3WDKA

Crystal structure of 4-phosphopantoate-beta-alanine ligase complexed with reaction intermediate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
252
structure length
249
Chain Sequence
PRYWSLYYREKIIEGMEKGMTAKAGLIAHGRGEAFDYLIGERTIEPAERAMRAAVAKFLLAEHPVISVNGNVAALVPKETIELAKALNAKLEINLFYRTEERVRTIAEELRKYDPEIEILGINPTKRIPGERGKVDENGIWKADVVLVPLEDGDRTEALVRMGKFVVTVDLNPLSRSARMADITIVDNIVRAYPRMVELAREMKDYSREELLKIVGEYDNGKTLSDVLLHIRDRLTRLAEEGIWRRKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-phosphopantoate--beta-alanine ligase
publication title Crystal structure of phosphopantothenate synthetase from Thermococcus kodakarensis
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Ligase
total genus 92
structure length 249
sequence length 252
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.36: 4-phosphopantoate--beta-alanine ligase.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02006 PPS_PS Phosphopantothenate/pantothenate synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12640 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wdkA00
4MB0A 4MB2A 3WDKA 3WDMA 3WDLA
chains in the Genus database with same CATH superfamily
2J3JA 3IQIX 5J4KA 5DYTA 4EYKA 2Q5CA 4W63A 3GU3A 2QAGB 3PPVA 2EJTA 1P80A 4OATA 2OORA 4U7PB 1OX5A 1VIVA 2KB0A 4PS1A 4UAUA 3L92A 2I99A 3EFEA 1YTLA 1M34A 4M0PA 3OP1A 5FL3A 2W11A 4P35A 3U19A 5JS1A 2VPPA 2QOEA 1LWNA 2GDJA 3AGPA 2XDWA 4RV9A 4CUKA 1EZZA 5BV0A 1B6GA 1X3SA 2JGAA 1WP9A 3L7NA 4WASA 3FDXA 1K6XA 3U3RA 2AV6A 1XAHA 1WCIA 2JFWA 2XR1A 3A1NA 3II6X 1T24A 2JH9A 3PVZA 1XT6A 4B73A 5GOTA 3U16A 1AKTA 1IHYA 1IBMB 2ENWA 4KG7A 5IK2D 3DHEA 2FEAA 4L15A 1L7RA 2ID8A 1Y5IA 1TLFA 4CEJA 1RCUA 4E5MA 2W2KB 2WKPA 1TYZA 3QTBA 3OKPA 3VBCA 5AOCA 3CG0A 2YWRA 2ZXEA 3X1JA 4D3SA 5EZSA 1HZZA 2P9ZA 1CR1A 1HDYA 3H9GA 2V9PA 4QOHA 3FMPB 1REQB 1MOPA 2DWCA 4NBVA 2RIRA 3DDSA 1VCIA 1UBSB 2XYQA 3S2ZA 3BQMB 1W29A 1AO3A 1Z17A 2WF5A 3M4ZA 1U2EA 1LXCA 3GLTA 1EJ6A 1J39A 3MAJA 3PF8A 2DUMA 2ZR8A 1FMCA 3F71A 3R09A 3TUZC 2EG5A 1KWKA 2IOQA 1NV9A 1VCOA 1VYHA 3Q2IA 3UAYA 5IANA 2PRYA 4D0GA 4HN4B 4DMFA 5G0UA 4YO8A 3UB2A 3AYZB 2E5FA 1B8UA 5BOVA 4E30A 2PL1A 2ZAYA 3K0AB 5I9IA 1EGMB 2V98A 3OF2A 4S1TA 2IHYA 4DBLC 1UK6A 4NPCA 2W6IA 4Z0NA 3UCEA 1UANA 3INRA 3MELA 4QU0A 1GLNA 4OVKA 3E8MA 4PC6A 4JWKA 3S70A 2QN9A 4LXIA 1T2NA 1ZW1A 1P75A 1J0CA 2G1JA 2Z43A 5LQSA 4DCOA 5BSKA 2PUTA 3DMGA 5CLJA 2JGJA 1XELA 2Z30A 5JNTA 4YMGA 3ITKA 1JZQA 5A3VA 5KYVA 4IJUA 1WULS 5THKA 3G7UA 2QVXX 4OFXA 3IUPA 4PSKA 3U3KA 3WA7A 3F5MA 4UNIA 4ID3A 4ENUA 1NBHA 2JF0A 4J0HA 4AJ2A 3QFCA 5ICEA 5B5SA 3GEEA 1WKBA 1XP5A 2J8ZA 2YWCA 3AXSA 3TR0A 5AIAA 4UAVA 4URXR 4I55F 5JNVA 2D6FA 1V96A 2AMJA 2RGAA 4M0LA 3LA6A 3Q7IA 3HO6A 2RK6A 4MQLA 3EXHA 4L5AA 4NOJA 3RSLA 4OSPA 2K5UA 3SQMA 2P68A 4ZXFA 2PBRA 4DIMA 4RVFA 3E5NA 3WWDA 1XNGA 1UXHA 1XYGA 1JA0A 2BUCA 1U0EA 1FRVA 5CA0B 1V26A 4BO8A 1H1DA 3WK8A 1E1QD 2JANA 2TMKA 4AJPA 2JARA 5FI1B 4DLZA 4E5SA 4F9TA 1E3IA 1LFDB 4JC5A 1UKAA 1Z2OX 2WDPA 4RCYA 2KI5A 1QX3A 1A2QA 2HLHA 1G7TA 3A6JA 5CIYA 2E4YA 5B3JA 1RE0A 5HUHA 2C92A 1GZ3A 3FI0A 3ASUA 4IJMA 5CH5A 3AY7A 5GJVC 4ICIA 4P4UA 3WJ2A 1FF9A 3TLEA 4H7EA 3TKYA 4TROA 2AH5A 1U7UA 1QC5A 2OXRA 1H5QA 4M83A 3TIVA 3V1KA 5HJ5A 2FW0A 2PGNA 2WUEA 1W75A 3LH5A 5C9ZA 3G8DA 4GX0A 1OE0A 5K3DA 2HF9A 4IH4A 4GUAA 3S2EA 2Y0DA 1J25A 3KQQA 1VJCA 3OCUA 2NT4A 2ZE5A 2IY9A 3HCFA 3TTYA 4DMMA 1ONSA 2NO5A 3O4HA 4QPJC 1VBFA 3FA2A 1NSYA 3AFGA 3S3TA 1USWA 4ZC1A 4K40A 1X9GA 2IP4A 4D8XA 1AQNA 1E6UA 2GN1A 1V43A 4M54A 2IXTA 2BE9A 5K2OA 5EIWA 3ZX4A 4CKXA 1NNSA 2JHPA 1ZESA 1XEXB 2PFSA 3DHVA 2BBSA 2D4AA 3AI2A 3FMIA 3LUGA 4DBVO 3WGGA 3BSSA 3MWEB 2IPLA 1HYGA 2J32A 2BCEA 4R7TA 2GNAA 3U7FB 1HSOA 2AZDA 2F1IA 1Y33E 1NN0A 1PLJA 3NOOA 1O6CA 4QUAA 4G25A 2YXDA 4MR8B 3JVEA 4KQGA 3BE5A 1SQSA 3ZBUA 5B53A 2PJZA 3NNSA 4QHSA 2VPTA 1Y1QA 3QGMA 3AG6A 1XD2A 2FPWA 4YCSA 2FI1A 1SVNA 3K15A 3MWKA 1NLUA 2DPLA 1TJYA 3NS7A 5CXSA 3UO8B 4RENA 5LDDC 2VHYA 1OYVA 4U00A 5KWSA 4WTOA 1SUIA 1RTKA 1WXQA 2L19A 2Y1CA 4BMXA 2XZOA 3VJMA 4GMKA 2ZRDA 4B81A 2ZDHA 3OE7A 1ZIPA 4XUDA 2XUOA 4FP9A 1UMDB 3RYCB 4H3KB 5BSWA 1PR3A 4UHJA 4QDZA 4QXOA 2K2WA 1SOAA 3SZGA 3QXXA 4LJ7A 1DG9A 4W8GA 2WJHA 4KC0A 2W2QA 2CXHA 3R7NA 1Z6YA 2WWVD 5JHHB 2FRVA 1UPTA 1W73A 4LBVA 4C7MA 4FHGA 3HTXA 3IAEA 4JR2A 3L7LA 4RGYA 1AU9A 3PRYA 2H7YA 1N7GA 5MN4A 2XW6A 2IYSA 2R44A 1IQPA 3KKEA 1JMVA 1EH5A 3L7CA 3ED5A 5GY7A 2W71A 1ULSA 2G83A 2Z1DA 2ZTMA 3ODPA 5A3SA 3HVRA 1MD9A 3WG9A 4JLUA 1FU4A 1E3LA 1KDPA 3ADOA 3IQDB 1P8AA 1GPYA 4KXNA 4CFZA 3MSXA 5IJ0A 3KUUA 1ZL2A 2YN2A 2REQB 3DGFC 2MSKA 1EUCB 3HKCA 1MZPA 4KXFB 5AVTA 1X2BA 1YACA 1C2YA 1EGHA 3BICA 2EL9A 3GT7A 2ZWMA 1YRQA 1YIOA 4MGIR 2C57A 3SAJA 3N8GA 5CFMA 2R8YA 1OIXA 4EG8A 1Z45A 3P9NA 3UT0A 3T3PB 4O4HB 5AXAA 1VKRA 3MUNA 1YR2A 5DLDA 3GOHA 4G01B 1G98A 2EFEB 4JJKA 2IX9A 5CVJA 1LK0A 3NZEA 2RHHA 1JE1A 5KHAA 2WABA 1E7SA 1XA0A 4HQOA 5CBPA 1PD1A 1ZKDA 2HR1A 4E08A 4HEQA 2DB3A 1JV2B 1CJMA 2GPYA 4PLPA 5KEIA 2ACVA 2Y1EA 5FPSA 2GEVA 1DRKA 2OAGA 4YWHA 4O2AF 5JAZA 2C0QA 3AETA 5LQJA 4J49A 1SUWA 1KK0A 3DEYX 1QJ4A 1L4YA 5IP5A 3DZJA 3CSSA 3ADPA 5C7LO 3PUHA 1QMPA 2GLTA 4EAAA 2ORWA 3FSRA 1THGA 3WWZA 2EW1A 1DHTA 3LBYA 1D2NA 1E9FA 3UOWA 4JC0A 2D13A 4AJ9A 1X92A 2Q99A 3VPCA 5GONF 1SPBS 3U48A 2ZANA 3ZV3A 3U0BA 1XLVA 3OZDA 3MBIA 2O2JA 3GN2A 2CZCA 2AKYA 3EEYA 1CIVA 2TMYA 3UJAA 4IQ8A 3SKXA 4YS6A 3F73A 5E6RB 2WHPB 3OUZA 3HL0A 4J2HA 5HM8A 4M1KA 3ZCUA 1QG6A 2GJAA 2DHCA 3MHPA 3VU9B 3KPVA 4OL9A 1N36B 2HMUA 1F20A 3S40A 3CX7A 3TE6A 4BNUA 4DAOA 3T7EA 4QQ8A 1Z2DA 1T9BA 4YMLA 4MI1A 2NG1A 3HGMA 2PLWA 3FYUA 5ALDA 3IUEA 5JCJD 1JFVA 1PJ2A 2EJWA 3K20A 3URMA 2MSNA 3WFZA 5KNCD 2R1UA 1SJ9A 3O83A 1YQDA 2CSUA 1E20A 2W2LD 4P2GA 4D4KA 1ZQ9A 1DTSA 3BIFA 1JJIA 1RFLA 1ETUA 4NRDA 4Y8VA 5JAPA 1A8HA 1U9ZA 2FAXA 1IDN1 3U7RA 5E1BA 3TZBA 3IPCA 1JQKA 3ZZTA 3W5CA 3D3KA 1JDVA 1E3WB 3KVYA 5ICSA 3A6ZA 1MEEA 2XVMA 1CUVA 3RT7A 3IEIA 3WRYA 2JASA 2Z2YA 4RF4A 5ADWA 4M0MA 2P2YA 1BIFA 1NZJA 2DF8A 1FFDA 4FKMA 4JZYA 1EFRA 1IB6A 1NE2A 1HKUA 3KBBA 4MAFA 5BW6B 3L0BA 1IYZA 1ND6A 3BXPA 4FIDA 4ZDIA 4NY1A 1BTOA 1G3UA 3OBBA 5E7QA 3WB0A 3IBTA 3G0HA 1OWNA 2FP4A 4BLOA 4OLBA 3BD6A 4Y2XA 2BHSA 1N0WA 3PQFA 5CLQA 1PR2A 3MIZA 4YP7A 2FV8A 4HQLA 5B6PA 4AW9A 1AB6A 5DM60 5HCIA 3L0IB 1FW8A 2X8LA 2BRUA 5JSYA 4LSWA 3HVIA 1DDGA 1DRJA 4BLPA 3BFPA 2BI7A 3G2HA 4DCTA 2QTCA 2XYHA 1JG1A 3F3YA 1J1IA 5JFOA 5EJ2A 2MMGA 5F7XA 2EXXA 1CQJA 1KSFX 1E2DA 3PD0A 4IDDA 1PJLA 2GJKA 1DIGA 3DFZA 3EVGA 1LPMA 1DXHA 5I6DA 3DG9A 4Q4CA 1IPEA 2BT4A 3VTFA 2QN7A 2ID4A 1N92A 1JQEA 2V7TA 3VHXB 5DMHA 3WKEA 4WV3A 1TUIA 4JWTA 5KWVA 1LPNA 1VSUA 4BTVA 4ABTA 4D4LA 3H1PA 4LNHA 3WIEA 4FBMA 4U9UA 3FMVA 2XLCA 4V0SA 3TMYA 3CXUA 2ZEJA 1YBVA 3U4QA 4DVGA 5KDDA 4TLDA 2RARA 2O0JA 1Q92A 2A35A 3QITA 4MK4A 4D4MA 4PHGA 3HCBA 4EGCB 2QZPA 2VHEA 1T13A 2W42A 1R9JA 5I48A 2I2AA 1GP2A 2Q29A 1Z6TA 4ND2A 2OILA 2GEFA 5B57C 1X7XA 3M8KA 3OO1A 3CEHA 3NFRA 4FGKA 1EFUA 1II8B 2CYAA 4TMTA 3UHPA 2XZPA 4BMNA 2VRCA 1W5EA 3BULA 4MQEA 2BGJA 5CVUA 3LG2A 1DDOA 3HV2A 3OKCA 3OLWA 3ONFA 1ADFA 4YV0A 4KGZA 1UBRS 2P3QA 2VP4A 3CN7A 2PKWA 4MA0A 3H9QA 1NG9A 2BD0A 5AT1A 1UZAA 5TQ0B 4ZJYA 4JL8A 3EEQA 5C7IO 4C0XA 1J1UA 5HIIA 2D62A 1T1IA 1TRKA 1XF1A 2HUPA 2G80A 2QNRA 2WPDA 2YHUA 1AD2A 4P5PA 3R6GA 4JDPA 3WSWA 3P5SA 1U2GC 2HA7A 3JALB 3PR2B 4KOEC 5HQTA 5IZCA 3KK0A 5HKAA 2IYNA 3FM9A 3F5QA 1JDPA 3T7CA 1ESCA 1WOMA 1NDQA 3EGXB 3LS2A 4G8CA 4Y67A 1ZSNA 2VNSA 1RJDA 2AOUB 2K6GA 2D74A 3L05A 3K05A 4YMTA 4YQFA 4V0NA 2BGKA 1WHSA 5TVKA 3ZHCA 2C4VA 3SBOA 3SSAA 2QMOA 5KSWB 4FLFA 4KDEA 4BO3A 3TLXA 1C80A 1EMDA 3Q11A 1T1JA 4FHZA 4ZZ1A 1JWLA 2W93A 2OMEA 4LSGA 4BU1A 3SZUA 4D9JA 4MRRA 1J2UA 4WKOA 3GNTA 1Z7EA 2BMDA 3KQNA 2IUSA 3LX4A 4KWHA 1UL1X 3PDWA 4WEQA 5DM4A 3JPYA 3JY6A 4OHZA 4DBZA 1AO0A 4LHZA 3VPBA 2FZWA 3O1HB 4QEDA 5LZ7A 2IS1A 2FX3A 2R79A 5ECDA 1ACJA 5BN3A 2A1TS 2YTZA 2HLDA 4HGOA 4OGGA 5IBPA 1GKIA 3DZIA 4ZVOA 3IAHA 4ZZIA 4B3CA 1DRUA 1WY7A 1XDBA 2YS6A 2VLBA 4OHYA 4PCUA 1CY6A 2XDQB 5ERGB 1B74A 4Y6OA 1NUSA 2IYWA 4F7DA 2Y1FA 1ZUNB 5IKOA 3QKSB 2QVCA 5HBGA 3TRFA 2FPIA 3VISA 2H31A 5JZMA 2HLPA 4IFBA 2OFXA 3O3CA 4GZ5A 4MH0R 1FXUA 2ZGVA 1ESDA 3KYDA 5DM1A 2I8AA 2OPBA 3HRKA 2QE6A 3AW9A 2W5UA 2I4OA 4OI4A 3BIXA 2V7BA 1DUSA 4O2BF 4DM3A 3IVXA 1FVHA 1TKBA 2P6NA 3EY9A 1UPBA 2P7HA 4UVHA 3DCNA 4WDQA 4LDZA 4POAA 2H4ZA 1QIIA 3UEOA 4C89A 4R8VA 1QB7A 1GV0A 1LV8A 3ILSA 2XTZA 3GNLA 3TX6A 3HCAA 2IUEA 3H9JA 3VVMA 2XB6A 4OQEA 3NEYA 1WF6A 3ENWA 4NJMA 1H2RS 4CCAA 3UJ7A 2ZFUA 4MULA 4EDHA 4ESEA 3I5AA 4X9XA 3ROPA 2YZGA 3TGLA 3B5EA 2XKKA 4YREA 3FVRA 3I0NA 1UP7A 4REMA 2PKXA 4AWBA 4XVCA 3E15A 1PFGA 2AJ8A 4LYEA 2PUFA 4YMHA 1MTOA 1U28A 5EZYB 5BR1A 2FK7A 1NVEA 5L45A 1EQ2A 3BXEA 2IS2A 1O77A 1WM1A 3FBGA 4N49A 3FTPA 4L0DA 3RAGA 4XTRA 5KYTA 2LIVA 1Z5WA 3CTPA 3UT5A 2DSTA 2GMWA 3ZJVA 2BHTA 4DCPA 2JAXA 4AP6A 5BQPA 2HDNB 1ORDA 1V41E 3AO0B 2QGZA 3QXCA 2FZ5A 1GCAA 4NAHA 4MZXA 4BV3A 2W22A 2Z3ZA 4EY8A 3ZDYB 3DBLA 4I6JA 1QQAA 2RHCA 2UV8A 3L8FA 4N7MA 1JLMA 2VTBA 1A50B 3BCSA 5TS2A 1DEHA 2GZRA 1Z0UA 4MGHA 3RS3A 1Z4MA 2J5BA 2JZCA 3Q9NA 3WGVA 5JH7A 4MS1B 4G37A 4WEOA 2RE8A 1K75A 3OOEA 1ZJ5A 3AUKA 3C14C 3ROKA 3WXBA 1QAQA 3GR6A 3UGJA 1D1SA 3ADCA 3SSOA 5A6VA 3FSJX 4UVIA 4DZRA 2CVZA 4E33A 2CFIA 3NH6A 3GMTA 4Z2AA 2B7LA 1KO1A 1GY8A 4LYDA 4UBOA 1NLFA 1W59A 2IHNA 2PPVA 1RRPA 2VSXA 3F8WA 2QRVA 3B78A 2C7RA 1T36A 5ALYA 4JGGA 3EIHA 2BBWA 2XCRB 5BQXA 2OY0A 1Y6ZA 2I7VA 4C4OA 4URFA 2ZUFA 4YO7A 1LJUA 5GADl 1E6MA 2WSBA 3ONVA 3VAYA 5DRYA 1PGQA 1RTTA 4REQB 4LCEA 1N2XA 3AJ9A 4IDAA 4LYFA 1ELOA 1V95A 1Z4KA 2Q50A 4A27A 4AMVA 5KQSA 1TTTA 1II0A 3A26A 4DDMA 4X3CA 3W6UA 4YCCA 3TZHA 3ZU2A 2QLMA 2WSIA 4AO8A 2NPOA 3HLYA 3QEMA 1VKHA 1ZOOA 3MLAA 4GPTA 4TS3A 3UKDA 2AOTB 4BEBA 4RD4A 2FZGA 2LIPA 3LQKA 3DAYA 3UUWA 5LP6A 2CJWB 3GA0A 4CKCB 4WW0A 3GEDA 4L02A 2V1XA 3OKFA 5DULA 3KHTA 5BV7A 4TZTA 5DF1A 3CURA 4PYKA 1QYRA 2PWPA 1YJBA 4J4TA 2ZAIA 4XM1A 3SC2A 3TZEA 2BW0A 1JXMA 4HRVA 3NIFB 2O1XA 5EXXA 4ZMRA 1JL3A 3IPRA 3PTAA 1DJQA 4QPCA 1DL5A 1KKUA 5AHXA 5DCWA 3HYCA 3ER9A 4E15A 1COWA 3RIHA 1A9SA 2D06A 4KGDA 5FPQA 5JMPA 3M9WA 4J90A 2VJMA 2NVWA 3VUFA 1GSOA 3OLCX 1YRHA 4BO6A 1UQRA 3EZXA 3DVAB 4L3OA 4MCHA 4PYRA 4CF4A 1KP2A 4CI0B 1BCSA 2GRJA 5BN5A 4DFDA 1K97A 4HN2A 3R7SA 3R3VA 1KIMA 5I4CA 3PNBA 1D6SA 4HLUA 1UBTS 1N32B 3DLCA 3GGCA 3NKLA 2PVCA 1WCV1 4KXXA 4NI5A 3SN6A 2H08A 1KDOA 3T5TA 4PSAA 1D5CA 2IS4A 2IYQA 2X14A 1F0YA 1E69A 4M0CA 3TZCA 3X43A 3GXOA 1I3OA 2PA0A 4WFKA 1XLTC 3CNHA 1GZSA 1MT3A 3EBPA 4IKPA 2CVPA 5B58T 1FDSA 4B75A 2ZIVB 1K5DA 3LSYA 2OSVA 3T9BA 3DL4A 4R9NA 3MEQA 5J5AA 1X74A 3ICEA 3EGCA 2HF7A 3PNKA 3J81A 3PG5A 2DH5A 3W3ZB 3ACDA 4ENPA 5BV8A 4Q1FA 3RAPR 2VJKA 1KQ3A 4MUNA 3HV0A 4CTKA 1G21E 2ZJZA 3HJRA 1LKZA 1GPH1 2ZSJA 5EPUA 5BYJA 1W6UA 4CM8A 3ABQB 1MAWA 4HEA6 1NUUA 3HNOA 4G6ZA 3TZKA 1V4VA 3IE1A 3UICA 4V3BA 2HLNA 1YAJA 2IBMA 3DTVD 4S3MA 4F5EA 3OFKA 1G2OA 1DTWB 1HFWA 3EIEA 5B64A 3CSDA 1IHXA 3PZRA 5TF4A 2WM8A 5CT6A 2I29A 3I1YA 1L7XA 4ZYUA 2ODBA 2PZFA 3L1JA 5JYBA 3FVWA 2X0KA 3Q0TA 2O8VA 4TWRA 1BCRB 3G17A 1FNBA 1U3UA 1CKEA 2ZSEA 3O8LA 4WT7A 2X8BA 3U40A 3JRWA 3NG1A 2GN8A 4YBZA 5DGIA 1SZCA 3PNMA 3VU1A 4PX9A 3R7WA 1PS9A 4NS1A 4UM9D 1KQGA 1N5OX 4C2AA 4RJLA 3L7YA 2ZYTX 3WNZA 4U39A 4AD8A 4AURA 5CB4F 3H18A 4NU0A 2R7LA 3S1AA 4BJ3A 3WL7A 1S3SA 2AI3A 1U94A 3ZH2A 4N0DA 2X5XA 3OPYI 5IAKA 2P9CA 2ABWA 4L4RA 3EXFB 1XGKA 1ZH2A 5AHKA 2QN3A 4KXLA 4LRXA 4C7OB 2HN9A 5DBHX 4D45A 1AB5A 3F1KA 4I99A 3QMWA 4DMCA 3RSOA 4C5AA 4JJIA 4CKBA 3OECA 2WWRA 3WGOA 3P2IA 4ND6A 5JY6A 3MGCA 1KO5A 1L7AA 3L01A 2IYOA 2Z2JA 2F90A 2CWWA 3CLTD 3HBMA 3M5DA 5DLQC 2PUVA 3VPFA 5J4LA 4E7OA 5BOSB 4IGIA 3GLQA 3PFBA 3F8SA 2BL4A 3WHPA 4B7UA 4W5QA 2JJ1A 2GD1O 2ZSAA 3Q5DA 2X1LA 3BUSA 4E3WA 4Q9HA 2ACKA 2J9FA 4R68A 4CTOA 1ZD2P 2I3GA 3LVFO 3PDJA 4P4GA 1OTXA 3FPLA 3WTCA 1F7UA 4L6AA 3TZLA 5KOJB 4D81A 4GIBA 1LEHA 4NQRA 2P0AA 5KX5F 3ER6A 4YP6A 3TIFA 3IOYA 2J0EA 2VDNB 3KJFA 4PU0A 1N0VC 2WZBA 4DSZA 1PR1A 2NTJA 3INTA 4DA7A 2IYLD 4R8KA 2NSJA 2PO7A 2R4TA 3DF7A 3H2ZA 5LWHA 1LVHA 2A0YA 4P4TA 3QVMA 1OBOA 1T9AA 4I6GA 4CF6A 4DABA 2FN4A 3SOPA 2EJBA 1MBZA 2G6TA 3RR2A 3GRCA 4NCXA 3ZLTA 4EI8A 8AT1A 1MFZA 4B8ZA 5ENVA 4JI4B 1T3HA 1EM8A 1ZM2A 3E23A 1TM3E 2IGBA 2M9MA 1ZITA 1K2WA 4QU8A 5C8VA 3GLFA 1HI9A 5EVCA 1ZR4A 1DBSA 4B34A 3DV0B 4GWLA 4QT4A 5A04A 1TKCA 1UJBA 1EBUA 3V4LA 3DE7X 2YWJA 2Y76A 4YALA 2IDKA 1BWPA 2G04A 4XWWA 1OXTA 2PCLA 1B41A 4TQUS 5AOAA 4WCFA 1OH5A 4OLAA 2VYNA 4GF5A 4LV8B 4KR2A 1CJTC 1NVTA 3DZFA 5DNWA 3SICE 1O54A 3QU7A 2PUDA 3WE7A 1P0FA 2WIDA 1J99A 4ZDWA 3ND6A 4BUJA 5JD6A 5JBNA 3AR2A 3AC0A 3PHHA 1LJ8A 1QOQB 2WV9A 3R6LA 4HDCA 1GGVA 4LHYA 2HOQA 3VZQA 1JR6A 2H2HA 2XH8A 2RB5A 1U81A 2HJ9A 3IEXA 3ON5A 4GBGA 4Q1BA 2R8OA 5JNSA 2B83A 3K6SA 2BONA 4L4SA 2C29D 4LRSB 4G5YA 4EY7A 3F7OA 2WMNB 1K3UB 2OBMA 2PX2A 3ICOA 4HWPA 3UK7A 5BVHB 4XWTA 3N39C 2P2ZA 2VHTA 2ECOA 3NBQA 3TX2A 3JZIA 1IJFA 3OQBA 5EIFA 4NK5A 4ZANA 2C9BA 3AONB 4J7AA 5TJ9A 4BMOB 4EO4A 2FPSA 3L6RA 1QFXA 3HDQA 3G5UA 1YXMA 1XTPA 4DLAA 1DAHA 4P3XA 2V7QD 3S81A 2PX3A 1CR4A 3OIGA 2X3FA 1ECCA 4Q03A 3JAKA 1J33A 4MWTA 2GH1A 3VO8A 3ZHRA 4MB2A 4BKUA 4L7VA 4HXEB 3N5KA 1N0IA 2A2ZA 2PV7A 1QHFA 3FUVA 1X8KA 1Z8FA 5FPHA 1SA0A 1XDDA 2CVHA 1KYXA 2O2DA 2PYIA 1IVSA 1CE8A 1U9IA 4ZYWA 3ADDA 1M5UA 3QI7A 1QANA 4ZOLF 2G9NA 3TNFA 5F5NA 3U4CA 4E12A 3KJHA 5BYAA 3C48A 1NZDA 3WGNA 3KVOA 5E9JA 3NHMA 3OU7A 5L40A 2D3WA 2XT6A 3UB4A 2VZ8A 2OGZA 1UBLS 1VE7A 2CXXA 1O03A 5FBLB 3FOEC 4JLDA 4D9MA 1O8BA 4XLTA 1ZD8A 1WHTB 5C52B 1VLVA 4W99A 3G9TA 2FQWA 2HA4A 2XHEA 1E4EB 1QCDA 1CVLA 3RIMA 4X92A 1I2DA 1RPJA 4XARA 3P4XA 3WGMA 1RQPA 1XDZA 1KXZA 3G0GA 4A4DA 5DHSA 3U5TA 2HQSA 2UVPA 4JEIA 4O4IF 1Y8RB 1IIBA 1QQBA 3DFFA 2QQGA 3FNFA 4JT2A 1UFQA 3ABZA 1KMHB 4G8DA 3SY8A 4AICA 1P60A 2GFIA 3F96A 1TCBA 2BUAA 2QXUA 2XMDA 3ZCQA 1Y7PA 2JA2A 2HWWA 4UQPA 3UJDA 5BVGA 4BB5A 1D0SA 3N6RA 5HJ7A 3MNFA 4XM2A 4AFNA 4ZYVA 4YGYA 3O8BA 4M0FA 2A1UB 2XE7A 3R40A 4BNWA 1GFZA 2O3RA 4CG2A 3KOOA 4K0RA 1KXJA 3FPCA 3FROA 1E0JA 4P4SA 2YJZA 1AQLA 2UUBB 2O7RA 4B8YA 2QG6A 1MW9X 5A7HA 3MJFA 5FWXB 3L7KA 1S1CA 1HDRA 4FDMA 3SKVA 1GO2A 3I3SR 3G8CA 1E5DA 1MNAA 1R18A 4B7AA 3C3DA 3EXG2 4BLRA 2XMRA 3OPMA 4LWPA 3W8NA 4YRFA 1I80A 1U1GA 1ENYA 3HBJA 4FNOA 3PIDA 4UCQA 1QWSA 5CCBA 2ZYVX 1AXEA 1KZYC 2R48A 3KZCA 3CNBA 1XRMA 3BA6A 3LDFA 2R96A 1TE2A 3NI2A 2AI2A 3PXXA 3UMVA 4DMRA 4Y6GB 1E9CA 1ZCFA 3G5TA 1C0LA 3B1WA 5B3KA 1UMCB 4O3FA 2W90A 2XCOA 1X0XA 3AUSA 2E4VA 2IT1A 5IAJA 1RC0A 3WGZA 3LK7A 3TLMA 3ASZA 4RPHA 1J4AA 1OGJA 2CJYA 5AKHA 2WT8A 3RD5A 1QPZA 4R40A 4R83A 4NBRA 2PLNA 1YD7A 2FJ0A 2J5RA 1F9AA 2J5KA 2CXNA 3EGWA 4L75A 1NE7A 3HJNA 1A76A 1XRQA 2VAPA 2X6TA 4ZCIA 2PDAA 5KWEA 4TKUA 4FX5A 2QIPA 1NR5A 1E63A 1I6MA 4GZLA 1IBCA 1R10A 1DQSA 4PSDA 4RJ2A 1XZMA 2JFNA 4MAMA 3G5LA 1K8ZB 3PWTA 4HWKA 3GD7A 3C6YA 2PA3A 3TLGA 4BNIA 1DU4A 1NVFA 4EI9A 4JD5A 4UFNA 1RCFA 2A0KA 4NESA 5FOXA 4ZDKA 1FP4B 2C97A 1EHYA 3RUCA 2ZU6A 1FNSA 3ZOKA 1TJNA 1BX1A 3UAZA 3EGIA 1I3MA 2R62A 1PG0A 1JNYA 1FSPA 4KYIB 1KO7A 3BTUA 1MX3A 2VXOA 2P30A 2FOIA 5C8YA 3LYLA 1RRKA 3RJZA 3ZHUA 3UJ3X 4C6RA 2DQZA 5JNWA 5KPDA 1O6BA 1S8OA 1A71A 3GT3A 4LMPA 2XGOA 1NX9A 3BCRA 3OIDA 1G8YA 1Z4QA 4OYLA 4Z7QB 2ANBA 4X71A 3CQ9A 3PXGA 4HYEA 1M2GA 3N59A 3DMDA 4J16A 4C5CA 1M0EA 1XVLA 4YQZA 5A2QA 1CY7A 2LCIA 3SS8A 4BV2A 1R8XA 3INNA 4GVLA 1V1JA 4IRMA 1WAMA 3AY3A 4ZAZA 2NYVA 2Z5LA 2RCYA 5J4HA 3TTTA 1JIQA 1O87A 1DAEA 1VCHA 3K5IA 1N2BA 3FGPA 4W9MC 3OX4A 4LI3X 4YMUA 3Q3IA 1E1NA 1CP3A 3AHHA 4WXRA 3A11A 3U81A 3L0DA 1QUFA 4RPKA 3RYIB 4TKZA 1QV7A 5DHAA 4RESA 5GWXA 1NTOA 2IPNA 5A9SA 3ZZMA 3QPAA 5LZ9A 1AKYA 1E62A 4YUVA 1UWLA 2JBWA 2V45A 3OF5A 1JFLA 1W6RA 1CX9B 2BAGA 4BBPA 4HVLA 1P2GA 3UFBA 2C5HA 221PA 1PTJC 3E9ZA 3GMDA 3JR3A 4QULA 2DUJA 1IN6A 1N5DA 2FPXA 4I9GA 4JITA 4BO2A 2C58A 2CUKA 1N9GA 4LEIA 1M8JA 2OCAA 2FVYA 5C3UA 3HY3A 4JSYA 3TB4A 1H1LA 4L1KA 4UE6A 4XKJA 4XI9A 3CCCA 2DT5A 2NTEA 4UQOA 3LL7A 3UYKA 1YFJA 3JQFA 5IC5A 3UVEA 4CM7A 3BORA 2VI5A 5EQDA 3KOWA 3ENQA 4ZGBA 1K4YA 3HU5A 5FAKA 5IBCA 5LQNA 1YVRA 2OQIA 1N6KA 3GAMA 4FTWA 5IUJC 1K8QA 3PGMA 1YB7A 4KR3A 1MABA 1IMOA 1TM4E 2WWWA 4HDOB 3SQNA 4HRYA 2FHSA 2DTDA 1XTZA 1H9BA 2FFBA 2AD5A 1V8ZA 1JHMA 2CMGA 2BH9A 2X0NA 1FSGA 4U5QA 1Q7CA 2QM3A 4M21A 2F6RA 1ISHA 3EXG1 4ND5A 3SEQA 5CFPA 1YB1A 3P2EA 4AJEA 2V96A 5JRDS 1YCGA 1QOPB 3QFRA 1OB5A 1RXSA 4QU9A 2X8JB 1GPLA 1KI3A 1Q21A 2ROQA 3Q3JB 3TXYA 1ADBA 1A96A 3S8MA 4O8CA 1GA6A 5REQA 3NEAA 1YZVA 5I3CA 3WYNA 1PKXA 5FWYA 1T2AA 5A05A 3ZWOA 4GDMA 4EO9A 5TLSA 1ZC3A 3DE2X 4B2IA 4YAFA 4CMJA 4F56A 2VDPB 4PX2A 4PSVA 3S2GA 5AVUA 4HLDA 5IDWA 1PDVA 4AG6A 2C7QA 1Z73A 4OYYA 4UAGA 3EEBA 4HBGA 2CK3D 2YHAA 4C2BA 2XI4A 4IOKA 4EY4A 2P9FA 3LFHA 4IX1A 1I1HA 5AD1A 3H86A 4HUQA 4MTLA 2H4YA 1Q1NA 1P4JA 3TWOA 3ID6C 5L51A 1Y63A 1XBTA 1Z0DA 3O4VA 5LUBA 4DUGD 3EEFA 2E6KA 1W34A 3HA3A 4FW9A 5AJTA 2ZITA 3I4LA 3QF4A 3EC1A 4TV9F 3UGQA 2O8BB 4D9KA 3D1VA 5IK2A 5AUQA 2X3UA 3NYIA 2HFJA 3O90A 3VDXA 5KWJA 1PCXA 1RYEA 1XDUA 1X7YA 2E1RA 3NGMA 2YX1A 4YRMA 5A4JA 3MTDA 1FYEA 1AMNA 2Q7DA 4D4IA 3WQBA 1S2LA 2OCGA 3ZQKA 3SMVA 2AMLA 3TRIA 2ZRHA 1O6FA 4KV9A 3M1IA 1CLUA 2NWQA 3RS4A 3NALA 1Q0UA 5HOEA 1E2GA 3EXIA 1BE0A 4TXHA 3WB1A 1E3MA 2ZIEA 4LJSA 3G85A 2XA9A 1K6IA 1NGSA 3B1YA 4DA0A 3CC8A 3BJZA 1HL7A 4P80A 2GFQA 1RM5A 5CT9A 1P2DA 2PNFA 2YASA 2ZK7A 3HCWA 3INYA 5DP1A 2ZQZA 4UULA 5CD1A 3HA7A 3PKJA 2WHQA 4ZWNA 1F8FA 2IZOA 2Q2NA 5ES3A 5JG7A 3WK9A 2IVZA 3TUJC 1BD3A 4CEIA 3KQVA 4MI6A 2ZPUA 3FLMA 3O8QA 1ZO8A 5IYZA 5DGTA 3NGLA 5LA6F 2PKEA 2FP3A 5CM9C 3AOEA 2B4YA 1XTJA 4BBJA 2PXXA 3H2HA 2XB2A 3GRVA 2VUHB 1HEUA 1K08A 5F52A 2VHZA 4ROTA 1T26A 4JP3A 4A0FA 2PE5A 1OH7A 1KTVA 1U63A 2QTVB 5CRIA 1RBYA 4KCGA 3S2FA 2IC5A 4R5HA 4CIBA 1UBHS 2GZHA 2EKLA 3PB3A 1L5KA 3RRXA 3L9XA 2ERYA 1ZOPA 4ETNA 1NW6A 1TW2A 1PFWA 2Q4TA 2QD5A 4GNKA 2QTFA 2HQOA 3E2PA 1XB2A 2FMUA 3WYAA 3NIGB 3GAZA 2ZXUA 2PVPA 5FTNA 5DSZA 3GYGA 2FFJA 3P0FA 4C6TB 5C3MA 3R74A 3ZBTA 2H1HA 1Q57A 3JR7A 3L3BA 4LOKA 1OFUA 2GYVA 1F17A 2QW0X 2ZG6A 4TRMA 5AKGA 3U3JA 1OLXB 2YOHA 1X1CA 3M1AA 5DKFA 5FJJA 1V71A 3STTA 3X2FA 2JAHA 3I1FA 3X3HA 4D9BA 3WIDA 2FFAA 4ER3A 1WDWB 2EARA 1CVRA 3VO1A 4DMKA 1UZNA 5KYXA 1E1QA 4IIVA 2LDBA 4OK3A 5L3QA 1IULA 3D1LA 2O4UX 2FU5C 4H0NA 1QGED 1X80B 1YFZA 5MN6A 2WUGA 2Z6AA 1XC7A 1UWVA 2LKDA 4R81A 4V1CI 1HT1E 2OHXA 3KQHA 1NQOA 2GTIA 2BLNA 4FD3A 4R0MA 5EMHA 2GF0A 4ZCRA 1KKMA 3ZW9A 2O8DB 1Z5PA 2A5JA 4IVPA 1KYTA 3I8XA 1UC9A 3KKNA 4FD2A 4I2NA 3ZJ4A 2H1IA 5BV2P 1TFUA 4RL4A 2B1JA 4P32A 1EX7A 2RGDA 1U80A 5ECYA 1HQYE 3AHDA 3M6FA 1QVAA 1CF9A 1QQTA 4DV7B 3LY5A 2BP7A 5TC4A 5KTPA 1L4FA 2W2NA 3G2OA 5JASA 3EXEA 4N39A 3GJZA 4RHXA 4A15A 4S1NA 1B8NA 2XBUA 3G5MA 2X2FA 1Q1GA 1FDUA 2DFDA 2EX1A 2HV9A 3I9LA 3PXDA 4LNAA 2XQVA 1JU9A 1P7ZA 1Z0SA 3CLHA 4MV9A 3UV6A 4RKEA 3UMCA 1K5HA 1QH1A 1RRMA 3GB9A 4QWWA 2BSXA 5KU7A 1HDIA 4WJZA 3A9WA 3V42A 3OWXA 4DSNA 4S05A 3WYBA 1TI7A 1TADA 2NUPB 2HCRA 3OVMA 4DV6B 2ZETA 5CA1F 4IQ0A 4X1KA 4A0HA 4IJKA 4RY2A 2JLVA 4U2GA 1Z7YA 4XWYA 4GI2A 5BUCA 4J9VA 4PN7A 1Z0FA 5JFTA 1PZFA 1XQ1A 1HEIA 2GHTA 2LCFA 2PY6A 4TUYB 3OQOA 5IM4A 3ADBA 4LBZA 2IYEA 3KZ1E 2BEKA 1APBA 2AGVA 3CLRD 5HVNA 1KE2A 4DQKA 1IM8A 6GPBA 3TO5A 4NCAA 4OYRA 4Y1RA 3IMGA 4HMPA 2A86A 4G86A 1B42A 4CL8A 4CMEA 1TF7A 1XVAA 2PRSA 2H57A 3HB7A 1L1FA 1E3JA 3IHTA 5AW0A 3BEDA 3QF7A 1N77A 1G63A 3PI6A 4MP3A 5H7XA 3N70A 5I7UA 2O7NA 3IGFA 1WKCA 2D0OB 1A5SB 2IIQA 4NR0A 2IEIA 1MC4A 2Y77A 1PV1A 4A0RA 3AHFA 1VI2A 3A58B 3EGDB 1X14A 2FRXA 3FOAA 4K7JA 4DCCA 3ORRA 1J0AA 1XHLA 2HBQA 2I3AA 1YTUA 1A9PA 2HKIA 3MMSA 3RKSA 4UFOA 4AY5A 1D6JA 1VRWA 3K0FA 1O95C 2NYRA 3I01M 4EHDA 1NVMB 3LQ4A 4ND3A 3D4IA 1OIVA 4FWIB 4DUPA 4QNRA 3ZQ6A 4PFSA 1P8JA 2B3DA 3AU9A 3ZZ0A 2LV8A 4A1FA 1F48A 3BKWA 5ICFA 4BOYA 3CPHA 2O06A 2QJOA 3QVLA 3U44B 2HW8A 1XQXA 2XODA 3BZBA 5I9LA 2X1VA 3EPRA 3MOSA 1E0DA 2YFKA 3OQ6A 1CUFA 2YNMC 3V5NA 2F17A 4ZQGA 1PTKA 2O7QA 3OU2A 1RP1A 4OHPA 3KYIB 2PS3A 3FTQA 3K8YA 1DBWA 2R00A 2WJ4A 3A9SA 3NORA 2SCUA 4DWWA 3C3PA 4GR5A 3KOUA 3RRNA 4DMUB 2BCJQ 1FNMA 1LVGA 4EYEA 4EY5A 1EYZA 1B6SA 1IB0A 4RJIA 2OKGA 3TAXA 4XA8A 2VQSA 2ZIXA 1FNDA 1RC1A 2JJ8A 2GHRA 3NHFA 4HYTA 1P2TA 1AF7A 1NOIA 2VAXA 3CEMA 4BEJA 4X6LA 5HDQA 3F7TA 4BVKA 1ZD9A 1C9NA 3KKPA 4RY9A 2GEUA 2SKDA 3EZFA 3WGYA 5K8IA 5KI6A 1UBGA 3AM4A 3FLBA 4IFTA 5I9BA 3EPKA 1UP4A 3OZGA 2QM0A 5COQA 5JD5A 4X90A 4N5HX 2Q2OA 4TXJA 1SB9A 1ZZEA 4JT9A 4GBED 4BN0A 4D8VA 3D3JA 4WNIA 2F1KA 1R1DA 2NZXA 3H11A 4BPRA 4EGQA 2VZ0A 1H3NA 1R4MB 2J3LA 4CMIB 4U7HA 1ZVMA 4Z8YA 1T9KA 4IHQA 5EUBA 3CZRA 5JVDA 1N75A 2I1QA 1RM0A 2V8OA 3FYHA 3K9QO 4LCJA 4MW0A 2B2XA 2G07A 4GC9A 2ZTHA 5EWMB 3SI7A 2YHIA 1XRJA 1Z0JA 2RI0A 3QHAA 1LF5A 3IOEA 5ALHA 1KAEA 4OBWA 4QXAA 3PFIA 4B43A 5E9AA 1RPZA 2WHXA 1CZUA 2XBLA 3QK7A 4ZFNA 4QVGA 1QB8A 4MUYA 3LQFA 2W2MA 1UDWA 4G5SA 1L5QA 3GEGA 1Z3CA 2H16A 3F78A 1NPTO 2IOHA 1N5JA 1TU0A 4FFMA 1P2UA 4HFNA 4PLVA 3SF8A 4P3PA 2Q07A 4BVBA 5H8WA 3I9JA 4CMBA 4TYYA 1OZHA 3DR5A 4J1NA 2JFVA 3IC5A 4GZ6A 5DHRA 2O8EA 1SXQA 4V0ME 4I1YA 1UFKA 5JCJA 5KNCA 1KEEB 3EK2A 4ND1A 4QECA 3IP8A 2W2LA 3BJIC 1YDFA 4WZ6A 1L4EA 3AB7A 4QHTA 3WWOA 3A06A 3WJAA 3I9V6 2CVFA 3DKKA 3LX6A 4EDFA 1CEQA 2CXQA 4IX9A 1M33A 1E2PA 4EZIA 5ALTA 4DA6A 4UOZA 1AQ6A 4MRMA 4YUAA 3LUKA 3M9XA 1OXVA 5DW3A 4DA4A 3IAFA 3L0ZA 2F64A 4IDHA 1GPKA 2WKQA 2AFIE 2CMHA 4U3JA 5AJXA 2GN4A 4YJ2A 3N3AC 3R41A 4PCVA 1TUGA 5EE3A 3WGQA 5AJZA 2BZGA 3KHUA 4EUNA 4V03A 3L40A 4NMLA 1JALA 4CNBA 5NLLA 2EKQA 4G5OA 4GWKA 2ZZNA 3TEJA 5JPCA 721PA 4I5IA 1KHHA 3IEVA 1ANKA 3KT0A 3LL4A 1FFGA 1G66A 4O25A 1XQ6A 4G1FA 3UJ9A 1KRHA 1U8EA 1JB1A 3FETA 2P2CA 3AF2A 1VIYA 1KR2A 2V74B 2WILA 5LM3A 1H8ED 1UOQA 2X8WA 5ULLA 1DIRA 2JATA 1RLOA 5KQMA 1U0NA 4N9QA 5G3ZA 4BAGA 3DE5X 3ZIDA 5ISMA 3KETA 3THSA 5CFQA 2P27A 4LJLA 2EZUA 3F98A 3UF0A 1ST2A 1Q7EA 5F9FA 2R2AA 3MQ2A 2J08A 3F90A 3M4JA 1OZGA 1RWOA 2QRQA 1DAFA 4OAQA 3BF7A 4QVKA 4GU5A 4TWZA 1I6KA 2RHMA 4UAJA 4NU8X 1I8TA 4MWEA 5B1SA 2RDMA 2RH9B 4MWDA 3B1VA 1FUEA 2FPPA 1YK0A 1V11B 4KIJA 3A6FA 3IIJA 4QQKA 5CLLA 1ZNZA 5I7EA 5IFLA 1E5XA 2VP0A 3I42A 3G0BA 1TLTA 2B34A 2UYOA 3L1UA 3TQOA 3C1OA 2GA8A 1F4VA 1G4UR 1ONOA 2K87A 2NU9A 3OFJA 3TSOA 1U8FO 3O2NA 5AM2A 4DIOA 3BMXA 1DINA 3LC0A 1QKKA 4WN9B 3ZWNA 4HGZA 3NC4A 4HDSA 4C7VA 3OQPA 2GK4A 4XM0A 4RYLA 1W9HA 1XK6A 3ICVA 4MSUA 2OUKA 4ZREA 1CY1A 3AWIA 3JAMA 3LPNA 2ODPA 4B3BA 5GINE 1QP7A 1BOFA 1KGSA 1TK2A 3OEWA 5H9WA 2Z6QA 3IEMA 3WLMA 1WEKA 1E2EA 2FW6A 2ONKA 3I04M 2YINC 4ZHQB 2VJLA 3LRTA 3T7KA 2W6QA 1GL6A 3LYAA 2Z8ZA 6ABPA 4YNBA 4KRGA 4DV0B 3NOXA 4YGXB 3EYWA 2VXBA 3G2NA 2GZMA 3PEEA 2ETXA 3G7SA 4EFNA 3AI7A 2C1ZA 2QQ5A 1Q0PA 5DBEX 1RRGA 2JJQA 3CVJA 3D0KA 3I72A 5LVAA 2JAWA 4B48A 3I2FA 2H17A 1RQ2A 4YRRA 1O08A 3H9EO 1ISSA 4BZPA 5BNWA 2OKCA 3FIJA 2VDKB 1T35A 4H60A 2CLOB 4WIAA 4WFJA 3GDFA 5EGSA 3CKKA 3PLAE 4TQAA 4YJGB 1NFFA 2OGTA 3QA9A 3U1VA 1F8YA 1OYYA 2OFPA 1YAHA 2QRLA 3F6RA 4E03A 1ZA1A 4Z8XA 13PKA 2CSXA 3WKCA 4CYMA 5J40A 3R24A 3O0DA 5BSEA 5IJ9B 4G5RA 5FTMA 1U2PA 3PNOA 4I4TB 1G41A 2MJLA 1EZ4A 3FMOB 4RLHA 4YH1A 1M34E 1DKOA 3FKJA 1OAOC 1MR3F 4ZT3A 3OUTA 3Q3EA 4U7DA 3TN7A 1BEEA 1F6WA 1PUIA 4TLAA 1UR5A 3W90A 1TECE 1NQXA 3SZMA 1LK7A 4FM9A 3L1IA 1ZP6A 4KVZA 1BAPA 4C7KA 3D4NA 5T6BA 3SJUA 4BECA 5BWOA 1K8YB 3LAWA 3LLUA 1MJHA 5A9RA 2W43A 3DQQA 4Q9AA 1OTYA 1KI2A 1CJUC 4OAPA 3DBRB 1NN1A 4TN5A 4G81A 3LBHA 3WX0A 4KFTA 5ADUS 2OOKA 1QHHA 2HYIC 3CE6A 3KJQA 2F43A 1H2AS 4OU5A 1ESNA 2FX2A 3L6EA 2AYXA 1P1RA 1Q44A 2WHRA 4NWIA 4OHXA 3VPAA 2EKBA 4F91B 4OQDA 1NLYA 2I5PO 1IWOA 5HKBA 3P20A 2OL4A 2XIJA 3DNPA 4L5IA 4ER6A 1L4GA 2AHOA 4I7EA 1QH0A 4FWTA 1W4CA 2RGRA 2PIDA 1AUPA 1T0IA 4F46A 3SIRA 1SC6A 3NTLA 4RF2A 1JPVA 3C85A 3KZOA 3WA6A 1C7QA 1F60A 1TKAA 2DPHA 2FUEA 3GFTA 2VR1A 1W85A 4WKNA 3UMRA 4INAA 4NZPA 3IO3A 3X1WA 1VLMA 1YH3A 5HQ3A 1AKMA 2VF4X 1PGPA 4KREA 3GNQA 1U0OC 1J8DA 1E7RA 1V8FA 4QHYA 5CJPA 5JLAA 4BL5A 4NOLA 4M89A 2F8MA 4ECAA 4NBKA 3PQ4A 5TT1A 1J56A 4RD1A 2B9VA 3TUIC 5I5GA 4HDMB 2PBLA 3GA5A 3JQBA 3TKLA 3RASA 4F8EA 2O2YA 2VFAA 3Q98A 4XIYA 5ALIA 2GNOA 1SUCA 5AR1A 3RLIA 3M4NA 4OJYA 1G5IA 1I5EA 1RLUA 2AG5A 3CH6A 3DEFA 4RSHA 1X9HA 5AVWA 3TR6A 1T0JB 3RVRA 1JKJB 4Q3LA 4FFBA 4DSAA 5A6SA 3WQHA 2IOFA 2IVFA 1JLSA 3LBNA 3LNTA 3MTQA 1B1CA 2VSQA 1WDKA 2QX9A 2JC3A 1NF2A 4HNRA 1QK5A 3OC0A 3M70A 3ZHOA 4CQNA 5AP9A 1ZU4A 1DFGA 3O91A 3THYA 4LNUA 4RF3A 3GJQA 1NUPA 1PT8A 1YGPA 4K5QA 1LLCA 2DCUA 1CQIB 3T5BA 1T8PA 1TM7E 1Y6JA 4GXNA 3GRAA 4IOMA 3OM0A 2BJWA 2QTBA 2ZJ8A 1FY2A 2DH6A 3C5WP 1OX4B 2JJ2D 3EMKA 4EQ6B 2NIPA 2XYVA 1VMAA 4KKVA 3HZZA 1M2HA 4ZCMA 3WQSB 3IT0A 5B1IA 3FWHA 3TH5A 5KKCA 4OHKA 1PW5A 5F3DA 2XOEA 3GLVA 3MYRA 4MW9A 4MRSA 3IDQA 4HDKB 1FK8A 1Z35A 4JOCA 1ABEA 2OOSA 2NYAA 1PGNA 4YCAA 4R98A 3UJBA 3AUXA 4DJTA 3L8HA 1U7OA 4CN9A 2PT5A 2WSSD 3K5WA 1ZNXA 1QZZA 3T7RA 4YY3B 3DLHA 3K73O 5CLIA 5DEOA 5E0OA 2IDZA 1MC5A 4MDHA 3KYBA 1WETA 5T67A 3CNLA 4CG1A 1EDDA 3KPWA 5JZBA 4HNGA 1MP0A 1RM4A 2W2XA 3C6KA 1VC2A 4OQ4A 1PRYA 1QCCA 2QLLA 3K1AA 4KIGA 5CDGA 5DP2A 4JT4A 3GLIB 4PYNA 4WE3A 2RAFA 1DT5A 3RTCA 2PJRA 2COKA 1XHEA 2IUUA 2REOA 4OLHA 3ZWXA 3V8NA 1KK3A 1XZCA 2DR3A 5EQTA 4CI9A 2W2TA 3HEBA 2FF5A 2XF2A 1QQ6A 1HFKA 2JJMA 5JWRA 3CCFA 1H23A 1E3TA 4IUCS 1N2CA 1VE9A 4DR6B 2DVMA 3TCKA 3QHPA 3D43A 1IZ8A 3PS9A 3NKVA 4FR0A 1P81A 3DWGA 3OZTA 4XB1A 5ALQA 4MEJA 1GGKA 1C29B 1ZINA 2RI1A 4LJKA 1KQNA 2BOVA 4BJ5A 4ND8A 4BQEA 3RAJA 1BVUA 1DEXA 1SQ6A 1XEAA 1AV6A 1TYCA 1WU8A 1ZC4A 1MV5A 2C03A 2HRZA 4IIJA 4JNCA 3EEIA 4CNQA 3UBMA 4CV0A 2EX0A 2O2CA 2R8RA 1EP9A 1OC2A 2D4HA 1RCTE 2VRBA 4GOND 4XSHA 3SR3A 1U9CA 3V3KA 2BJHA 4KB5A 4D3DA 1GVNB 2AIRA 2YMMA 4P31A 1OYWA 1E7QA 2ISCA 3CPJB 3EH2A 4QUDA 1C14A 4OLFA 4DZZA 2UZAA 5JEDA 3MTIA 3VVCA 4M22A 2QV0A 4IWYA 5E7MA 3LOUA 3C41J 2QTHA 2QN6A 3ILHA 3MQ4A 4KBFA 4QDUA 1A95A 2Z5VA 1J42A 3AKCA 1DXOA 3I05A 1IBLB 4CF3A 2VP9A 3SHTA 1GTSA 3CH4B 3PD1A 3BRSA 1YZGA 1GAXA 1DC6A 1FLDA 1N7HA 1OQAA 3FF1A 4EG6A 3WMFA 1C3VA 3OX1A 4ERNA 5KTRA 4MJXA 1HXHA 2ZS8A 5ALNA 3BZWA 1EG7A 3D2BA 4PG6A 3IP6A 5TR9A 1H94A 4F84A 2FXVA 3WBJA 4FYIA 4KAFA 4YLGA 3CF6R 3SVLA 4MW5A 3WIBA 1BG6A 1CHDA 1MAAA 1TK9A 3AESB 3OCVA 4GC5A 1NUTA 4KLCA 4F45A 4X3OA 1H2BA 3J81k 3IQXA 3NV7A 4HEHA 1JLLA 3UN1A 2QG9A 3EQ6A 3IOMA 4DSUA 1M8KA 2ZB7A 3GRPA 2JFGA 3NHKA 3QKUA 1P7WA 1KI1A 4KE6A 5JE8A 2J3QA 3AG5A 1JTFA 5ICCA 3TYXA 2I3BA 2QQEA 3OZAA 3KZKA 1XVTA 2AG8A 3W6PA 1Z88A 1PS0A 3DTVA 2FUG6 3ZW7A 4R2XA 5FUMA 1RNLA 2WD8A 3KD2A 4H7IA 5M3BA 3ZDQA 5KOHA 3H4MA 1PNVA 6PFKA 5KJCA 2AFHE 4OB7A 3M82A 3SIXA 2IODA 5EIOA 3ZDFA 3PFKA 3QXHA 4HWRA 2JHAA 1RWBA 1C3OA 4Q1AA 4MVXA 3RU7A 3PQ3A 4JUBA 3P32A 1BH6A 4FSHA 2BGLA 1FPQA 5FF9A 1QK3A 3LUHA 1R4NB 3KB6A 1LD3A 4FWBA 4GKAA 4UHBA 1BXKA 1FFXB 2GO7A 2I1WA 5EEGA 4MDEA 3MCVA 5JNUA 2L82A 1AKUA 1ISPA 2WMDA 4AJLA 1GPAA 3A9RA 4GEGA 2EFCB 5D3MA 4B3SB 3RJ5A 2FW9A 2GETA 3EZYA 3M2PA 5K1ZA 5J2UA 1B0AA 2Q3EA 3FSGD 4UPDA 3S2SA 1OF1A 1RZUA 1NOKA 2R6HA 2ZJFA 3RU9A 1AKRA 2RHOA 4Y2GA 3N5CA 2V65A 3AERB 4IYRA 4MMXB 1RLTA 3CF4G 3G88A 3B5JA 2HZ7A 3UG6A 4IDOA 1E3EA 3N2GB 3DUFA 4D6YA 1XZKA 1PL7A 1JAIA 1P9RA 4C0QC 2I65A 2HXGA 2B37A 4LYYA 4WQMA 3GUZA 3JD4A 3QLJA 5CURA 4RGQA 4LMAA 4U0KA 3W3AH 4D6PA 4EOGA 1G42A 4OJNA 5L4NA 2SNIE 3FUUA 4D80A 4AMBA 2RCNA 1MOQA 3CZMA 3OIVA 1XNRB 1FX0A 3HDHA 5BWBA 3PXUA 1U8AA 1H6AA 1F51E 3QLVA 3DKRA 4MQEB 3THXB 2I62A 1NAIA 1ZK3A 3FH0A 3Q3GE 4PG7A 1J5XA 1LDEA 1KDTA 3CKMA 3OEED 4FLEA 1PUXA 1VA5A 1QYIA 2WAOA 3H83A 3QY0A 1RXCA 1YUNA 4P3KA 3QKWA 4K3UA 1NM5C 2R1ZA 4RTRA 2F59A 1TZMA 3D2CA 4HTFA 2R1TA 1MIHA 2XTNA 2Y68A 1SCQA 2B2NA 1RMTA 2K7ZA 4KZPA 5CHYA 3OFVA 4OQZA 3GT0A 2ZJ1A 3VV3A 2P40A 2P6MA 2P2LA 4ODIA 1GAJA 5C51B 4HQ6A 5CDSA 4U6NA 1V5GA 5JRJA 4B6RA 3BCUA 1VTKA 4FJ1A 7YASA 1WXIA 3OQVA 4TYPA 3MT7A 3C45A 1CUXA 1L5HA 3WL5A 1N2ZA 1S1MA 1VA4A 2VPZA 1D4FA 1IE3A 1UEJA 1AK9A 3GCDA 3UH0A 2NOAA 1F5SA 5EL0A 3DLIA 4ZICA 1QP8A 2DBZA 2GLXA 2X22A 5KQLA 1JEOA 2WNIA 3C8ZA 4I8IA 4ON9A 5JCOA 3CUKA 4MQFB 4BMDA 5B2FA 5CPFA 2DU8A 1M6HA 2ODNA 2P5TB 4CKWB 5KC9A 2RD2A 1BWRA 3VR4A 1NXPA 3ET4A 1C3XA 5GGXA 4L9RA 4MQ4A 4AF8A 4CLRB 3ANLA 5NULA 3OZEA 3ENNA 4I1SA 4LJAA 4QRHA 4QM7A 1TLLA 1YB5A 5JH7F 4AG5A 3QWBA 4L3VA 3AEQB 5EJ5A 3PGJA 1G9XA 1J70A 4CV1A 5JT1A 1JXOA 5EJMA 2H9IA 3OZFA 4JHLA 4RSMA 1RS0A 3PEFA 2QTWB 1XZIA 2C96A 2YYYA 5DT9A 2HRQA 5IWAB 3EW9A 2O8FB 4LWZA 1KZHA 2MTBA 1YZ3A 3PGKA 4IYJA 4N9WA 4Q82A 2Q5HA 4UMVA 1XZLA 1P74A 5GPBA 3WR5A 4FFWA 3W5AA 4JBYA 3HZHA 3U7HB 2DR0A 1M5TA 4RLSA 1SXJB 4P7BA 3IBCA 1IXZA 2V7QA 1GQYA 3K0KA 4MVWA 3AP1A 3G8YA 1V8BA 2F4NA 3O95A 2FLKA 3Q7EA 2AZMA 3QELA 4JB8A 3ZWCA 4EA6A 3K6JA 3RNOA 1CY4A 1K7FB 1E18A 1VE3A 2CD9A 2Y2UA 1ML3A 2REXB 3AUFA 3CWZA 4WESA 1SUFA 5I51A 2HT1A 2ADMA 1EFCA 1U8YA 3AUYA 4OSEA 3QRWA 3SD7A 3HXPA 3VH3A 5FLXA 2NN3C 3SHFA 1DWQA 2Z04A 2BI8A 3CINA 3D6VA 3L8EA 4M46A 1OLOA 2A9KA 2WJ6A 3RU2A 4TYNA 4ZQCB 5AW1A 2DJ5A 1M54A 1HTBA 1O97D 3KWJA 4DC9A 1KAHA 1M1YA 2C5EA 4ZHSA 5LP6F 1WMFA 3VHQA 4UOEA 4G4GA 3EEOA 2LKCA 1MEOA 4HB2A 4R8MA 1XZPA 2NXJA 2QSZA 1GL7A 3BA1A 1K0FA 1TFRA 4FJ0A 4C4SA 1LDBA 1V16A 1XCGB 5K8VA 2JHCA 3U61B 4AJHA 4LC1A 5CFZA 3DWFA 1EFPA 1H2ZA 2VLIA 1U3VA 2VPQA 1EJ2A 2VZ9A 3QV2A 4OF4A 3UWPA 1A9YA 2IZZA 4PQGA 2JG3A 4A8HA 3I92A 3DZHA 1J0BA 2D59A 2IA5A 1QBKC 3CGWA 4JC4A 3RANA 1EP2B 4EJSA 5LNK6 3U6BA 3V8PA 5HEKA 4NYMQ 1IU9A 5G0VA 1T0PA 1ETHA 1N8NA 1G21B 2WUFA 4KXUA 3JYPA 3QWFA 4S2UA 4W7IA 2FGKA 3LHDA 1MVNA 1VYUA 4OY3A 4XH9B 5ILQA 2CHGA 2DQKA 3S28A 2D00A 3KYCB 5IU6A 1SURA 3NM6B 4PYMA 3GIWA 2BMVA 3TB6A 5F2NA 1BXRA 3QUAA 1RJ9B 2BF4A 3H97A 4JP8A 1HTWA 1QRUA 1SKUA 1Q7TA 1P19A 5GIPE 1ULBA 2C78A 3GRKA 1CY2A 2ZRKA 3ONNA 5DRTA 1F6DA 1OXBB 1C1HA 1N57A 1VM6A 2H92A 2MDTA 2VDWA 2ZB8A 3KALA 3RCBA 2HREA 2QE7D 2ZXFA 3RYHB 3WTBA 2O8CB 2CNLA 1EZ1A 2D1RA 2F9MA 3G8AA 3WIVA 1ZXBA 2UZIR 4QJ5A 1WNFA 4FGUA 1OLSB 3EZ7A 3FHJA 2EF1A 4U5XA 4RNCA 3GFVA 3Q3CA 3P0HA 3VAAA 1XZBA 5JI2E 1X70A 1UBFA 3BTVA 1QIKA 3E9CA 2BKLA 2EV9A 2GR9A 3NO4A 1ZN7A 3PXAA 1KVQA 2AUMA 3B3JA 4KUEA 4MV3A 2E3JA 3P8ZA 3TZQA 4BO5A 1SGWA 3T15A 1VG8A 3QVSA 1GM5A 3GDWA 2HT6A 1YE5A 3RC9A 5LKAA 2YJ3A 3N76A 3PT5A 3QJ5A 2W2PA 5K3BA 1GSIA 3RS5A 3A05A 2KMLA 3JX9A 1FP7A 3VOSA 5CB0A 2OV1A 4TKLA 3ACBA 4EBBA 1OFVA 2VG8A 4KWIA 5BN4B 5D3ZA 2IGTA 1THTA 4MCAA 1R6BX 1L8QA 1JSZA 1N1MA 1X39A 2PQ6A 3H8WA 3LUCA 4O4LB 3T1NA 4CT4B 5SZIA 2H3HA 5KNDH 1EVZA 3BX1A 1H66A 4RTLA 3VJRA 2Q3BA 4EHKA 1VGQA 1TVMA 3JQGB 2GUGA 3O8OB 2Z09A 4IFEA 1TF2A 4JEUA 4M0DA 4DF3A 5B4UA 4Q4JB 4YP1A 5A02A 4IDNA 2VP6A 1NY5A 3MG9A 1PJZA 2VJYA 4BGEA 3Q5EA 3QLUA 1C0KA 2B99A 2EWMA 1R0LA 4BDSA 1TXGA 1US8B 4IDEA 2QQFA 3OHPA 2I9PA 1QS0B 1A97A 3AHEA 1KQOA 5DMXA 1KMIY 2BFFB 4M60A 2QBYB 4CEHA 3ZCRA 4KRXA 5LDGA 1T2UA 1JR3D 4U2KA 1I0IA 3M6VA 3P9ZA 5KNBH 5SZKB 1SVLA 3WQRA 3HRHA 4OX9B 1OFHA 1IUNA 3FRHA 4CCYA 3V4RA 1RWMA 1L3CA 3KOZA 3WZMA 4YRGA 5ED4A 2UVQA 4QUIA 8ADHA 4WA8A 4J3FA 4LF5B 1P1KA 4J0JA 1NU6A 2M98A 2X5NA 4NZYA 2RGCA 5FPTA 3UMFA 1F3OA 1IOWA 2QVLA 3PL1A 4RFSB 3R0VA 4D4HA 5T8KA 1NONA 4D2IA 5KKAA 2HDWA 4NEHB 4RL6A 5THXA 3QPBA 3CSUA 2Q49A 5B3JC 1N3LA 2X76A 3NOVA 3VSBA 1YI0A 2VDQB 2YHSA 4K87A 5FFMA 4RZUA 1LS6A 3ROFA 1EDBA 1NBMD 3HU2A 5HP4A 3IKLA 4XWAA 1UODA 4P7FA 3C8MA 4HDRB 3R9IA 1Z15A 4Z1MD 2FW8A 1CR0A 4EHHA 1Q1BA 4GR4A 4CQJA 2QRZA 1IHUA 2DLDA 5PGMA 4OG2A 2XIQA 3DMTC 1YE8A 1ACMA 4R1OA 3U80A 4B4KA 3UMYA 1XALA 1AUVA 1H5NA 4Y2PA 1GUAA 1ZY2A 2Y4OA 2AZXA 1QCZA 2OV6A 4L2IA 4ETMA 1CC1S 2I55A 2QUHA 1DBQA 1TO2E 2HNBA 4EW2A 2GPNA 3A70A 4OFWA 3KC2A 4DNQA 4FHFA 4Q34A 1SQ0A 3SFVA 1KS9A 2AW5A 4I3GA 1JKFA 2AN1A 2GD0A 4Y2UA 2O3SA 3KJGA 5B1DA 1VL0A 1TCAA 1YFKA 4I14A 4OUDB 4RAQA 1GZ5A 1VPTA 4TL8A 2TS1A 4MVJH 2G1AA 4U2EA 3TW4A 4B2PA 4EFKA 1C50A 1ABFA 1S9HA 2HMWA 3HJGA 2XXAA 4OQFA 1JIVA 4CIVA 2WWYA 3T7TA 4Z4GA 3FDZB 2IXBA 3CF2A 3Q7PA 4PLTA 1Q2XA 2EFGA 4GO1A 3AFMA 5BT9A 1BA2A 4M8IA 3ICQB 2AC2A 1HQCA 3O9MA 4I5DA 3WADA 1KBOA 3I73A 3RADC 2QTRA 2HSJA 1I7LA 4EHAA 1E2UA 3W9BA 2HK9A 1PKEA 5K0SA 1WXEA 1WCWA 2WF7A 5KCZA 2WWIA 4NJEA 4KMSA 1BXGA 5KYGA 4NEQA 3GELA 2ZJ0A 4M7OA 4IG4A 5ALWA 1SAYA 1VL5A 2VDJA 3GFSA 4JR1A 3MTJA 3FR8A 1HPLA 4XWGA 5B55A 5LPNA 2YL2A 3P9YA 2AOWA 4PZDA 4V0LA 4PGHA 1W2HA 3T7SA 3PCTA 1ENZA 3JWGA 1LA2A 1FMJA 3NYWA 4OYHA 3CJRA 4KNYA 6ADHA 5KSYA 1A1SA 4BMYA 2W6MA 3MK31 4MARA 3IJRA 2QAGA 4L4YA 2BFBB 2G4LA 3W2EA 4IO0A 4K26A 4G07A 4G4SP 4KQMA 3PYXA 5DX1A 4JXXA 3NBMA 3H2GA 1CY8A 2CK3A 4AZ0B 2Y3IA 3OZ7A 4PS0A 3QYPA 4IDPA 1DX4A 5E7JA 3W04A 4J0KA 3RRFA 1NUQA 3PHBE 4II3A 5L53A 3UOGA 1G9SA 5LJIA 4DUGA 2PRZA 2GEBA 4I3HA 3VHRA 4DADA 5ES4B 1AGRA 1DBRA 4YT8A 2XUIA 1BVYF 4IDGA 2JCSA 2OZLA 4P5EA 3O4GA 3OQ1A 1AURA 2Z2ZA 1SQFA 2UYHA 4P5DA 5BV1A 1ZN8A 4EO7A 4PGFA 1SC3A 3T4PA 3W7VA 5A4MS 3FNHA 121PA 1N5IA 2Z6VA 4CCWA 2PWAA 2WTAA 4CG3A 3WNDA 4DLYA 2W2KA 3LGSA 1ZRMA 4RULA 4N01A 4YDHB 1ZVQA 4UHHA 4JKOA 4CWAA 1M6YA 1Z0AA 4M1TA 3X1MA 4D9CA 5JSHA 1J8QA 4ZVPA 3ER8A 1XL1A 5J58A 3DTNA 4RD0A 4Z4FA 3H87A 1FP2A 1REQA 4XIIA 4D6XA 3VMMA 2R7MA 4DQUA 2H1CA 3IBSA 1Z68A 2OCKA 3T06B 1S4MA 3QNWA 4NONA 4ZOCA 2B8NA 3N7TA 5H9VA 1TAQA 3T5DA 5FR2A 1G5QA 1NNEA 4CM1A 4LXXA 5FADA 2VWHA 3FLEA 4BX2A 3EB9A 3GL9A 4YI5A 4PNHA 4E22A 1Z37A 3GLHB 5E6SB 1S2NA 1C8BA 1U65A 3E1GA 4HATA 1IN1A 1YQEA 4IS3A 2B4KA 3BOSA 5E4JA 2GNPA 3PFHA 4X64B 4AN0A 2O2HA 2IEZA 2YVAA 4AY2A 4TLEA 2J3KA 4E2ZA 3IXLA 3K0AA 4DYDA 1IQ0A 5I4IA 2MSEB 3MFQA 3IFSA 1KI6B 4Q1EA 3W8DA 3CYFA 4LJ4A 2OEPA 3K1YA 1OH8A 3K6SB 2N9UA 2ZBRA 3EISA 4Q4LA 1NJ5A 1J2EA 2XD4A 4RADA 2O4CA 2KHZA 1WMDA 3V7NA 1FSSA 4UMDA 5KNLA 3AFOA 3FPHA 5EI5A 1G20E 3OJEA 3ZE2B 2EU8A 3N8NA 2I2DA 5T41A 3KR1A 2ALJA 2NXEA 1A9QA 1F8UA 2Y4NA 3CUVA 4PIVA 3HB9A 1D04A 3FTCA 4ZRMA 3ZV6A 3NTXA 4BUCA 1DQZA 1RPNA 1E8NA 3K8OE 3L7JA 3LWBA 4MV5A 1NW4A 1B8OA 3W7AA 3FDIA 4Q5IA 1HMYA 1EGQA 3V7WA 1RD4A 4DXAA 1UQTA 1Z08A 2Z58A 2MYTA 5BWNA 1RYFA 3P27A 4F4HA 3ZBQA 2D7DA 3SJCA 3KXIA 1HDCA 1F0PA 3LX8A 4JQZA 1JT9A 1CCWA 2C3PA 3C3EA 3B38A 3FHOA 3PDCA 4PYIA 3SIPA 3SM9A 3X44A 2AYZA 1T5SA 2X40A 5CA0A 2Y0BA 3NNNA 3O31A 4J0GA 3RUDA 4Y2HA 2V6BA 4MV4A 2F55A 1VB3A 3V4OA 2G0TA 4MR9B 4Q18A 4BNXA 1AVTA 4B74A 2B7BA 2QA5A 4ISCA 1A72A 2OB1A 4MWGA 4RACA 1UBJS 2WFZA 2WTNA 3AM3A 4BNVA 1U2ZA 1DTEA 4QPNA 4AY4A 5HYVA 3ITEA 5EUMA 2YICA 1AN9A 3HKEB 1R9GA 4BLUA 4BCBA 4EEKA 4B17A 4KOAA 5BURA 3WRXC 3CKLA 1O5IA 4KK4A 5BMVB 4C0JA 5L3VA 5HF6A 2VRNA 3LKVA 2OZVA 3R3HA 3DEHA 4GKBA 3WISA 5C8YF 5CG2A 4ZTZB 3LC7O 4U8HA 1U0FA 1QYXA 2NQ2C 4IGFA 4GS5A 4YIKA 4DCSA 1NDHA 5B1EA 1XYVA 4UQLA 3PC2A 3FTEA 1Z7WA 5T4EA 2ZBFA 5A2GA 2VP2A 2OWEA 1XEXA 2FX5A 2ON6A 3O3OB 2JH3A 3HHPA 4D46A 3BPSA 2CFSA 3MWEA 3N2KB 3T9AA 2R8ZA 3TLCA 2QRKA 3OP4A 4AS2A 9LDTA 1M1UA 4QGHA 2D1TA 5FEMA 3GLFE 2HHHB 4JBIA 2WJWA 3ZWDA 1F0KA 4RE6A 1ZH6A 1XR3A 4MR8A 1R0ZA 3GPLA 1UM8A 2P91A 4DC0A 2GGSA 4EGAA 3A0UA 4DL9A 5MN5A 2D1SA 3BWVA 3AVUA 1N4DA 3ESDA 4PZZA 3R3WA 1P4RA 1H1TA 5JDCA 2I80A 4OIMA 5DJ5A 2Q1UA 1KARA 2QP3A 3DT9A 3K8QA 4NE2A 3K53A 4ZEOA 2VA8A 2DERA 4JI2B 1YQXA 1J8VA 1RIIA 2VCYA 1TM2A 3DOIA 1T6XA 3P2MA 2WOOA 3S27A 1ECFA 2OVBA 5AHOA 2PS9A 3JD3A 4LYGA 1GNTA 4DNOA 1OMOA 1E7WA 5KQPA 4FE7A 5CDUA 4EFDA 1GNRA 4M9UA 1YS7A 3W5JA 1FFAA 2OLEA 2KQUA 2HF8A 3WICA 1T0BA 3S4YA 5AM4A 1UMDA 2FMFA 3RYCA 5C34B 4KPYA 3R9KA 2EDCA 3BRQA 2D54A 2V5VA 1WPQA 3P5BA 3Q7QA 4PXYA 4AUNA 1W581 4EG4A 4BFLA 1IPFA 1JR4A 3H9CA 1HDOA 3TQHA 2BBOA 2JW5A 2FDRA 2DHEA 3W7BA 4GGMX 1QIEA 4EG7A 2CXUA 3K9NA 1SUAA 4BIIA 1FVXA 4IMRA 3SEZA 5F7ZA 1SVUA 4AMUA 1SOWA 2IIBA 3PUIA 4N6OA 4HZUB 4BASA 4B80A 5IX8A 4D7AA 2WT4A 4R2JA 3DPSA 3EA4A 3KL4A 4ZOQI 2J4CA 3LVRE 3LT1A 2ZAGA 4Q6BA 3OWOA 3EVNA 5F23A 3A4YA 3EQ8A 1K4MA 2V58A 3KBOA 3KOMA 3NBAA 1K5PA 2RKBA 4KLNA 3RRZA 4DCUA 2DOKA 1D2RA 3O4JA 5DXAA 1Z5OA 4OXQA 5AOBA 1YS2X 2OAQ1 3LKBA 4Y30A 3AR6A 4YJHB 1Z25A 2EKPA 2JFPA 3CF0A 4LZWA 5MFPA 1UIMA 2REQA 4FU0A 4KQXA 1EUCA 4ENSA 2ZBEA 3IODA 2ZBQA 2J7KA 2YW9A 3UGTA 4V38A 3BGDA 4LHXA 4JI1B 4B9EA 4KVAA 4QO7A 4FVTA 5CK5A 4E46A 4Z7JA 4O4HA 3Q1LA 3GLSA 1N6OA 3UAVA 3VTZA 3DONA 4OXYA 3FBTA 3AP3A 4C0BA 5DBIA 3OZIA 5JRZA 3OCWA 4B2YA 2J0SA 2PJDA 5ILGA 2W8ZA 4BB6A 1T8TA 3N2ZB 3HBAA 1UPCA 5DN6D 4L78A 3SEAA 5LKRA 5AKEA 4S2EA 1X1EA 4K8RB 5U4XA 1JA9A 3R3YA 4Z4HA 1RWPA 1UK7A 2FWJA 5C5CA 2BHLA 2J3EA 4PEVA 3OTWA 5EHQA 3H75A 1RYZA 3B6ZA 3QBJA 1MW8X 1Q2UA 3A1CA 4BXOB 1ZJWA 2HAEA 1VLLA 2ZJ7A 3ZV4A 4Q37A 2J6HA 4W5TA 1U8CB 2BGUA 3PPXA 4RIEA 5LMUB 2PXAA 4ZU3A 3SQWA 4A6XA 4NAUA 4C4PA 3VPSA 1FW6A 3ZQJA 3T12A 4INPA 4F6RB 5E6RA 4YJFA 2WHPA 3SG0A 3V8BA 1J1ZA 5BNFA 5FPYA 2FWIA 1D09A 3QMPA 4U4AA 2FG6C 3QJGA 2Q3DA 3IPXA 3ZE6A 4U1RA 3VU9A 4CPDA 3TMKA 1E96A 1H4VB 1SIOA 1BRMA 2Y92A 5TGTA 3U26A 1YDGA 3KSMA 4CODB 4PZAA 1C7IA 3CH7A 3MJHA 1PJCA 1LPSA 1GV1A 4PTYA 3RGWS 1I2ZA 5JI3E 2UUAB 1E89A 5IYZF 3NONA 1M7BA 1O6GA 1Q0HA 2ZRQA 2X0DA 4YV7A 5C5EA 5F51A 4QYXA 3WV4A 1NMYA 1JE0A 1UJ2A 5EE5B 3OT5A 4MAAA 5BSMA 2DY0A 3BL5A 5EKUA 2CXSA 3VSCA 4XWKA 5HIMA 1FTWA 1RHRA 4J03A 4B87A 4UUAA 5AK6A 5EKXA 4D97A 3BXXA 1E9DA 1C5KA 1FFWA 2LP4Y 4H4CA 1E3WA 2N1BA 2VZLA 2G1KA 5ECWA 5IPFA 1B3BA 2M6RA 4Y2SA 1ZI6A 3IRUA 4XYMA 5HZMA 1Z12A 3EIUA 3D0RA 4YRLA 3I0ZA 3T3NA 3H19A 4UTNA 1M1NB 3Q7TA 5CH3A 3ICCA 4YDSA 5EPOA 5LZ2A 1KAMA 2DT8A 4A9AA 1TT7A 1FP6A 1DI0A 1HR0B 1P1JA 2BFAA 1A77A 4HLCA 1DCFA 3H6HA 4ZVSA 1Z5GA 1NT2A 2ZYUX 4AM8A 1CRPA 4G0UA 3SYLA 2XQGA 1Z6ZA 2WEKA 4DIDA 3VR4H 4W8HA 1KYYA 2WOJA 1W94A 3RDPA 4CL3A 5C80A 2PL3A 1C41A 1U98A 2JVIA 3GGJA 5HCUA 3E3AA 1SXPA 1RI1A 2Q6OA 3AJAA 3ND9A 3MRVA 1XFAA 1ZSVA 4G0WA 1YIDA 3L8ZA 3DO5A 4XXHA 2WA2A 2FWAA 5FIUA 1BDBA 5HJ2A 5HCNA 1JVBA 3O2SB 3SR4A 4AUKA 4WBNB 2OBBA 4UDXX 3EVCA 2O07A 3L6CA 2EFYA 4LF7B 2EBUA 2V6JA 2YYAA 3BXFA 1TZCA 5LBIA 3STWA 2RGWA 4XUCA 4B35A 1S2DA 4YP5A 2Q27A 5G2OA 3CLKA 4L5CA 1YZNA 3VHXA 4E6PA 1ZCAA 4YAWA 4I9UA 4MB0A 3RIYA 4YPVA 2DCMA 1ILEA 2HI0A 3VNVA 2O2ZA 4JYPA 1Q83A 1I6WA 2CXTA 3WLNA 4B7XA 1GPWB 5ESRA 4IQGA 4E2WA 3OKAA 4URVR 4N41A 2FN3A 1PIWA 3D8NA 3NP7A 1M1ZA 2I6XA 5C5IA 3PGLA 1XK7A 1SC4A 1SOVA 4DDUA 3I52A 3PE6A 3ZHZA 1DBIA 3PXBA 1YA6A 1PS8A 2XVXA 1X1DA 3E3NA 1IEWA 3MCZA 1TL7C 3NANA 5D8DA 3O4RA 3WLLA 2AF4C 4P82A 1I36A 1G6KA 4LXYA 1OFIA 1BDIA 2A9OA 4LHEA 5TQ2B 5BUZA 1II8A 3BG5A 1JIIA 3VO9A 1PX2A 2HTEA 3MS2A 3NQ41 1AQYA 1Z4OA 4QXMA 1ESZA 4MUMA 4QGBA 3WI7A 3R5JA 8GPBA 2D0DA 3GWGA 2QQ0A 3DL7A 5IM4F 1AZWA 1NSFA 1RAAA 2R9VA 4MLZA 2WY2D 2BSQA 3HJCA 1SU4A 2GQ0A 3W9UA 5TQ0A 1UOPA 1W35A 4ZXPA 4BAUA 1WTAA 2JLCA 3L41A 3TRHA 5LZ8A 4RTSA 3JALA 1JSXA 5JU6A 2EGUA 1GSHA 3U4IA 2CUZA 1LBEA 3JD2A 1G4HA 3FTNA 3Q7RA 1EM6A 2H8KA 2P2SA 2QZ9A 3EGXA 2CC2A 3BHMA 5CIQA 2AOUA 2OECA 1JW9B 1XU7A 2AKEA 1RABA 2LE0A 1BFUA 1CLEA 3IAM1 3KKMA 3NWJA 5EP1A 4E51A 3T1QA 1LI5A 3QSYA 4FYJA 3KJIA 1BW9B 2FPGB 1Q16A 2P5YA 1ZD1A 5F5XA 4KI7A 4L22A 4D82A 4YRAA 1PL6A 1QR2A 2W0MA 2Y66A 4GAEA 2DKFA 4RH0A 2ZPTX 4HDQB 5F76A 4ILKA 4X44A 3F1LA 4ZI7B 1VL2A 2HK8A 3WP1B 1SKMA 3IEKA 1DB3A 2Y6VA 2ZSUA 4W9NA 1DELA 3FGOA 4Q39A 1X8LA 1YOVB 3VPDA 3E05A 3QVKA 4WECA 5JS6A 3NDPA 1QK4A 1ZVKA 2YUIA 4LS3A 1C30B 2AG1A 4OHVA 4W5JA 2EFJA 1VMKA 2P75A 1SULA 2ORIA 1R50A 5E9WA 4OHRA 5JAIA 4Q9LA 5JXIA 4PINA 5L6LB 1V7QA 2CVOA 1A04A 4K9KA 4B85A 2H2GA 4WFQA 4MPTA 4JX9A 1DAPA 3EBOA 2C5GA 4Q93A 5G4KB 2PUCA 1P5JA 4X6XA 2CJPA 4C22A 2P6PA 2OC4A 4AY3A 1O5TA 2O2IA 3D6JA 2XDQA 1G64A 1OTHA 1YQGA 4HH3C 3W4IA 3AQIA 4ZEMA 4QDTA 1ZUNA 4O59O 2QJWA 1KK2A 3QNUA 1MCZA 1MXFA 4YRCA 3K70C 5LP1A 1H3FA 1Y1TA 3DW3X 5JSQA 2ZTSA 3LJKA 1RYNA 1Z47A 3PWSA 4JEMA 3MILA 3QHQA 4AX8A 5FD8A 4F9FA 4ARZB 1VJ5A 1PO7A 3P0IA 2CUTA 3U4GA 3QYFA 4XLLA 4D5EA 3VUEA 3KT8A 5JR3A 1IH8A 1E77A 3UQZA 1GEGA 1FA9A 1HM5A 1NFRA 3F5DA 8OHMA 3R5TA 1AUQA 1I4TD 2WIJA 1IL0A 4INZA 4AQDA 1PJ8A 1ZEJA 4ZO7A 5HBRA 1UM9B 3SJBA 3B1ZA 2XD9A 3ONEA 1Q6YA 1ZLXA 2GWHA 2XHZA 5JVDF 3NGXA 4KEAA 5EFOA 3NT2A 1QVRA 2B5WA 2JHGA 3BFXA 5LBUA 2HU5A 3UCXA 4HWTA 3Q6IA 3STHA 1F2TA 4H7HA 4GECA 4UBNA 1YOBA 5ABPA 4K6HA 4DR7B 5EP3A 5JXHA 2H2DA 2WA1A 3GRRA 4PTZA 2DPYA 4Q21A 1RPAA 2WM3A 1C1DB 1W96A 3N0WA 3DV9A 5JWOA 3ZGNA 5KJ1A 5EWJA 4CTNA 5KBYA 2I9KA 1JHZA 2D2FA 4P7KA 1HK7A 1M2EA 2C4KA 3JZDA 2A78A 5EZYA 4ZCSA 3TINA 4QGSA 5GTDA 2GJSA 1C3EA 3BIWA 3MSCA 1BU8A 1QVVA 2VQ3A 1KZGB 2WTXA 3TOSA 3F6BX 1FUIA 1MUUA 1MG5A 1QHIA 1U8XX 5IG2A 5B36A 2R87A 3OY7A 3KE8A 3RKRA 1FBTA 2R8XA 1YI8A 1ML4A 1OA0A 3HS3A 3JARB 2WQZA 3I39X 1YRLA 5BRNA 3UY4A 2UXCB 1G5TA 3BS4A 4WN3A 1EJ0A 3B89A 1TVKB 2QENA 4D96A 3DBHB 1YRBA 5ALZA 4H7DA 1KYVA 1RHQA 2F1OA 3UHFA 1EWKA 2JJ2A 1K8RA 3Q2KA 4MTCA 5BW5A 4L08A 2OHFA 3R3SA 2R8EA 4G09A 4JUIA 4RK7A 2REBA 3LLMA 3NAMA 4L8VA 3TM4A 5K0FA 1RXWA 1VL1A 4ZT4A 3MB8A 1QGUB 4MS1A 3E2IA 4Q9IA 4C30A 3TVDA 2MIIA 3E81A 5HWSA 1FU8A 3U31A 4YJ2F 3W6ZA 2GZ2A 3I62A 2Q5QA 2LCQA 4S1PA 3AV3A 2ET6A 1K7YA 1B0PA 2IPXA 2IITA 2WSSA 1XRRA 4PFKA 2JGLA 1EUDB 1CW2B 4CMGA 4RQAA 2G88A 3SX0A 3ZY6A 3GLKA 3OSUA 3N87A 2RGEA 1F7VA 3RB8A 4Q4HB 2R68A 3UFXB 3CB4A 1HF3A 4ZQIA 3AGQA 3T3EA 2J30A 2ZWPA 2AQKA 2RGGA 3IELA 4MQBA 4QUJA 3LZCA 5A3JA 4PNZA 1QLJA 4R2WA 1RI5A 4REQA 4WACA 2W9XA 5J2TB 1V3VA 3MJ4A 1KWGA 1OFGA 4YJKA 2OV2A 2Q41A 3MN1A 5SY6A 4EKGA 3K0CA 1Z4LA 3C6MA 4KVGA 4NENA 4IGEA 4DLSA 1E1KA 1XNHA 3AKZA 4M98A 1I32A 2DYKA 1AC5A 1SBTA 1TB4A 4RM3A 3VAZA 3ZE7A 4QIHA 2AOTA 4TMYA 1I1OA 4GVPA 1NW5A 2FSUA 2HPZA 2G06A 2VUUA 2CJWA 1FU7A 3TRDA 4CKCA 3L0YA 1YJ8A 6Q21A 3G2JA 1ZUHA 1P61B 2H1RA 3KSBC 1GTZA 2ES4A 4E0BA 2NNWB 3H7AA 1QIDA 1L9KA 2VUIB 4UMFA 3LZ6A 3R7BA 5GJBA 4LWQA 1RJFA 3EX7C 3EZ6A 1PSWA 2Y1LA 2CW5A 2CT8A 4LJRA 3DUWA 4NZZA 1ULAA 1YI1A 2A5DA 1X86B 1YZUA 5ALRA 3DOCA 3NJ4A 4BNYA 3R3XA 4AS1A 2B1RA 2ODQA 3DQZA 1YS1X 3D6MA 4MV7A 3DVAA 1H2FA 1ATIA 1E98A 1AUOA 2FWB