3WDKA

Crystal structure of 4-phosphopantoate-beta-alanine ligase complexed with reaction intermediate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
252
structure length
249
Chain Sequence
b'PRYWSLYYREKIIEGMEKGMTAKAGLIAHGRGEAFDYLIGERTIEPAERAMRAAVAKFLLAEHPVISVNGNVAALVPKETIELAKALNAKLEINLFYRTEERVRTIAEELRKYDPEIEILGINPTKRIPGERGKVDENGIWKADVVLVPLEDGDRTEALVRMGKFVVTVDLNPLSRSARMADITIVDNIVRAYPRMVELAREMKDYSREELLKIVGEYDNGKTLSDVLLHIRDRLTRLAEEGIWRRKEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-phosphopantoate--beta-alanine ligase
publication title Crystal structure of phosphopantothenate synthetase from Thermococcus kodakarensis
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Ligase
total genus 92
structure length 249
sequence length 252
chains with identical sequence B, C, D
ec nomenclature ec 6.3.2.36: 4-phosphopantoate--beta-alanine ligase.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02006 PPS_PS Phosphopantothenate/pantothenate synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12640 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wdkA00
3WDKA 4MB0A 4MB2A 3WDMA 3WDLA
chains in the Genus database with same CATH superfamily
5D1HA 1U0FA 2C0CA 3FJYA 2DKOA 1UUFA 2WD7B 1OQAA 1W85B 1UMKA 4PC7A 3RV3A 1Z2NX 3WFZA 2VQEB 3DQQA 5FL7A 4H1UA 4XYGA 1CUZA 2DC1A 5T57A 5CHYA 3SE0A 4EUSA 3LMKA 1RLUA 2QW0X 1NT2A 3KWLA 1IZ8A 1G64A 4MI3A 4QOJA 3UV7A 4DWOA 1X7ZB 2AOUB 2GF2A 3NBZC 1JR4A 1U7WA 3QIVA 6LDHA 3HTXA 4L3WA 5FL3A 1KA9H 4BUZA 1FQKA 1WHTA 3BGOS 3V1MA 5A2QA 4GKJB 4OXYA 4TRRA 3RHFA 1TJYA 1PJ2A 1TXGA 1V2HE 2MIIA 3H4VA 3HWWA 3HPRA 3LCUA 4RFVA 5CLLA 3VZPA 1RJEA 3MWFA 1L5KA 3QLVA 3ZW8A 1VKHA 1QV6A 2ZSFA 3PNVA 5SY4A 2FWJA 2QN9A 2FSFA 4TSRA 4Q9KA 5CBKA 3QYAA 1JECA 1GNPA 1XLUA 1DWOA 1PDOA 1GNQA 3GZTB 5F1OA 5IEBA 5JSQA 1NBOA 3E5RA 4FYKA 1XTIA 2ZJ7A 3F46A 3HE3A 4CV3A 4EMTA 1QYRA 1ZNZA 2I4LA 3JY6A 3O92A 3DTNA 3EZGA 5AKIA 3T3HA 3LUKA 4A5SA 5AVVA 3SBEA 2PL5A 2E1PA 5K6AA 3I72A 4Q1VA 4XGNA 2R8EA 4KU4A 2XCUA 2R3SA 2H06A 3RU2A 5AW9A 4UD2A 2HBRA 4X8HA 5LMUB 1TD1A 5JD4A 4UTNA 3PUXA 1NMEA 2PSEA 2C5HA 1A2OA 4M4SA 4HZUB 3K1JA 1RYHA 2OB1A 4ILKA 1RYNA 1ZW1A 4DYVA 5F2NA 5TC4A 4HNVA 1IE3A 1CJBA 2Q4OA 1C7ZA 3QA3E 1K7FB 2J4CA 5TJHA 2Y4OA 1T3LA 1A4UA 2C2ZA 1PDVA 2E3JA 3GPBA 3ZCXA 5JNWA 5HKAA 1LJUA 2C00A 2XZPA 4WNAA 2H54A 4WXHA 3U3KA 4CGYA 4RCZA 2JGEA 3QPUA 1IY9A 2Q5OA 3BIJA 5LP6F 3OHMA 1AVTA 3IIIA 1YK1A 1OI4A 3BCUA 3H2ZA 4ZCSA 3AB8A 3SM9A 2I2XB 2WJJA 4CG0A 3AJ8A 2JLCA 3EPKA 1JHAA 4BLPA 3OSUA 5CEJA 1XOIA 1OH6A 2TMDA 5KMGB 5FWAA 3RHZA 3CZAA 3IQEA 4LZLA 2G0AA 3U4CA 2XUGA 3USZA 3WZLA 1GTL1 5JZOA 3GGDA 1D7AA 1WZ2A 1FVFA 2CV2A 3SSMA 5JC8A 2BHLA 1SHZA 1NW8A 3N8IA 5H8WA 4QXPA 3ZBQA 1O97C 1QHGA 4FX5A 5JBQA 4LZPA 1ZRSA 1VIVA 5KQMA 4Y1GA 5SZKB 1P7WA 1KJWA 4GOND 1BWPA 2WUVA 2G9QA 3OIYA 4WOBA 1EK1A 2FRVA 1Z6XA 3CGGA 4ZCQA 1BIFA 1JQLB 1P1FA 1VKOA 2QSUA 3M4YA 1PJTA 3KP1A 4EL0A 4PZLA 3WR5A 4MV5A 5JNTA 1PVDA 2AC2A 5A4AA 5I9NA 1C0IA 5TNXA 1F0KA 3GXOA 2AI3A 2C5GA 1GUBA 1Z2AA 3KALA 3C8UA 2JH8A 3V2GA 2F90A 1M74A 4Y98A 5K0JA 1QHEA 4N0DA 4YT8A 1T8WA 5C5EA 4Z9FA 1ZM7A 2BHRA 2ATEA 1R5NA 1IHYA 2ZIWB 4RL4A 3IPRA 1PP4A 1XQ9A 3OQBA 2XA2A 3LHKA 4IVQA 1DKMA 3U5ZB 1RBZA 3MJDA 1VIDA 2O0LA 4IZIA 1CQWA 2IPLA 3DZHA 1N2SA 2IYOA 1E79D 3AWDA 4GC5A 4D81A 1JHYA 1QGAA 3AVWA 2C98A 1RLIA 4PO3X 3TI9A 2H51A 2WIKA 2EGGA 2I8AA 1I6MA 4A15A 5FUVA 3MBKA 1Q1ZA 3CLRC 3SYTA 4FSXA 2QX4A 4L74A 2XWJI 4BRWA 3ZVMA 4C22A 4YUWA 4C7MA 3QZUA 4IX9A 2IXEA 4LDQA 1O95D 5U9CA 2B37A 1FDUA 4RTLA 4P6VF 1PLJA 5LJIA 1AC5A 2ISQA 2P67A 2AOXA 4D3ZA 1OB5A 2XQGA 3ZCUA 4HN9A 3GW8A 2H5LA 1TQDA 1MO4A 4FK8A 3ZY5A 1OVMA 2FEAA 2PA3A 4QDOA 2UUBB 1DG3A 3KR2A 4I50F 4R2XA 3CLSD 1BHJA 4FM9A 5KYTA 2CFTA 4REQA 2FGKA 4HDKA 4KO1S 3CH7A 2W22A 2OWEA 4G4SO 1DIGA 4Q1DA 4ARZB 4BKOA 3RF7A 2BKXA 4D02A 2P79A 2DJIA 3V1TC 2VDWB 5JAMA 2F1KA 4MQBA 2V96A 4PVDA 5K8UA 4G01B 2M6RA 4B1FA 5CDGA 1MA3A 1KKUA 1WU7A 4R83A 2V6GA 3D4IA 4BZPA 3KBBA 4ZDJA 3R9IA 5FCDA 1TVKB 2JIMA 3DDNA 2ZJ5A 3K09A 5ULLA 1OYWA 1KO4A 1HYQA 2XOKA 3DE6X 3WMXA 4CLDA 4EX6A 2GXAA 5KTMA 3KAQA 3R7SA 1FQJA 1MJFA 4E2ZA 4Z4EA 2OV2A 4L9RA 5I3ZA 3HJFA 1OWPA 3O4FA 3PHJA 4BFXA 3ZI4A 3TLYA 3R7LA 3M6AA 3EHEA 4R84A 5K4GA 1W47A 2CMDA 4P34A 4QJIA 4XVCA 1CE8B 3ONVA 4B85A 4V0NA 3C7CB 2F4NA 2FPXA 4CNQA 4QEZA 1FPMA 1EX9A 1ML3A 2MMGA 2PZKA 2HU5A 4RD6A 1VLLA 3G5TA 1MJGM 4AT1A 2J59A 3B6ZA 4C1NA 2OO3A 1U4NA 2W2LA 2XNHA 3EFEA 1K4YA 2JFWA 4G63A 1T5IA 3KYCA 3TRIA 5L6LB 3R23A 2ISSD 3W9BA 3FTEA 2YZMA 1WLYA 3GRRA 3HU5A 5CA1F 5TPWB 4ZOQI 1DRJA 1MAUA 5KSZA 3IA2A 1ILEA 5G41A 3LUPA 4IDBA 3HJTA 3IBFA 4EYGA 5CVTA 4B17A 4X3OA 4B73A 3ESRA 4G65A 2JHFA 1ZMRA 3BK1A 2QYHA 1ODFA 1RQ7A 1VDZA 3EH1A 4ASUA 4CL2A 3NEJA 3QEMA 2JK0A 4YH1A 2P35A 2R00C 3GLQA 3WMEA 1UBMS 5KTKA 4ZO8A 4LJRA 3EG9A 5KQLA 3W1VA 1PJ3A 1FMTA 3PZBA 3OQHA 4MVJD 5CT5A 1TCAA 3K0CC 1LC0A 5JNUA 1GZ5A 3TDKA 1CUDA 3AIOA 2NO1A 3BULA 3I8OA 3RTEA 1OA0A 3BL8A 2AKEA 2B5WA 1UJ6A 4JC5A 5IF9A 2IXDA 3TOXA 1KEEB 4Q93A 1YULA 2Z9DA 1JRLA 1U7DA 2VPQA 3H1FA 4AN4A 4DLKA 4D9MA 1A97A 1PS0A 1JR3A 4YDSA 2AXPA 3EUAA 4JL8A 3VC1A 1FTSA 1M1UA 1JSCA 4JJGA 3HVRA 4X20A 1E2HA 2R6AA 4RY2A 1T91A 1SG9A 1T4CA 2DBRA 1ADCA 3JQFC 2JC3A 4RIEA 1TMKA 2ZWVA 4TM8A 3HA3A 2Y1LA 1TIKA 2N0SA 3DEZA 1T2EA 3MGKA 1NYTA 4IICA 3GRPA 4K9SA 1NE2A 3V2HA 1LSUA 4X95A 1X9HA 1AXEA 2XZOA 5EEHA 3DDCA 1DTSA 3GEEA 4UXJA 2G06A 1V47A 1SHUX 4FWBA 4MUIA 3SYKA 3MOIA 4AMVA 5F73A 4H1HA 4C0WA 4N47A 3WIVA 4MHOA 1E2IA 2I1LA 3BMNA 1NVKA 3F6SA 4WFJA 3HGMA 1GOTA 2O3RA 4O4JA 5F2KA 3E7FA 1OFIA 1DLIA 1PLKA 3Q7SA 4HDNB 3O4VA 4NBKA 1Y1SA 4HTFA 3TEJA 3C24A 4HH4A 1QFMA 1FYDA 2YJTD 3CIOA 4I46A 1MB4A 2VJKA 4CL8A 3MJCA 2F1RA 2NZXA 2QRQA 2DQZA 4PG6A 3R76A 1X9GA 2J45A 2RHRA 1K75A 3RWBA 4QQNA 1QIHA 1QTNA 2JLYA 1FS5A 5I9BA 4I9NA 1QDUA 1EJBA 1NU6A 3V1LA 4ER7A 3KAPA 1XR3A 4KQCA 3EIXA 2APJA 2PX4A 3OECA 5HCUA 1YGPA 3OP1A 4YRAA 4HS9A 3AEQA 3ZJ5A 2DT5A 4DMKA 1FRNA 3F4LA 3KT0A 3GMSA 1W87A 4CIBA 5JH7A 1QQ7A 2QXYA 3MJTA 2MSKA 1RI3A 4GKVA 5FI1B 2IHVA 3WVNA 3GARA 3U9SA 1HNXB 2AZXA 1U6KA 2HI0A 1PUJA 1UBNA 2EP8A 3IP8A 4FE4A 2OBLA 3JD4A 1CRWG 3WGOA 4AG3A 4KNYA 5IABA 3AQ4A 4KNWA 1YVPA 3BMQB 1SHKA 3D0RA 1PHPA 2BCJQ 3WMFA 4R51A 1F38A 3BXGA 4HFMA 3MRXA 1HEUA 2QN1A 5CCEA 1KZ4A 1YCGA 2J3JA 3HH8A 3GFSA 3JQGB 1NQXA 5BPFA 5IK2D 1II8A 1UMBA 5AJTA 1MENA 2D4AA 5HA5A 5D7NA 3DR5A 1YE3A 1Q1QA 2Z6QA 2XMGA 1TTHA 1WPRA 4R9RA 5KNBA 1V8BA 3HO6A 3HUFA 1HNNA 1JSXA 3BOSA 1YVDA 2W8BA 3ACDA 3DPIA 4OK5A 2X19A 5LUBA 2Q3JA 2HDHA 2J87A 2UYGA 3KVOA 3L7JA 4R2MA 5CFZA 4AG5A 1JGTA 2C3UA 2QLBA 3C2QA 1L7QA 2PFSA 5JVDA 4X97A 1E2NA 4PAWA 1NOIA 4MUAA 4K6MA 2EKBA 2QNIA 3P0IA 1AKQA 3IDZA 4H2DA 4EZEA 2QBYB 2WE8A 4NTZA 1XCMA 3DMTA 1Y1LA 3DMRA 1Q7TA 3FR8A 4JKOA 1EWTA 2BKEA 2ZFUA 4MJ7A 4BO4A 1KETA 2VTDA 4W7HA 3B51X 1Z4KA 4ZI7B 3WKBA 3U4QB 3QKSB 2P9HA 2J08A 2IU3A 3VR6A 1KE2A 3WL6A 4NBSA 2YYZA 3DBVO 1SBTA 3HCOA 4RW0A 4QTYA 3PDCA 3HUDA 2H59A 3THWA 4Z4GA 2JI8A 2Z4TA 5ALXA 4KQKA 2Y93A 1R6VA 3L1IA 2X0RA 1ISPA 2QRHA 3E9RA 3I2FA 2ZRDA 2NQ2C 4RSHA 4JSYA 3GLGE 2VWPA 1JH8A 1K6MA 3AM5A 4M99A 4L22A 1A7KA 4TVKA 5EP3A 1A9SA 5NULA 2C9OA 3BXFA 2B36A 2XADA 3TVTA 4YBZA 3S55A 4BC1A 5SY9A 4BOYA 5I4KA 5AJWA 3GNLA 3W6PA 5DTIA 1DT3A 4V0RA 1R8JA 4JHXA 3C97A 1I4DD 1VSUA 3REQA 4QARA 3SF8A 2D1SA 4UQLA 5K2OA 3HB4X 4HNGA 4RM2A 3N3BC 3VKFA 1MZPA 2CNOA 1RWBA 1KRWA 1UPCA 2CUKA 1MC5A 3ORYA 1Y9ZA 3QHQA 4Q4AB 3JQAA 2H85A 2IQIA 1ORRA 1TJ4A 2N42A 2XE4A 3PNLA 3UOAB 2G9VA 2WABA 3NBKA 5H83A 2R65A 3DM5A 5EIOA 2O20A 3L8ZA 4KIUA 5IBRA 2HXGA 2P9YA 3HSYA 5GWXA 1X39A 1D6SA 1W9MA 4JY7A 3VX4A 1KJ9A 3A4LA 1QIIA 3EQ6A 3GVXA 3HCNA 1FTYA 1L2TA 2GN2A 4LCJA 4OK6A 4XFKA 3QRWA 4V0MA 1IUKA 1COZA 3BXPA 3T34A 4C01A 5IVPA 2CDRA 2Q1YA 1P1JA 2H8KA 2W6JA 1O87A 2AEMA 2FOLA 2YQ4A 4WACA 5CX1A 2VZLA 1B8OA 1PS9A 2C3YA 3M33A 4C07A 2JZNA 3VPCA 2Z8ZA 2Y8EA 1FB5A 1VE3A 4Z86A 5C5IA 2CXUA 3ND8A 2ARKA 2WOOA 4PICA 5F12A 5HK8A 4IH9A 4CMJA 5LMNB 1JHXA 1DO2A 3K05A 3AI7A 2GCNA 3ZJYA 4Y2XA 4MKIA 4RK7A 4JODA 1GG9A 5B53A 3RAGA 3ZWMA 3BKXA 1JNYA 3WRXA 3UK2A 3FDZA 3AO0B 1MCZA 5DSZA 2PA0A 3QX9A 5FX2A 5J23A 4K88A 3PR2B 5EINA 3X1JA 4A3SA 1A82A 2V4ZA 3NP9A 1CWUA 3ESCA 3F3SA 4ZAYA 4UEJA 4DA8A 2D0PB 4Y30A 4B2YA 3WLPA 4F8EA 1CNEA 1TZMA 3K8QA 2PRYA 4FMCB 2B5VA 5KKNB 3EN0A 1R0LA 4KQGA 3GFQA 3FMVA 4BFSA 4YHHB 3LX5A 1JHOA 3FAKA 3EIEA 4G56A 3U7IA 4EGAA 1I0IA 3DV0B 2G36A 3V1NA 3FNGA 3AR2A 1C5KA 1TPYA 3B1KA 2CN1A 4RKYA 3RJ5A 2ZBGA 1H1LB 1WQ4A 4RF3A 3R7NA 5HFNA 5K20A 4A0QA 4IV5A 1IN1A 3GEIA 3J80A 2VJOA 3K8OE 1XFDA 1Y9EA 1YUBA 2AZTA 2IXAA 4IDEA 4RV9A 3DL2A 4H0NA 4HPJB 2ZT7A 4UEWA 4WBNB 1YJ8A 2KE5A 2QF7A 5E3IA 1XP5A 3ZXYA 3HDYA 4OXNA 1Y8RB 2J5BA 2RARA 3EISA 1MXFA 4PBRA 3ZHBA 4M36A 5AVQA 2BMWA 1G41A 2I7XA 2EF0A 2WNSA 1OX4B 1L4HA 2Q0SA 3FBGA 4GO1A 1KYWA 3WKEA 2O1EA 1H5UA 4A6XA 1L4GA 1M1YE 4B71A 1H3FA 3VBEA 4Q9AA 1PWHA 1EFPA 1P3JA 1XF9A 2IPOA 1E1QA 1P62B 4V2UA 2P4UA 1CJTC 5BQ3A 4MO2A 3RIGA 4C1BA 3FNIA 3UJ6A 3WDLA 3DXZA 3TLEA 1LRKA 3GC6A 2JJ8A 3BB1A 3TIIA 5FHRA 2XE8A 1BX3A 3U4IA 5AI8A 4PRKA 4ZHQA 3FZYA 3Q8LA 1EPUA 4Z53A 1AS0A 3RBAA 1Q57A 1GFSA 3HGTA 2AFHB 1OKKD 3I64A 2FDRA 1VSTA 5ECWA 1PWZA 3A27A 3FYHA 1IRIA 2ZWOA 1EFTA 3O4GA 3HCRA 3ZE0B 3COJA 4WMLA 4BRUA 3FOZA 1US8A 2QPOA 4CMEA 4RTOA 1E3EA 4YMVA 4NV0A 1UPBA 1W6RA 2BFFA 2FRDA 5BV0A 1K7SN 4UZFA 3DG9A 3LE8A 3D0OA 3KEMA 1U8ZA 4C0AC 4NPAA 3RLIA 1H66A 1R0ZA 2P3SA 2QVCA 3KPJA 3MCUA 4KDCA 5SY6A 4AG6A 4C4TA 4MGIR 3BIWA 4Y9DA 3KRTA 5TQ0A 1ZCZA 3B2EA 3Q3HA 3F5FA 3UUFA 1EVQA 3BZWA 2WKRA 2OECA 4LWQA 4B9AA 1V71A 4MVJP 5ICMA 5DU2A 3MXTA 1CQXA 2F1IA 1ZD5A 1GPNA 1VFPA 4UNRA 2GCEA 5DNYB 4C6SA 1J2RA 1YFZA 4YVFA 1ISMA 2AFIA 4K6KA 3V55A 1YA6A 2WAAA 5K05A 4N03A 4WCFB 2NSDA 4AWXA 2P1ZA 3L01A 4LVCA 4QJ3A 3RSFA 2UVDA 3AYXB 2I91A 1XKXA 2EBUA 1J90A 1TECE 2NM0A 2QL6A 5TARA 3HPQA 1P2DA 4CKYA 5C37A 3GVPA 4K86A 4RZQA 1N5RA 3BFVA 3NMUF 3JSAA 1WCYA 1RRMA 4XXHA 2VRBA 3WNCA 1ZVQA 4HBZA 5CXSA 5HJ2A 5CB4B 1YU6A 2AOTA 3W2FA 4H4CA 2QJFA 3ZIAA 5A62A 5M5BA 4LC0A 4KCGA 1CQJA 5LN1A 1P91A 1E2FA 1ZRNA 4OATA 3KJXA 2NW6A 2E49A 5DGXA 5TS3A 3TW4A 5JS1A 5T8KC 2CUZA 3WICA 1GDDA 1SXJA 4IXMA 2PN1A 4IV0A 1V35A 2OV3A 2V0CA 4WA7A 1YB7A 4CN8A 1NNLA 3WWZA 1YNOA 5LZ7A 4FS8A 5BVHA 3PT5A 3N2ZB 5EHGA 2WWWA 2V6BA 2BGWA 2FWMX 4DRYA 5H80A 3D5EA 3FCCA 2VWQA 1D03A 4FHGA 4RSGA 3SHFA 3CSSA 4DDMA 3W5IA 4O4HF 3WC4A 3ETLA 1VL5A 1K2VN 2OLEA 4LYDA 3YASA 3LUBA 1WEKA 1R6TA 5TQJA 4Q24A 4KLNA 4BN4A 1MH1A 3QI7A 1WX1A 2JCYA 2H1FA 2P5YA 2GJSA 3GN2A 3R5SA 5DDIP 4DBZA 3OTWA 4BFTA 1P80A 1ZU5A 2C2WA 2H08A 1RRPA 3RUCA 3VH3A 2C7OA 4DR7B 2QTRA 4MRPA 3D3EA 1RAFA 5IZCC 1JDSA 3OZ7A 4Y7CA 4LW8A 4GPEA 2EATA 4O29A 5COBA 3LHSA 4AWAA 1J0AA 5TR9A 4OLBA 2HQBA 2A8YA 3E9NA 4B2PA 5E0KB 1MU0A 4XEHA 1UXKA 3KKOA 4MARA 4PO1A 1O77A 3EXIA 4E13A 3FNEA 2XH8A 5CA1B 2Q5JA 1JKIA 4MVJM 2V9PA 4MNTA 1WETA 1A27A 4GUAA 1ANKA 2FA9A 3DLHA 2Q4RA 1EGMB 4ROSA 3U39A 4D0NA 3R6LA 2BJWA 3W3ZB 2B3DA 2QN7A 3TH5A 4CW7A 4DLTA 3A1NA 4M6WA 3WJ7A 5I5EA 3WA7A 2H18A 3PDIB 5KPJA 3GROA 1GA4A 3UF0A 3RJZA 1T0HB 4AS2A 4FVTA 4L8FA 5FADA 2ZJ8A 1AQUA 4JITA 1NI3A 4JVSB 4KWTA 3OQIA 1L1FA 5I4CA 4H60A 2FN8A 1NPTO 5DB4A 3COSA 1DZ3A 3OCZA 2CFCA 4EZBA 4WK0B 3H2YA 2J3MA 3LC7O 5ILOA 3PFGA 4H4EA 3ZS9A 3O4HA 4MXDA 5CNKA 2ZDHA 1A9PA 4GD3Q 1C8KA 4BNGA 4D9CA 4G84A 3DLBA 1P6QA 5DGHA 2M1XA 2K5UA 4FDLA 4MRVA 4MVJE 4GLFA 4IHJB 2WWIA 2Q6KA 3I83A 5H68A 1NI4A 2HPVA 1ZUNB 2DFVA 3I58A 3SX2A 3TW6A 5B6IA 1QONA 2DWQA 3HB5X 4P5EA 4RHYA 1CS0A 5J2UF 3T1OA 3WKDA 4IIHA 4LBZA 5EI5A 4C06A 1DX6A 4COKA 3WOVA 4GBJA 4Z4FA 3LOUA 4LRYA 3FMGA 1VRCA 1JPUA 4JT8A 4PNHA 2RHCA 2DQYA 5CG2A 1Y3BE 3IAFA 1CF4A 2X9GA 4DTCA 1XCOA 3P0RA 1RP1A 3KKZA 3MWEB 3QUBA 1XKQA 1ATZA 2LV8A 4NATA 5AVKA 4D3YA 1TYZA 2JKZA 3FPEA 2NO9A 3I8XA 3HYSA 4LK3A 1H65A 4QU8A 4V0KA 3L84A 2DTEA 2NACA 3NTLA 2P1RA 3WWYA 4DDHA 4XQEA 1FS4A 1Y4ZA 4I4IA 4HVTA 5IJWA 1RM4A 3AU9A 1CUIA 4C5BA 5J43A 3MM4A 1JJAA 2AW3A 3EIQA 1FUIA 3GGPA 2K7FA 1LBIA 1YJ5A 2O4CA 2ZB7A 3BTUA 3LUJA 1DU4A 4OFBA 4D4LA 3G5MA 2D2IA 4OGWA 1DKLA 1YS6A 4AX8A 4AFNA 4F3RA 3GNTA 3A3KA 2BGTA 1UBEA 3ZE6A 5F7XA 3DJFA 5KVCA 4QNRA 5G0VA 3AHGA 1Y1QA 3H0KA 4DR3B 1RWQA 2JZCA 4TSFD 5KOJA 1TL7C 4X8MA 1VM6A 1X77A 2F64A 3A4VA 4WFQA 3CF4A 1NN1A 1X7DA 4CDMA 2WAYA 3SJBA 2HLDD 4CUZA 3IUYA 2WC1A 4N3CA 1BHSA 3WLSA 2Z2XA 2CYAA 1G5FA 3U4DA 4ZC8A 1C9JA 3OZEA 2X42A 3DHWC 5CW2A 5IJ0A 3JTMA 3K0BA 1ZESA 1HV8A 3V5NA 4ADSG 4Q3BA 4KRYA 4B7ZA 1KYTA 4RESA 1QRUA 2QOEA 3ZLJA 1INLA 1AURA 1J5PA 5CDUA 2MDTA 2QAIA 4I1OA 1Z5GA 3VDXA 1UDCA 4CKEA 4CIVA 4EBFA 2XXAA 4BNLA 3U7FB 1B42A 3BIXA 3SE7A 2IX9A 5SICE 1VBFA 1RXEA 5DEOA 4R2JA 2QG4A 4E2YA 4AJIA 2IW3A 3L8FA 3NHAA 5D5HA 1WKBA 3PWZA 1FFDA 1NRJB 2XQVA 1MX5A 3PIIA 2QYTA 4D41A 1DAKA 1YBVA 1SU4A 3HXTA 3PWKA 2C5BA 3FPKA 2D8MA 1IG0A 1K6XA 4MMZB 3DYIA 1NW3A 5BNWA 4QEDA 4WDRA 2R7KA 3W1EA 1ZM9A 1D1QA 1C1YA 1WDWB 1ACLA 1Z8NA 2FDXA 2Q45A 2YHBA 3EA0A 3IRUA 4JH0A 5H3LA 4KXVA 1H4SA 1N6RA 1T9DA 3SC3A 3P9YA 3UQZA 1NZDA 2XVMA 3KXDA 4WLOA 3D2CA 2D3WA 2MSWA 3ED1A 1JL3A 4EHJA 4L28A 5AW6A 3U19A 2X2FA 1CJMA 2BI7A 3KU1A 3PUJA 3SKXA 4U63A 4UM8B 2NQ8A 4MB0A 4ZVUA 2WUWE 3T1VA 1GUZA 5AK3A 1UQTA 4F96A 2VXBA 1B76A 4JLOA 4DG8A 1H2EA 4DLRA 4P5PA 4P33A 4XJVA 4KXNA 4YXFA 3E7PA 1I4EB 1TMYA 1SRRA 1J70A 1JEDA 2OV1A 1ZH4A 2R5FA 1D1PA 2VK2A 1KZ6A 2Y0EA 1V6CA 2ZVQX 3LQKA 4GPIB 1H93A 3E70C 3O38A 4LY0A 4ZOEA 2WUGA 3KLOA 3BILA 1UQRA 4AKSA 2BLNA 1KVTA 2WM2A 5KQPA 1MEOA 3HYTA 4PRLA 4U0JA 2FUNB 3NFYA 4O5AA 2OCDA 1A77A 2F2TA 2PKEA 5ECGC 3VISA 3FCYA 4HLNA 3OEWA 3RS7A 3KNZA 1Q22A 4OHWA 2RBGA 4I4NA 3T3PB 4AZ3A 2COUA 5CAEA 3N70A 1FW8A 2HMWA 1FTQA 2GAJA 4W5HA 1CQPA 3AL3A 1XZCA 1N2BA 3PC2A 1QGZA 4E31A 4QELA 1ZN8A 1KI6A 1MIHA 3BK2A 3ESAA 4N6OA 5E1MA 4DANA 1V16A 1CHNA 2Y92A 2ZGVA 4YJGA 2FSHA 2ZAMA 1M72A 4TMVA 3TIGA 4RTKA 1MDFA 3D64A 1RQLA 3KS9A 4JLNA 1P2GA 3LUCA 4N0PA 4TLCA 3TGWA 4YHBA 4LJ9A 1Z5OA 3H84A 2IXGA 4M1SA 4S1PA 3V80A 3WIOA 1YOBA 1JTFA 3LIPA 3L7NA 4JWTA 3OOSA 2J7PD 4CODB 4YQYA 4P22A 4OJMX 5K5EA 1M6WA 5FBZA 4DNPA 3AB7A 4E4TA 1F9AA 1A9TA 1NUAA 1U3UA 1UFOA 9ABPA 3PNQA 3RJTA 3TTUA 2C99A 3PKJA 3A6FA 4Q6WA 1MOPA 2QN6A 4BFLA 3N0XA 1IZYA 3G9ZA 5DGIA 2IX3A 2YUTA 2A1UB 1Q3TA 2IY9A 3E81A 4WOJA 4DC9A 4AZSA 3RC1A 4LS3A 2H1IA 5FV4A 1WUYA 1L5HB 3ICWA 1MTZA 1BEZA 3A11A 1X1DA 3AKEA 3DPUA 4YRCA 4Z99A 3M6WA 4K9LA 3FSGD 3TRKA 1JQJC 1WABA 4BN5A 3OUUA 4WV3A 1HZZA 3EGOA 1NR1A 5T67A 2IOFA 3GGOA 5ENDA 4CM8A 4IGIA 2I78A 1TB4A 3RHSA 1G8KA 3AM1A 4RK0A 4U7TB 3TQTA 2WICA 1RYZA 1A8QA 4XUEA 4OAQA 4XAQA 5A1TA 2MINA 1XGKA 3W5AA 1NMSA 4LVNA 3ULKA 4C7VA 5JJCA 4RVFA 2XMRA 1LTKA 3IQFA 4X3CA 3IHTA 2B4TO 4LJKA 3NEAA 5AI4A 5EERA 5KJCA 3LUHA 4MR7B 1S9HA 3C1AA 4U2BA 3MINB 2ZYIA 7ADHA 2VZ9A 3RTBA 1HTBA 2NSHA 4QDJA 1C30B 4DLLA 5IKPA 4HEA1 4D4JA 4YPOA 2WTUA 2JJ1A 1P4GA 1YZHA 3FROA 1KE1A 3WL8A 2WHPA 3BTSA 5AVWA 2IKSA 3HJCA 1VMEA 3HUEA 3PGMA 3GMDA 4BGDA 1RJ9B 2UV8A 5L53A 3ZX5A 3A26A 2P40A 2Q1XA 2WU4A 4P4UA 3RANA 8ADHA 5KOHA 1RVDA 2PTGA 4K9KA 3N8KA 4OAOA 1ZY2A 5TF4A 4DYHA 4HJXA 2CT8A 3AL0C 4ESOA 2JD0A 2HNAA 5BW4A 5JIBA 2VH5R 2J4DA 1JE1A 3CEPB 2W70A 1ISGA 2ZYUX 4XIFA 1LLQA 1GYRA 3G1UA 3MJEA 1J0DA 1KI2A 1LGYA 1NFQA 1GPAA 2ASEA 1FFXB 2CKMA 2ZI4A 1JIKA 2CSUA 3GDFA 3HSKA 3B5JA 4TV8B 5FUWA 3RAPR 4EQZA 4H6XA 2OQVA 3AF1A 5CD1A 1QE3A 2X76A 2Q9BA 4D79A 2EFDB 3AP1A 2QW8A 5CA0F 2B6NA 1IUPA 1C81A 2ZIFA 4B4KA 2H1WA 3HMKA 1NY5A 2JVJA 3O31A 2Q5CA 3VR4H 3AF0A 2WWGA 3HS3A 4BPBA 1WRBA 2B2XA 4JI3B 1UL1X 4H3SA 5GTDA 2VYNA 2YIJA 3F6RA 1BG6A 3WQSB 2V6FA 3EJ6A 4N5MA 1JKJA 4CKCB 2CEAA 2N1MA 3HUTA 3H1GA 4MI6A 4RTSA 1DBPA 3ABQB 2CB0A 4WHMA 3UN1A 4CTJA 4NI5A 3QHPA 2RGDA 4YALA 2VNHA 2C8VA 4J2TA 4C0BA 1ZOLA 1H8ED 1QFSA 2HYDA 1M33A 3TLGB 2NTEA 4OEHA 2ZB8A 5G0SA 5CXUA 3E5HA 3ZOKA 3AU8A 3PFIA 2HA4A 1QU2A 3FYUB 2WG0A 4D98A 2F59A 4FW9A 5B58T 4OJNA 3KLBA 4BMOB 1PKXA 5HF5A 1VP9A 2Q5HA 2HJVA 3SXJA 5BO5A 4ZAWA 4F85A 4CEHB 1DCMA 4RLSA 1O97D 1ZL0A 2C9MA 3IAS1 2QJRA 1OT5A 2PX8A 2Q7XA 3L07A 4XE5A 1HOTA 1U0JA 3SHWA 1R4AA 2IYUA 3MT7A 1Z8DA 1W581 4B47A 1YONA 3DO5A 4DUGD 1ZMTA 2A5DA 3GJ5A 4DJFC 4OVKA 4YJ3B 4XM2A 5IXYA 2ZIZA 2ZJFA 3FUVA 4Q7JB 3LBFA 3W90A 2VDQB 4IOLA 4JN6B 2CY0A 5CTAA 2C20A 1RTTA 3H9QA 1RHJA 2VCYA 2WJ3A 3FZQA 3N86A 4JU8A 4MGHA 2Q7OE 4KUGA 1QGED 2QT1A 1CDEA 3M2PA 2R11A 4BVGA 2ZETA 4C0SA 2JJ2D 5GGYA 3K6JA 1FMJA 5LIPA 3ON5A 1SUIA 2OBFA 4H27A 3VJMA 4C2UA 3SJUA 4C6HA 1B7GO 4BNNA 1RLMA 1XCJA 1W88B 1A8SA 1U6JA 1XLVA 2H5JA 2PS3A 1G7RA 1PJQA 2WM3A 2WUEA 4GX2A 2Q50A 3JZDA 4MITA 4UEKA 2A5JA 4D97A 5LJLA 4ABTA 4CEJA 1V1RB 2VFAA 2BC9A 2WJPA 2G4VA 3GNSA 3L06A 2FNAA 4CTKA 4F4IA 3R7BA 5AVRA 1QDEA 2OHXA 3CLRD 5CIWA 4A1FA 3TW8B 3DULA 4DEXA 3V7UA 1CY7A 3WL3A 4PSDA 4S1NA 1OAKA 3A1FA 3PCRB 4JQSA 1IPEA 3TX2A 3I3SR 3IT0A 4W5RA 1YRBA 4EI7A 3ZYZA 4CG2A 2FR8C 5NLLA 1POWA 1HKHA 3ZVNA 5ESDA 2R68A 2DFLA 4RKEA 2QTVA 3UH0A 2AR0A 4Z2AA 4AJ9A 2Z2KA 1FRQA 1SR8A 5GJWC 3UHOA 1W4LA 3H0CA 3QMWA 3NC0C 3LKVA 2QROA 4EPYA 4BO1A 4QNMA 5B2ZA 3U16A 2IIPA 2XOEA 4PYKA 5BNIA 1HLGA 2VLBA 1DJNA 3N0RA 3EVCA 4TS9A 4JR2A 5IN5A 3ZK9A 4WESB 4PYMA 4B7XA 4ZZ3A 2H2WA 1V1MA 5TB5A 2PQ0A 3JYPA 3P4UA 5FLKA 4UTOA 1RHMA 3ZHYA 4MR8A 4BV8A 3EBOA 3TD6A 2VK8A 4ECEA 5H3CA 5KYWA 3W5DA 2ZZNA 2R1TB 3LT2A 4IMRA 4ZVMA 4JDUA 4XLLA 2MTBA 3OKFA 1JG4A 3RRJA 2ZRMA 2EGHA 3LRPA 4BO8A 3VV2A 4HDSA 4IRUB 1O9GA 4QQ8A 1EE9A 2PWYA 5AK4A 2PL9A 3ZWQA 1XTZA 4TXMA 4EB0A 4WZBA 5ILQA 4B6GA 2HQ1A 2I34A 1POXA 2FQ1A 2VWGA 5FJIA 1IK4A 1C1DB 4I4TB 4M54A 3UWOA 1RM0A 4YRLA 2P4EA 2R97A 5LXTA 2WAXA 1WDMA 4JJIA 5FPSA 3G6WA 5HF8A 2QNRA 3IR7A 1GUYA 1Z75A 2NAPA 2BGGA 2PJZA 4BLVA 4D4KA 2DR2A 3NDPA 1KYIA 3TSWA 3DFIA 1NNI1 1WNFA 3K70C 1OY1A 3HI4A 4QDTA 4N9WA 4OGFA 4HQFA 3T7IA 1J0BA 3E27A 1I5RA 1VHWA 2W11A 3QTBA 4L0CA 4CR7A 2ZRHA 3GJ4A 2UZ4A 2VQDA 3LK6A 2AQIA 4HR7A 4X6LA 3K6RA 4QXQA 2FSIA 4AYXA 4O1MA 1Y3AA 4J03A 2WUDA 1GUFA 1TLFA 3EXFA 3OX3A 1X7YA 5JSYA 1EEHA 3PFWO 4CKZA 3L77A 1NVVQ 1RHQA 5CJJA 3G9QA 1O94A 3NKFA 5IKEA 3PLNA 5IDXA 4E1VA 5EE1A 1PSDA 1UWCA 1U9JA 2YZGA 4LGYA 4B9EA 5IDWA 2W83A 4Z1MA 1M6NA 3IAUA 3VOTA 1EUDB 1M5TA 4A2CA 5IJ9B 4GBMA 3A4NA 1PF7E 3DYVA 2REXB 2HREA 4EA6A 1P81A 2C9YA 2IEDA 3IT3A 4QREA 4AICA 3DEHA 1IM2A 2AJCA 2EFYA 2Y77A 1T2FA 3CTPA 3KUUA 4FNAA 2I7CA 3ESXA 1I36A 1L4BA 1TUBB 4G86A 4KO2S 1OHHD 4X1YB 3ZDRA 1TM2A 2YJ6A 4RVGA 1YWGO 5AI9A 2NO7A 4E46A 1OIVA 3L8HA 3RKRA 4YJDA 1GPDG 1EP2B 1JFTA 3SIXA 1JBQA 4IF6A 2FJ0A 3C5VA 1BCSB 2ZBVA 3ND5A 5IYZA 5I7WA 3MUOA 2C3OA 3PC6A 4OJQA 2X4GA 3ASVA 1M1XB 3B7PA 3EF0A 2WT4A 4GRAA 2XE7A 3VOSA 4LF7B 4GRDA 3INNA 4Z8XA 1JE0A 5TJ9A 2QRNA 1I1HA 3GT3A 3DUFB 3IAM1 4TX1A 3EZXA 3OG9A 4TGLA 4YRPA 2K6GA 4CTOA 1RM3A 1X2EA 6CHYA 1TAGA 2I6SA 3M70A 4HGNA 1TVEA 3QIAA 2QTBA 1ORDA 5HJEA 4DV2B 3LFHA 3O1IC 3MS7A 1RKUA 2XXBA 1M7GA 4FDAA 3ZD7A 1SJ9A 2F9MA 3DJYA 4LSMA 4DREA 5K3FB 1V3VA 1UEXC 5L3SA 4X65B 4L2IB 2W6CX 4KEAA 4FMPA 2KQUA 3GUHA 4L4UA 2VTBB 2BGLA 4FHEA 3FOCA 1FFHA 2NQTA 3IPLA 3FPGA 1GPUA 1O9BA 3T9AA 5JATA 4DCVA 4NHOA 3UBMA 2BBWA 1OLOA 3S1AA 1BDMA 1E20A 4KMRA 4DG5A 3L6UA 4O8ZA 2QNBA 4HADA 4EW1A 1NM5A 3CG0A 1UH5A 1QG4A 3P9PA 1XTQA 4EJ2A 4W5WA 3PJRA 4YLGA 4JQOA 4AS3A 1YI8A 3NHMA 2X5NA 4K03A 4K46A 4JQYA 3MQ2A 4HNRA 4CF7A 4RPLA 2GK3A 2LD4A 3MWDB 2PGXA 3BL6A 5E7IA 4CU2A 2H4YA 3F67A 1F14A 2ST1A 3EC2A 4MVCA 3KSMA 1PWXA 1JWBB 3W7AA 3EXG1 1F6WA 4Y2TA 1P0PA 2PBRA 3N58A 3PUHA 1AA9A 1IM8A 1QB8A 4CFSA 2J46A 3E0XA 5H70A 2Q4DA 3RGGA 4D9EA 4M88A 2G8NA 3Q7QA 1ZEMA 2YC4C 2M6KA 1HO3A 2TMYA 1W1IA 4MQLA 3MOGA 1KOGA 1ULAA 1BU5A 2XWSA 4U6QA 1E6UA 5AW0A 4XVUA 4EJSA 4B80A 4LTMA 1FRFS 3JQCA 4QU0A 1RHUA 2OUKA 1QTQA 4WCVA 1WLSA 1YU9A 3BA1A 3M2TA 5EY5B 3HJHA 3S2SA 1AKUA 4RTMA 3V4SA 2OO7A 2PZBA 1SKYB 3K72B 1AE1A 2Y71A 1YR7A 3JWGA 4PV7A 3W5HA 5K3BA 3B9RA 2HLHA 2O2XA 3TQHA 4LJ6A 1DGQA 2HC9A 5BOSB 5DK6A 1QZUA 2BGRA 2EQAA 4W9NC 3E22B 1D5CA 2GM5A 2CVQA 4DL9A 3NEYA 4TKUB 2GPNA 4TLDA 1X7WB 3D1LA 3L6BA 1YD7A 2YWFA 4QUIA 2A78A 3E6AA 2Q3EA 3G2HA 5AICA 4PSKA 4R5HA 3QOXA 3D8NA 1QK4A 1QKIA 2CHQA 1G8GA 1KYYA 1JIQA 3IDFA 3IMGA 3EZFA 4EP1A 3R77A 4QLBA 4DV7B 2OAP1 1LX7A 1BMFA 5AUPB 2IUSA 2J3KA 2X9NA 4WFIA 1KQOA 2ETXA 2REOA 2ADOA 4EG5A 2NV6A 3EEQA 1Z74A 2W48A 3NM4A 4N8DA 4WJKB 3UK7A 1SVKA 3C45A 2VYVD 4TQUS 1CUCA 4FFVA 1TT7A 3MCAA 2JAXA 3B6KA 3PHLA 1RC0A 3ENWA 1E3QA 3I04M 5K45A 1WXHA 2CJWA 1RZRA 3CKMA 1T8PA 1VJRA 1YTUA 1C4OA 2NZWA 1V96A 3GV0A 1ORVA 1D9XA 1GWNA 2BEVA 2PT6A 4J7CA 4XUDA 3RRYA 5JDIC 3RK4A 5JY1A 3OIUA 4AO7A 2OLJA 1IN8A 5I8ZA 3EOZA 5TSDA 1U7OA 1TRHA 3CURA 2DZDA 5EQJB 1JTEA 2QTLA 4ND7A 2IV2X 7MDHA 2Z43A 4BZWA 1O5TA 1EGAA 1IHUA 5ALQA 1UDWA 3H1PA 4IO0A 5KSPA 1X92A 3ACBA 5BN5B 3CCCA 4Q1BA 2VHEA 2PU5A 2F3PA 1UOPA 4AY5A 4FFRA 2UUCB 2CBGA 2LE0A 4H3VA 2I6FA 2ZYWX 4Z3OA 5B7PA 4RGQA 2VDMB 2X3YA 5I7FA 2FV8A 1DCKA 1RWKA 4LF9B 1DIHA 1JHQA 3W2IA 4AK9A 1PJ8A 1KZGB 1R0SA 1WCIA 3G79A 3DD5A 3TF5A 3UJPA 3VNVA 2FZVA 4RJLA 5A9SB 3OO0A 4YS6A 3HHPA 2IUTA 1T1GA 5K0ZA 2IEGA 5T7BA 4DMCA 5GZ1A 4BXOB 1NHWA 2C77A 4J3NA 2VHTA 3T0GA 2AG1A 3RSQA 1YACA 1XXHE 3LKDA 2V97A 1SM4A 1O4WA 4PIPA 1M0EA 2Y67A 2DUJA 4CCWA 1OE0A 3KEQA 3DDSA 5KREA 2AQHA 2GASA 2Z2ZA 4MIYA 5D86A 4CIDA 3QFFA 3SWWA 2GBFA 3B1XA 2EBFX 1XCLA 2E4UA 2OCPA 3KR0A 4ESHA 4ZYUA 4OGLA 4D8WA 5LDDC 3OQ6A 1NSFA 1V9LA 4A91A 2J0VA 2V7PA 4B83A 5BV8A 5CEEA 1LSOA 2HFJA 3JYOA 1RAGA 5TMEA 4GEGA 4PLTA 1JZTA 1R6AA 3PA8A 4MB2A 2VAMA 3FTDA 4MVWA 1JAXA 3K6KA 2AFRA 3D1JA 5D85A 5DN6A 3D4OA 3AEUA 3OE7A 3BFXA 3BA6A 1UWKA 2ZR7A 2P0EA 3IUBA 2IV3A 1PV2A 2R62A 1E92A 2VTEA 2JGDA 3AZOA 3G17A 2D0DA 3OPYI 2V7XA 4IRXA 2QUIA 2VP0A 4RD4A 4TKZA 3FWHA 1H2XA 4E3ZA 1SZDA 2C95A 5FIUA 2PWZA 4EEKA 2XNKA 3OJ0A 5G3ZA 3EGVA 2FPPB 3SX4A 4N8EA 3BE4A 3GJ6A 5KCMA 4BNFA 2HV9A 7REQB 2BI4A 1ZAKA 2GPWA 5E7MA 4J2OA 1Y3FE 2LZ0A 2NNLD 1UDBA 2AF3C 3INYA 1N3LA 4J29A 2BFDA 4WY8A 1BAPA 4B76A 4EA8A 1UKYA 3FPLA 5FTWA 2YMLA 4CXMA 3SPXA 3SQDA 1I01A 4E70A 1QM5A 2CDBA 2DKFA 2G5TA 2OBBA 2RHOA 2XUJA 4GI2A 2CMHA 3H4TA 1AF4A 4Y0AA 5EMHA 4DJEC 2PXHA 4DPMA 5K0GA 3FTPA 2JI7A 4YUXA 1ZCBA 3A58B 4M76B 2O07A 3MUNA 1SKBA 3NTUA 3SBDA 4RAQA 1FUUA 3SS9X 4MS3B 3K1AB 4DA7A 4DMLA 5AW2A 2GLXA 4AI6A 2F7SA 2YUIA 3DFUA 3D2BA 1D4ZA 1YZTA 4PLCA 2R8ZA 4Q4HA 4LYJA 4EHIA 1QFXA 5K8TA 1VKRA 1PYDA 2YWRA 3FNFA 1DXHA 3ENZA 3F3MA 3HJBA 4ID9A 3IPAA 4IYJA 4OAPA 3RSZA 5A3JA 5JDCA 5JUWA 4K81B 4R01A 5AJVB 2XF2A 3UYKA 5L95A 1X7GA 1F5NA 5K0EA 3EZ7A 3WGIA 2ECOA 3AINA 3F6YA 5BSUA 1G5RA 1G21B 4OUDA 4IG4A 5ALMA 5B6PA 2DETA 2GN4A 2BKUA 2VEOA 4PXAA 1M1NB 4B4VA 1DBRA 3DBRA 3BQ9A 2G9UA 5JROA 5TE9A 4NCIA 1M8JA 4RM3A 1FEZA 4TTAA 4I1RA 5HUHA 2X86A 3N07A 2AYYA 3VAZA 4B84A 4IIVA 5EZ5A 4MPJA 4NF2A 3KZKA 1UXIA 2ZVPX 3ECAA 3X2EA 4EYOA 2HDWA 1E18A 4GDMA 2Q9CA 5ALOA 3S5UA 3DZCA 4F3YA 5ALRA 3AOGA 3SQNA 4E3WA 4DV0B 3H5RA 8MHTA 4YXWD 2ENWA 1JQ5A 2QM3A 2ZR0A 3DL7A 3RIEA 3LF2A 1LS1A 1E6WA 3LQFA 1C9KA 1HYGA 1CIVA 1E0SA 1VLHA 3RE1A 1RXSA 3M6UA 3REOA 4ZK6A 2YV5A 2QUBA 1H0SA 4F6RA 4PBTA 3ZCTA 4K40A 1Z4OA 1VIAA 1UFQA 4JEMA 1Y6RA 3UNXA 4ZIRB 5BXYA 3IPXA 1VL1A 2E4ZA 2WSIA 5TF0A 4F11A 1VA5A 1N75A 4RY8A 4A8JC 3IMEA 1VJDA 4BNZA 2WPDA 3BFPA 4FUTA 3N6VA 5AKEA 2G5GX 2DLCX 4IS2A 3ZDEA 1XEAA 4AP5A 3KHKA 2RGGA 4W82A 1IEXA 5B2FA 1UXHA 3JALB 3H5NA 2IITA 3AV0B 3KOXA 1J49A 4R1PA 4RYDA 4HNTA 2BTEA 4FW8A 1JVNA 2E48A 2ECFA 5DIFA 2A6PA 1FDOA 3Q4GA 1PFVA 5DLYA 3ELDA 3PIDA 4N5DA 2HCBA 3SEFA 2YICA 4FEEA 3PNBA 2ZWPA 1N33B 1F4VA 3HBMA 1G3MA 1WMFA 5GP1A 3BGVA 3LK7A 4R9SA 4R0NA 1OU4A 4D9KA 2GBLA 3W8FA 1IB6A 3GOHA 3SMVA 3PKZA 5AOVA 5EXXA 4AJLA 5KBYA 2QB5A 2WUFA 1K4MA 3FAZA 4AD8A 3EVEA 3DEIA 1HZJA 1QQTA 4PQFA 3VUEA 3HZOA 4HVCA 1Y7LA 4PE5B 1QK3A 3OZVA 5MGNA 5DYYA 3JAWA 4EABA 1JS1X 1TU0A 2YRWA 1Q1NA 3F6PA 4XH9B 1BGVA 1MB0A 5B36A 2WQ7A 2GJAA 3RLFA 2QXUA 1HEYA 1HFJA 4BYMA 1XD8A 1RRKA 3IE0A 2J9GA 4PX5A 3BH0A 2JA2A 4URYR 3ST7A 5CGZA 1YL7A 4BQIA 1NMXA 3JZAA 4TROA 2VG8A 4CMIA 4ES6A 2O7QA 3LA6A 2IUEA 1Z6QA 2XB6A 3HBAA 4ARCA 4HP8A 4LC1A 3BMOA 5F5LA 4M9QA 2A35A 3ANSA 1UWVA 3CUVA 1JFLA 1PW7A 1WPXA 1EZZA 1GRQA 2PRSA 4FT4A 3R0XA 1M5UA 1QYCA 3EQ9A 2NXNA 3O2JA 3OOWA 1JVSA 1KU0A 1CX9B 1RAHA 3ZEIA 3ZZUA 5BWMA 1TMOA 4LF4B 4D0GA 3RS4A 3VHLB 2P3OA 2CFRA 1Z6TA 3I12A 3OX4A 4NZ9A 2GEUA 2ZR9A 1X9IA 4A27A 2QRJA 4ZT2A 1CR1A 1HORA 2Q3DA 3ZZTA 1T6BY 1E4EA 2BMVA 4HDMB 2PSFA 3M5DA 2BFCB 3G2IA 4XFJA 1XZPA 2NVBA 4GI1A 3JQ7A 3OTIA 3KVYA 4HY3A 3BYZA 2IYXA 4LA4A 1NJ5A 2IVZA 1VHQA 1NGSA 2Z5GA 3DW3X 4OBXA 1YL6A 3AEXA 4OGKA 5LL6P 4ZEOA 5FR1A 5JO9A 4L02A 2AB0A 1TJ5A 2BFWA 2YWDA 5I7RA 3GA7A 4P0TA 2CL5A 4P4SA 1R4ZA 4H4DA 4WKNA 1LC3A 2W2PA 1QP7A 1MQSA 3IVAA 1Z7WA 2YW2A 1KIFA 2RAFA 3L40A 3JTEA 4IIJF 2CJFA 4JLKA 1Z6PA 1OLXB 2BZ1A 3NC4A 2C04A 2W5UA 1X8XA 3QG5A 1QUFA 3K0FA 3DD1A 3K2EA 2B8TA 4U2CA 4GMDA 3NVKI 3LTNC 3NBUA 2V0NA 1FMFA 2A0UA 1FVXA 1QGUA 3H11A 4I6JA 3V8BA 4B09A 1P7YA 1XYYA 2C07A 1ORIA 2NTVA 3GUYA 3RFCA 4C7BA 4C89A 5KQSA 1JAYA 4M1WA 1PKEA 1T43A 3H1AA 4KE6A 1BD3A 3C4JA 4GSKA 2QSYA 4RMNA 4GZ5A 5AD1A 1IONA 1RJGA 2HLPA 3VYVA 1REQA 1NBMA 1NW9B 2NSJA 3U6BA 3C5HA 4PTYA 2YX1A 2PUCA 3OWOA 3Q6NA 3Q3VA 5AI6A 1ISHA 1A5SB 2B8EA 2WHYA 3CLTC 1IIRA 3B6IA 4MP6A 1N0UA 2ICAA 3DO6A 4LEIA 4QPJC 4XQ9A 3ZWCA 4BTVA 2NU8A 2QE7D 4HDKB 4JQCA 3D2LA 1HDRA 1XTSA 2AOWA 2FPKA 4WBXC 5CDFA 3WNZA 3C16C 1P0QA 1G8YA 1OR8A 5REQA 4WK4B 1PGJA 4O2BA 2ZS8A 1XRQA 3NWOA 1LV8A 1QFYA 1RLOA 5HDBB 4OQFA 3T5BA 1IN4A 1SCKA 5B12A 2HSDA 4OX9Y 2KPOA 3ER6A 5ESWA 1KHTA 5F35A 4DCSA 4V38A 1KPGA 5GV8A 4W8GA 3STYA 1JF8A 4BECA 4YDQA 5DHRA 2A5FA 2QGFA 3LFUA 4LE1A 6REQB 4ETWA 3R0IA 3IJEB 1MFPA 3ZWAA 2GETA 2XCLA 2X0JA 2PPVA 5IN4A 1HH4A 2BP7A 3GQVA 3R3XA 3TZEA 1KU6A 4CLEA 4UAGA 1T3TA 3QVWA 2G1UA 1LDEA 4G97A 4RHFA 3AKZA 5JQGF 1ZISA 3AVPA 2PKRA 1GQOA 3AH8A 3H5VA 4PGFA 4BYGA 4AB1A 1JLLA 3PUIA 2DSTA 4OQNA 2VNIA 4EF4A 5BV1A 3AUTA 4RTJA 5EIAA 3LCVB 4PN3A 2V7EA 1ZU4A 1C4KA 3KVRA 4REMA 1GUDA 1XALA 3EC7A 2CKDA 1VKNA 2OCYC 3PC4A 3KYCB 2ZOSA 4I3FA 4S24A 4TXLA 2NUAB 4F04A 3PC7A 3EXHA 4CGZA 3LP6A 4RXUA 1LEHA 4ME6A 5FR2A 2VPYA 4BNKA 5AK5A 5LOVA 5TQ2A 3IEUA 4TT8A 1SG0A 2H4JA 3ETNA 2IV7A 3BAZA 1Z37A 3ZWOA 4FOOA 1Z56C 2PO5A 4MIKA 1TEXA 3D7RA 3HV0A 1EQUA 4PWYA 4RAOA 5HX7A 3FD8A 4L50A 1XZIA 1IQRA 1Q6ZA 4I1SA 4H7PA 3UFXA 1JDBC 5P8WA 1QO0A 3NOVA 3QYJA 2NMVA 2XVZA 1JB9A 3EDMA 4LJYA 8ATCA 4GEKA 2EX4A 1I3NA 1XXLA 2YVQA 3CNQS 2R0QC 1HG1A 3D4NA 3TQIA 1K6JA 5L40A 1T5TA 1SFRA 1GD1O 4BWVA 3W5CA 3SZLA 5DWVA 4QLOA 1GARA 1KWKA 2WT8A 2DBQA 4BB6A 1WS6A 3AP3A 4BNXA 5GM2A 1U0RA 1QTIA 1VPLA 1WSBA 1N6NA 1AB5A 2WHQA 2FTKE 1MVOA 2X8JB 1HL3A 3QVJA 2C3PA 1EB8A 2WJHA 1VCHA 3WIDA 2ETVA 2YDXA 3J7TA 5D5QA 1NW5A 3TDNA 1WE2A 3KZXA 2EP7A 3TL6A 3D81A 5CFQA 1DV2A 2OYSA 3BWDD 5H0IA 3DE7X 3L0CA 3ZNPA 1KF0A 4Z7NB 3K6SA 4X20B 1GQSA 4AUMA 5DLPA 4QZVA 4MW5A 4AIIA 4D4HA 2A5LA 1T4CB 5AIBA 3KDPA 2WWFA 3OFJA 4DJ5X 4PLWA 4EK9A 3FLEA 1IH8A 4KXFB 3HACA 1AXGA 2VTKA 1XIVA 4K6GA 3OI7A 4J8PA 4JUBA 1GPYA 1T9HA 2ZK7A 3QUTA 4LOHA 4MTCA 4QYWA 4UUMA 2GPSA 1RAIA 5EMNA 4ZOLF 3DQPA 4Y1EA 2CZCA 2FPIA 3NBAA 1ZIDA 4Y6GB 3VU1A 5GONB 1XQWA 1E59A 1ENZA 4OHMA 2I67A 3BMNB 3QFTA 4YRFA 4GPTA 1E4YA 2QVYX 1EWKA 1SVLA 2X41A 3C3CA 3KCQA 4O4JB 2R5WA 1YQEA 4TTVA 4TV9A 4UTVA 1FXSA 2HX1A 4G2NA 4PBSA 3VH1A 4Q1EA 5D84A 5ERGB 2VYFA 4QDUA 3T4XA 5IMSA 1KYXA 4EHLA 1ABBA 4DR2B 1ZM2A 2Y2VA 3DWIA 4DT1A 2PKCA 3Q6IA 4OSEA 4CMBA 4GQBA 4COOA 9ATCA 3RO7A 2FF5A 2XODA 3V48A 1V8OA 3IHWA 5LQUA 2OMEA 3CZ5A 3UJ3X 4EO4A 4ZYVA 2OCKA 1T3GA 2YZ7A 3TTXA 3ZQUA 4C43A 2I3DA 4PGMA 3A1SA 4MWOA 2CEKA 3PXAA 1I1QB 4KSYA 3KE8A 4NKRA 1S2GA 5BXQC 2O2ZA 1U2TA 3PX2A 3LY9A 3N0VA 1N6LA 3AEQB 3P27A 5COQA 5G1PA 3Q41A 2EZTA 3JXEA 3HBLA 1OFTA 5JSZB 5KWVA 4OSOA 4I5IA 3TMAA 1NJGA 1IL0A 5D2CA 3ZDZB 1H6CA 2A86A 1N1MA 4HEQA 4TMWA 5C46F 2A9JA 3ONWA 2ZJOA 3LQ1A 1LTHR 1UMCA 3GLSA 4PSVA 1U9ZA 1YV9A 2EW1A 2IYPA 4TUYF 4LWOA 2OENG 4Z9BA 1LI4A 4AXBA 4KTVE 1LLCA 2HW8A 4XJSA 1PYGA 2FWIA 3D6VA 4XPIA 1I0LA 1HQKA 3WWEA 3Q5DA 5BORA 2AE1A 4NZZA 4FGKA 1BRMA 2ZRBA 1UMBB 2VOEA 2XB4A 1FNDA 3C1UA 3HYCA 4IOMA 1KIMA 3RSCA 1JMKC 1PR4A 1X8KA 2P9ZA 3QHAA 4URWR 3TKAA 2FLWA 2IEIA 3VPAA 2PEZA 1DAMA 3AESA 4P31A 1JEAA 1FJHA 1PE0A 2W8BB 2Z95A 3NZEA 2JK1A 2Y05A 1T2VA 2C2HA 3A0RB 3EIUA 2ZU0C 4A8PA 5AOBA 4BJHB 4FKMA 3K16A 3PQ5A 4HQRA 2OORA 3BFJA 5CM9C 5AM5A 5SYMA 5F23A 4GYJA 2VA9A 3FY4A 5EHNA 4LSWA 1ECGA 3I6ZA 4GNRA 3SKVA 4LNHA 3KQNA 2DPYA 1P3DA 1YHNA 5JCJA 1T8UA 3O0TA 2EWVA 4IL5A 3LCMA 4ZVKA 2B69A 3RWMB 2WF9A 2FFHA 2ERXA 4KO8A 3HZZA 4ZEXA 4J6FA 4HX2A 4TLBA 4MVJH 3LT0A 3DL4A 3VNAA 2EW2A 2Q5QA 3PD1A 1NZJA 5DGTA 3R74A 4ZVRA 4BQNA 1K3TA 3F5QA 3EWNA 2A5YB 2ON6A 4ZJPA 3A6KA 2G88A 2CZQA 3G0OA 2XYPA 4M86A 1CDOA 2GGSA 2C1EA 1P4JA 2WA2A 5LZ8A 1QS0A 3OMLA 2ZROA 3P5BA 3WX0A 5HEKA 4IIYA 5FUQA 1CK4A 2O8BB 4BY9E 1O6GA 3F78A 3K73O 2M6SA 5DE3A 3SDZA 1G5QA 1M2OB 3G7SA 4RDHA 2ZRNA 1EVKA 2ZE6A 2IYSA 3FWYA 3WQBA 1E5DA 4FEGA 3PHCA 5KC9A 1SIUA 1QGOA 3K32A 4JROA 4ZO4A 1YDGA 2CVOA 1IM5A 1ZCAA 2WD9A 5JI3E 3DCNA 1WD7A 4IVNA 4WECA 3ZBUA 2QTAA 3RVOA 4D57A 4ZFNA 4WZ6A 5CFLA 2PXCA 1E1NA 3G1WA 2HJGA 3TUJC 2OLKA 1XJQA 1A7JA 3DVQX 1M66A 3E9MA 1GXSA 3UUGA 1GCOA 3AF5A 3EHDA 4A6DA 1CLUA 2FPUA 1NF2A 3IODA 2F8TA 2D5LA 5KYGA 2NNWB 1TIPA 3CX7A 3G2OA 3HVKA 3MGGA 2X22A 1SUCA 3UK0A 1Q2XA 1T4MA 1NI5A 3Q2IA 5A6SA 5IM4A 4V0SA 4GMFA 4D3XA 4F2PA 2V45A 4EO9A 1EWVA 2PFGA 3AKDA 3ROGA 5CCBA 3ZHTA 5BYKA 2HM7A 3JARA 4JR0A 2HO5A 4HAXA 1MOQA 5F9MA 4JJFA 1ID1A 4FMBB 1LPAB 3LT1A 3D8BA 1VIMA 4GYYA 1FFSA 3HU3A 3C8ZA 1YR8A 3QGMA 1EBBA 2XSZA 3B82A 5BSHA 3Q98A 4YJKA 3CJQA 3GB9A 1MO2A 1DVRA 3C6ZA 1QBGA 3HXLA 4ISBA 4N01A 2D1FA 4G1CA 3NHWA 5HOEA 1XZGA 4KQHA 5LYJA 1QCZA 3W2EA 3CBGA 2G4CA 2XLCA 3EQ2A 1PL8A 1JQ3A 2IGTA 2AWOA 1J6UA 1U2PA 2P7HA 1L5MA 3MYRA 3TLXA 1UBOS 3WRVA 4BNMA 3MLAA 5EP2A 4AAYA 1OJLA 5A0FA 5K8IA 2WU1A 4HZIA 3FRHA 5EESA 2Z57A 2C2YA 1DSSG 3I23A 3LWBA 1HM5A 4UM9D 5CYGA 2O6LA 2R4TA 1PR0A 3BRCA 3NKLA 4EG1A 5ED4A 1IC6A 2QV7A 3BQNB 3GQBA 3RS2A 1WHSA 2FHSA 1UMDA 1WPGA 2XDAA 3MUEA 2BDTA 3F7OA 1U0BB 2OC4A 3EUWA 4ASUD 2BI8A 4UOZA 1USVA 1TZCA 2GTIA 2ZUTA 5LQKA 2DWCA 2CXTA 2WJYA 1J56A 2AG8A 2CVFA 2FKAA 2PUJA 3T5AA 2HHLA 2KLBA 1YT5A 3AF6A 1Z5ZA 1Y5MA 5ITZA 5C1IA 3E9EA 1DRKA 1MVNA 2OPHA 4MTLA 1NUSA 1HBJA 4MCAA 3W3AH 2VIIA 4LJ5A 4QBGB 1Z28A 2PO7A 3A7DA 2YJNA 3I01M 4NFHA 5C81A 4F93B 2Z2IA 4FLMA 2GFQA 1XC7A 4J16A 2HTFA 1KC1A 3CRMA 4B82A 4C04A 1C50A 1XQVA 1RPJA 2O4UX 3D8TA 3VFDA 2UXCB 3O2NA 1CZRA 3EAQA 1IN7A 1KQ3A 4MUJA 4GUDA 1EA5A 2Q4TA 1Z6GA 1M9NA 5DOZA 4ZRNA 2IU6A 2G1KA 4L9AA 3LPCA 2ZE8A 4YACA 4ZHQB 4GZ3A 1OTYA 2OGUA 4XWTA 3SNKA 3RR2A 2HB6A 3SIRA 5HRUA 3IEXA 1MT3A 4B5KA 3EEYA 4IJKA 1I1OA 4AZTA 2HCFA 1MNAA 3N8HA 3V8VA 5BOSA 3AUAA 2O8EA 3E35A 3RQIA 1RYFA 4LXGA 3H75A 4Q4JB 4NU5A 3ZDQA 4D0SA 1P1RA 3MTQA 2KYRA 4QQKA 2GAOA 1N92A 3ESZA 1HKUA 1NZFA 2P0AA 5HVNA 3B36A 4HTAA 3K70D 2TRSB 3P2MA 3C5EA 1D4FA 3GJYA 2VATA 1FMLA 4TWZA 3AR6A 521PA 4ER0A 2FG5A 2X2OA 2EC5A 3O8LA 3AOEA 1EP3B 3WSWA 4ZCTA 5DNWA 3MMXA 2CNWA 3RVLA 5FOQA 3CUWA 3A1EA 4B4WA 5E6SA 5HTKA 3VSAA 5IFKA 5JWOA 2OEPA 5HKKD 1ZIPA 2O0HA 2PIAA 2OFFA 3H5LA 1OB2A 1E60A 4B31A 1GTRA 2O8FA 1E6LA 1F4PA 1GVHA 4MW9A 4QASA 1TYAE 3G8BA 1B73A 4OQXA 2H48A 1EEXB 2YIMA 4OJKA 3PPXA 5B1DA 3LPMA 3T5DA 4MUFA 5L4NA 5DWDA 4L51A 3VR2D 4KGVA 1AHPA 4ZAXA 5FOUA 1C3VA 4F72A 4PCLA 6YASA 1N7HA 1VHTA 4UKDA 3TNLA 3U44A 1HI9A 1QO7A 5ECDA 1ZWKA 3QVOA 1OA1A 1G3UA 3CZPA 4ZT3A 1SHJA 1IQPA 1XDBA 2AOTB 4MDHA 4PZDA 2YYSA 1ZQ9A 5EPUA 1H4TA 1CQJB 3EDCA 1F06A 1EU1A 4OBEA 1SNYA 1MOSA 1ZNXA 1CKEA 1ZSVA 3BHIA 4UBKA 3K2IA 3D3WA 4MULA 4P4LA 5K09A 4M8IA 3BSSA 4ZMRA 3D7KA 4KGZA 2B25A 2JFQA 5BVHB 1VC2A 1NJ2A 3GLGA 4O1HA 1W85A 1MBZA 4H3KB 1OIWA 1P4HA 4WIAA 5I7EA 1TEVA 1U2DA 3EFOB 3RRNA 1Z47A 3QPAA 3WTBA 3NTOA 3TQOA 2IXBA 1CUYA 3DCJA 3K09C 2AOUA 4IHQA 3KTOA 1N1EA 1SD1A 4UW9A 1RI1A 3M81A 1F2VA 3ZCPA 1OBFO 2Y1DA 2ZQ5A 3U3OA 2A7XA 2XT0A 3WK4A 4CLOB 4P0PB 2DERA 2B8NA 5FBWB 2ZJ1A 5KEIA 2NVUA 4G2TA 2DPXA 4LYYA 3B7WA 3PS9A 4KN9S 5AQEA 1XPRA 1ZW6A 3W06A 4PC3A 1FX0B 3OCYA 2JIRA 2PLNA 5SYNA 2PKQP 5BN1A 1EZ4A 2F62A 2FSVA 4FXOA 1RXCA 1L7BA 1VCNA 2CHGA 2OD9A 2WIAA 3E7XA 3EXIB 4K9RA 5DBFA 5AXCA 2I6UA 1E1CB 3E1KA 2X6RA 3D7NA 3E9QA 3FNBA 5KHOC 5KDDA 1S2NA 1TK2A 1BWQA 1MT0A 2JFUA 3OFNA 2G70A 1S5PA 3UXMA 4NMLA 4JVNA 4LZWA 3U3ZA 1TYDE 3VH4A 1EG7A 1X74A 2ZZKA 3ONDA 1HRDA 3LJKA 3QPDA 4GI5A 1I4OA 2D1TA 4M0KA 3OQNA 3UA3A 4KX3A 4YMHA 3DONA 4RHCA 2CF5A 3AIKA 3N2GB 3O91A 3C39A 3E9DA 4GI7A 4NS1A 5H9VA 5HMMA 5JBNA 3P0HA 2PSJA 4ZI5A 3BEOA 3OQIB 5AFSA 4DW8A 4X7BA 3NWPA 3AT1A 721PA 4N48A 4JOSA 1S8AA 3ML1A 4PZUA 4X41A 3L92A 5HZKA 3K9BA 2ZRIA 3UHPA 1ULUA 1CR4A 1Z5VA 2H2IA 1NQ5A 1TGYA 1YA8A 5LWQA 1U65A 4LOLA 4B3RB 1Y9DA 4ZQGA 2DYKA 2YDYA 2IHBA 1R0KA 3ER8A 3QE2A 2C7QA 4UQOA 1RP7A 2ZS7A 4ZICA 1GDHA 1EGHA 3OZXA 3DW1X 3LO8A 4PYQA 2FK7A 3R44A 4CLRA 3ZK7A 4AMYA 1AV7A 4MVJI 3U7HB 4Z7JA 4QUDA 1EXVA 3EG5A 2RIPA 1HETA 3TTVA 1Z0DA 1TCCA 2HJHA 1CS0B 2HZ7A 4BBZA 3BRQA 1KWGA 1H0KA 1Q5PA 4RJIA 2ATVA 3I0NA 4GSLA 2O7RA 2VRCD 2XUOA 3F3YA 3QU7A 3HXKA 3E15A 1XCPA 3RHTA 1G1MA 4OPMA 3ZLTA 4YR7A 2F67A 3MT9A 1CETA 2FAXA 2VT6A 4YBRA 1B2RA 1M34E 1E7MA 1H85A 2XQKA 3JQPA 4FDUA 4MV6A 4YCJA 1EXWA 5K2MA 3W5VA 4EIWA 3WBKA 3ENQA 221PA 2QX8A 2E5WA 4DLUA 4QAJA 2ZM5A 3ZDCA 1PX0A 1XJWA 4DIFA 4CKWA 2B34A 3TOVA 4MJ3A 3WFJA 1G2QA 3ORSA 1M8KA 1NXWA 3QYFA 1B26A 3TL3A 3C6KA 2FE1A 3PL1A 4BFYA 2WKSA 4DWWA 3ZE2B 1ZCFA 3CUSA 4JI8B 3ZBTA 1GRCA 5E6UB 2LW7A 1J22A 1EVYA 1R27A 2ZB2A 4KMMA 2NYVA 2UYYA 3H05A 2DUMA 5FTMA 2RGBA 1TJ3A 2VK1A 2VSYA 4FEYA 4UREA 3LNTA 3H1TA 1DO8A 4UNSA 5FWNA 1HMYA 4LHEA 2JGMA 4KPEC 1YDHA 1LWOA 3HJRA 1BFUA 1ENYA 5HQTA 3LA8A 1O96B 2JI6A 3IMCA 3KCNA 1UK6A 3KQVA 3C85A 4HAYA 1UKBA 2HNKA 4XWOA 1UBHS 3QKUA 2HKIA 4G3XA 4JP2A 3SZRA 5HE8A 4LYHA 4YV7A 2HCJB 4FQ5A 4ALKA 1H0HA 3A4MA 4OB7A 1G5TA 3QY9A 4FYPA 1M6HA 4MINA 4RWEA 4WH0A 5B3LA 5IJ0B 1DTEA 1U80A 3BSFA 3C74A 4FJ2A 3V6MA 4EW2A 4R69A 5I9IA 1VPVA 3OEHA 3Q11A 3KOUA 3T3EA 2ZU6A 2Q1SA 4DR6B 4CKEB 5A0TA 4Y0VA 2Q1UA 5DLQC 1ORTA 4J0DA 1F2UA 1VQ1A 2B1RA 1F6DA 1LSSA 1WB4A 5FOXA 4NU6A 1F8GA 4WLVA 4JVMA 1ZBQA 1LLFA 2O8DA 1ISFA 2L18A 1LPMA 1PJBA 1FDRA 1EH5A 1Z17A 1Z83A 1L4EA 1ZNYA 3N7UA 4R2KA 1Q0PA 5EIHA 4ZT7A 2VDLB 2PE5A 2A9FA 3HL4A 1TVKA 5CK4A 5LB2A 4ZV4A 5EKUA 1FQOA 3BBLA 4BEBA 4XDGA 2X4DA 5J59A 3N2NA 1NVBA 3UC9A 1G4AE 3Q1LA 1AOXA 4WE3A 1I7SB 1H1TA 1IPHA 3AK4A 1E79A 1I10A 3QVXA 2QTCA 1KK2A 3UO8B 3CNOA 1JAHA 1OU0A 2FZLA 1AQNA 1CE8A 2I33A 3U2QA 2WZCA 4FHFA 1QYIA 4WY2A 3JQEA 4AJEA 1AMUA 4Q19A 1O95A 2V58A 2B9EA 3PWTA 3QH4A 4X24A 3TIFA 1HWYA 5EP4A 4F5YA 1OSNA 2Q1TA 1Z15A 5JSUA 2V9ZA 4Q3KA 3ZDBA 4KREA 5HXAA 4NOKA 4B40A 2XQJA 5T5QA 3UXYA 2WWHA 3UWDA 1E4VA 1DQZA 1W36C 3KJGA 3U3MA 1TE2A 2PT7A 2V7UA 3E2MA 1JVBA 4GI3A 1SC6A 5FFMA 3F2VA 1Z7BA 3JWJA 3N2IA 1RWVA 2ZB3A 2QZ9A 4PPFA 1QB7A 3DKKA 2I2WA 3DLAA 3PYMA 4K8OA 5JC1A 3JD1A 3BSYA 1KP9A 2OUIA 3G2MA 2B2NA 5E9JA 2EKQA 1U2GC 3KYDA 3OUZA 3PGXA 1D09A 5DASA 3BE6A 3WWDA 1MAVA 3MTEA 2JGNA 4ZOCA 4F5DA 1P7PA 1DDIA 4YP5A 2BEKA 2VJCA 2GUWA 4A0SA 4V3CA 4BS9A 2L17A 3SEAA 1KEEA 3LPNA 2AG6A 3PJEA 4OHOA 1YRLA 1U8FO 5TMPA 3EEOA 2E4AA 4CF4A 4IDOA 4JOBA 1AK1A 3NRJA 3E82A 2BISA 1SBCA 2HBZA 3HDGA 3IDOA 4A36A 1R6XA 5B3JA 4HGPA 3FWKA 4F4FA 1O3YA 1QV7A 5GM1A 1XTKA 2XPCA 3O75A 1P5RA 2IPMA 2C58A 2CE7A 5M7EA 1KEKA 1GTJ1 2IIQA 3O26A 1MIOB 3R0VA 1HDZA 3O4IA 3AM4A 5DM2A 1IBLB 2CBXA 4DCPA 3R3WA 1VBNA 2WR8A 4OK3A 4AP9A 3ILXA 4UMEA 3PF9A 2IBTA 1F8YA 1P17A 4LRUA 2Z83A 2R7MA 3CZMA 4N7MA 1Z7YA 3QLTA 1E5LA 4H9GA 3I1IA 5IW8A 4BBJA 1QUEA 4WGFA 4ANFA 3A37A 1LBEA 1UC9A 5KOIA 3W8DA 1GNSA 1J4AA 1NBAA 2WU3A 4FR5A 3MAJA 5IZ4A 4GX1A 2GARA 1IN5A 2XTZA 3FM9A 5CT4A 4CQLB 4CM8B 3IVMA 2CLCX 1I3CA 4HV4A 3A4TA 5ICCA 3O3NB 4MV0A 2A3RA 2ZCJA 1L4LA 4BRZA 4N8SA 2YOHA 1F60A 2L69A 2GR9A 4TQ9A 2V8OA 3J81A 3MWJA 5BMVF 4K9DA 3A32A 1NBEA 3U09A 2PANA 4NZPA 2VHCA 3UA4A 1H94A 1Q12A 2AVNA 2J5KA 4TQAA 4LOAA 2P6RA 3R1IA 3OZFA 3UWMA 5L7WA 3S3TA 3GHYA 4YRMA 3JQQA 1UM9B 1GN8A 4M3NA 3N87A 4W1RA 1ZG3A 3EXAA 1TAHA 1V5WA 5ADVA 2VDPB 3L6RA 1SELA 3NOQA 4MW6A 4L1KA 3BXEA 2VHXA 2GO1A 5B1EA 3H9GA 1XTVA 2JFYA 1CUJA 1XZ8A 2CXNA 2GHIA 3EDQA 3IURA 1TA9A 2BFMA 2CD9A 2WHPB 3AZQA 3MTIA 2WSLA 5TGZA 3UAWA 5HK9A 3VTAA 1ZN9A 3HZRA 1ZK0A 2P2SA 1G7CA 4AMUA 2FVXA 3IVRA 2I65A 4JYZA 5KOHB 1L5VA 2CNDA 1GGJA 5AVZA 2OZEA 3HB0A 1LTQA 4MR9B 3UJ8A 5IPFA 3ITDA 3T06B 3JQGA 2GPYA 1KGSA 2I7VA 2FQQA 4KE9A 2QQ0A 3M1LA 4JLBA 1TM7E 3TKLA 2H4XA 3ZLVA 2PYDA 3SZOA 5JALA 3GJQA 1EP9A 1NVWQ 3IOEA 3BDIA 5DXAA 1P7CA 2EZUA 3IKVA 1GA1A 3T9BA 3W4IA 3O21A 5CITA 2O5CA 2P75A 4DVJA 4DB4A 2DVMA 3ZNNA 1KL7A 3A6EA 1FZTA 1JDTA 2DFDA 3OC0A 4A8HA 2QTNA 1XA0A 2EQ5A 1PCXA 4MWCA 4K28A 5JYDA 1NVFA 3G0BA 3GH1A 4G0VA 3DV9A 3LM8A 4PONA 4MA0A 4LJ4A 1LPSA 3AR8A 1S8FA 4R40A 1GCIA 4GXNA 1TADA 1JA1A 3B1ZA 3M0EA 4GWGA 5LA6A 3IELA 3HN2A 4I66A 5LBTA 4ZI7A 3FJ1A 2QE6A 2DSNA 3QKSA 3WO0A 3U4QA 1DQYA 1J9GA 2C83A 4PQEA 1PR1A 2OFPA 3FZNA 2JGKA 4KQIA 1JQEA 1KJQA 1QSGA 5JTTA 3ZWPA 1GSOA 1DFIA 2YQ5A 1UF9A 4EVQA 1Q7RA 3UCEA 1CF2O 4DGSA 2VBGA 4BLUA 1YQGA 3PFBA 3JQBC 5DRTA 3ODPA 4BNHA 3S70A 2RHGB 3HGQA 3PNKA 2Q8PA 3IMKA 4IXWA 1ELOA 4CM3A 3GGGA 3OLQA 3NHLA 5ES4B 2OV4A 1K97A 3LVFO 4PINA 1CUXA 2O0KA 5IK2A 1Y1KE 4EPRA 1JI3A 1C0KA 3GZNB 1ID8A 1NJ8A 4UU7A 1PK7A 3H2SA 4QOHA 4QXRA 5DCWA 1LPPA 1R10A 2Y9PB 5BV2P 1PNOA 1H6DA 1I6KA 2CMFA 4OXQA 4CN9A 2IGBA 4E22A 2IS6A 3DHNA 3LTEA 4Q4AA 1VE9A 2POCA 3TRDA 4CETA 3HR7A 4AU1A 3FOEC 3IQXA 2D06A 3EA4A 2CVZA 3T52A 3GDGA 2XAAA 3R9WA 2Q49A 4M2LA 2HJSA 3HLYA 1WUIS 2JKVA 1LJLA 4JL5A 4BVAA 3KJEA 1SXJC 4M87A 4Y9RA 2C7RA 1NN3A 3TBKA 1L3CA 2E6UX 2HT6A 4TLAA 2FWBA 2HUPA 2XMPA 4X66B 1JWLA 1DAFA 4BP3A 1GFWA 2IE0A 2VZ0A 4JJ7A 5C8VA 4RTNA 5JXIA 1ZA2A 4JIMA 1PT5A 1MXHA 4ZCPA 3VOAA 5K0TA 3I5AA 3N75A 2IODA 4P83A 4W9MC 3WGUA 3ES9A 2CMGA 4LX0A 1SUBA 2BMAA 5DPMA 4N3BA 1KSFX 1HTWA 4JJ8A 4HNSA 1O9HA 1NX9A 4JB2A 1N8NA 1ZINA 4CZ2A 1JKFA 2G4LA 3I5XA 4PQYA 3MMNA 1OI7A 4P32A 2A0WA 5ALLA 2OWDA 2UZ0A 5TRTA 4QD3A 1T15A 1EDOA 2QLTA 3ZE1B 3IXQA 4YCCA 1Y3HA 1C7QA 1E5TA 2QUJA 1EB9A 2QTVB 2XUQA 3CLTD 3GJ8A 3R5FA 3WLOA 5IC6A 1ZI9A 2P6OA 1GKUB 5F2EA 2RBKA 3AG6A 1ONPA 4FYJA 4RHTA 4F91B 2XTMA 5AUNB 3QOFA 1R9JA 2V1UA 3IV6A 2IP4A 3ILVA 4G0MA 1AV6A 1ZRHA 4YCBA 2D5IA 4BAZA 3L1UA 3CS3A 3KKPA 1GZSA 1AN0A 3A9RA 4BGEA 5I51A 1JDPA 3DV0A 2H1SA 1KAHA 2QR2A 2GB4A 3OM8A 5JPIA 1H1LA 3E8SA 5AJZA 3RBZA 2JGJA 1CEQA 1NVMB 2Q41A 4U7JA 3VSCA 1EXMA 3AR7A 1TFUA 3SC2A 1XZMA 1IRXA 4OHVA 3RS0A 3BTVA 3BWMA 3L82B 4QUAA 3ZHZA 3A1WA 5CURA 1SD2A 3OBIA 1LS6A 3GPDG 3ORQA 4HDSB 3WGZA 5LP6A 1Y8RA 5F77A 3GJ7A 2ZUCA 1AM4D 2AZ4A 1PQ4A 4Q34A 2IYFA 1PV1A 4TS1A 4WZBB 4E2XA 2AIRA 1OX4A 2HGZA 2OKGA 4NYMR 3V34A 4EO7A 3TE6A 2OO5A 1L6RA 4M7WA 1GT91 2LIPA 3TFOA 4JZYA 2OXEA 3FB1A 4IHKA 4ND3A 1Q17A 4DGQA 4ZREA 3SSOA 2JFFA 2PIDA 2GWHA 3N7TA 4XD7A 4NYIR 5DFAA 2GBCA 2CGEA 1I9GA 2C96A 5F78A 4WXEA 1PEDA 2ZAOA 2H9YA 1JEYA 1SHLA 4IZ6A 4O2AF 4YWJA 1GZ6A 1II0A 2W71A 3QVGA 4KODA 4NG5A 2Q5FA 2AI1A 1R5OA 2YY7A 5KTPA 2ZRPA 3BGIA 2HPZA 3GU3A 2RAPA 4J9UE 3K2QA 3S8MA 2YWBA 5TLSA 3EXFB 2AFHA 3NASA 5C7LO 3IEKA 1GEEA 2PYZA 2YWEA 1YMQA 4KAAA 3TK1A 2R2AA 1UM8A 1J0EA 2ZRAA 3I73A 4F5EA 2YBEA 1NUPA 1T6NA 2KLHA 2O0JA 2PVPA 4HQKA 1P1HA 3VU8A 4PZCA 3DKVA 3KTDA 1VLMA 4CI0B 1ISRA 1DWPA 3OT1A 1AB6A 1CLEA 4ARVA 5C5DA 3VUFA 2O3QA 2IUFA 1KZ9A 1RYBA 1WV1A 3G0CA 1L5WA 3HV2A 4E2WA 1BSVA 2ZDQA 4FGJA 2BE9A 1EYZA 3P20A 3PVCA 3DXYA 3UC5A 1W4BA 4FFBB 1L7AA 4B0PA 1KKMA 1T3SA 1WVGA 1JHMA 1Z6YA 1AU9A 2I4OA 2IDKA 1AXRA 3FKSD 1RQXA 1QFJA 1E9VA 4YLEA 1YQTA 1ZXBA 3LKZA 1BGXT 3S99A 3V7YA 1PEKE 3VJKA 5HRCA 3IGFA 3B1JA 3BPSA 5KJ6A 3WGJA 3R20A 5DNAA 3ND6A 2ZUFA 5T4EA 1FK8A 1LBSA 2CK3D 2PGAA 3CRW1 1K92A 2JIZA 1Y80A 3GLTA 3LYLA 2PX3A 2C8JA 4MX8A 4MW0A 4IUDS 5JE8A 4C4YA 3CVXA 3STWA 2PRJA 5F4ZA 1LDYA 2Z3WA 4DIOA 3KWFA 2P5TB 2GOYA 1YR2A 4DV4B 3R75A 1SOMA 4I4LA 1Y7PA 2R1ZA 4I50A 4J9VA 3UHAA 1GYPA 4WNCA 4QHTA 1JDBB 5ARCA 1OKKA 3IYLW 3WGNA 4D99A 1B6GA 1TKRA 2IELA 1SVNA 1A4XA 4YWHA 1R12A 3UKOA 2MSLA 4KACA 2ZR8A 2LVBA 2VHZA 2QYSA 3KLNA 4KGDA 4RJ2A 4YAFA 3S2GA 4GH5A 4MCHA 1XMIA 2I03A 1ZGBA 1NW7A 1YUNA 3ZD6A 4M9RA 1NXVA 1YIOA 2JFPA 5KDLA 3OOEA 3S1AB 3ZQ6A 4C3UA 3S7TA 3TNJA 3U48A 3VSBA 4BJ6A 4CUKA 1HNWB 2QM7A 3IJ5A 3ABOB 2EZ8A 4R1NA 3V4OA 2LUOA 3O8DA 2X14A 3ZPXA 2W2KA 3FHCB 1NA5A 3KEOA 1KK1A 3ZC3A 2WHRA 3C8HA 1DKRA 5K0FA 2QX6A 2GHRA 3NIDB 4AKHA 3GEGA 4L8GA 4P3XA 1YZLA 3MT8A 4AY2A 1ZX1A 2V98A 4LE0A 4Q7LA 1AHIA 1E1RD 1YRHA 2XA1A 1D2EA 5D01A 3R0ZA 5G4LA 3HM2A 1AUOA 2O1WA 3QVMA 4UXHA 5MHTA 1ABFA 1S4QA 1SPBS 4UUOA 5JFGA 2JIQA 3ZJUA 3SYLA 1GAEO 5F1KA 2IW1A 5JXGA 1NQUA 1HMPA 1IHPA 1H2ZA 4MGZR 5I3CA 1M6YA 4KQJA 1KORA 5CA1A 3TTSA 2IZZA 3NATA 1WVIA 4EJSB 1RFGE 3L4JA 3H86A 3AHJA 3C15C 5CNMA 1KDPA 3OKPA 4H6WA 2Q27A 2C61A 2WM9B 1COWA 3DZ8A 5IX8A 1CQIA 1TTQB 2MU1A 4NQZA 4IUBS 3PDIA 4KQFA 3ROMA 4S2EA 4D9NA 1JEEA 4PY2A 1VE7A 3H8WA 1NP6A 3PFCA 3AHEA 5LVAA 3P9NA 3I76A 1KSHA 3IEMA 2ZSKA 1N2XA 3BKWA 1HDYA 2JAQA 4FMDF 5J40A 3CH6A 1OASA 4GOMD 5EUBA 3WB2A 4IDHA 2AW5A 5E8RA 4YAJA 5BR1A 1KFJB 1KVSA 4N7JA 2BFAA 2JIPA 5EVCA 3S7ZA 1VCMA 4CM7A 2BDEA 1QP8A 1XA4A 2AZDA 4IQ4A 3KU4A 3VVLA 2B78A 4HB0A 4NENA 5HDQA 4E09A 3FVQA 4LF5B 3W5BA 2VH2A 4UBMA 2NU9B 4DA0A 4I2NA 2ORED 2JH3A 5DF1A 3ZJ4A 4P7BA 4EWLA 1RS0A 2J3HA 3PCTA 5ESRA 1GZHB 3LH5A 2J31A 3EVFA 3PZRA 4DSOA 1FY2A 1ORHA 3BUSA 4GRIA 4HAWA 5EXTA 2B1JA 1Z0SA 5CR9A 5FUMA 1RBMA 4Q3AA 1OXKB 2FMIA 1UDRA 5F9HA 1L1RA 1XB2A 1ZD9A 1Z5UA 2BEVB 3AMVA 2C1ZA 1ULSA 3AETB 1UEIA 2OOSA 4FOPA 4TWJA 4YCDA 3VR3D 1XK6A 1LJ8A 1RVV1 2OHHA 3MWEA 1DUVG 4KBYA 1AHNA 3T4PA