;  3KII A;  5CK6 A;  2YFI B;  1SQW A;  3DGO A;  4BTX A;  1E97 A;  4RNT A;  3K5T A;  1STD A;  1BGS A;  5A0O B;  2F5M A;  3CC4 3;  1BUJ A;  1LXE A;  2JQ5 A;  3NBR A;  2QGU A;  3NV0 A;  3KE7 A;  1EKM A;  1Q9E A;  3EF8 A;  3DM8 A;  4GB5 A;  3IMA B;  1RHL A;  2RCD A;  2CFK A;  1B27 A;  1BSC A;  5M18 A;  1M1X B;  3FZW A;  1B3S A;  3WOD G;  1SPU A;  3HK4 A;  2FNQ A;  1CEW I;  1RMS A;  5CXO A;  2CFD A;  1G96 A;  1RKY A;  3EN1 B;  1BU4 A;  4WYK B;  3WA2 X;  1A2K A;  4XBT A;  1BNE A;  1GOY A;  1BRI A;  4RNY A;  2P38 A;  4OK0 A;  1M90 4;  1DET A;  2F98 A;  3FG1 A;  4K1V A;  3HX8 A;  4XBX A;  1K73 4;  1Q81 4;  1UI8 A;  2XEP A;  3KZT A;  3GRD A;  3N9H A;  7GSP A;  1L5G B;  4FCM A;  1KQS 2;  5LC7 A;  3MYT A;  4R9K A;  1GMR A;  1N8Q A;  2L4V A;  1CQS A;  1U5O A;  4H61 A;  1LNI A;  2WOH A;  1EA2 A;  1W02 A;  3OWU A;  3K7C A;  1X1Y A;  4IT7 A;  1A2V A;  1GMQ A;  1BRS A;  1NNV A;  1FGR A;  2KF4 A;  4NHF A;  2WOF A;  3LTA A;  1UGH I;  1GYB A;  2CFL A;  2Y73 A;  1M9G A;  1ULI B;  4N6M A;  5G1K A;  3SYU A;  3H51 A;  1UGI A;  2CHC A;  1BNI A;  5BU4 A;  1PU4 A;  3S27 A;  1JN5 A;  1RNB A;  4XM4 A;  2W6J H;  3FLJ A;  3EB8 A;  1LOW A;  2IMJ A;  1TTO A;  2M7O A;  2OWP A;  3AGN A;  1JKG A;  1RN1 A;  3GZR A;  4L7K A;  5AYS C;  5AEW B;  4AEQ A;  1FZU A;  2AAD A;  3LH4 A;  1V58 A;  4O3V A;  3WR2 A;  2E2U A;  1BRH A;  2HMN B;  2I9W A;  1FGO A;  1PYL A;  1V57 A;  2K3D A;  1M1K 4;  1BSB A;  3PXM A;  2CH9 A;  3OXA A;  2K54 A;  1GY7 A;  2LQV A;  1BSE A;  2Z77 A;  3D79 A;  1VQL 3;  4HM6 B;  2E2V A;  1WNH A;  1BAN A;  2W0Q A;  1EUI C;  3SXX A;  1YNV X;  3GWR A;  1VQ7 3;  1OGX A;  1KWI A;  3LT8 A;  1CYV A;  3G0K A;  3NHX A;  1OF5 B;  1K28 A;  2STD A;  5CLK A;  3FKA A;  2IUK A;  3T0U A;  1W4N A;  3UJM A;  2CC3 A;  2ZA4 A;  1W6Y A;  1OPY A;  2HMK B;  2UGI A;  2WGO A;  3B4P A;  3SX1 A;  5AIH A;  3CCL 3;  2QA4 3;  3BND A;  1VQ5 3;  4LEH A;  4MMZ B;  2KRT A;  4MJD A;  1DMQ A;  3O8Y A;  1VQ8 3;  2PZV A;  4KZ1 A;  1LOY A;  2OOV C;  1JB5 A;  3E99 A;  3KSP A;  3LZA A;  1FGT A;  1KSI A;  4ORL A;  3S67 A;  1VQM 3;  1NU3 A;  1RGF A;  2XFT A;  2OCT A;  3H3H A;  3MG1 A;  3F40 A;  4KFD A;  2OQE C;  2IY2 A;  3UL5 A;  1IVU A;  3HOH A;  3S5C A;  1OF5 A;  5D83 A;  2FGT A;  1EEJ A;  4HM8 B;  2XFS A;  4LSO A;  2L1S A;  2HMO B;  2KAA A;  4IIA A;  2CWT A;  2OTL 3;  4L8O A;  1RSN A;  2YX9 A;  1PFP A;  4Q53 A;  8CHO A;  3CCV 3;  3NX0 A;  3ZG0 A;  3CPW 2;  2C11 A;  1Q40 B;  1SJW A;  2CX1 A;  1STF I;  1AY7 A;  1WQL B;  1GSP A;  3BIR A;  1JV2 B;  3N8B A;  3CCE 3;  1SII A;  1RCL A;  2XSH B;  2GXF A;  4BL2 A;  2BMQ B;  2KF5 A;  1K9M 4;  1QMA A;  1WMP A;  3KSE D;  3MWZ A;  1TRP A;  4RZM A;  1BOX A;  1FW7 A;  3RGA A;  1BSD A;  4MMY B;  4KVH A;  5ELU A;  4XB5 A;  3DGL A;  1VZZ A;  3LYG A;  2RSX A;  1TFK A;  1MNL A;  1ZGX A;  4HM3 B;  4LZI A;  5AIF A;  3DGM A;  4EV5 A;  4AKZ A;  1Q86 4;  1VQ6 3;  3EE1 A;  5D82 A;  2CK3 H;  2ZL8 A;  1B20 A;  5FW5 A;  1RCK A;  1W7C A;  1I8V A;  1DMM A;  4OUQ A;  5IG4 A;  5M19 A;  2B1X B;  1LVN A;  2OTJ 3;  3FG3 A;  3U97 A;  4FMA A;  1RNT A;  6STD A;  4K1U A;  4WFO A;  3EJV A;  1RDS A;  3F8H A;  5BIR A;  3ZG5 A;  1DE3 A;  1ISK A;  1HZ1 A;  1AR0 A;  1LNH A;  1OH0 A;  1VQN 3;  3FF2 A;  1RLS A;  1DYU A;  1GD4 A;  3J7Y d;  1W6G A;  5EQL A;  1Q82 4;  1TU5 A;  2RBI A;  3B4O A;  5GSP A;  3OX9 A;  3OW2 2;  3D5G A;  1YGE A;  3KCH A;  1KD1 4;  4XDV A;  2RGQ A;  2W56 A;  5IEP A;  1W2B 2;  4R4K A;  2B24 B;  1GOU A;  1JZD A;  3HI7 A;  4EXR A;  3HII A;  1B2S A;  2ML5 A;  3BU4 A;  3CU3 A;  4X2H A;  2F99 A;  2CG1 A;  1RJO A;  3DZL A;  1UCL A;  5G2G A;  4O8S A;  1J2B A;  2GBW B;  1YJN 3;  2YFJ B;  3GAX A;  3FG4 A;  3CCM 3;  3S29 A;  4CJN A;  3MHE A;  4N6O B;  3DGN A;  1TFO A;  2H0G A;  4OVM A;  2BIR A;  3NQY A;  1IV7 A;  1B2M A;  1JBT A;  1IVV A;  1BNG A;  1W00 A;  5I97 A;  3CPO A;  3SED A;  1G02 A;  1LOV A;  3G71 3;  2Z7A A;  1JN5 B;  1X1X A;  3AHS A;  1O7P B;  3MSO A;  2IYJ A;  3F9S A;  1OHP A;  3CCQ 3;  4XBY A;  3F8X A;  2ZHX B;  3CC2 3;  4R1K A;  3PS8 A;  3DY5 A;  1I0X A;  1N5P A;  1OCV A;  4L8P A;  3NXJ A;  1IQY A;  4HOH A;  2QIY A;  1TIJ A;  3LT9 A;  4BIR A;  1MGR A;  1NB3 I;  1K41 A;  3D5I A;  2F56 A;  4HM5 B;  5IW9 A;  1E3V A;  5KP3 A;  1CYU A;  3RDE A;  3RGR A;  1I0V A;  3AGO A;  4GHO A;  1TP6 A;  3HIG A;  4EW5 A;  3BLZ A;  1QAF A;  3WHO A;  1RGC A;  2XF3 A;  1MWR A;  2P0X A;  4FCJ A;  4PEJ A;  1B2Z A;  4LGQ A;  2WO0 A;  1UCI A;  1X1U A;  3EX9 A;  1Z1S A;  1NDO B;  2HMJ B;  3EBT A;  4CDL A;  1YIT 3;  1HKX A;  1N5H A;  2OOV A;  1C54 A;  1TUH A;  4CCV A;  1FYS A;  3IPT A;  3Q90 A;  3U1W A;  5FGO A;  1N9J A;  3X3Y A;  1VQP 3;  3EN8 A;  1T2I A;  4KFE A;  2P0M A;  4BU4 A;  1IV9 A;  1RRH A;  1IK3 A;  3CXC 2;  4STD A;  4HM1 B;  3EBY A;  3JUQ A;  4I5Q A;  3X41 A;  4NRE A;  1RGL A;  1WTH A;  2F5W A;  3K9M C;  1YHQ 3;  1VQO 3;  1JBR A;  3X42 A;  1N9E A;  1QVG 2;  1LQM B;  4J9A A;  3CCU 3;  1BAO A;  3VF1 A;  1IQ8 A;  1FUW A;  2C4B A;  2CW9 A;  4EC6 A;  3AHW A;  3OV4 A;  4FR9 A;  2GSP A;  3ALA A;  1A90 A;  2PNC A;  1GY5 A;  4HM0 B;  4KT3 B;  1GD3 A;  3FSD A;  2ZDJ A;  3K0Z A;  3DUK A;  5CF1 A;  4WYK A;  2Q07 A;  4N6U A;  1PY3 A;  4K61 A;  1YI2 3;  3A5E A;  1WMN A;  2CWU A;  4FMC A;  4HM2 B;  2MF7 A;  4HBR A;  3CNM A;  1TRQ A;  6RNT A;  2SBL A;  3EC9 A;  3MG3 A;  4HYZ A;  2UUG C;  1FGQ A;  1T5Y A;  2D1W A;  2V1L A;  3NM2 A;  1IDP A;  5IEN A;  3LTC A;  4CPK A;  1T2H A;  4WWU C;  1JZO A;  2HML B;  5LC6 A;  1O7G B;  2BT3 A;  3VGN A;  1D6U A;  5HGR A;  1I2E A;  3SOY A;  4J5K A;  2AAE A;  3PGB A;  1U8C B;  1R4Y A;  1SIH A;  2W56 B;  3G8Z A;  3NQZ A;  4X2O A;  3KKG A;  1ZO2 A;  4HAA A;  2O3O A;  1ZX2 A;  1RGG A;  4BTW A;  3K63 A;  2GEY A;  3VSY A;  1RRL A;  3Q2P A;  3STD A;  3BNE A;  3D4A A;  1VQ4 3;  2OQE A;  3SLU A;  3BB9 A;  2W9Q A;  1X1W A;  1OGZ A;  2GU1 A;  3CCR 3;  3QK9 A;  3ZFZ A;  1BRN L;  1YJW 3;  4H3U A;  1OHS A;  3HZP A;  3SOA A;  5BVB A;  4O02 B;  3D9R A;  3QRD A;  3WOE B;  2A15 A;  2CKF B;  1I2G A;  3AMO B;  3F7X A;  3GZX B;  4HZB B;  3OWS A;  1A2P A;  3X3Z A;  4ZM8 A;  1ULJ B;  2IUJ A;  1ROA A;  3PZW A;  2WGQ A;  4N6V 0;  2HMM B;  5JPP A;  1NJI 4;  3BNC A;  3LXU X;  1EG9 B;  2CIU A;  1IT8 A;  3N54 B;  2H0I A;  2P09 A;  3Q3F A;  1Q7Y 4;  3OWY A;  1I3I A;  1ROV A;  2W9P A;  3NBJ A;  1BRJ A;  1MWU A;  2XH9 A;  2YFL B;  2R4I A;  3S28 A;  3B7C A;  4JRF A;  1RGE A;  4RNZ A;  4WP5 A;  3V99 A;  3WDG B;  4TX4 A;  1UCK A;  1B2X A;  2F86 B;  5IEO A;  1FUS A;  1BRG A;  8RNT A;  1DVD A;  1W01 A;  2Y74 A;  4FMD A;  2GEX A;  2KXG A;  1UUW B;  1Q7H A;  1OAC A;  3CCS 3;  1D6Y A;  2BU4 A;  3BNB A;  3JUM A;  3LML A;  5EEO A;  2BHM A;  2H0H A;  3UNL A;  3CCJ 3;  1B2U A;  1NO3 A;  4N6N B;  3X3X A;  1VQK 3;  4FMB A;  2MC8 A;  1AVK A;  1JBS A;  5DRE A;  3Q1C A;  1HU9 A;  1RGH A;  4BL3 A;  2XRX B;  3L0R A;  4J8T A;  3X40 A;  5IF6 A;  3FH1 A;  3WA3 A;  1IVW A;  2BMR B;  2UX0 A;  5IG0 A;  3JUP A;  1JRQ A;  6GSP A;  1WMO A;  2GBX B;  3NM7 A;  1UW1 A;  1YIJ 3;  2W03 A;  3CMA 3;  2Z6B A;  2RNT A;  2BO9 B;  1LRA A;  1UI7 A;  4G1M B;  3DMC A;  1JJ2 2;  1UUV B;  3LTD A;  5DRV A;  1DMN A;  2INX A;  3ER7 A;  3DH2 A;  1BRK A;  2D42 A;  4QWT A;  5TGN A;  4HM4 B;  1FA3 A;  1BNF A;  1QAK A;  1ASK A;  1S5A A;  2C10 A;  1I3F A;  5HOH A;  5IG5 A;  5STD A;  3KFQ C;  3PCS A;  3PYJ A;  3M8C A;  5AYR B;  1NB5 I;  4LYL B;  3GZY B;  1KC8 4;  1TJD A;  1BVI A;  1QJG A;  1VQ9 3;  5CF2 A;  3FF0 A;  3JUO A;  2O9U X;  1YVS A;  3I0Y A;  1W5Z A;  5EVH A;  1O7W B;  4HJL B;  4XDW A;  5M1A A;  5JBS A;  1A67 A;  1GY6 A;  2ML6 A;  3FGY A;  3I55 3;  2LYX A;  4LMI A;  1GS3 A;  5IER A;  1JB4 A;  1UDI I;  3IJE B;  3A76 A;  1C7H A;  4MMX B;  1Q42 A;  1JNQ A;  1MWT A;  2W04 A;  1QAL A;  2XSO B;  3CNX A;  3JVC A;  3NBB A;  4N3V A;  4N6T A;  3V98 A;  4DKI A;  1SAR A;  1BUQ A;  1FGM A;  3MKI A;  2BMO B;  3DXO A;  1K8A 4;  1OUN A;  1E3R A;  1AQZ A;  4IPB A;  4U13 A;  2KF6 A;  4EV2 A;  9RNT A;  5AEU B;  2Z76 A;  1O7N B;  1W2Z A;  5BXQ A;  2XGL A;  3URP A;  1IQX A;  3NUV A;  4EBG A;  1G0T A;  1I2F A;  1Q40 A;  3PCR A;  4MEI A;  1Y4K A;  3DGY A;  2GU3 A;  1IVX A;  3ROB A; 
#chains in the Genus database with same CATH homology
 5KP4 A;  1IT7 A;  3NV0 B;  3MG2 A;  3T8N A;  7STD A;  3GZB A;  1D6Z A;  4HZ9 B;  1US1 A;  4N6L A;  1R4C A;  3WOF B;  1YJ9 3;  2XGN A;  1YVB I;  4RBN A;  4HVN A;  3ECF A;  5AIG A;  4BTY A;  4FCZ A;  3T8U A;  4K90 B;  3JUN A;  2FXT A;  3G16 A;  4WHA A;  1V74 A;  4JF8 A;  1W6C A;  5IG3 A;  2KCD A;  1IU7 A;  1MOL A;  1OHO A;  3F7S A;  4R9L A;  2E2T A;  2IA7 A;  1O7H B;  3EQQ B;  2K0M A;  3CC7 3;  2XR8 B;  1RN7 A;  3B8L A;  3LOY A;  4HKV B;  3CD6 3;  1N8R 4;  2CG0 A;  2W2C A;  1NWW A;  1O7M B;  1AVL A;  4HM7 B;  3G6E 3;  1AV4 A;  2RFR A;  2CWV A;  3UB1 A;  4KFF A;  2CFG A;  4GL6 A;  1S72 3;  3CME 3;  2BNG A;  4O2H A;  3LTB A;  1JB2 A;  2JDI H;  3I56 3;  3KN4 A;  3F14 A;  3AMO A;  3TDG A;  4EYC A;  5AII A;  3EHC A;  4R80 A;  3G4S 3;  3V92 A;  5JPU A;  1EQK A;  2QEX 3;  1JKG B;  5D81 A;  5ELJ A;  1LOX A;  1F8N A;  3FCS B;  3MPH A;  3SVA A;  5KP1 A;  3WMD A;  4I4K A;  5AI1 A;  2P05 A;  1QVF 2;  3D3L A;  3UL6 A;  1DVC A;  4AKY A;  2CFW A;  3KII A;  5CK6 A;  2YFI B;  1SQW A;  3DGO A;  4BTX A;  1E97 A;  3K5T A;  1STD A;  5A0O B;  3CC4 3;  1LXE A;  2JQ5 A;  3NBR A;  2QGU A;  3NV0 A;  3KE7 A;  1EKM A;  3EF8 A;  3DM8 A;  4GB5 A;  3IMA B;  2RCD A;  2CFK A;  1M1X B;  3FZW A;  3WOD G;  1SPU A;  3HK4 A;  2FNQ A;  1CEW I;  5CXO A;  2CFD A;  1G96 A;  1RKY A;  3EN1 B;  4WYK B;  3WA2 X;  1A2K A;  4XBT A;  4RNY A;  1M90 4;  2P38 A;  4OK0 A;  2F98 A;  3FG1 A;  4K1V A;  3HX8 A;  4XBX A;  1K73 4;  1Q81 4;  1UI8 A;  2XEP A;  3KZT A;  3GRD A;  3N9H A;  1L5G B;  4FCM A;  1KQS 2;  5LC7 A;  3MYT A;  4R9K A;  2L4V A;  1N8Q A;  4H61 A;  1CQS A;  1U5O A;  2WOH A;  1EA2 A;  1W02 A;  3OWU A;  3K7C A;  4IT7 A;  1A2V A;  1FGR A;  4NHF A;  2WOF A;  3LTA A;  1GYB A;  2CFL A;  2Y73 A;  1M9G A;  1ULI B;  4N6M A;  3H51 A;  2CHC A;  1PU4 A;  3S27 A;  1JN5 A;  4XM4 A;  2W6J H;  3FLJ A;  3EB8 A;  2IMJ A;  2M7O A;  2OWP A;  1JKG A;  3GZR A;  4L7K A;  5AYS C;  5AEW B;  3LH4 A;  4O3V A;  2E2U A;  2HMN B;  2I9W A;  1FGO A;  1M1K 4;  3PXM A;  2CH9 A;  3OXA A;  2K54 A;  1GY7 A;  2LQV A;  2Z77 A;  1VQL 3;  4HM6 B;  2E2V A;  1WNH A;  2W0Q A;  3SXX A;  3GWR A;  1VQ7 3;  1OGX A;  1KWI A;  3LT8 A;  1CYV A;  3G0K A;  3NHX A;  1OF5 B;  1K28 A;  2STD A;  5CLK A;  3FKA A;  2IUK A;  3T0U A;  1W4N A;  3UJM A;  2CC3 A;  1W6Y A;  1OPY A;  2HMK B;  2WGO A;  3B4P A;  3SX1 A;  5AIH A;  3CCL 3;  2QA4 3;  3BND A;  1VQ5 3;  4LEH A;  4MMZ B;  2KRT A;  4MJD A;  1DMQ A;  3O8Y A;  1VQ8 3;  2PZV A;  4KZ1 A;  2OOV C;  1JB5 A;  3E99 A;  3KSP A;  3LZA A;  1FGT A;  1KSI A;  4ORL A;  3S67 A;  1VQM 3;  1NU3 A;  2XFT A;  3H3H A;  2OCT A;  3MG1 A;  4KFD A;  3F40 A;  4WFO A;  2OQE C;  3UL5 A;  1IVU A;  3S5C A;  1OF5 A;  5D83 A;  2FGT A;  4HM8 B;  2XFS A;  4LSO A;  4IIA A;  2HMO B;  2OTL 3;  2CWT A;  4L8O A;  2YX9 A;  1PFP A;  4Q53 A;  8CHO A;  3CCV 3;  3NX0 A;  3CPW 2;  2C11 A;  1Q40 B;  1SJW A;  1STF I;  1WQL B;  1JV2 B;  3N8B A;  3CCE 3;  1SII A;  2XSH B;  2GXF A;  2BMQ B;  1K9M 4;  1QMA A;  1WMP A;  3KSE D;  3MWZ A;  4RZM A;  3RGA A;  4MMY B;  4KVH A;  5ELU A;  4XB5 A;  3DGL A;  1VZZ A;  3LYG A;  2RSX A;  1TFK A;  1MNL A;  4HM3 B;  4LZI A;  5AIF A;  3DGM A;  4EV5 A;  4AKZ A;  1Q86 4;  1VQ6 3;  3EE1 A;  5D82 A;  2CK3 H;  2ZL8 A;  5FW5 A;  1W7C A;  1DMM A;  4OUQ A;  5IG4 A;  2B1X B;  1LVN A;  2OTJ 3;  3FG3 A;  3U97 A;  4FMA A;  6STD A;  4K1U A;  3EJV A;  3F8H A;  1ISK A;  1AR0 A;  1LNH A;  1OH0 A;  1VQN 3;  3FF2 A;  1DYU A;  1GD4 A;  3J7Y d;  1W6G A;  5EQL A;  1Q82 4;  1TU5 A;  3B4O A;  3OX9 A;  3OW2 2;  1YGE A;  1KD1 4;  4XDV A;  2RGQ A;  2W56 A;  5IEP A;  1W2B 2;  4R4K A;  2B24 B;  3HI7 A;  4EXR A;  3HII A;  2ML5 A;  3CU3 A;  4X2H A;  2F99 A;  2CG1 A;  1RJO A;  3DZL A;  5G2G A;  4O8S A;  1J2B A;  2GBW B;  1YJN 3;  2YFJ B;  3GAX A;  3FG4 A;  3CCM 3;  3S29 A;  3MHE A;  4N6O B;  3DGN A;  1TFO A;  4OVM A;  3NQY A;  1IV7 A;  1IVV A;  5I97 A;  1W00 A;  3CPO A;  3SED A;  3G71 3;  2Z7A A;  1JN5 B;  1O7P B;  3MSO A;  3F9S A;  1OHP A;  3CCQ 3;  4XBY A;  3F8X A;  3CC2 3;  4R1K A;  3PS8 A;  3DY5 A;  1N5P A;  1OCV A;  4L8P A;  3NXJ A;  1IQY A;  2QIY A;  1TIJ A;  3LT9 A;  1NB3 I;  5IW9 A;  1K41 A;  1CYU A;  4HM5 B;  1E3V A;  5KP3 A;  3RDE A;  3RGR A;  1TP6 A;  3HIG A;  3BLZ A;  1QAF A;  2XF3 A;  2P0X A;  4FCJ A;  4PEJ A;  4LGQ A;  2WO0 A;  3EX9 A;  1Z1S A;  1NDO B;  2HMJ B;  3EBT A;  4CDL A;  1YIT 3;  1HKX A;  1N5H A;  2OOV A;  1TUH A;  4CCV A;  3IPT A;  3Q90 A;  3U1W A;  5FGO A;  1N9J A;  3X3Y A;  1VQP 3;  3EN8 A;  4KFE A;  1IK3 A;  2P0M A;  1IV9 A;  1RRH A;  3CXC 2;  4STD A;  4HM1 B;  3EBY A;  3JUQ A;  3X41 A;  4NRE A;  1WTH A;  1YHQ 3;  3K9M C;  1VQO 3;  3X42 A;  1N9E A;  1QVG 2;  4J9A A;  3CCU 3;  3VF1 A;  1IQ8 A;  1FUW A;  2CW9 A;  4EC6 A;  3OV4 A;  4FR9 A;  3ALA A;  1A90 A;  2PNC A;  1GY5 A;  4HM0 B;  1GD3 A;  3FSD A;  2ZDJ A;  3K0Z A;  3DUK A;  5CF1 A;  4WYK A;  2Q07 A;  4N6U A;  4K61 A;  1YI2 3;  4HM2 B;  1WMN A;  2CWU A;  4FMC A;  2MF7 A;  4HBR A;  3CNM A;  2SBL A;  3EC9 A;  3MG3 A;  4HYZ A;  1FGQ A;  1T5Y A;  2D1W A;  2V1L A;  3NM2 A;  1IDP A;  5IEN A;  3LTC A;  4WWU C;  2HML B;  5LC6 A;  1O7G B;  2BT3 A;  3VGN A;  1D6U A;  5HGR A;  3SOY A;  3PGB A;  1U8C B;  2W56 B;  1SIH A;  3G8Z A;  3NQZ A;  4X2O A;  3KKG A;  1ZO2 A;  2O3O A;  1ZX2 A;  4BTW A;  3K63 A;  2GEY A;  3VSY A;  1RRL A;  3Q2P A;  3STD A;  3BNE A;  1VQ4 3;  2OQE A;  3SLU A;  3BB9 A;  2W9Q A;  2GU1 A;  1OGZ A;  3CCR 3;  3QK9 A;  1YJW 3;  4H3U A;  1OHS A;  3HZP A;  3SOA A;  5BVB A;  4O02 B;  3D9R A;  3QRD A;  3WOE B;  2A15 A;  2CKF B;  3AMO B;  3F7X A;  3GZX B;  4HZB B;  3OWS A;  4ZM8 A;  3X3Z A;  1ULJ B;  2IUJ A;  1ROA A;  3PZW A;  2WGQ A;  4N6V 0;  2HMM B;  5JPP A;  1NJI 4;  3BNC A;  3LXU X;  1EG9 B;  2CIU A;  1IT8 A;  3N54 B;  1Q7Y 4;  2P09 A;  3OWY A;  1ROV A;  2W9P A;  3NBJ A;  3S28 A;  4AEQ A;  2XH9 A;  2YFL B;  2R4I A;  1FA3 A;  3B7C A;  4JRF A;  4WP5 A;  4RNZ A;  3V99 A;  3WDG B;  4TX4 A;  2F86 B;  5IEO A;  1DVD A;  1W01 A;  2Y74 A;  4FMD A;  2GEX A;  2KXG A;  1UUW B;  1OAC A;  3CCS 3;  1D6Y A;  3BNB A;  3LML A;  3JUM A;  5EEO A;  2BHM A;  3UNL A;  3CCJ 3;  1NO3 A;  4N6N B;  3X3X A;  1VQK 3;  4FMB A;  2MC8 A;  1AVK A;  5DRE A;  3Q1C A;  1HU9 A;  2XRX B;  3L0R A;  4J8T A;  3X40 A;  5IF6 A;  3FH1 A;  3WA3 A;  1IVW A;  2BMR B;  2UX0 A;  5IG0 A;  3JUP A;  1JRQ A;  1WMO A;  2GBX B;  3NM7 A;  1UW1 A;  1YIJ 3;  2W03 A;  3CMA 3;  2Z6B A;  2BO9 B;  4G1M B;  1UI7 A;  3DMC A;  1JJ2 2;  1UUV B;  3LTD A;  5DRV A;  1DMN A;  2INX A;  3ER7 A;  2D42 A;  4QWT A;  5TGN A;  4HM4 B;  1QAK A;  1ASK A;  1S5A A;  2C10 A;  5IG5 A;  5STD A;  3KFQ C;  3PCS A;  3PYJ A;  3M8C A;  5AYR B;  1NB5 I;  1KC8 4;  3GZY B;  1QJG A;  1VQ9 3;  5CF2 A;  3FF0 A;  3JUO A;  2O9U X;  3I0Y A;  5EVH A;  1W5Z A;  5JBS A;  1O7W B;  4HJL B;  4XDW A;  1A67 A;  1GY6 A;  2ML6 A;  3FGY A;  3I55 3;  2LYX A;  4LMI A;  1GS3 A;  5IER A;  1JB4 A;  3IJE B;  3A76 A;  1C7H A;  4MMX B;  1Q42 A;  1JNQ A;  2W04 A;  1QAL A;  2XSO B;  3CNX A;  3JVC A;  3NBB A;  4N3V A;  4N6T A;  3V98 A;  1BUQ A;  1FGM A;  3MKI A;  2BMO B;  3DXO A;  1K8A 4;  1E3R A;  1OUN A;  4IPB A;  4U13 A;  4EV2 A;  5AEU B;  2Z76 A;  1O7N B;  1W2Z A;  5BXQ A;  2XGL A;  1IQX A;  3NUV A;  4EBG A;  1Q40 A;  3PCR A;  4MEI A;  1Y4K A;  2GU3 A;  1IVX A;  3ROB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...