3WDNA

High-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
SVRKFTEKHEWVTTENGVGTVGISNFAQEALGDVVYCSLPEVGTKLNKQEEFGALESVKAASELYSPLSGEVTEINKALAENPGLVNKSCYEDGWLIKMTFSNPSELDELMSEEAYEKYIKSIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution X-ray crystal structure of bovine H-protein using the high-pressure cryocooling method
pubmed doi rcsb
source organism Bos taurus
molecule tags Oxidoreductase
molecule keywords Glycine cleavage system H protein, mitochondrial
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3wdnA00
4TQUS 1E2VA 1E2ZA 1Q1EA 3A7AB 4JK1C 3VR2A 1Z7TA 3CRKC 5KNDA 3DXJC 3M85A 2K7VA 1OXVA 2PNRC 2EJFC 2BE5D 3I72A 4G7ZC 3OOCA 3HGBA 3GQBA 2A68D 4XIGS 4G7OC 1VF5C 2A6EC 4XTCS 4KHZA 2JEAI 1OXTA 1IW7C 2BA1A 4PV1C 4OGQC 1TKWB 3M4YA 5C0XH 2F1MA 1Y8OB 2JXMB 3FMCA 1GHKA 3A8IE 2K32A 4KI0A 4RCNA 4DK1A 3MXUA 3D31A 3T51B 1ZKOA 3IFTA 2DNEA 1FYCA 3GD7A 1CI3M 2A69C 3WDNA 5BN5A 4G7HC 2E75C 1H9SB 1TU2B 2NN6G 1ZYRC 3VR4A 2O5IC 3RLFA 4KKUA 3U9SA 4DNRB 2ZT9C 2D2CC 3H94A 3EQLC 3T56B 2E76C 3KLRA 2V4DA 4KKSA 3VA7A 4GZYC 4OO1H 3L7ZC 1B9NA 4H13C 2Q8IB 3SDZA 3P20A 4KMUC 4TKOB 5KNCA 1SMYC 5JEAH 1DCZA 3LNNA 1H9SA 1Z6HA 3A8KE 1I6VC 3MFYA 3PUVA 2L5TA 4KKTA 2A69D 1GUTA 1DXMA 2KA7A 4KN4C 1HTPA 2CW0C 1H9KA 3PUXA 1E2WA 3PUZA 1VF7A 1Q90A 3OPOA 1HPCA 1HQMC 2LMCB 3T53B 2AUJD 4OO1G 1OXUA 3SE0A 5K36H 2E74C 4DNTB 2KCCA 1Q12A 1BDOA 1IW7D 4KN7C 2EDGA 3FPPA 2B8FA 1IYVA 2NN6H 1CTMA 1O78A 1YNJC 3PV0A 5K36G 3A8JE 2EJGC 4H0LC 1LACA 1H9RA 2YYZA 3ND9A 2BE5C 1GJXA 4LK1C 1H9MA 2R6GA 3QIAA 3I73A 5C0XG 1IYUA 1OXSC 3W3AA 2A6ED 2QF7A 1K8MA 1A6XA 4IQZA 2A68C 2BA0A 5BN4A 1GUNA 1YNNC 3BG3A 3OW7A 3A7LA 3VR3A 1GUOA 1Y69U 3N6RA 2NN6I 4JBWA 2JEBI 3PUYA 3I4LA 1V8QA 2A6HD 1LABA 2AUKA 3LWUA 4LJZC 1K8OA 3IKJA 1GHJA 4L8JA 4I7ZC 4IFDH 4BA1I 1ONLA 1OXXK 1EWHA 5KNBA 4IFDG 2PCFB 2K33A 1V43A 3AB9A 1VDZA 1QJOA 4H44C 4DK0A 3BDOA 1GUGA 3QG1A 1O7LA 1T5EA 1Y8NB 2PPBC 3NE5B 5BN3A 2AWOA 3CRLC 1H9JA 2B8GA 2BDOA 1GUSA 1CFMA 1FR3A 1Q1BA 1G291 2A6HC 2DN8A 2JE6I 3PUWA 3QJYA 3VR6A 2O5JC 2D5DA 2IT1A 2D62A 1HCZA 3VR5A 1PMRA 2EVBA 5A35A 1VCIA 2EJMA 4HR7B 3M7NA 5JEAG 1DD2A 1B9MA 2DNCA 4BA2I 1Y8PB 3D4RA 3TZUA 3ND8A
chains in the Genus database with same CATH superfamily
5C4XH 4JK1C 4A3IB 4A3GB 3STBC 1JT8A 1M8AA 3KF6A 2TMPA 1BCPF 3OOCA 3S1MH 2EYFA 4DR2Q 1E7ZA 4AIMA 4R4OA 4LF4Q 1KTKA 4Y7NH 4HCSA 2KVMA 4KY5A 4XT1B 5C0XH 4IOCA 1I3QB 1TS3A 3KF6B 2KHIA 4K8JA 3CCMA 1CI3M 1SRUA 2IX1A 1I4HA 2K03A 5CC4A 2JA6B 1EWIA 1K8AC 4CBVA 3OIQA 3HFZB 4CDFC 1IL2A 2M9VA 5DEHA 2NVYH 1YI2A 4LAAA 4CJ2C 5K5PA 3S14B 2YU9H 4OXPA 5FLXL 5JJIA 4PG3A 4B08A 1I6HB 3OTOL 2FXQA 3MEHA 1UEAB 3N52A 1KAAA 4C2MB 1LLRD 2PI2E 4OEMB 1U9RA 4RGTA 3SE0A 4JC0A 3H0GB 1VQIA 1FNUA 1E0BA 1KQSA 1EYCA 2IJ0A 2EYLA 2UUCQ 3G48A 4LK1C 5LMNW 1H9MA 1PTOH 2RA4A 3NTHA 5C44G 2Q2TA 4NMZA 2QGQA 3MWYW 2NVXH 4A3LG 1KDCA 1LTBD 3KF8A 3KJOA 4A75A 3OIPA 4RGNA 5DM73 4BY7H 1HNWQ 4OL7A 2ZM6Q 2MJ8A 1HZBA 5FLXE 3B6YA 1SE2A 1N33Q 2VB3X 1BCPD 2CHBD 5M5XB 4GKKL 4KD4A 2E5LL 1X3FA 3S2HB 2NBFA 1ENFA 4HEDA 4O0AA 1HNXL 3EJIA 4ZUIA 1XPRA 2HQLA 3K7AH 4S3SA 3GV6A 4QIWB 4GS3A 1YHAA 3IRBA 1HXYD 3ICEA 3NPPA 4H7BA 3D4WA 2CKZB 4LF8L 4J15A 1EYAA 1F9RA 1H95A 1Z47A 1RIPA 4K5XA 2N8NA 2HHHL 2F0UA 3MZ5A 2JEAI 3SR1A 3X3MA 3C46A 4BBSH 2KHSA 1OO9B 1QCBD 1TWGH 4JVZA 2F4IA 2K5NA 5IYDH 3X3NA 2CH4W 3TP8A 4XDXA 2F0KA 1AZQA 3ZJYC 1MJEA 4DV1L 2UUAQ 1VQLA 5GQOA 3OYYA 5JEAJ 1DOLA 1WTPA 2PZUA 5C44B 1LT5D 1DCZA 1RTOA 1TWFH 2RSNA 5C4JH 4HMJA 2PQAA 3H3VH 4NXML 3HOYG 1VQBA 1GUTA 1TS5A 3TREA 3D0FA 2OF1A 3M3YB 4JBMA 1VF7A 2EYOA 1TY0A 1OXUA 3IAYA 4FF3A 5IT9E 3TSSA 1VQJA 1PRTD 4JI5Q 1JE5A 3Q8DA 1PTOD 1JJCB 2YYZA 5C4HA 5DAUA 2I5MX 3QIAA 3HKZE 4LUZA 1GD7A 1YEZA 1F2YA 2NWGA 1B4OA 2NYZD 2OCEA 3I73A 4DAVA 1RTNA 1YITA 4JI1Q 4AH6A 4DV5Q 1J5EQ 3R3OA 1I4PA 1QILA 2VQFQ 2QA4A 4A3EH 5IP9H 3SK6A 4JOIA 4L8JA 2NVTB 2PW5A 5M3MH 1ONLA 5M5YB 3S2DH 2IPKD 1JOOA 2MP1A 1GUGA 3BU2A 3PMFA 2X6GA 5LMNQ 1XJVA 1GUSA 1FR3A 5EKLA 4IJLA 5IYBH 2UXDL 2IX0A 4QL5A 3TQYA 1L0XB 5I9PA 5ELNA 1GO3E 4XXEA 5IOCA 4APVA 4JI6L 1WCMB 3D6WA 2CVRA 3HOWB 2L55A 3ULJA 3A7AB 3S16B 1KRSA 1P16A 3RD4A 4TVAB 1D1KA 5LMNL 1EY0A 2EJFC 3FKIG 4K0KL 2K6AA 3KDFA 1XTCD 3GQBA 3FDTA 4NXNL 2WACA 1SNOA 3TS0A 4GNXC 1X6OA 4XTCS 5COYA 3KLSX 1EZ8A 3GTLH 2XWBB 4DFAA 2F3IA 2UU9L 3W5OA 1STNA 2JP1A 4KI0A 3H6MA 4JCVE 1Q7YC 2EY2A 4LNQA 2E2JH 2D0PA 2KQ3A 2KEEA 2KOLA 3BDLA 4GKKQ 2NN6G 3CCLA 1ZYRC 5C3WA 1HFGA 3GTGH 1Q8IA 4OX9L 1FNWA 4CJ1B 1PYWD 1X32A 2OQ0A 2JYOA 2XVSA 3VYRA 2SOBA 3I8ZA 1VQEA 1H9SA 2E8GA 1GVPA 2K5QA 3BVGA 1F77A 4KN4C 4EQPA 5CBEE 1I50B 2DJGC 4N8FA 3OPOA 1E3PA 3KDFB 1DZ1A 4RFBA 2R7FA 2F52A 1WTOA 4IALA 1N34Q 2EDGA 1JWSD 2HDMA 1IBML 1NE3A 5EAYA 3GO5A 2Z4IA 4X64Q 1VQ5A 3HKZG 3K58A 3ND9A 2BE5C 3RLOA 1RODA 2D0OA 4K14A 4A93B 1G8ZD 1QB5D 1PZJD 4DV4L 4O1NA 1J6QA 1VQ7A 1EY9A 3A7LA 3OWEB 1STBA 3O13A 3I4NG 2Q8RE 4B9XA 4JBWA 1AE2A 1SYFA 1Y14B 2UUCL 1I5FA 2CQOA 2HQEA 1HNZQ 1KLUD 5L37A 1IBKQ 1K8OA 1F2ZA 4IFDH 3OMCA 5KIXA 3ERSX 4IUUA 3JAMi 4LUOA 3HOXH 3GTMH 5I4DA 2WKDA 3CQZH 1JJGA 3CC4A 1SBBB 1TWAB 2B8GA 1PYSB 3VR6A 5KEEA 3I4NH 1K9MC 1QVGA 2D5DA 2IT1A 3HOYH 1MJCA 1PZID 1RL2A 4FVMA 4R8IA 3A74A 2B2YC 2MFIA 3SXHA 2VQEQ 1EY8A 5C5MA 2CCZA 1HNXQ 2WP8J 2F0QA 2PNRC 1SNQA 3I72A 4CJ0B 2F3WA 3HGBA 1MSHA 1JQYD 2DUDA 1PFBA 3RNUA 5M3FH 1OXTA 1A3VA 1T9HA 1VQ8A 1A15A 2PZWA 1BNZA 2F1MA 4Z9CB 1XNQL 1PRTC 1IZ6A 5IGGA 1FYCA 1D6EC 1B1ZA 1V1OA 1HA6A 1O7IA 4KKUA 3EROA 4C3HB 2D2CC 5J3BA 1DOMA 4JI7L 4DR7Q 1UE7A 4DUYQ 1EY7A 1TIID 1JWUD 4NP5A 5F2DA 1CZWA 2I46A 4P73A 3PQIA 5I6YA 5IGCA 4DV6Q 3NTKA 2HD3A 4BBRH 3E0JA 1BBXC 4DXGA 3GTQH 4DNTB 1ML0D 5ELBA 3F2DA 3TBIB 3K5OA 3BZKA 4N9PA 3TDQA 5C5LA 3MXNB 1SR3A 3OHXC 2ASBA 1IHZA 1K0SA 2OTJA 4CDDC 2RHSB 4C3IG 1E24A 3DM1A 4C3IH 3MTSA 1EIFA 3S24A 2K1BA 3BYYB 4E6IA 1VQFA 3HOVH 5M5WH 3NTIA 4ZQ3A 2CH4A 4AYBG 4TSSA 4LF4L 1S5BD 1N8RC 2PCFB 4H44C 1HUMA 1NBWA 2HHHQ 4GKJL 4ME3A 2Z4HA 3BDOA 1XNRL 1G2TA 1N36L 1TWHH 1T5EA 3GTOH 3PIO3 4A4IA 3DWQA 3CRLC 4POGA 1JE4A 1II3A 2NTTA 1ZEQX 2JE6I 4POFA 4A3GH 1ILPA 4JI3Q 1U4PA 3AFPA 1PRTF 1LTSD 4AQYQ 1SNPA 1KXLA 1L1OB 3PF5A 1PH4A 3TS2A 2CQAA 4RH6A 4LF5L 5E4WC 3J7AF 3VR2A 1M4VA 3E0EA 4X3UA 2YV5A 3K80C 3HOUH 3HOZG 1LT4D 1S4ZA 2RQXA 4L63B 1EFID 4A3CG 4RAUC 4HJ5A 5H1SE 2AWNA 2A6EC 2RKSA 1Q81C 3RMHA 1LM0A 1QWYA 2ID0A 1IYJB 2VZAA 1K0RA 1PYBA 3NK9A 1SE3A 3M7GA 1GHKA 3I70A 3A8IE 3MXUA 4IUTA 2UUAL 1EIHA 4V190 2A69C 1D5MC 4MNOA 4K8IA 2PQAB 4UP8A 3S14H 4DR4Q 2MO0A 1EEFD 3P7JA 3VR4A 3U9SA 2XRSD 3H3VC 3T56B 5LMUL 4OWTB 2Z9HA 4ZYSA 5EPKA 3S15H 1YJNA 3VYUA 5IYDG 3LWEA 5JPMC 3NSWA 1NJIC 2F0VA 2L5TA 2JA6G 2A69D 4JPBW 1KDBA 3AMUA 1ESFA 1N33L 1XMOQ 2AUJD 3I91A 3W1BA 1JB3A 4DV3L 3L2PA 2K5HA 2KCCA 4HCEA 5IGFA 4LF8Q 1HUNA 2J0TD 2KCNA 3FVQA 3NWTA 2I5LX 1O78A 5C3EB 1JJ2A 5IYCH 2MQHA 3CCVA 4ME5A 3ZYYX 3HOZB 1W3SA 4BY7B 1MBYA 3AFQA 1M1KC 1CT1D 4LFBQ 1EY5A 3S1RB 3BS1A 1EEID 4NW2A 3S2HH 3STBD 2EYPA 4RCOA 2R93H 2VUMB 2HCIA 3PO2G 4QUCA 2WB1G 2VW9A 2D9UA 1HR0Q 1X9NA 3IL8A 2H1EA 4Q0FA 1ICWA 4DV0Q 4A3MH 2Q2HA 2ZXPA 2Z0SA 3PO3B 3KUPA 4LFBL 1O7LA 3FP9A 1IKLA 5IODA 3HKSA 1UNSA 3NBIA 2IL8A 1LTTD 2XGTA 3RZDH 3J80i 3CPFA 3M7NA 4P2CB 1FNVA 1HA5A 2L1BA 1EWCA 2RDGA 2YTYA 4BBSB 1X3GA 4X6AH 1SFOH 1Z7TA 3J81E 1CKNA 2F0GA 3GTPB 4OWXB 2F0LA 2F3VA 2B63B 1VQNA 1CUKA 4XIGS 1HZ9A 2F0HA 4XQQA 4HIMA 5ISRA 3FPUB 1Y1WG 3DEOA 4A3KH 3CMEA 4JI2L 3V2TA 2EY5A 2JXMB 1Y1WH 3T51B 4L5TA 4PNYA 2P5ZX 1YJWA 1CM9A 5BN5A 2IX3A 2OTLA 4A3DH 3VDYA 5CYUA 2B2TA 2SNSA 2V4DA 2R93G 3L7ZC 3SK4A 1B9NA 4XYQA 4RKLA 1GM5A 5J1ZA 3JAMc 3GV3A 1PH5A 1WD0A 1I6VC 2MGSA 1RKNA 3J80L 4XQJA 1JOQA 2WINB 4N8X1 5HY6A 1Y1VG 1C9OA 1B50A 1H9KA 4DAYA 3T16A 2ATWA 2MO1A 4B3SL 3UDFA 4Y7NB 1BDOA 4DK6C 1D2BA 2BDNA 4DR3L 4L5SA 4IPDA 3KBXA 1GXDC 4H0LC 5HGQA 3EVQA 2A5HA 1L2FA 4UY8C 2RDHA 4JI0L 1KD1C 4C3HG 2LXKA 3H09A 2QF7A 2JA6H 1EY6A 1PFSA 3H0GG 3UE1A 1YNNC 3OW7A 3ONAB 3N6RA 4A3IG 2F0SA 1VQKA 1LTRD 5IGBA 3GTJB 1M90C 1A62A 5JVH3 2BCOA 4F8MA 1V1PB 1GHJA 3K59A 1I6HH 4C3JG 2E2IH 3QB3A 3J7ZC 2VY3A 4DAMA 4IFDG 3AB9A 1NAPA 4C2MH 2B2VC 1I4QA 4K5VA 1CSQA 1ILQA 2KJXA 1EIGA 3U9OA 4B3TL 4IZ8A 4YWMA 1G291 3FKIB 1S3OA 2K75A 3T1YL 2XWJB 1N34L 3PIPA 1UE1A 3VYTA 1SYEA 1WTHA 2NVXB 2Z6KC 1AW7A 1V1QA 1TY2A 4LFCL 4HJ8A 1K3BC 2E5LQ 5HGTA 2WIIB 1SYBA 1PFNA 2IHFA 2VXWA 2DJFC 4WJWA 1V9PA 3CHBD 3T1YQ 5M5XH 1WD1A 3Q24A 4KLKA 5JOBA 1EU4A 2DNEA 1AP0A 1HZCA 2WKCA 4PZ8A 1QUQA 3NQIA 2ICIA 1D1IA 1Q8KA 4KHVA 3S9WA 5JEAH 1F2LA 1DONA 3PUVA 5EBDA 2A73B 1K3RA 2K01A 1A0IA 1RJTA 1YZ6A 1K28A 2ZTEA 4ZRZA 4A3BB 2GA4B 3WOEA 4DV0L 2A1AA 1KABA 1BOSA 4ZLTF 3V96A 3K81C 2B8FA 4MIUA 2QW7A 4X64L 2HDLA 3A8JE 4KHPL 2F0PA 5DM63 1I4XA 5C0XG 1EUJA 1A3UA 3M4QA 4JBJA 2EYMA 1HJPA 1VMPA 4O42A 4ULLA 3K5MA 3PUYA 1R9TH 5C44H 2HCCA 2R7DA 3H3VI 4DR3Q 4IUPA 4RHSA 2QEJC 4EX5A 1EWHA 3M3YH 3PO2H 4HSPA 2KHJA 2N49A 1U4LA 4YIJA 4CKCA 1EQRA 1N9WA 1JMCA 3CD6A 4CGYB 4FF1A 3OSOA 1BCPC 1LO5D 2HIXA 2D62A 4DV7Q 4K2KA 1PLFA 1PMRA 2EVBA 1UE5A 4UP9A 1X3EA 2ICEC 5JEAG 3S1QH 1EOVA 3DWPA 4A3BG 1X56A 3AEVA 2WAQE 4JI5L 4K5WA 1E2VA 3RN5A 1STEA 3CRKC 4OO1I 1X3PA 3L3OC 5IIFA 4GOPA 1PH7A 2JA8B 3CW2C 2JA7G 1VF5C 4BY1H 4KHZA 2RHQB 4NB3A 2NVTH 5D3DA 1VS0A 5FO8B 1VQOA 1J5EL 1CSPA 1Y8OB 1VQ9A 1LUZA 4DK1A 1KDAA 4IFDI 4J6HA 4IOAA 1PV4A 3RLFA 1EQVA 4GLXA 2F0WA 3EA6A 2C9OA 3MXPA 4BXXH 1STYA 2Q8IB 2VL6A 4F7XA 2B2TC 3MHBA 3RR5A 1ZYRD 2Q2IA 1NCVA 2E2DC 2XIWA 3K7UC 4DV4Q 4TRDA 3RUZA 5FO9B 1U4MA 3CCJA 1PH8A 4PZ6A 1U4RA 1L1OC 1HQMC 4OO1G 3RN2A 4GOPB 2V1CC 4DPGA 3GTLB 3GP7A 5FKAC 2R7ZB 1IKMA 2J7ZA 4RA8A 4GOPC 2RCNA 3CCQA 4AQYL 2R6GA 1AN8A 3U4VA 5M5WB 2A6ED 1ENAA 1ASYA 3Q0AA 3EBEA 4LF5Q 4LW1A 4JI2Q 2WFWA 1XMOL 2RBMA 4P74A 3I4MB 1HZAA 1G6ZA 2A6HD 1LABA 3KLWA 1XMQQ 4QIWE 1DGSA 3I2ZA 5DNFA 4ZK9B 2Z6BA 5IY0A 4I7AA 1ZXTA 3NBHA 3G6JB 3K8AA 1OXXK 1I50H 1EYGA 2L9HA 1SAPA 3M4OH 3QG1A 2OXPA 1UAPA 4DV1Q 4YY3Q 4IFDJ 5IT9L 3UE0A 1Q1BA 4L6TB 4HSVA 3PGZA 2F0DA 4JI3L 1PZKD 3C3LA 4LF7L 4ZAIA 1B9MA 3MFGA 5CV6A 2RSOA 1E2ZA 3QWNA 2E2HB 4WJ3M 1PHJA 3ULPA 1OXVA 4JOIC 2FJ2A 4KD3A 1SSOA 2XNAC 1KIXA 4DV6L 3I55A 1WTWA 4NPSA 3H91A 4GN3B 3HOXB 3CCEA 2NVQB 3K6OA 3NWSA 2KECA 2EE1A 4JI1L 1PRTB 2QKIC 1JR0D 2F0NA 1RF2D 3VYSA 2E75C 5M3MG 3GTKB 1PTOF 1KAWA 4QCLA 1CKNB 2FMCA 4GLAC 2JA9A 2ZT9C 3EQLC 2E76C 4X3KA 3ULLA 1VQPA 4H02A 1KRTA 2NUCA 3SDZA 4M8AA 2BOSA 2MUYA 4JV5L 2N78A 1IXRA 1SJED 4K6LA 1W6KA 1PA6A 5C3EG 4EQOA 4B3TQ 2R92B 4HJ9A 2N3SA 1E2WA 3PUZA 5D65A 3DHQA 2M00A 1K83B 5K36H 2Z6KA 2GVAA 1WYDA 4DGZA 3MC0B 3TZDA 1YNJC 1PXUA 1E1TA 3F2UA 3G6EA 5K36G 1LACA 3DM3A 2ALYB 4IJHA 5FLMH 4R4TA 1SXTA 1Y1VH 1TWCB 5IWAL 4LFCQ 3BZCA 1V1PA 5FK9C 1FGUA 3CPWA 2JA5H 5A2QE 1A6XA 4C3JB 3PCOB 4EGVA 5HURA 2HIVA 2N88A 1RD9D 4WORA 5EJWA 1AH9A 3BVZA 2Q2UA 3SK8A 4KTAA 1V8QA 4DU9A 1KC8C 1BO0A 3S1NB 1PH6A 4LJZC 1SNCA 3IKJA 3CKIB 1HNZL 2UXBL 4QJFA 1D5ZC 1EU3A 1TS4A 3K0XA 4DF7A 2ES2A 2LS01 2VQEL 1J8IA 1ET9A 3KF8B 1VMCA 2L15A 3NENA 1SFOB 2DN8A 2WB1B 2A6HC 2O5JC 3E9HA 4DV7L 2F4VL 4FO2A 1O7ZA 3U58A 1C8CA 3HOWG 3MXGA 3F1ZA 3SK5A 1UWVA 4U68A 2DNCA 2AQ1B 1SDFA 4QUFA 1B3AA 3AYHB 4K6DA 1SYGA 1IBKL 2OEOA 1CHQD 1NSNS 1X54A 3R8BA 1IW7C 1VQDA 1G51A 1S5DD 1MHWC 4OGQC 3M4YA 2B2UA 3BDCA 2DY8A 4R9WA 4RCNA 1ZKOA 3IFTA 5IYCG 4UHVA 5E3FA 4BS9A 3DEPA 4DAYB 2QDBA 4DA2A 2A8VA 3VA7A 4KKSA 4LWCA 3SVMA 4GNXB 1IBLL 4LF9L 2SEBD 2LY7A 3J80c 1KLGD 4TKOB 4P72A 3L0OA 5LMUQ 1BUVT 3TP6A 2FHTA 5LL6X 5G3LD 3HOUB 3ITPA 3PUXA 5JJLA 1O80A 1LTGD 5GAGC 5C4ZA 1CK1A 1DJRD 4GN5A 4RG1A 1U0LA 1E1OA 1S5ED 3D3RA 1RDPD 3U50C 2K5VA 1H9RA 1HTLD 3HEJA 1Z9FA 3GTJH 3RZOB 1O7YA 4OONA 2JSOA 1GKHA 2F0OA 1HQRD 4YCUA 3JC66 5EKKA 5EPJA 2MNAA 4GKJQ 3OTOQ 2G9DA 4EQNA 1B53A 1MIUA 1ET6A 2Y0SE 1XYIA 4ZKCB 3T4AC 3I4MG 2VNUD 1EY4A 2PZTA 1JOKA 4C56C 3PIP3 2QCPX 3I90A 4DR2L 1WTVA 1NTGA 5IGDA 4I7ZC 2AQ3B 1PDQA 4IUNA 1MI2A 2C5CA 2KCMA 5EQ0A 2K33A 1VDZA 1QJOA 4DK0A 1E22A 2XSCA 1CHPD 1XNRQ 2N55A 2PPBC 1KHIA 1TQOA 1AZPA 2Q8TA 4DXFA 2R7ZG 3HRZC 1H9JA 4DN4M 3I4OA 2EYHA 2SNMA 1YHBA 4BY1G 1Q82C 5A35A 5C0XI 2EJMA 4HR7B 3HOUG 3HOZH 1XXGA 4KJNA 4DV3Q 1W2BA 1H9SB 1Y8PB 4HIOA 1GOZA 5EKIA 1A3TA 3S1RH 2K7VA 2ENBA 5CV4A 2IHEA 2NB0A 1F9SA 2B39A 3E5SA 2VUMH 4A93G 4LFAL 2XTIA 3KK7A 1QNUA 3UDGA 4PQXA 3BZDB 4UAIA 4EQ5A 2TSSA 3S17B 1MSGA 2K04A 4A3MB 3R2IA 5I9OA 5GADC 1AE3A 4JYAL 2DGYA 4A3JB 4B3MQ 4WRDA 5ELDA 3EIVA 3L9AX 4DUZL 2L4NA 1PH1A 4H13C 3RLNA 1IL8A 4A3BH 4DR6Q 2UU9Q 4KMUC 3TN2A 5FLXc 4RGMA 2LFNA 4DR7L 1EQQA 3GTPH 3W2DA 2KA7A 3NXWA 4BBSG 2B63H 5FJ8G 4DK3C 1Q90A 2LMCB 4N9TA 3T53B 3CC7A 1N32Q 2JA7H 4B3RL 3I7FA 1Q3LA 1F9QA 3C1EA 2AHOB 4HN7A 1A8VA 2C35B 5M9OA 4KN7C 3HOXG 4A3FH 1K8GA 4A3FG 3AQQA 2NN6H 1CTMA 4X66Q 1Y1WB 2H4OA 5D14A 1R9TB 4BY7G 2OWOA 1D7QA 5CORA 4CKBA 4L5RC 1SE4A 1QNKA 1N36Q 1L0WA 1F9PA 1VQMA 4IQZA 4A3KG 5C4XB 4A3IH 1C0AA 1GUNA 2NZHA 4OIJA 1PH2A 2NN6I 3A54A 2H5XA 2PO4A 2B2YA 1WCMG 3I4LA 4IUVA 5CV5A 3SGIA 1EYDA 5CGKA 1SMXA 5CMDA 4X65Q 3KLSA 4YWKA 1FVIA 5E4XA 4KJOA 4QF4A 1I3QH 4NXMQ 2IW3A 3S1QB 2AQ2B 1B8AA 4KY6A 1CA5A 4DV2L 5I2XA 4OHJA 4DR5Q 2AWOA 4JI6Q 1CFMA 4HJ7A 4DUZQ 3PUWA 2F0EA 5EBCA 1BF4A 4MN3A 1I4RA 1CA6A 2JQOA 4F87A 4BY1B 3FHWA 4WJ4A 2B2VA 4OIKA 1JORA 3TZUA 2JN4A 5T1IA 2SDFA 3M85A 1X65A 4DNIA 1HR0W 2RCFA 3D8GA 2A68D 2K4KA 3HKZB 1PTOC 1XX8A 1U5KA 4G7OC 1HRJA 4RHRA 2E2IB 3H0GH 5KGUA 2K05A 5JPNC 1TKWB 3MXNA 4J8QA 3CC2A 3J81i 1VQCA 3PIOA 3U4ZA 3GD7A 3WDNA 1PTOB 4IPCA 1ICFB 4G7HC 1I4GA 4LUVA 3FKIH 3UDIA 5CV8A 5J39A 2JJQA 2HUGA 3F2CA 4X62Q 1QOHA 2R61A 1QE6A 1D5XC 2VS1A 4PMWA 2PW7A 5KNCA 1A63A 1PVOA 3KYHC 3TP5A 3W1GA 2F0JA 3MFYA 4JI8L 5FO7B 2UUBL 4R1JA 3K5LA 4C1NI 1DXMA 5IYBG 5JJKA 1HTPA 5LL6S 1QUQB 1HPCA 5ELFA 1R4PB 3AU7A 1IW7D 2ZTCA 3FPPA 4OX9Q 3WWVA 1WTRA 3K7AB 1TR5A 3PV0A 3TEHB 4JV5Q 1NR2A 4ALPA 1G6PA 2ZXRA 2I5HA 4FF2A 1S5FD 4DAPA 4HAEA 3BG3A 2F0TA 3H15A 3EN2A 3MVVA 4HIKA 1NR4A 3M9BA 5CR3A 4R4CA 4PZ7A 2UXBQ 2JEBI 3BYTB 3CCRA 4OWWB 4ABNA 2AMCB 1S72A 2XRQD 4ZCKA 3JAME 4A3DG 3GDEA 4L5QA 3C2PA 3J80E 5BR8Q 3VA5A 4CDCC 1TXYA 3T13A 1Y8NB 2EOTA 2Z1CA 3TP7A 4CKEA 3NP8A 5IWAQ 2PI2A 2EYJA 3J7YW 3K57A 2E2HH 1EFWA 1VQ6A 1IBMQ 5G3LF 2NZ1D 1W6JA 4G57A 4LF7Q 2KEDA 3DUZA 4B9WA 3PSIA 1QZHA 1LT3D 3CF5A 3IFDA 1BXTA 1Q1EA 4QB4A 5C3XA 4ZKBB 4DR4L 4G7ZC 1KNAA 1YNJD 1SROA 1XNQQ 4UDUC 3GTKH 5CV9A 3JAML 1WI5A 5IGEA 4IN3A 1DYQA 1WTXA 1BBWA 3PO2B 3S1MB 4RMFA 4IURA 1TU2B 1ESRA 4GZYC 3A56A 4ID6A 3V05A 4OO1H 2PNHA 5FJ8H 1BQQT 1K83H 1CKMA 1JICA 2FINB 3A8KE 3KOJA 1EOTA 4IPGA 1CZGA 5BR8L 4QGUA 4GLVB 2UXDQ 2K5WA 4JYAQ 4JBKA 4NDXA 3S2DB 1OTCA 3K0YA 3J81c 1TWCH 2JA8H 2NVYB 2QILA 2YU9B 1S5CD 4A3MG 5IE8A 4LF6Q 2HT1A 1BR9A 1B7YB 4Q5VA 3CCUA 1XPUA 1B3QA 2EXDA 2MHVA 1WCMH 3S1NH 1WTQA 2BH2A 1OXSC 3W3AA 2BH8A 2X69A 3HOWH 4R8NA 5BN4A 3E9IA 3S16H 4X3TA 1Y69U 5ELEA 4FF4A 4JI0Q 5EGTA 4A3CH 4LF6L 4IO9A 4FXKC 2X6LA 3G7LA 3J7AV 4C1NK 4RGOS 1JC7A 2GVBA 1S40A 3M4PA 3EFXD 3LWUA 4WFN3 1XPOA 4BA1I 2DY7A 2NTSA 5C6AA 3NELA 3J81j 2Y0SG 4LFAQ 1YBYA 4DV2Q 3LGJA 1T5XD 5TSSA 2XN9C 2E2JB 4QMGA 2UXCL 2BDOA 4FYDA 4FNFA 2R7ZH 1KL9A 4RKBA 3NQTA 4UPAA 3GTGB 2WAQB 5JVG3 1SYDA 2JA5G 1VCIA 3D4DA 4DUYL 1SNDA 3P20A 3ND8A 1BBUA 4KY7A 3TMEA 1FJGQ 1CQVA 3QR8A 3CMAA 3I4MH 1PH9A 3Q22A 1HNWL 2QDLA 4GNXA 3G71A 4R4IA 5DLQE 3URYA 4A3JG 1C4QA 4PV1C 4A3GG 1XTDA 3M4OB 3R93A 1YHQA 3A5UA 3DWAA 4P71A 1J9OA 2VUMG 4A93H 3FEWX 1YNXA 3OWFA 4DNRB 2I0QA 1Q86C 5ELCA 1X55A 3KLRA 3P75A 4BBRG 1TWGB 1G91A 1NUCA 1I94Q 2K5DA 4DR1Q 1SMYD 2B2UC 1Z6HA 3KFUA 1NNXA 2RDFA 4MZ9A 4KKTA 2PQEA 4IUQA 1F2MA 1AEXA 1LYLA 2L0CA 4AYBE 5FOBB 1A2UA 4ILWA 1NMGA 2NZOA 1QVFA 2OT2A 1YVCA 5AJ3L 5ELOA 2A19A 3BVMA 3QO2A 4F88A 1TWFB 5C4JB 3QOLA 4PMBA 4FXDA 3I4NB 3PF4A 3F8TA 4HTHA 2NVQH 2R92G 3E6ZX 1P8LA 4DR6L 1TVXA 2IWHA 4R4QA 2I07B 1RHPA 3K5NA 2B63G 2OQKA 1K8MA 1EZ6A 5IP7G 2A68C 4A3LH 5I6WA 2B2WA 2EQSA 1GUOA 1HR0L 1WJJA 2O2LD 3OMGA 2EPBA 3KBGA 1BKBA 1RCVD 4IPHA 4BXXG 3HS0C 4MTKA 1G2SA 4B3RQ 2WV6D 2R92H 1DM0B 4OELB 4YHHQ 3P1HA 1LT6D 2MPMA 3R2TA 4A3EB 3NE5B 3PO3G 3SEBA 3J7A5 4JI4L 3I56A 4ODGA 5M3MB 5C0XJ 3F2BA 1CQFA 5M5YH 5KRUA 3VR5A 5IP7H 4DR1L 1NMFA 2LSSA 3D6CA 1Y1VB 1DD2A 2G9HD 4BA2I 4A76A 2F4VQ 2JA5B 4TQUS 4C3JH 1MD2D 3A5ZB 1VQ4A 4EVOA 3S17H 1YJ9A 4XT3B 1JB7A 1GUWA 5KNDA 3DXJC 1QVCA 3CU7A 4HMIA 4K0KQ 2EXZA 4LMQD 4BBRB 2PMZE 1SE8A 2CFMA 3QOJA 2LXJA 1BCPB 5AFWA 4JI8Q 2QEXA 2UUBQ 3TRZA 2ZJQA 4FP5D 2B2WC 1HFNA 2BA1A 1QG7A 4QQBX 1AFPA 1STAA 2A74C 5I2YA 3FMCA 2CW0D 2K32A 4G4KA 4I65A 4YY3L 3D31A 1MGSA 5M3FG 4X62L 1KNEA 3WOFA 1VQAA 4RWSC 2KUMA 1DOKA 1R4QB 3FRPB 3T1HQ 4HJAA 1HH2P 1XMQL 3C1FA 2JA7B 4MTNA 1SMYC 4Y52H 1SEBD 2F0MA 4A3FB 3LNNA 2RVLA 1X3QA 5E1FA 4YHHL 4K2LA 4B3SQ 1MKHA 1WFQA 5T1GA 4X65L 4CDEC 1EQTA 1SYCA 1UEBA 2Z8LA 5E7NA 2E74C 2KCTA 3GTOB 4BWGB 2CWAA 2EIFA 2G5DA 4X3SA 2R3ZA 2EJGC 2K52A 2JA8G 1IBLQ 4LF9Q 2EZVA 5JJZA 1VQGA 1IYUA 1STGA 2LKVA 4A3EG 2KENA 3J81L 3MAQA 5EPLA 1SNMA 2AKWB 2GN5A 2RF4A 3ERQA 1ASZA 2FMMA 2L11A 1L0YB 2AUKA 5IT9c 5D3IB 5KYLA 4YCWA 1D8LA 4JI7Q 3KJPA 2JK8A 4B3ML 5KNBA 1JCKB 2FFKB 2YTXA 4FDBA 3HOVG 3NEMA 3CCSA 4FXGC 1EIYB 1A2TA 5GROA 2Y0SB 3G4SA 5BN3A 4HIDA 3CP0A 4DKAC 4JW0A 3DMUA 1SJHD 3I3CA 3UDXA 1BVSA 3SHLA 5LHY1 4XYOA 1HCZA 1JWMD 3RZOH 2K50A 3GTMB 3S15B 3MEFA 3CQZB 2K14A 5CV7A 1TS2A 5FLMG 2B29A 3NBHB 3UI2A 5CBAE 1TWAH 5A2QL 1HHVA 1FGBD 1FL0A 1CKOA 2BE5D 1LTAD 3HOYB 1NY4A 3LX0A 4KV6A 1UUPA 2IY5B 2ZTDA 1Q46A 2EY1A 3CXCA 2PYKA 3OW2A 2L12A 1C7YA 4DV5L 3Q23A 3NHHA 5C3EH 1SN8A 1L1OA 2VQFL 4DR5L 1FJGL 3DLLA 1N32L 1B70B 3E3XA 2O4XA 4ZUJA 5M3FB 1UE6A 2O5IC 2YTVA 1VQHA 4O2DA 4YCVA 2ZJPA 4GN4B 4X66L 1ENCA 3H94A 2ZXOA 2B3GA 1LV9A 2F0FA 1K73C 3NUCA 2R93B 4NXNQ 5GAHC 1PFMA 5J22A 2UXCQ 2WB1E 4C3HH 1FD7D 2CWPA 4QY7A 1YIJA 2CW0C 3PO3H 2M2LA 1B2TA 4JG2A 1LTLA 4KHPQ 1Q12A 2WAQG 1I94L 1IYVA 2ZM6L 3A55A 1PH3A 3T1HL 2KBNA 4P75A 3RZDB 1TT2A 4JI4Q 4M1UB 3CAMA 1STHA 1GJXA 2EY6A 4YWLA 3HG9A 5IP9G 1WVLA 1WOCA 3GTQB 4AYBB 5GAEC 4A3JH 2BA0A 1XWEA 2F0IA 3VR3A 4J1MA 1LTID 2J4XA 3A0JA 3ER0A 3HP3A 2PMZB 4UP7A 4NKLA 1QZGA 4CHTB 3BJUA 4PMCA 1B44D 4KK7A 4XQNA 4A3KB 5C4XG 3MA2B 4C3IB 1V43A 4MHEA 1C48A 2F03A 5KYIA 3HOVB 5JAVA 3HZXA 1EL0A 1SLJA 4U673 2K28A 3QJYA 4A3DB 4V0BA 2ZJRA 3Q6SA 1YNND 1TWHB 5NUCA 2VB2X 5AJ3Q 3D4RA
chains in the Genus database with same CATH topology
4JK1C 4A3IB 4A3GB 1M8AA 2TMPA 1BCPF 3OOCA 2EYFA 1KTKA 4HCSA 2KVMA 4KY5A 4XT1B 5C0XH 1I3QB 1TS3A 4K8JA 1CI3M 2IX1A 1I4HA 2K03A 5CC4A 2JA6B 4CBVA 3OIQA 2M9VA 5DEHA 4LAAA 4CJ2C 5K5PA 3S14B 5FLXL 4B08A 1I6HB 3MEHA 1UEAB 3N52A 1KAAA 4C2MB 1LLRD 1U9RA 4RGTA 3SE0A 3H0GB 1FNUA 1E0BA 1EYCA 2IJ0A 2EYLA 4LK1C 1H9MA 1PTOH 2RA4A 3NTHA 4NMZA 3MWYW 1KDCA 1LTBD 3KF8A 3OIPA 4RGNA 5DM73 4OL7A 2MJ8A 5FLXE 1SE2A 2VB3X 1BCPD 2CHBD 5M5XB 4KD4A 3S2HB 2NBFA 1ENFA 4HEDA 3EJIA 4ZUIA 4S3SA 3GV6A 4QIWB 1HXYD 3NPPA 4H7BA 3D4WA 1EYAA 1F9RA 1Z47A 4K5XA 2F0UA 3MZ5A 2JEAI 3SR1A 3X3MA 3C46A 2KHSA 1OO9B 1QCBD 2F4IA 3X3NA 3TP8A 4XDXA 2F0KA 1AZQA 5JEAJ 1DOLA 1WTPA 2PZUA 5C44B 1LT5D 1DCZA 1RTOA 2RSNA 4HMJA 1GUTA 1TS5A 2OF1A 3M3YB 1VF7A 2EYOA 1TY0A 1OXUA 3IAYA 4FF3A 5IT9E 3TSSA 1PRTD 1PTOD 2YYZA 5C4HA 5DAUA 3QIAA 2NYZD 3I73A 1F2YA 2NWGA 1B4OA 4DAVA 1RTNA 3R3OA 1I4PA 1QILA 3SK6A 4L8JA 2NVTB 2PW5A 1ONLA 5M5YB 2IPKD 1JOOA 2MP1A 1GUGA 3PMFA 2X6GA 1GUSA 1FR3A 5EKLA 2IX0A 1L0XB 5I9PA 4XXEA 5IOCA 1WCMB 3D6WA 2CVRA 3HOWB 2L55A 3A7AB 3S16B 3RD4A 1D1KA 1EY0A 2EJFC 2K6AA 1XTCD 3GQBA 3FDTA 2WACA 1SNOA 4XTCS 5COYA 3KLSX 1EZ8A 2XWBB 4DFAA 1STNA 2JP1A 4KI0A 3H6MA 2EY2A 2KQ3A 2KEEA 2KOLA 3BDLA 2NN6G 1ZYRC 5C3WA 1HFGA 1Q8IA 1FNWA 4CJ1B 1PYWD 1X32A 2JYOA 2XVSA 3VYRA 2SOBA 3I8ZA 1H9SA 2K5QA 3BVGA 1F77A 4KN4C 4EQPA 5CBEE 1I50B 3OPOA 1DZ1A 4RFBA 1WTOA 4IALA 2EDGA 1JWSD 2HDMA 3GO5A 2Z4IA 3K58A 3ND9A 2BE5C 1RODA 4A93B 4K14A 1G8ZD 1QB5D 1PZJD 4O1NA 1EY9A 3A7LA 3OWEB 1STBA 3O13A 2Q8RE 4B9XA 4JBWA 1SYFA 2HQEA 1KLUD 1K8OA 1F2ZA 4IFDH 3OMCA 5KIXA 4IUUA 5I4DA 2WKDA 1SBBB 1TWAB 2B8GA 3VR6A 5KEEA 2D5DA 2IT1A 1PZID 4FVMA 4R8IA 2B2YC 3SXHA 1EY8A 5C5MA 2WP8J 2F0QA 2PNRC 1SNQA 3I72A 4CJ0B 2F3WA 3HGBA 1MSHA 1JQYD 1PFBA 1OXTA 1A3VA 1A15A 2PZWA 1BNZA 2F1MA 4Z9CB 1PRTC 5IGGA 1FYCA 1D6EC 1B1ZA 1V1OA 1HA6A 4KKUA 3EROA 4C3HB 2D2CC 1DOMA 1EY7A 1TIID 1JWUD 4NP5A 5F2DA 1CZWA 2I46A 5I6YA 5IGCA 3NTKA 3E0JA 1BBXC 4DXGA 4DNTB 1ML0D 5ELBA 3TBIB 3K5OA 4N9PA 3TDQA 5C5LA 3OHXC 1IHZA 4C3IG 3DM1A 3MTSA 2K1BA 3BYYB 4E6IA 3NTIA 4ZQ3A 4TSSA 1S5BD 2PCFB 4H44C 1HUMA 2Z4HA 3BDOA 1G2TA 1T5EA 3PIO3 3DWQA 3CRLC 1JE4A 1II3A 2NTTA 1ZEQX 2JE6I 1ILPA 1U4PA 1PRTF 1LTSD 1SNPA 2CQAA 4RH6A 5E4WC 3J7AF 3VR2A 1M4VA 4X3UA 1LT4D 1S4ZA 2RQXA 4L63B 1EFID 4RAUC 2AWNA 2A6EC 2RKSA 3RMHA 1QWYA 2ID0A 3NK9A 1SE3A 3M7GA 1GHKA 3I70A 3A8IE 3MXUA 4IUTA 1EIHA 4V190 2A69C 1D5MC 4K8IA 1EEFD 3P7JA 3VR4A 3U9SA 2XRSD 3H3VC 3T56B 4ZYSA 5EPKA 3VYUA 3LWEA 5JPMC 3NSWA 2F0VA 2L5TA 2A69D 1KDBA 3AMUA 1ESFA 2AUJD 3I91A 1JB3A 2KCCA 4HCEA 5IGFA 1HUNA 2J0TD 2KCNA 3FVQA 3NWTA 1O78A 5C3EB 4ME5A 3ZYYX 3HOZB 4BY7B 1MBYA 1CT1D 1EY5A 3S1RB 3BS1A 1EEID 4NW2A 2EYPA 4RCOA 2VUMB 2HCIA 4QUCA 2D9UA 3IL8A 2H1EA 4Q0FA 1ICWA 2ZXPA 3PO3B 3KUPA 1O7LA 1IKLA 5IODA 1UNSA 3NBIA 2IL8A 1LTTD 3M7NA 4P2CB 1FNVA 1HA5A 2L1BA 1EWCA 2RDGA 4BBSB 1Z7TA 3J81E 2F0GA 3GTPB 2F0LA 2F3VA 2B63B 4XIGS 2F0HA 4XQQA 5ISRA 3FPUB 3DEOA 3V2TA 2EY5A 2JXMB 3T51B 4PNYA 1CM9A 5BN5A 2IX3A 5CYUA 2B2TA 2SNSA 2V4DA 3L7ZC 3SK4A 1B9NA 4XYQA 4RKLA 5J1ZA 3GV3A 1WD0A 1I6VC 2MGSA 1RKNA 3J80L 4XQJA 1JOQA 2WINB 1B50A 1H9KA 4DAYA 3T16A 4Y7NB 1BDOA 1D2BA 2BDNA 3KBXA 1GXDC 4H0LC 3EVQA 2A5HA 2RDHA 4C3HG 3H09A 2QF7A 1EY6A 1YNNC 3OW7A 3ONAB 3N6RA 2F0SA 1LTRD 5IGBA 3GTJB 5JVH3 2BCOA 4F8MA 1V1PB 3K59A 1GHJA 4C3JG 3QB3A 4IFDG 3AB9A 1NAPA 2B2VC 1I4QA 4K5VA 1ILQA 2KJXA 1EIGA 3U9OA 4IZ8A 1G291 3FKIB 2XWJB 3VYTA 1SYEA 2NVXB 1AW7A 1TY2A 5HGTA 2WIIB 1SYBA 1PFNA 2VXWA 4WJWA 3CHBD 1WD1A 3Q24A 5JOBA 1EU4A 2DNEA 1AP0A 2WKCA 3NQIA 2ICIA 1D1IA 4KHVA 5JEAH 3S9WA 1F2LA 1DONA 3PUVA 5EBDA 2A73B 2K01A 1RJTA 4ZRZA 4A3BB 2GA4B 3WOEA 1KABA 1BOSA 4ZLTF 3V96A 4MIUA 2B8FA 2HDLA 3A8JE 2F0PA 5DM63 1I4XA 5C0XG 1A3UA 2EYMA 1VMPA 4O42A 4ULLA 3K5MA 3PUYA 2HCCA 4IUPA 4RHSA 2QEJC 1EWHA 4HSPA 1U4LA 4YIJA 4CKCA 4CGYB 4FF1A 3OSOA 1BCPC 1LO5D 2D62A 4K2KA 1PLFA 1PMRA 2EVBA 5JEAG 2ICEC 3DWPA 4K5WA 1E2VA 1STEA 3CRKC 4OO1I 1X3PA 3L3OC 5IIFA 2JA8B 1VF5C 4KHZA 5D3DA 5FO8B 1Y8OB 4DK1A 1KDAA 4IFDI 4J6HA 3RLFA 1EQVA 2F0WA 3EA6A 2C9OA 3MXPA 1STYA 2Q8IB 4F7XA 2B2TC 3MHBA 1ZYRD 1NCVA 2E2DC 2XIWA 4TRDA 3RUZA 5FO9B 1U4MA 1U4RA 1HQMC 4OO1G 3GTLB 3GP7A 5FKAC 2R7ZB 1IKMA 2J7ZA 4RA8A 2R6GA 1AN8A 5M5WB 2A6ED 1ENAA 3Q0AA 2RBMA 3I4MB 1G6ZA 2A6HD 1LABA 5DNFA 4ZK9B 1ZXTA 3NBHA 3G6JB 1OXXK 2L9HA 1SAPA 3QG1A 2OXPA 1UAPA 4IFDJ 5IT9L 1Q1BA 4L6TB 4HSVA 2F0DA 1PZKD 3C3LA 4ZAIA 1B9MA 3MFGA 5CV6A 2RSOA 1E2ZA 3QWNA 2E2HB 1OXVA 2FJ2A 4KD3A 1SSOA 2XNAC 1WTWA 3H91A 3HOXB 2NVQB 3K6OA 3NWSA 2KECA 2EE1A 1PRTB 2QKIC 1JR0D 2F0NA 1RF2D 3VYSA 2E75C 3GTKB 1PTOF 4QCLA 2FMCA 2ZT9C 3EQLC 2E76C 4X3KA 2NUCA 3SDZA 4M8AA 2BOSA 2MUYA 1SJED 4K6LA 1W6KA 4EQOA 2R92B 1E2WA 3PUZA 5D65A 3DHQA 2M00A 1K83B 5K36H 4DGZA 3MC0B 3TZDA 1YNJC 1PXUA 3F2UA 5K36G 1LACA 1SXTA 1TWCB 1V1PA 5FK9C 5A2QE 1A6XA 4C3JB 4EGVA 5HURA 2N88A 1RD9D 4WORA 5EJWA 3BVZA 3SK8A 4KTAA 1V8QA 4DU9A 1BO0A 3S1NB 4LJZC 1SNCA 3IKJA 3CKIB 1D5ZC 1EU3A 1TS4A 4DF7A 2LS01 1J8IA 1ET9A 1VMCA 1SFOB 2DN8A 2WB1B 2A6HC 2O5JC 4FO2A 1O7ZA 1C8CA 3MXGA 3SK5A 4U68A 2DNCA 2AQ1B 1SDFA 4QUFA 1B3AA 4K6DA 1SYGA 2OEOA 1CHQD 1NSNS 3R8BA 1IW7C 1S5DD 4OGQC 3M4YA 2B2UA 3BDCA 2DY8A 4R9WA 4RCNA 1ZKOA 3IFTA 5E3FA 4BS9A 3DEPA 2QDBA 4DA2A 3VA7A 4KKSA 3SVMA 2SEBD 2LY7A 1KLGD 4TKOB 1BUVT 3TP6A 2FHTA 5LL6X 5G3LD 3HOUB 3ITPA 3PUXA 1O80A 1LTGD 5C4ZA 1CK1A 1DJRD 1S5ED 3D3RA 1RDPD 1H9RA 1HTLD 3HEJA 3RZOB 1O7YA 2JSOA 2F0OA 1HQRD 5EKKA 5EPJA 2G9DA 4EQNA 1B53A 1ET6A 1XYIA 4ZKCB 3T4AC 2VNUD 1EY4A 2PZTA 1JOKA 4C56C 3PIP3 2QCPX 3I90A 1WTVA 5IGDA 4I7ZC 2AQ3B 1PDQA 4IUNA 1MI2A 2C5CA 5EQ0A 2K33A 1VDZA 1QJOA 4DK0A 2XSCA 1CHPD 2N55A 2PPBC 1TQOA 1AZPA 2Q8TA 4DXFA 3HRZC 1H9JA 4DN4M 2EYHA 2SNMA 5A35A 5C0XI 2EJMA 4HR7B 1XXGA 4KJNA 1H9SB 1Y8PB 1GOZA 5EKIA 1A3TA 2K7VA 2ENBA 5CV4A 2NB0A 1F9SA 2B39A 3E5SA 3KK7A 1QNUA 4PQXA 3BZDB 4UAIA 2TSSA 3S17B 1MSGA 2K04A 4A3MB 3R2IA 5I9OA 4A3JB 4WRDA 5ELDA 3L9AX 2L4NA 4H13C 1IL8A 4KMUC 3TN2A 4RGMA 2LFNA 3W2DA 2KA7A 3NXWA 1Q90A 2LMCB 4N9TA 3T53B 1Q3LA 1F9QA 3C1EA 4HN7A 5M9OA 4KN7C 2NN6H 1CTMA 1Y1WB 2H4OA 5D14A 1R9TB 5CORA 4CKBA 1SE4A 1QNKA 1F9PA 4IQZA 5C4XB 1GUNA 4OIJA 2NN6I 3A54A 2PO4A 2B2YA 3I4LA 4IUVA 5CV5A 1EYDA 5CGKA 5CMDA 3KLSA 5E4XA 4KJOA 4QF4A 2IW3A 3S1QB 2AQ2B 4KY6A 1CA5A 5I2XA 4OHJA 2AWOA 1CFMA 1BF4A 3PUWA 2F0EA 5EBCA 4MN3A 1I4RA 1CA6A 4F87A 4BY1B 2B2VA 4OIKA 1JORA 3TZUA 5T1IA 2SDFA 3M85A 3D8GA 2A68D 3HKZB 1PTOC 1XX8A 4G7OC 1HRJA 4RHRA 2E2IB 5KGUA 2K05A 5JPNC 1TKWB 3MXNA 4J8QA 3GD7A 3WDNA 1PTOB 4G7HC 1I4GA 5CV8A 5J39A 2HUGA 1QOHA 2R61A 1QE6A 1D5XC 4PMWA 2PW7A 5KNCA 3TP5A 2F0JA 3MFYA 5FO7B 3K5LA 4C1NI 1DXMA 1HTPA 5LL6S 1HPCA 5ELFA 1R4PB 3AU7A 1IW7D 3FPPA 1WTRA 3K7AB 1TR5A 3PV0A 1NR2A 2ZXRA 4FF2A 1S5FD 4DAPA 4HAEA 3BG3A 2F0TA 3MVVA 1NR4A 5CR3A 2JEBI 3BYTB 4ABNA 2XRQD 3JAME 3C2PA 3J80E 3VA5A 3T13A 1Y8NB 2EOTA 2Z1CA 3TP7A 4CKEA 3NP8A 2EYJA 3J7YW 3K57A 5G3LF 2NZ1D 1W6JA 4G57A 2KEDA 3DUZA 4B9WA 1LT3D 3IFDA 1BXTA 1Q1EA 4QB4A 5C3XA 4ZKBB 4G7ZC 1KNAA 1YNJD 4UDUC 5CV9A 3JAML 5IGEA 4IN3A 1DYQA 1WTXA 3PO2B 3S1MB 4IURA 1TU2B 1ESRA 4GZYC 3A56A 4ID6A 3V05A 4OO1H 1BQQT 1JICA 2FINB 3A8KE 1EOTA 1CZGA 2K5WA 4NDXA 3S2DB 3K0YA 2NVYB 2QILA 2YU9B 1S5CD 1BR9A 4Q5VA 2MHVA 1WTQA 1OXSC 3W3AA 2X69A 4R8NA 5BN4A 4X3TA 1Y69U 5ELEA 4FF4A 5EGTA 4FXKC 2X6LA 3G7LA 3J7AV 4C1NK 4RGOS 1JC7A 3EFXD 3LWUA 4WFN3 4BA1I 2DY7A 2NTSA 5C6AA 1T5XD 5TSSA 2XN9C 2E2JB 4QMGA 2BDOA 4FYDA 4FNFA 4RKBA 3NQTA 3GTGB 2WAQB 5JVG3 1SYDA 1VCIA 3D4DA 1SNDA 3P20A 3ND8A 4KY7A 3TMEA 1CQVA 3Q22A 3URYA 1C4QA 4PV1C 3M4OB 3R93A 3DWAA 1J9OA 3FEWX 3OWFA 4DNRB 5ELCA 3KLRA 3P75A 1G91A 1TWGB 1NUCA 2K5DA 1SMYD 2B2UC 1Z6HA 2RDFA 4KKTA 2PQEA 4IUQA 1F2MA 1AEXA 2L0CA 5FOBB 1A2UA 4ILWA 2OT2A 3BVMA 3QO2A 4F88A 1TWFB 5C4JB 3QOLA 4PMBA 4FXDA 3I4NB 4HTHA 3E6ZX 1TVXA 2IWHA 2I07B 1RHPA 3K5NA 1K8MA 1EZ6A 2A68C 5I6WA 2B2WA 1GUOA 2O2LD 3OMGA 2EPBA 3KBGA 1RCVD 3HS0C 1G2SA 2WV6D 1DM0B 3P1HA 1LT6D 2MPMA 3R2TA 4A3EB 3NE5B 3SEBA 4ODGA 5M3MB 5C0XJ 1CQFA 5KRUA 3VR5A 3D6CA 1Y1VB 1DD2A 2G9HD 4BA2I 2JA5B 4TQUS 1MD2D 4EVOA 1GUWA 4XT3B 5KNDA 3DXJC 3CU7A 4HMIA 2EXZA 4LMQD 4BBRB 3QOJA 5AFWA 1BCPB 4FP5D 2B2WC 1HFNA 2BA1A 1QG7A 1AFPA 1STAA 2A74C 5I2YA 3FMCA 2CW0D 2K32A 4G4KA 4I65A 3D31A 1MGSA 1KNEA 3WOFA 4RWSC 2KUMA 1DOKA 1R4QB 3FRPB 3C1FA 2JA7B 1SMYC 1SEBD 2F0MA 4A3FB 3LNNA 2RVLA 1X3QA 5E1FA 4K2LA 5T1GA 1EQTA 1SYCA 2Z8LA 2E74C 3GTOB 4BWGB 4X3SA 2R3ZA 2EJGC 2EZVA 5JJZA 1IYUA 1STGA 2LKVA 3J81L 3MAQA 5EPLA 1SNMA 3ERQA 2FMMA 2L11A 1L0YB 2AUKA 5D3IB 5KYLA 5KNBA 1JCKB 2FFKB 4FXGC 1A2TA 2Y0SB 5BN3A 3DMUA 1SJHD 3I3CA 3SHLA 5LHY1 4XYOA 1HCZA 1JWMD 3S15B 3GTMB 3CQZB 5CV7A 1TS2A 5CBAE 3UI2A 5A2QL 1HHVA 1FGBD 2BE5D 1LTAD 3HOYB 3LX0A 4KV6A 1UUPA 2EY1A 2PYKA 2L12A 3Q23A 3NHHA 2O4XA 4ZUJA 5M3FB 2O5IC 1ENCA 3H94A 2ZXOA 1LV9A 2F0FA 3NUCA 2R93B 1PFMA 5J22A 1FD7D 2CW0C 2M2LA 1B2TA 1Q12A 1IYVA 3A55A 3RZDB 1TT2A 4M1UB 1STHA 1GJXA 2EY6A 3HG9A 1WVLA 3GTQB 4AYBB 2BA0A 1XWEA 2F0IA 3VR3A 4J1MA 1LTID 2J4XA 3HP3A 2PMZB 4NKLA 4CHTB 4PMCA 1B44D 4KK7A 4XQNA 4A3KB 3MA2B 4C3IB 1V43A 4MHEA 1C48A 2F03A 5KYIA 3HOVB 5JAVA 3HZXA 1EL0A 4U673 2K28A 3QJYA 4A3DB 4V0BA 3Q6SA 1YNND 1TWHB 5NUCA 2VB2X 3D4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TQU S;  1E2V A;  1E2Z A;  1Q1E A;  3A7A B;  4JK1 C;  3VR2 A;  1Z7T A;  3CRK C;  5KND A;  3DXJ C;  3M85 A;  2K7V A;  1OXV A;  2PNR C;  2EJF C;  2BE5 D;  3I72 A;  4G7Z C;  3OOC A;  3HGB A;  3GQB A;  2A68 D;  4XIG S;  4G7O C;  1VF5 C;  2A6E C;  4XTC S;  4KHZ A;  2JEA I;  1OXT A;  1IW7 C;  2BA1 A;  4PV1 C;  4OGQ C;  1TKW B;  3M4Y A;  5C0X H;  2F1M A;  1Y8O B;  2JXM B;  3FMC A;  1GHK A;  3A8I E;  2K32 A;  4KI0 A;  4RCN A;  4DK1 A;  3MXU A;  3D31 A;  3T51 B;  1ZKO A;  3IFT A;  2DNE A;  1FYC A;  3GD7 A;  1CI3 M;  2A69 C;  3WDN A;  5BN5 A;  4G7H C;  2E75 C;  1H9S B;  1TU2 B;  2NN6 G;  1ZYR C;  3VR4 A;  2O5I C;  3RLF A;  4KKU A;  3U9S A;  4DNR B;  2ZT9 C;  2D2C C;  3H94 A;  3EQL C;  3T56 B;  2E76 C;  3KLR A;  2V4D A;  4KKS A;  3VA7 A;  4GZY C;  4OO1 H;  3L7Z C;  1B9N A;  4H13 C;  2Q8I B;  3SDZ A;  3P20 A;  4KMU C;  4TKO B;  5KNC A;  1SMY C;  5JEA H;  1DCZ A;  3LNN A;  1H9S A;  1Z6H A;  3A8K E;  1I6V C;  3MFY A;  3PUV A;  2L5T A;  4KKT A;  2A69 D;  1GUT A;  1DXM A;  2KA7 A;  4KN4 C;  1HTP A;  2CW0 C;  1H9K A;  3PUX A;  1E2W A;  3PUZ A;  1VF7 A;  1Q90 A;  3OPO A;  1HPC A;  1HQM C;  2LMC B;  3T53 B;  2AUJ D;  4OO1 G;  1OXU A;  3SE0 A;  5K36 H;  2E74 C;  4DNT B;  2KCC A;  1Q12 A;  1BDO A;  1IW7 D;  4KN7 C;  2EDG A;  3FPP A;  2B8F A;  1IYV A;  2NN6 H;  1CTM A;  1O78 A;  1YNJ C;  3PV0 A;  5K36 G;  3A8J E;  2EJG C;  4H0L C;  1LAC A;  1H9R A;  2YYZ A;  3ND9 A;  2BE5 C;  1GJX A;  4LK1 C;  1H9M A;  2R6G A;  3QIA A;  3I73 A;  5C0X G;  1IYU A;  1OXS C;  3W3A A;  2A6E D;  2QF7 A;  1K8M A;  1A6X A;  4IQZ A;  2A68 C;  2BA0 A;  5BN4 A;  1GUN A;  1YNN C;  3BG3 A;  3OW7 A;  3A7L A;  3VR3 A;  1GUO A;  1Y69 U;  3N6R A;  2NN6 I;  4JBW A;  2JEB I;  3PUY A;  3I4L A;  1V8Q A;  2A6H D;  1LAB A;  2AUK A;  3LWU A;  4LJZ C;  1K8O A;  3IKJ A;  1GHJ A;  4L8J A;  4I7Z C;  4IFD H;  4BA1 I;  1ONL A;  1OXX K;  1EWH A;  5KNB A;  4IFD G;  2PCF B;  2K33 A;  1V43 A;  3AB9 A;  1VDZ A;  1QJO A;  4H44 C;  4DK0 A;  3BDO A;  1GUG A;  3QG1 A;  1O7L A;  1T5E A;  1Y8N B;  2PPB C;  3NE5 B;  5BN3 A;  2AWO A;  3CRL C;  1H9J A;  2B8G A;  2BDO A;  1GUS A;  1CFM A;  1FR3 A;  1Q1B A;  1G29 1;  2A6H C;  2DN8 A;  2JE6 I;  3PUW A;  3QJY A;  3VR6 A;  2O5J C;  2D5D A;  2IT1 A;  2D62 A;  1HCZ A;  3VR5 A;  1PMR A;  2EVB A;  5A35 A;  1VCI A;  2EJM A;  4HR7 B;  3M7N A;  5JEA G;  1DD2 A;  1B9M A;  2DNC A;  4BA2 I;  1Y8P B;  3D4R A;  3TZU A;  3ND8 A; 
#chains in the Genus database with same CATH topology
 5C4X H;  4JK1 C;  4A3I B;  4A3G B;  3STB C;  1JT8 A;  1M8A A;  3KF6 A;  2TMP A;  1BCP F;  3OOC A;  3S1M H;  2EYF A;  4DR2 Q;  1E7Z A;  4AIM A;  4R4O A;  4LF4 Q;  1KTK A;  4Y7N H;  4HCS A;  2KVM A;  4KY5 A;  4XT1 B;  5C0X H;  4IOC A;  1I3Q B;  1TS3 A;  3KF6 B;  2KHI A;  4K8J A;  3CCM A;  1CI3 M;  1SRU A;  2IX1 A;  1I4H A;  2K03 A;  5CC4 A;  2JA6 B;  1EWI A;  1K8A C;  4CBV A;  3OIQ A;  3HFZ B;  4CDF C;  1IL2 A;  2M9V A;  5DEH A;  2NVY H;  1YI2 A;  4LAA A;  4CJ2 C;  5K5P A;  3S14 B;  2YU9 H;  4OXP A;  5FLX L;  5JJI A;  4PG3 A;  4B08 A;  1I6H B;  3OTO L;  2FXQ A;  3MEH A;  1UEA B;  3N52 A;  1KAA A;  4C2M B;  1LLR D;  2PI2 E;  4OEM B;  1U9R A;  4RGT A;  3SE0 A;  4JC0 A;  3H0G B;  1VQI A;  1FNU A;  1E0B A;  1KQS A;  1EYC A;  2IJ0 A;  2EYL A;  2UUC Q;  3G48 A;  4LK1 C;  5LMN W;  1H9M A;  1PTO H;  2RA4 A;  3NTH A;  5C44 G;  2Q2T A;  4NMZ A;  2QGQ A;  3MWY W;  2NVX H;  4A3L G;  1KDC A;  1LTB D;  3KF8 A;  3KJO A;  4A75 A;  3OIP A;  4RGN A;  5DM7 3;  4BY7 H;  1HNW Q;  4OL7 A;  2ZM6 Q;  2MJ8 A;  1HZB A;  5FLX E;  3B6Y A;  1SE2 A;  1N33 Q;  2VB3 X;  1BCP D;  2CHB D;  5M5X B;  4GKK L;  4KD4 A;  2E5L L;  1X3F A;  3S2H B;  2NBF A;  1ENF A;  4HED A;  4O0A A;  1HNX L;  3EJI A;  4ZUI A;  1XPR A;  2HQL A;  3K7A H;  4S3S A;  3GV6 A;  4QIW B;  4GS3 A;  1YHA A;  3IRB A;  1HXY D;  3ICE A;  3NPP A;  4H7B A;  3D4W A;  2CKZ B;  4LF8 L;  4J15 A;  1EYA A;  1F9R A;  1H95 A;  1Z47 A;  1RIP A;  4K5X A;  2N8N A;  2HHH L;  2F0U A;  3MZ5 A;  2JEA I;  3SR1 A;  3X3M A;  3C46 A;  4BBS H;  2KHS A;  1OO9 B;  1QCB D;  1TWG H;  4JVZ A;  2F4I A;  2K5N A;  5IYD H;  3X3N A;  2CH4 W;  3TP8 A;  4XDX A;  2F0K A;  1AZQ A;  3ZJY C;  1MJE A;  4DV1 L;  2UUA Q;  1VQL A;  5GQO A;  3OYY A;  5JEA J;  1DOL A;  1WTP A;  2PZU A;  5C44 B;  1LT5 D;  1DCZ A;  1RTO A;  1TWF H;  2RSN A;  5C4J H;  4HMJ A;  2PQA A;  3H3V H;  4NXM L;  3HOY G;  1VQB A;  1GUT A;  1TS5 A;  3TRE A;  3D0F A;  2OF1 A;  3M3Y B;  4JBM A;  1VF7 A;  2EYO A;  1TY0 A;  1OXU A;  3IAY A;  4FF3 A;  5IT9 E;  3TSS A;  1VQJ A;  1PRT D;  4JI5 Q;  1JE5 A;  3Q8D A;  1PTO D;  1JJC B;  2YYZ A;  5C4H A;  5DAU A;  2I5M X;  3QIA A;  3HKZ E;  4LUZ A;  1GD7 A;  1YEZ A;  1F2Y A;  2NWG A;  1B4O A;  2NYZ D;  2OCE A;  3I73 A;  4DAV A;  1RTN A;  1YIT A;  4JI1 Q;  4AH6 A;  4DV5 Q;  1J5E Q;  3R3O A;  1I4P A;  1QIL A;  2VQF Q;  2QA4 A;  4A3E H;  5IP9 H;  3SK6 A;  4JOI A;  4L8J A;  2NVT B;  2PW5 A;  5M3M H;  1ONL A;  5M5Y B;  3S2D H;  2IPK D;  1JOO A;  2MP1 A;  1GUG A;  3BU2 A;  3PMF A;  2X6G A;  5LMN Q;  1XJV A;  1GUS A;  1FR3 A;  5EKL A;  4IJL A;  5IYB H;  2UXD L;  2IX0 A;  4QL5 A;  3TQY A;  1L0X B;  5I9P A;  5ELN A;  1GO3 E;  4XXE A;  5IOC A;  4APV A;  4JI6 L;  1WCM B;  3D6W A;  2CVR A;  3HOW B;  2L55 A;  3ULJ A;  3A7A B;  3S16 B;  1KRS A;  1P16 A;  3RD4 A;  4TVA B;  1D1K A;  5LMN L;  1EY0 A;  2EJF C;  3FKI G;  4K0K L;  2K6A A;  3KDF A;  1XTC D;  3GQB A;  3FDT A;  4NXN L;  2WAC A;  1SNO A;  3TS0 A;  4GNX C;  1X6O A;  4XTC S;  5COY A;  3KLS X;  1EZ8 A;  3GTL H;  2XWB B;  4DFA A;  2F3I A;  2UU9 L;  3W5O A;  1STN A;  2JP1 A;  4KI0 A;  3H6M A;  4JCV E;  1Q7Y C;  2EY2 A;  4LNQ A;  2E2J H;  2D0P A;  2KQ3 A;  2KEE A;  2KOL A;  3BDL A;  4GKK Q;  2NN6 G;  3CCL A;  1ZYR C;  5C3W A;  1HFG A;  3GTG H;  1Q8I A;  4OX9 L;  1FNW A;  4CJ1 B;  1PYW D;  1X32 A;  2OQ0 A;  2JYO A;  2XVS A;  3VYR A;  2SOB A;  3I8Z A;  1VQE A;  1H9S A;  2E8G A;  1GVP A;  2K5Q A;  3BVG A;  1F77 A;  4KN4 C;  4EQP A;  5CBE E;  1I50 B;  2DJG C;  4N8F A;  3OPO A;  1E3P A;  3KDF B;  1DZ1 A;  4RFB A;  2R7F A;  2F52 A;  1WTO A;  4IAL A;  1N34 Q;  2EDG A;  1JWS D;  2HDM A;  1IBM L;  1NE3 A;  5EAY A;  3GO5 A;  2Z4I A;  4X64 Q;  1VQ5 A;  3HKZ G;  3K58 A;  3ND9 A;  2BE5 C;  3RLO A;  1ROD A;  2D0O A;  4K14 A;  4A93 B;  1G8Z D;  1QB5 D;  1PZJ D;  4DV4 L;  4O1N A;  1J6Q A;  1VQ7 A;  1EY9 A;  3A7L A;  3OWE B;  1STB A;  3O13 A;  3I4N G;  2Q8R E;  4B9X A;  4JBW A;  1AE2 A;  1SYF A;  1Y14 B;  2UUC L;  1I5F A;  2CQO A;  2HQE A;  1HNZ Q;  1KLU D;  5L37 A;  1IBK Q;  1K8O A;  1F2Z A;  4IFD H;  3OMC A;  5KIX A;  3ERS X;  4IUU A;  3JAM i;  4LUO A;  3HOX H;  3GTM H;  5I4D A;  2WKD A;  3CQZ H;  1JJG A;  3CC4 A;  1SBB B;  1TWA B;  2B8G A;  1PYS B;  3VR6 A;  5KEE A;  3I4N H;  1K9M C;  1QVG A;  2D5D A;  2IT1 A;  3HOY H;  1MJC A;  1PZI D;  1RL2 A;  4FVM A;  4R8I A;  3A74 A;  2B2Y C;  2MFI A;  3SXH A;  2VQE Q;  1EY8 A;  5C5M A;  2CCZ A;  1HNX Q;  2WP8 J;  2F0Q A;  2PNR C;  1SNQ A;  3I72 A;  4CJ0 B;  2F3W A;  3HGB A;  1MSH A;  1JQY D;  2DUD A;  1PFB A;  3RNU A;  5M3F H;  1OXT A;  1A3V A;  1T9H A;  1VQ8 A;  1A15 A;  2PZW A;  1BNZ A;  2F1M A;  4Z9C B;  1XNQ L;  1PRT C;  1IZ6 A;  5IGG A;  1FYC A;  1D6E C;  1B1Z A;  1V1O A;  1HA6 A;  1O7I A;  4KKU A;  3ERO A;  4C3H B;  2D2C C;  5J3B A;  1DOM A;  4JI7 L;  4DR7 Q;  1UE7 A;  4DUY Q;  1EY7 A;  1TII D;  1JWU D;  4NP5 A;  5F2D A;  1CZW A;  2I46 A;  4P73 A;  3PQI A;  5I6Y A;  5IGC A;  4DV6 Q;  3NTK A;  2HD3 A;  4BBR H;  3E0J A;  1BBX C;  4DXG A;  3GTQ H;  4DNT B;  1ML0 D;  5ELB A;  3F2D A;  3TBI B;  3K5O A;  3BZK A;  4N9P A;  3TDQ A;  5C5L A;  3MXN B;  1SR3 A;  3OHX C;  2ASB A;  1IHZ A;  1K0S A;  2OTJ A;  4CDD C;  2RHS B;  4C3I G;  1E24 A;  3DM1 A;  4C3I H;  3MTS A;  1EIF A;  3S24 A;  2K1B A;  3BYY B;  4E6I A;  1VQF A;  3HOV H;  5M5W H;  3NTI A;  4ZQ3 A;  2CH4 A;  4AYB G;  4TSS A;  4LF4 L;  1S5B D;  1N8R C;  2PCF B;  4H44 C;  1HUM A;  1NBW A;  2HHH Q;  4GKJ L;  4ME3 A;  2Z4H A;  3BDO A;  1XNR L;  1G2T A;  1N36 L;  1TWH H;  1T5E A;  3GTO H;  3PIO 3;  4A4I A;  3DWQ A;  3CRL C;  4POG A;  1JE4 A;  1II3 A;  2NTT A;  1ZEQ X;  2JE6 I;  4POF A;  4A3G H;  1ILP A;  4JI3 Q;  1U4P A;  3AFP A;  1PRT F;  1LTS D;  4AQY Q;  1SNP A;  1KXL A;  1L1O B;  3PF5 A;  1PH4 A;  3TS2 A;  2CQA A;  4RH6 A;  4LF5 L;  5E4W C;  3J7A F;  3VR2 A;  1M4V A;  3E0E A;  4X3U A;  2YV5 A;  3K80 C;  3HOU H;  3HOZ G;  1LT4 D;  1S4Z A;  2RQX A;  4L63 B;  1EFI D;  4A3C G;  4RAU C;  4HJ5 A;  5H1S E;  2AWN A;  2A6E C;  2RKS A;  1Q81 C;  3RMH A;  1LM0 A;  1QWY A;  2ID0 A;  1IYJ B;  2VZA A;  1K0R A;  1PYB A;  3NK9 A;  1SE3 A;  3M7G A;  1GHK A;  3I70 A;  3A8I E;  3MXU A;  4IUT A;  2UUA L;  1EIH A;  4V19 0;  2A69 C;  1D5M C;  4MNO A;  4K8I A;  2PQA B;  4UP8 A;  3S14 H;  4DR4 Q;  2MO0 A;  1EEF D;  3P7J A;  3VR4 A;  3U9S A;  2XRS D;  3H3V C;  3T56 B;  5LMU L;  4OWT B;  2Z9H A;  4ZYS A;  5EPK A;  3S15 H;  1YJN A;  3VYU A;  5IYD G;  3LWE A;  5JPM C;  3NSW A;  1NJI C;  2F0V A;  2L5T A;  2JA6 G;  2A69 D;  4JPB W;  1KDB A;  3AMU A;  1ESF A;  1N33 L;  1XMO Q;  2AUJ D;  3I91 A;  3W1B A;  1JB3 A;  4DV3 L;  3L2P A;  2K5H A;  2KCC A;  4HCE A;  5IGF A;  4LF8 Q;  1HUN A;  2J0T D;  2KCN A;  3FVQ A;  3NWT A;  2I5L X;  1O78 A;  5C3E B;  1JJ2 A;  5IYC H;  2MQH A;  3CCV A;  4ME5 A;  3ZYY X;  3HOZ B;  1W3S A;  4BY7 B;  1MBY A;  3AFQ A;  1M1K C;  1CT1 D;  4LFB Q;  1EY5 A;  3S1R B;  3BS1 A;  1EEI D;  4NW2 A;  3S2H H;  3STB D;  2EYP A;  4RCO A;  2R93 H;  2VUM B;  2HCI A;  3PO2 G;  4QUC A;  2WB1 G;  2VW9 A;  2D9U A;  1HR0 Q;  1X9N A;  3IL8 A;  2H1E A;  4Q0F A;  1ICW A;  4DV0 Q;  4A3M H;  2Q2H A;  2ZXP A;  2Z0S A;  3PO3 B;  3KUP A;  4LFB L;  1O7L A;  3FP9 A;  1IKL A;  5IOD A;  3HKS A;  1UNS A;  3NBI A;  2IL8 A;  1LTT D;  2XGT A;  3RZD H;  3J80 i;  3CPF A;  3M7N A;  4P2C B;  1FNV A;  1HA5 A;  2L1B A;  1EWC A;  2RDG A;  2YTY A;  4BBS B;  1X3G A;  4X6A H;  1SFO H;  1Z7T A;  3J81 E;  1CKN A;  2F0G A;  3GTP B;  4OWX B;  2F0L A;  2F3V A;  2B63 B;  1VQN A;  1CUK A;  4XIG S;  1HZ9 A;  2F0H A;  4XQQ A;  4HIM A;  5ISR A;  3FPU B;  1Y1W G;  3DEO A;  4A3K H;  3CME A;  4JI2 L;  3V2T A;  2EY5 A;  2JXM B;  1Y1W H;  3T51 B;  4L5T A;  4PNY A;  2P5Z X;  1YJW A;  1CM9 A;  5BN5 A;  2IX3 A;  2OTL A;  4A3D H;  3VDY A;  5CYU A;  2B2T A;  2SNS A;  2V4D A;  2R93 G;  3L7Z C;  3SK4 A;  1B9N A;  4XYQ A;  4RKL A;  1GM5 A;  5J1Z A;  3JAM c;  3GV3 A;  1PH5 A;  1WD0 A;  1I6V C;  2MGS A;  1RKN A;  3J80 L;  4XQJ A;  1JOQ A;  2WIN B;  4N8X 1;  5HY6 A;  1Y1V G;  1C9O A;  1B50 A;  1H9K A;  4DAY A;  3T16 A;  2ATW A;  2MO1 A;  4B3S L;  3UDF A;  4Y7N B;  1BDO A;  4DK6 C;  1D2B A;  2BDN A;  4DR3 L;  4L5S A;  4IPD A;  3KBX A;  1GXD C;  4H0L C;  5HGQ A;  3EVQ A;  2A5H A;  1L2F A;  4UY8 C;  2RDH A;  4JI0 L;  1KD1 C;  4C3H G;  2LXK A;  3H09 A;  2QF7 A;  2JA6 H;  1EY6 A;  1PFS A;  3H0G G;  3UE1 A;  1YNN C;  3OW7 A;  3ONA B;  3N6R A;  4A3I G;  2F0S A;  1VQK A;  1LTR D;  5IGB A;  3GTJ B;  1M90 C;  1A62 A;  5JVH 3;  2BCO A;  4F8M A;  1V1P B;  1GHJ A;  3K59 A;  1I6H H;  4C3J G;  2E2I H;  3QB3 A;  3J7Z C;  2VY3 A;  4DAM A;  4IFD G;  3AB9 A;  1NAP A;  4C2M H;  2B2V C;  1I4Q A;  4K5V A;  1CSQ A;  1ILQ A;  2KJX A;  1EIG A;  3U9O A;  4B3T L;  4IZ8 A;  4YWM A;  1G29 1;  3FKI B;  1S3O A;  2K75 A;  3T1Y L;  2XWJ B;  1N34 L;  3PIP A;  1UE1 A;  3VYT A;  1SYE A;  1WTH A;  2NVX B;  2Z6K C;  1AW7 A;  1V1Q A;  1TY2 A;  4LFC L;  4HJ8 A;  1K3B C;  2E5L Q;  5HGT A;  2WII B;  1SYB A;  1PFN A;  2IHF A;  2VXW A;  2DJF C;  4WJW A;  1V9P A;  3CHB D;  3T1Y Q;  5M5X H;  1WD1 A;  3Q24 A;  4KLK A;  5JOB A;  1EU4 A;  2DNE A;  1AP0 A;  1HZC A;  2WKC A;  4PZ8 A;  1QUQ A;  3NQI A;  2ICI A;  1D1I A;  1Q8K A;  4KHV A;  3S9W A;  5JEA H;  1F2L A;  1DON A;  3PUV A;  5EBD A;  2A73 B;  1K3R A;  2K01 A;  1A0I A;  1RJT A;  1YZ6 A;  1K28 A;  2ZTE A;  4ZRZ A;  4A3B B;  2GA4 B;  3WOE A;  4DV0 L;  2A1A A;  1KAB A;  1BOS A;  4ZLT F;  3V96 A;  3K81 C;  2B8F A;  4MIU A;  2QW7 A;  4X64 L;  2HDL A;  3A8J E;  4KHP L;  2F0P A;  5DM6 3;  1I4X A;  5C0X G;  1EUJ A;  1A3U A;  3M4Q A;  4JBJ A;  2EYM A;  1HJP A;  1VMP A;  4O42 A;  4ULL A;  3K5M A;  3PUY A;  1R9T H;  5C44 H;  2HCC A;  2R7D A;  3H3V I;  4DR3 Q;  4IUP A;  4RHS A;  2QEJ C;  4EX5 A;  1EWH A;  3M3Y H;  3PO2 H;  4HSP A;  2KHJ A;  2N49 A;  1U4L A;  4YIJ A;  4CKC A;  1EQR A;  1N9W A;  1JMC A;  3CD6 A;  4CGY B;  4FF1 A;  3OSO A;  1BCP C;  1LO5 D;  2HIX A;  2D62 A;  4DV7 Q;  4K2K A;  1PLF A;  1PMR A;  2EVB A;  1UE5 A;  4UP9 A;  1X3E A;  2ICE C;  5JEA G;  3S1Q H;  1EOV A;  3DWP A;  4A3B G;  1X56 A;  3AEV A;  2WAQ E;  4JI5 L;  4K5W A;  1E2V A;  3RN5 A;  1STE A;  3CRK C;  4OO1 I;  1X3P A;  3L3O C;  5IIF A;  4GOP A;  1PH7 A;  2JA8 B;  3CW2 C;  2JA7 G;  1VF5 C;  4BY1 H;  4KHZ A;  2RHQ B;  4NB3 A;  2NVT H;  5D3D A;  1VS0 A;  5FO8 B;  1VQO A;  1J5E L;  1CSP A;  1Y8O B;  1VQ9 A;  1LUZ A;  4DK1 A;  1KDA A;  4IFD I;  4J6H A;  4IOA A;  1PV4 A;  3RLF A;  1EQV A;  4GLX A;  2F0W A;  3EA6 A;  2C9O A;  3MXP A;  4BXX H;  1STY A;  2Q8I B;  2VL6 A;  4F7X A;  2B2T C;  3MHB A;  3RR5 A;  1ZYR D;  2Q2I A;  1NCV A;  2E2D C;  2XIW A;  3K7U C;  4DV4 Q;  4TRD A;  3RUZ A;  5FO9 B;  1U4M A;  3CCJ A;  1PH8 A;  4PZ6 A;  1U4R A;  1L1O C;  1HQM C;  4OO1 G;  3RN2 A;  4GOP B;  2V1C C;  4DPG A;  3GTL B;  3GP7 A;  5FKA C;  2R7Z B;  1IKM A;  2J7Z A;  4RA8 A;  4GOP C;  2RCN A;  3CCQ A;  4AQY L;  2R6G A;  1AN8 A;  3U4V A;  5M5W B;  2A6E D;  1ENA A;  1ASY A;  3Q0A A;  3EBE A;  4LF5 Q;  4LW1 A;  4JI2 Q;  2WFW A;  1XMO L;  2RBM A;  4P74 A;  3I4M B;  1HZA A;  1G6Z A;  2A6H D;  1LAB A;  3KLW A;  1XMQ Q;  4QIW E;  1DGS A;  3I2Z A;  5DNF A;  4ZK9 B;  2Z6B A;  5IY0 A;  4I7A A;  1ZXT A;  3NBH A;  3G6J B;  3K8A A;  1OXX K;  1I50 H;  1EYG A;  2L9H A;  1SAP A;  3M4O H;  3QG1 A;  2OXP A;  1UAP A;  4DV1 Q;  4YY3 Q;  4IFD J;  5IT9 L;  3UE0 A;  1Q1B A;  4L6T B;  4HSV A;  3PGZ A;  2F0D A;  4JI3 L;  1PZK D;  3C3L A;  4LF7 L;  4ZAI A;  1B9M A;  3MFG A;  5CV6 A;  2RSO A;  1E2Z A;  3QWN A;  2E2H B;  4WJ3 M;  1PHJ A;  3ULP A;  1OXV A;  4JOI C;  2FJ2 A;  4KD3 A;  1SSO A;  2XNA C;  1KIX A;  4DV6 L;  3I55 A;  1WTW A;  4NPS A;  3H91 A;  4GN3 B;  3HOX B;  3CCE A;  2NVQ B;  3K6O A;  3NWS A;  2KEC A;  2EE1 A;  4JI1 L;  1PRT B;  2QKI C;  1JR0 D;  2F0N A;  1RF2 D;  3VYS A;  2E75 C;  5M3M G;  3GTK B;  1PTO F;  1KAW A;  4QCL A;  1CKN B;  2FMC A;  4GLA C;  2JA9 A;  2ZT9 C;  3EQL C;  2E76 C;  4X3K A;  3ULL A;  1VQP A;  4H02 A;  1KRT A;  2NUC A;  3SDZ A;  4M8A A;  2BOS A;  2MUY A;  4JV5 L;  2N78 A;  1IXR A;  1SJE D;  4K6L A;  1W6K A;  1PA6 A;  5C3E G;  4EQO A;  4B3T Q;  2R92 B;  4HJ9 A;  2N3S A;  1E2W A;  3PUZ A;  5D65 A;  3DHQ A;  2M00 A;  1K83 B;  5K36 H;  2Z6K A;  2GVA A;  1WYD A;  4DGZ A;  3MC0 B;  3TZD A;  1YNJ C;  1PXU A;  1E1T A;  3F2U A;  3G6E A;  5K36 G;  1LAC A;  3DM3 A;  2ALY B;  4IJH A;  5FLM H;  4R4T A;  1SXT A;  1Y1V H;  1TWC B;  5IWA L;  4LFC Q;  3BZC A;  1V1P A;  5FK9 C;  1FGU A;  3CPW A;  2JA5 H;  5A2Q E;  1A6X A;  4C3J B;  3PCO B;  4EGV A;  5HUR A;  2HIV A;  2N88 A;  1RD9 D;  4WOR A;  5EJW A;  1AH9 A;  3BVZ A;  2Q2U A;  3SK8 A;  4KTA A;  1V8Q A;  4DU9 A;  1KC8 C;  1BO0 A;  3S1N B;  1PH6 A;  4LJZ C;  1SNC A;  3IKJ A;  3CKI B;  1HNZ L;  2UXB L;  4QJF A;  1D5Z C;  1EU3 A;  1TS4 A;  3K0X A;  4DF7 A;  2ES2 A;  2LS0 1;  2VQE L;  1J8I A;  1ET9 A;  3KF8 B;  1VMC A;  2L15 A;  3NEN A;  1SFO B;  2DN8 A;  2WB1 B;  2A6H C;  2O5J C;  3E9H A;  4DV7 L;  2F4V L;  4FO2 A;  1O7Z A;  3U58 A;  1C8C A;  3HOW G;  3MXG A;  3F1Z A;  3SK5 A;  1UWV A;  4U68 A;  2DNC A;  2AQ1 B;  1SDF A;  4QUF A;  1B3A A;  3AYH B;  4K6D A;  1SYG A;  1IBK L;  2OEO A;  1CHQ D;  1NSN S;  1X54 A;  3R8B A;  1IW7 C;  1VQD A;  1G51 A;  1S5D D;  1MHW C;  4OGQ C;  3M4Y A;  2B2U A;  3BDC A;  2DY8 A;  4R9W A;  4RCN A;  1ZKO A;  3IFT A;  5IYC G;  4UHV A;  5E3F A;  4BS9 A;  3DEP A;  4DAY B;  2QDB A;  4DA2 A;  2A8V A;  3VA7 A;  4KKS A;  4LWC A;  3SVM A;  4GNX B;  1IBL L;  4LF9 L;  2SEB D;  2LY7 A;  3J80 c;  1KLG D;  4TKO B;  4P72 A;  3L0O A;  5LMU Q;  1BUV T;  3TP6 A;  2FHT A;  5LL6 X;  5G3L D;  3HOU B;  3ITP A;  3PUX A;  5JJL A;  1O80 A;  1LTG D;  5GAG C;  5C4Z A;  1CK1 A;  1DJR D;  4GN5 A;  4RG1 A;  1U0L A;  1E1O A;  1S5E D;  3D3R A;  1RDP D;  3U50 C;  2K5V A;  1H9R A;  1HTL D;  3HEJ A;  1Z9F A;  3GTJ H;  3RZO B;  1O7Y A;  4OON A;  2JSO A;  1GKH A;  2F0O A;  1HQR D;  4YCU A;  3JC6 6;  5EKK A;  5EPJ A;  2MNA A;  4GKJ Q;  3OTO Q;  2G9D A;  4EQN A;  1B53 A;  1MIU A;  1ET6 A;  2Y0S E;  1XYI A;  4ZKC B;  3T4A C;  3I4M G;  2VNU D;  1EY4 A;  2PZT A;  1JOK A;  4C56 C;  3PIP 3;  2QCP X;  3I90 A;  4DR2 L;  1WTV A;  1NTG A;  5IGD A;  4I7Z C;  2AQ3 B;  1PDQ A;  4IUN A;  1MI2 A;  2C5C A;  2KCM A;  5EQ0 A;  2K33 A;  1VDZ A;  1QJO A;  4DK0 A;  1E22 A;  2XSC A;  1CHP D;  1XNR Q;  2N55 A;  2PPB C;  1KHI A;  1TQO A;  1AZP A;  2Q8T A;  4DXF A;  2R7Z G;  3HRZ C;  1H9J A;  4DN4 M;  3I4O A;  2EYH A;  2SNM A;  1YHB A;  4BY1 G;  1Q82 C;  5A35 A;  5C0X I;  2EJM A;  4HR7 B;  3HOU G;  3HOZ H;  1XXG A;  4KJN A;  4DV3 Q;  1W2B A;  1H9S B;  1Y8P B;  4HIO A;  1GOZ A;  5EKI A;  1A3T A;  3S1R H;  2K7V A;  2ENB A;  5CV4 A;  2IHE A;  2NB0 A;  1F9S A;  2B39 A;  3E5S A;  2VUM H;  4A93 G;  4LFA L;  2XTI A;  3KK7 A;  1QNU A;  3UDG A;  4PQX A;  3BZD B;  4UAI A;  4EQ5 A;  2TSS A;  3S17 B;  1MSG A;  2K04 A;  4A3M B;  3R2I A;  5I9O A;  5GAD C;  1AE3 A;  4JYA L;  2DGY A;  4A3J B;  4B3M Q;  4WRD A;  5ELD A;  3EIV A;  3L9A X;  4DUZ L;  2L4N A;  1PH1 A;  4H13 C;  3RLN A;  1IL8 A;  4A3B H;  4DR6 Q;  2UU9 Q;  4KMU C;  3TN2 A;  5FLX c;  4RGM A;  2LFN A;  4DR7 L;  1EQQ A;  3GTP H;  3W2D A;  2KA7 A;  3NXW A;  4BBS G;  2B63 H;  5FJ8 G;  4DK3 C;  1Q90 A;  2LMC B;  4N9T A;  3T53 B;  3CC7 A;  1N32 Q;  2JA7 H;  4B3R L;  3I7F A;  1Q3L A;  1F9Q A;  3C1E A;  2AHO B;  4HN7 A;  1A8V A;  2C35 B;  5M9O A;  4KN7 C;  3HOX G;  4A3F H;  1K8G A;  4A3F G;  3AQQ A;  2NN6 H;  1CTM A;  4X66 Q;  1Y1W B;  2H4O A;  5D14 A;  1R9T B;  4BY7 G;  2OWO A;  1D7Q A;  5COR A;  4CKB A;  4L5R C;  1SE4 A;  1QNK A;  1N36 Q;  1L0W A;  1F9P A;  1VQM A;  4IQZ A;  4A3K G;  5C4X B;  4A3I H;  1C0A A;  1GUN A;  2NZH A;  4OIJ A;  1PH2 A;  2NN6 I;  3A54 A;  2H5X A;  2PO4 A;  2B2Y A;  1WCM G;  3I4L A;  4IUV A;  5CV5 A;  3SGI A;  1EYD A;  5CGK A;  1SMX A;  5CMD A;  4X65 Q;  3KLS A;  4YWK A;  1FVI A;  5E4X A;  4KJO A;  4QF4 A;  1I3Q H;  4NXM Q;  2IW3 A;  3S1Q B;  2AQ2 B;  1B8A A;  4KY6 A;  1CA5 A;  4DV2 L;  5I2X A;  4OHJ A;  4DR5 Q;  2AWO A;  4JI6 Q;  1CFM A;  4HJ7 A;  4DUZ Q;  3PUW A;  2F0E A;  5EBC A;  1BF4 A;  4MN3 A;  1I4R A;  1CA6 A;  2JQO A;  4F87 A;  4BY1 B;  3FHW A;  4WJ4 A;  2B2V A;  4OIK A;  1JOR A;  3TZU A;  2JN4 A;  5T1I A;  2SDF A;  3M85 A;  1X65 A;  4DNI A;  1HR0 W;  2RCF A;  3D8G A;  2A68 D;  2K4K A;  3HKZ B;  1PTO C;  1XX8 A;  1U5K A;  4G7O C;  1HRJ A;  4RHR A;  2E2I B;  3H0G H;  5KGU A;  2K05 A;  5JPN C;  1TKW B;  3MXN A;  4J8Q A;  3CC2 A;  3J81 i;  1VQC A;  3PIO A;  3U4Z A;  3GD7 A;  3WDN A;  1PTO B;  4IPC A;  1ICF B;  4G7H C;  1I4G A;  4LUV A;  3FKI H;  3UDI A;  5CV8 A;  5J39 A;  2JJQ A;  2HUG A;  3F2C A;  4X62 Q;  1QOH A;  2R61 A;  1QE6 A;  1D5X C;  2VS1 A;  4PMW A;  2PW7 A;  5KNC A;  1A63 A;  1PVO A;  3KYH C;  3TP5 A;  3W1G A;  2F0J A;  3MFY A;  4JI8 L;  5FO7 B;  2UUB L;  4R1J A;  3K5L A;  4C1N I;  1DXM A;  5IYB G;  5JJK A;  1HTP A;  5LL6 S;  1QUQ B;  1HPC A;  5ELF A;  1R4P B;  3AU7 A;  1IW7 D;  2ZTC A;  3FPP A;  4OX9 Q;  3WWV A;  1WTR A;  3K7A B;  1TR5 A;  3PV0 A;  3TEH B;  4JV5 Q;  1NR2 A;  4ALP A;  1G6P A;  2ZXR A;  2I5H A;  4FF2 A;  1S5F D;  4DAP A;  4HAE A;  3BG3 A;  2F0T A;  3H15 A;  3EN2 A;  3MVV A;  4HIK A;  1NR4 A;  3M9B A;  5CR3 A;  4R4C A;  4PZ7 A;  2UXB Q;  2JEB I;  3BYT B;  3CCR A;  4OWW B;  4ABN A;  2AMC B;  1S72 A;  2XRQ D;  4ZCK A;  3JAM E;  4A3D G;  3GDE A;  4L5Q A;  3C2P A;  3J80 E;  5BR8 Q;  3VA5 A;  4CDC C;  1TXY A;  3T13 A;  1Y8N B;  2EOT A;  2Z1C A;  3TP7 A;  4CKE A;  3NP8 A;  5IWA Q;  2PI2 A;  2EYJ A;  3J7Y W;  3K57 A;  2E2H H;  1EFW A;  1VQ6 A;  1IBM Q;  5G3L F;  2NZ1 D;  1W6J A;  4G57 A;  4LF7 Q;  2KED A;  3DUZ A;  4B9W A;  3PSI A;  1QZH A;  1LT3 D;  3CF5 A;  3IFD A;  1BXT A;  1Q1E A;  4QB4 A;  5C3X A;  4ZKB B;  4DR4 L;  4G7Z C;  1KNA A;  1YNJ D;  1SRO A;  1XNQ Q;  4UDU C;  3GTK H;  5CV9 A;  3JAM L;  1WI5 A;  5IGE A;  4IN3 A;  1DYQ A;  1WTX A;  1BBW A;  3PO2 B;  3S1M B;  4RMF A;  4IUR A;  1TU2 B;  1ESR A;  4GZY C;  3A56 A;  4ID6 A;  3V05 A;  4OO1 H;  2PNH A;  5FJ8 H;  1BQQ T;  1K83 H;  1CKM A;  1JIC A;  2FIN B;  3A8K E;  3KOJ A;  1EOT A;  4IPG A;  1CZG A;  5BR8 L;  4QGU A;  4GLV B;  2UXD Q;  2K5W A;  4JYA Q;  4JBK A;  4NDX A;  3S2D B;  1OTC A;  3K0Y A;  3J81 c;  1TWC H;  2JA8 H;  2NVY B;  2QIL A;  2YU9 B;  1S5C D;  4A3M G;  5IE8 A;  4LF6 Q;  2HT1 A;  1BR9 A;  1B7Y B;  4Q5V A;  3CCU A;  1XPU A;  1B3Q A;  2EXD A;  2MHV A;  1WCM H;  3S1N H;  1WTQ A;  2BH2 A;  1OXS C;  3W3A A;  2BH8 A;  2X69 A;  3HOW H;  4R8N A;  5BN4 A;  3E9I A;  3S16 H;  4X3T A;  1Y69 U;  5ELE A;  4FF4 A;  4JI0 Q;  5EGT A;  4A3C H;  4LF6 L;  4IO9 A;  4FXK C;  2X6L A;  3G7L A;  3J7A V;  4C1N K;  4RGO S;  1JC7 A;  2GVB A;  1S40 A;  3M4P A;  3EFX D;  3LWU A;  4WFN 3;  1XPO A;  4BA1 I;  2DY7 A;  2NTS A;  5C6A A;  3NEL A;  3J81 j;  2Y0S G;  4LFA Q;  1YBY A;  4DV2 Q;  3LGJ A;  1T5X D;  5TSS A;  2XN9 C;  2E2J B;  4QMG A;  2UXC L;  2BDO A;  4FYD A;  4FNF A;  2R7Z H;  1KL9 A;  4RKB A;  3NQT A;  4UPA A;  3GTG B;  2WAQ B;  5JVG 3;  1SYD A;  2JA5 G;  1VCI A;  3D4D A;  4DUY L;  1SND A;  3P20 A;  3ND8 A;  1BBU A;  4KY7 A;  3TME A;  1FJG Q;  1CQV A;  3QR8 A;  3CMA A;  3I4M H;  1PH9 A;  3Q22 A;  1HNW L;  2QDL A;  4GNX A;  3G71 A;  4R4I A;  5DLQ E;  3URY A;  4A3J G;  1C4Q A;  4PV1 C;  4A3G G;  1XTD A;  3M4O B;  3R93 A;  1YHQ A;  3A5U A;  3DWA A;  4P71 A;  1J9O A;  2VUM G;  4A93 H;  3FEW X;  1YNX A;  3OWF A;  4DNR B;  2I0Q A;  1Q86 C;  5ELC A;  1X55 A;  3KLR A;  3P75 A;  4BBR G;  1TWG B;  1G91 A;  1NUC A;  1I94 Q;  2K5D A;  4DR1 Q;  1SMY D;  2B2U C;  1Z6H A;  3KFU A;  1NNX A;  2RDF A;  4MZ9 A;  4KKT A;  2PQE A;  4IUQ A;  1F2M A;  1AEX A;  1LYL A;  2L0C A;  4AYB E;  5FOB B;  1A2U A;  4ILW A;  1NMG A;  2NZO A;  1QVF A;  2OT2 A;  1YVC A;  5AJ3 L;  5ELO A;  2A19 A;  3BVM A;  3QO2 A;  4F88 A;  1TWF B;  5C4J B;  3QOL A;  4PMB A;  4FXD A;  3I4N B;  3PF4 A;  3F8T A;  4HTH A;  2NVQ H;  2R92 G;  3E6Z X;  1P8L A;  4DR6 L;  1TVX A;  2IWH A;  4R4Q A;  2I07 B;  1RHP A;  3K5N A;  2B63 G;  2OQK A;  1K8M A;  1EZ6 A;  5IP7 G;  2A68 C;  4A3L H;  5I6W A;  2B2W A;  2EQS A;  1GUO A;  1HR0 L;  1WJJ A;  2O2L D;  3OMG A;  2EPB A;  3KBG A;  1BKB A;  1RCV D;  4IPH A;  4BXX G;  3HS0 C;  4MTK A;  1G2S A;  4B3R Q;  2WV6 D;  2R92 H;  1DM0 B;  4OEL B;  4YHH Q;  3P1H A;  1LT6 D;  2MPM A;  3R2T A;  4A3E B;  3NE5 B;  3PO3 G;  3SEB A;  3J7A 5;  4JI4 L;  3I56 A;  4ODG A;  5M3M B;  5C0X J;  3F2B A;  1CQF A;  5M5Y H;  5KRU A;  3VR5 A;  5IP7 H;  4DR1 L;  1NMF A;  2LSS A;  3D6C A;  1Y1V B;  1DD2 A;  2G9H D;  4BA2 I;  4A76 A;  2F4V Q;  2JA5 B;  4TQU S;  4C3J H;  1MD2 D;  3A5Z B;  1VQ4 A;  4EVO A;  3S17 H;  1YJ9 A;  4XT3 B;  1JB7 A;  1GUW A;  5KND A;  3DXJ C;  1QVC A;  3CU7 A;  4HMI A;  4K0K Q;  2EXZ A;  4LMQ D;  4BBR B;  2PMZ E;  1SE8 A;  2CFM A;  3QOJ A;  2LXJ A;  1BCP B;  5AFW A;  4JI8 Q;  2QEX A;  2UUB Q;  3TRZ A;  2ZJQ A;  4FP5 D;  2B2W C;  1HFN A;  2BA1 A;  1QG7 A;  4QQB X;  1AFP A;  1STA A;  2A74 C;  5I2Y A;  3FMC A;  2CW0 D;  2K32 A;  4G4K A;  4I65 A;  4YY3 L;  3D31 A;  1MGS A;  5M3F G;  4X62 L;  1KNE A;  3WOF A;  1VQA A;  4RWS C;  2KUM A;  1DOK A;  1R4Q B;  3FRP B;  3T1H Q;  4HJA A;  1HH2 P;  1XMQ L;  3C1F A;  2JA7 B;  4MTN A;  1SMY C;  4Y52 H;  1SEB D;  2F0M A;  4A3F B;  3LNN A;  2RVL A;  1X3Q A;  5E1F A;  4YHH L;  4K2L A;  4B3S Q;  1MKH A;  1WFQ A;  5T1G A;  4X65 L;  4CDE C;  1EQT A;  1SYC A;  1UEB A;  2Z8L A;  5E7N A;  2E74 C;  2KCT A;  3GTO B;  4BWG B;  2CWA A;  2EIF A;  2G5D A;  4X3S A;  2R3Z A;  2EJG C;  2K52 A;  2JA8 G;  1IBL Q;  4LF9 Q;  2EZV A;  5JJZ A;  1VQG A;  1IYU A;  1STG A;  2LKV A;  4A3E G;  2KEN A;  3J81 L;  3MAQ A;  5EPL A;  1SNM A;  2AKW B;  2GN5 A;  2RF4 A;  3ERQ A;  1ASZ A;  2FMM A;  2L11 A;  1L0Y B;  2AUK A;  5IT9 c;  5D3I B;  5KYL A;  4YCW A;  1D8L A;  4JI7 Q;  3KJP A;  2JK8 A;  4B3M L;  5KNB A;  1JCK B;  2FFK B;  2YTX A;  4FDB A;  3HOV G;  3NEM A;  3CCS A;  4FXG C;  1EIY B;  1A2T A;  5GRO A;  2Y0S B;  3G4S A;  5BN3 A;  4HID A;  3CP0 A;  4DKA C;  4JW0 A;  3DMU A;  1SJH D;  3I3C A;  3UDX A;  1BVS A;  3SHL A;  5LHY 1;  4XYO A;  1HCZ A;  1JWM D;  3RZO H;  2K50 A;  3GTM B;  3S15 B;  3MEF A;  3CQZ B;  2K14 A;  5CV7 A;  1TS2 A;  5FLM G;  2B29 A;  3NBH B;  3UI2 A;  5CBA E;  1TWA H;  5A2Q L;  1HHV A;  1FGB D;  1FL0 A;  1CKO A;  2BE5 D;  1LTA D;  3HOY B;  1NY4 A;  3LX0 A;  4KV6 A;  1UUP A;  2IY5 B;  2ZTD A;  1Q46 A;  2EY1 A;  3CXC A;  2PYK A;  3OW2 A;  2L12 A;  1C7Y A;  4DV5 L;  3Q23 A;  3NHH A;  5C3E H;  1SN8 A;  1L1O A;  2VQF L;  4DR5 L;  1FJG L;  3DLL A;  1N32 L;  1B70 B;  3E3X A;  2O4X A;  4ZUJ A;  5M3F B;  1UE6 A;  2O5I C;  2YTV A;  1VQH A;  4O2D A;  4YCV A;  2ZJP A;  4GN4 B;  4X66 L;  1ENC A;  3H94 A;  2ZXO A;  2B3G A;  1LV9 A;  2F0F A;  1K73 C;  3NUC A;  2R93 B;  4NXN Q;  5GAH C;  1PFM A;  5J22 A;  2UXC Q;  2WB1 E;  4C3H H;  1FD7 D;  2CWP A;  4QY7 A;  1YIJ A;  2CW0 C;  3PO3 H;  2M2L A;  1B2T A;  4JG2 A;  1LTL A;  4KHP Q;  1Q12 A;  2WAQ G;  1I94 L;  1IYV A;  2ZM6 L;  3A55 A;  1PH3 A;  3T1H L;  2KBN A;  4P75 A;  3RZD B;  1TT2 A;  4JI4 Q;  4M1U B;  3CAM A;  1STH A;  1GJX A;  2EY6 A;  4YWL A;  3HG9 A;  5IP9 G;  1WVL A;  1WOC A;  3GTQ B;  4AYB B;  5GAE C;  4A3J H;  2BA0 A;  1XWE A;  2F0I A;  3VR3 A;  4J1M A;  1LTI D;  2J4X A;  3A0J A;  3ER0 A;  3HP3 A;  2PMZ B;  4UP7 A;  4NKL A;  1QZG A;  4CHT B;  3BJU A;  4PMC A;  1B44 D;  4KK7 A;  4XQN A;  4A3K B;  5C4X G;  3MA2 B;  4C3I B;  1V43 A;  4MHE A;  1C48 A;  2F03 A;  5KYI A;  3HOV B;  5JAV A;  3HZX A;  1EL0 A;  1SLJ A;  4U67 3;  2K28 A;  3QJY A;  4A3D B;  4V0B A;  2ZJR A;  3Q6S A;  1YNN D;  1TWH B;  5NUC A;  2VB2 X;  5AJ3 Q;  3D4R A; 
#chains in the Genus database with same CATH homology
 4JK1 C;  4A3I B;  4A3G B;  1M8A A;  2TMP A;  1BCP F;  3OOC A;  2EYF A;  1KTK A;  4HCS A;  2KVM A;  4KY5 A;  4XT1 B;  5C0X H;  1I3Q B;  1TS3 A;  4K8J A;  1CI3 M;  2IX1 A;  1I4H A;  2K03 A;  5CC4 A;  2JA6 B;  4CBV A;  3OIQ A;  2M9V A;  5DEH A;  4LAA A;  4CJ2 C;  5K5P A;  3S14 B;  5FLX L;  4B08 A;  1I6H B;  3MEH A;  1UEA B;  3N52 A;  1KAA A;  4C2M B;  1LLR D;  1U9R A;  4RGT A;  3SE0 A;  3H0G B;  1FNU A;  1E0B A;  1EYC A;  2IJ0 A;  2EYL A;  4LK1 C;  1H9M A;  1PTO H;  2RA4 A;  3NTH A;  4NMZ A;  3MWY W;  1KDC A;  1LTB D;  3KF8 A;  3OIP A;  4RGN A;  5DM7 3;  4OL7 A;  2MJ8 A;  5FLX E;  1SE2 A;  2VB3 X;  1BCP D;  2CHB D;  5M5X B;  4KD4 A;  3S2H B;  2NBF A;  1ENF A;  4HED A;  3EJI A;  4ZUI A;  4S3S A;  3GV6 A;  4QIW B;  1HXY D;  3NPP A;  4H7B A;  3D4W A;  1EYA A;  1F9R A;  1Z47 A;  4K5X A;  2F0U A;  3MZ5 A;  2JEA I;  3SR1 A;  3X3M A;  3C46 A;  2KHS A;  1OO9 B;  1QCB D;  2F4I A;  3X3N A;  3TP8 A;  4XDX A;  2F0K A;  1AZQ A;  5JEA J;  1DOL A;  1WTP A;  2PZU A;  5C44 B;  1LT5 D;  1DCZ A;  1RTO A;  2RSN A;  4HMJ A;  1GUT A;  1TS5 A;  2OF1 A;  3M3Y B;  1VF7 A;  2EYO A;  1TY0 A;  1OXU A;  3IAY A;  4FF3 A;  5IT9 E;  3TSS A;  1PRT D;  1PTO D;  2YYZ A;  5C4H A;  5DAU A;  3QIA A;  2NYZ D;  3I73 A;  1F2Y A;  2NWG A;  1B4O A;  4DAV A;  1RTN A;  3R3O A;  1I4P A;  1QIL A;  3SK6 A;  4L8J A;  2NVT B;  2PW5 A;  1ONL A;  5M5Y B;  2IPK D;  1JOO A;  2MP1 A;  1GUG A;  3PMF A;  2X6G A;  1GUS A;  1FR3 A;  5EKL A;  2IX0 A;  1L0X B;  5I9P A;  4XXE A;  5IOC A;  1WCM B;  3D6W A;  2CVR A;  3HOW B;  2L55 A;  3A7A B;  3S16 B;  3RD4 A;  1D1K A;  1EY0 A;  2EJF C;  2K6A A;  1XTC D;  3GQB A;  3FDT A;  2WAC A;  1SNO A;  4XTC S;  5COY A;  3KLS X;  1EZ8 A;  2XWB B;  4DFA A;  1STN A;  2JP1 A;  4KI0 A;  3H6M A;  2EY2 A;  2KQ3 A;  2KEE A;  2KOL A;  3BDL A;  2NN6 G;  1ZYR C;  5C3W A;  1HFG A;  1Q8I A;  1FNW A;  4CJ1 B;  1PYW D;  1X32 A;  2JYO A;  2XVS A;  3VYR A;  2SOB A;  3I8Z A;  1H9S A;  2K5Q A;  3BVG A;  1F77 A;  4KN4 C;  4EQP A;  5CBE E;  1I50 B;  3OPO A;  1DZ1 A;  4RFB A;  1WTO A;  4IAL A;  2EDG A;  1JWS D;  2HDM A;  3GO5 A;  2Z4I A;  3K58 A;  3ND9 A;  2BE5 C;  1ROD A;  4A93 B;  4K14 A;  1G8Z D;  1QB5 D;  1PZJ D;  4O1N A;  1EY9 A;  3A7L A;  3OWE B;  1STB A;  3O13 A;  2Q8R E;  4B9X A;  4JBW A;  1SYF A;  2HQE A;  1KLU D;  1K8O A;  1F2Z A;  4IFD H;  3OMC A;  5KIX A;  4IUU A;  5I4D A;  2WKD A;  1SBB B;  1TWA B;  2B8G A;  3VR6 A;  5KEE A;  2D5D A;  2IT1 A;  1PZI D;  4FVM A;  4R8I A;  2B2Y C;  3SXH A;  1EY8 A;  5C5M A;  2WP8 J;  2F0Q A;  2PNR C;  1SNQ A;  3I72 A;  4CJ0 B;  2F3W A;  3HGB A;  1MSH A;  1JQY D;  1PFB A;  1OXT A;  1A3V A;  1A15 A;  2PZW A;  1BNZ A;  2F1M A;  4Z9C B;  1PRT C;  5IGG A;  1FYC A;  1D6E C;  1B1Z A;  1V1O A;  1HA6 A;  4KKU A;  3ERO A;  4C3H B;  2D2C C;  1DOM A;  1EY7 A;  1TII D;  1JWU D;  4NP5 A;  5F2D A;  1CZW A;  2I46 A;  5I6Y A;  5IGC A;  3NTK A;  3E0J A;  1BBX C;  4DXG A;  4DNT B;  1ML0 D;  5ELB A;  3TBI B;  3K5O A;  4N9P A;  3TDQ A;  5C5L A;  3OHX C;  1IHZ A;  4C3I G;  3DM1 A;  3MTS A;  2K1B A;  3BYY B;  4E6I A;  3NTI A;  4ZQ3 A;  4TSS A;  1S5B D;  2PCF B;  4H44 C;  1HUM A;  2Z4H A;  3BDO A;  1G2T A;  1T5E A;  3PIO 3;  3DWQ A;  3CRL C;  1JE4 A;  1II3 A;  2NTT A;  1ZEQ X;  2JE6 I;  1ILP A;  1U4P A;  1PRT F;  1LTS D;  1SNP A;  2CQA A;  4RH6 A;  5E4W C;  3J7A F;  3VR2 A;  1M4V A;  4X3U A;  1LT4 D;  1S4Z A;  2RQX A;  4L63 B;  1EFI D;  4RAU C;  2AWN A;  2A6E C;  2RKS A;  3RMH A;  1QWY A;  2ID0 A;  3NK9 A;  1SE3 A;  3M7G A;  1GHK A;  3I70 A;  3A8I E;  3MXU A;  4IUT A;  1EIH A;  4V19 0;  2A69 C;  1D5M C;  4K8I A;  1EEF D;  3P7J A;  3VR4 A;  3U9S A;  2XRS D;  3H3V C;  3T56 B;  4ZYS A;  5EPK A;  3VYU A;  3LWE A;  5JPM C;  3NSW A;  2F0V A;  2L5T A;  2A69 D;  1KDB A;  3AMU A;  1ESF A;  2AUJ D;  3I91 A;  1JB3 A;  2KCC A;  4HCE A;  5IGF A;  1HUN A;  2J0T D;  2KCN A;  3FVQ A;  3NWT A;  1O78 A;  5C3E B;  4ME5 A;  3ZYY X;  3HOZ B;  4BY7 B;  1MBY A;  1CT1 D;  1EY5 A;  3S1R B;  3BS1 A;  1EEI D;  4NW2 A;  2EYP A;  4RCO A;  2VUM B;  2HCI A;  4QUC A;  2D9U A;  3IL8 A;  2H1E A;  4Q0F A;  1ICW A;  2ZXP A;  3PO3 B;  3KUP A;  1O7L A;  1IKL A;  5IOD A;  1UNS A;  3NBI A;  2IL8 A;  1LTT D;  3M7N A;  4P2C B;  1FNV A;  1HA5 A;  2L1B A;  1EWC A;  2RDG A;  4BBS B;  1Z7T A;  3J81 E;  2F0G A;  3GTP B;  2F0L A;  2F3V A;  2B63 B;  4XIG S;  2F0H A;  4XQQ A;  5ISR A;  3FPU B;  3DEO A;  3V2T A;  2EY5 A;  2JXM B;  3T51 B;  4PNY A;  1CM9 A;  5BN5 A;  2IX3 A;  5CYU A;  2B2T A;  2SNS A;  2V4D A;  3L7Z C;  3SK4 A;  1B9N A;  4XYQ A;  4RKL A;  5J1Z A;  3GV3 A;  1WD0 A;  1I6V C;  2MGS A;  1RKN A;  3J80 L;  4XQJ A;  1JOQ A;  2WIN B;  1B50 A;  1H9K A;  4DAY A;  3T16 A;  4Y7N B;  1BDO A;  1D2B A;  2BDN A;  3KBX A;  1GXD C;  4H0L C;  3EVQ A;  2A5H A;  2RDH A;  4C3H G;  3H09 A;  2QF7 A;  1EY6 A;  1YNN C;  3OW7 A;  3ONA B;  3N6R A;  2F0S A;  1LTR D;  5IGB A;  3GTJ B;  5JVH 3;  2BCO A;  4F8M A;  1V1P B;  3K59 A;  1GHJ A;  4C3J G;  3QB3 A;  4IFD G;  3AB9 A;  1NAP A;  2B2V C;  1I4Q A;  4K5V A;  1ILQ A;  2KJX A;  1EIG A;  3U9O A;  4IZ8 A;  1G29 1;  3FKI B;  2XWJ B;  3VYT A;  1SYE A;  2NVX B;  1AW7 A;  1TY2 A;  5HGT A;  2WII B;  1SYB A;  1PFN A;  2VXW A;  4WJW A;  3CHB D;  1WD1 A;  3Q24 A;  5JOB A;  1EU4 A;  2DNE A;  1AP0 A;  2WKC A;  3NQI A;  2ICI A;  1D1I A;  4KHV A;  5JEA H;  3S9W A;  1F2L A;  1DON A;  3PUV A;  5EBD A;  2A73 B;  2K01 A;  1RJT A;  4ZRZ A;  4A3B B;  2GA4 B;  3WOE A;  1KAB A;  1BOS A;  4ZLT F;  3V96 A;  4MIU A;  2B8F A;  2HDL A;  3A8J E;  2F0P A;  5DM6 3;  1I4X A;  5C0X G;  1A3U A;  2EYM A;  1VMP A;  4O42 A;  4ULL A;  3K5M A;  3PUY A;  2HCC A;  4IUP A;  4RHS A;  2QEJ C;  1EWH A;  4HSP A;  1U4L A;  4YIJ A;  4CKC A;  4CGY B;  4FF1 A;  3OSO A;  1BCP C;  1LO5 D;  2D62 A;  4K2K A;  1PLF A;  1PMR A;  2EVB A;  5JEA G;  2ICE C;  3DWP A;  4K5W A;  1E2V A;  1STE A;  3CRK C;  4OO1 I;  1X3P A;  3L3O C;  5IIF A;  2JA8 B;  1VF5 C;  4KHZ A;  5D3D A;  5FO8 B;  1Y8O B;  4DK1 A;  1KDA A;  4IFD I;  4J6H A;  3RLF A;  1EQV A;  2F0W A;  3EA6 A;  2C9O A;  3MXP A;  1STY A;  2Q8I B;  4F7X A;  2B2T C;  3MHB A;  1ZYR D;  1NCV A;  2E2D C;  2XIW A;  4TRD A;  3RUZ A;  5FO9 B;  1U4M A;  1U4R A;  1HQM C;  4OO1 G;  3GTL B;  3GP7 A;  5FKA C;  2R7Z B;  1IKM A;  2J7Z A;  4RA8 A;  2R6G A;  1AN8 A;  5M5W B;  2A6E D;  1ENA A;  3Q0A A;  2RBM A;  3I4M B;  1G6Z A;  2A6H D;  1LAB A;  5DNF A;  4ZK9 B;  1ZXT A;  3NBH A;  3G6J B;  1OXX K;  2L9H A;  1SAP A;  3QG1 A;  2OXP A;  1UAP A;  4IFD J;  5IT9 L;  1Q1B A;  4L6T B;  4HSV A;  2F0D A;  1PZK D;  3C3L A;  4ZAI A;  1B9M A;  3MFG A;  5CV6 A;  2RSO A;  1E2Z A;  3QWN A;  2E2H B;  1OXV A;  2FJ2 A;  4KD3 A;  1SSO A;  2XNA C;  1WTW A;  3H91 A;  3HOX B;  2NVQ B;  3K6O A;  3NWS A;  2KEC A;  2EE1 A;  1PRT B;  2QKI C;  1JR0 D;  2F0N A;  1RF2 D;  3VYS A;  2E75 C;  3GTK B;  1PTO F;  4QCL A;  2FMC A;  2ZT9 C;  3EQL C;  2E76 C;  4X3K A;  2NUC A;  3SDZ A;  4M8A A;  2BOS A;  2MUY A;  1SJE D;  4K6L A;  1W6K A;  4EQO A;  2R92 B;  1E2W A;  3PUZ A;  5D65 A;  3DHQ A;  2M00 A;  1K83 B;  5K36 H;  4DGZ A;  3MC0 B;  3TZD A;  1YNJ C;  1PXU A;  3F2U A;  5K36 G;  1LAC A;  1SXT A;  1TWC B;  1V1P A;  5FK9 C;  5A2Q E;  1A6X A;  4C3J B;  4EGV A;  5HUR A;  2N88 A;  1RD9 D;  4WOR A;  5EJW A;  3BVZ A;  3SK8 A;  4KTA A;  1V8Q A;  4DU9 A;  1BO0 A;  3S1N B;  4LJZ C;  1SNC A;  3IKJ A;  3CKI B;  1D5Z C;  1EU3 A;  1TS4 A;  4DF7 A;  2LS0 1;  1J8I A;  1ET9 A;  1VMC A;  1SFO B;  2DN8 A;  2WB1 B;  2A6H C;  2O5J C;  4FO2 A;  1O7Z A;  1C8C A;  3MXG A;  3SK5 A;  4U68 A;  2DNC A;  2AQ1 B;  1SDF A;  4QUF A;  1B3A A;  4K6D A;  1SYG A;  2OEO A;  1CHQ D;  1NSN S;  3R8B A;  1IW7 C;  1S5D D;  4OGQ C;  3M4Y A;  2B2U A;  3BDC A;  2DY8 A;  4R9W A;  4RCN A;  1ZKO A;  3IFT A;  5E3F A;  4BS9 A;  3DEP A;  2QDB A;  4DA2 A;  3VA7 A;  4KKS A;  3SVM A;  2SEB D;  2LY7 A;  1KLG D;  4TKO B;  1BUV T;  3TP6 A;  2FHT A;  5LL6 X;  5G3L D;  3HOU B;  3ITP A;  3PUX A;  1O80 A;  1LTG D;  5C4Z A;  1CK1 A;  1DJR D;  1S5E D;  3D3R A;  1RDP D;  1H9R A;  1HTL D;  3HEJ A;  3RZO B;  1O7Y A;  2JSO A;  2F0O A;  1HQR D;  5EKK A;  5EPJ A;  2G9D A;  4EQN A;  1B53 A;  1ET6 A;  1XYI A;  4ZKC B;  3T4A C;  2VNU D;  1EY4 A;  2PZT A;  1JOK A;  4C56 C;  3PIP 3;  2QCP X;  3I90 A;  1WTV A;  5IGD A;  4I7Z C;  2AQ3 B;  1PDQ A;  4IUN A;  1MI2 A;  2C5C A;  5EQ0 A;  2K33 A;  1VDZ A;  1QJO A;  4DK0 A;  2XSC A;  1CHP D;  2N55 A;  2PPB C;  1TQO A;  1AZP A;  2Q8T A;  4DXF A;  3HRZ C;  1H9J A;  4DN4 M;  2EYH A;  2SNM A;  5A35 A;  5C0X I;  2EJM A;  4HR7 B;  1XXG A;  4KJN A;  1H9S B;  1Y8P B;  1GOZ A;  5EKI A;  1A3T A;  2K7V A;  2ENB A;  5CV4 A;  2NB0 A;  1F9S A;  2B39 A;  3E5S A;  3KK7 A;  1QNU A;  4PQX A;  3BZD B;  4UAI A;  2TSS A;  3S17 B;  1MSG A;  2K04 A;  4A3M B;  3R2I A;  5I9O A;  4A3J B;  4WRD A;  5ELD A;  3L9A X;  2L4N A;  4H13 C;  1IL8 A;  4KMU C;  3TN2 A;  4RGM A;  2LFN A;  3W2D A;  2KA7 A;  3NXW A;  1Q90 A;  2LMC B;  4N9T A;  3T53 B;  1Q3L A;  1F9Q A;  3C1E A;  4HN7 A;  5M9O A;  4KN7 C;  2NN6 H;  1CTM A;  1Y1W B;  2H4O A;  5D14 A;  1R9T B;  5COR A;  4CKB A;  1SE4 A;  1QNK A;  1F9P A;  4IQZ A;  5C4X B;  1GUN A;  4OIJ A;  2NN6 I;  3A54 A;  2PO4 A;  2B2Y A;  3I4L A;  4IUV A;  5CV5 A;  1EYD A;  5CGK A;  5CMD A;  3KLS A;  5E4X A;  4KJO A;  4QF4 A;  2IW3 A;  3S1Q B;  2AQ2 B;  4KY6 A;  1CA5 A;  5I2X A;  4OHJ A;  2AWO A;  1CFM A;  1BF4 A;  3PUW A;  2F0E A;  5EBC A;  4MN3 A;  1I4R A;  1CA6 A;  4F87 A;  4BY1 B;  2B2V A;  4OIK A;  1JOR A;  3TZU A;  5T1I A;  2SDF A;  3M85 A;  3D8G A;  2A68 D;  3HKZ B;  1PTO C;  1XX8 A;  4G7O C;  1HRJ A;  4RHR A;  2E2I B;  5KGU A;  2K05 A;  5JPN C;  1TKW B;  3MXN A;  4J8Q A;  3GD7 A;  3WDN A;  1PTO B;  4G7H C;  1I4G A;  5CV8 A;  5J39 A;  2HUG A;  1QOH A;  2R61 A;  1QE6 A;  1D5X C;  4PMW A;  2PW7 A;  5KNC A;  3TP5 A;  2F0J A;  3MFY A;  5FO7 B;  3K5L A;  4C1N I;  1DXM A;  1HTP A;  5LL6 S;  1HPC A;  5ELF A;  1R4P B;  3AU7 A;  1IW7 D;  3FPP A;  1WTR A;  3K7A B;  1TR5 A;  3PV0 A;  1NR2 A;  2ZXR A;  4FF2 A;  1S5F D;  4DAP A;  4HAE A;  3BG3 A;  2F0T A;  3MVV A;  1NR4 A;  5CR3 A;  2JEB I;  3BYT B;  4ABN A;  2XRQ D;  3JAM E;  3C2P A;  3J80 E;  3VA5 A;  3T13 A;  1Y8N B;  2EOT A;  2Z1C A;  3TP7 A;  4CKE A;  3NP8 A;  2EYJ A;  3J7Y W;  3K57 A;  5G3L F;  2NZ1 D;  1W6J A;  4G57 A;  2KED A;  3DUZ A;  4B9W A;  1LT3 D;  3IFD A;  1BXT A;  1Q1E A;  4QB4 A;  5C3X A;  4ZKB B;  4G7Z C;  1KNA A;  1YNJ D;  4UDU C;  5CV9 A;  3JAM L;  5IGE A;  4IN3 A;  1DYQ A;  1WTX A;  3PO2 B;  3S1M B;  4IUR A;  1TU2 B;  1ESR A;  4GZY C;  3A56 A;  4ID6 A;  3V05 A;  4OO1 H;  1BQQ T;  1JIC A;  2FIN B;  3A8K E;  1EOT A;  1CZG A;  2K5W A;  4NDX A;  3S2D B;  3K0Y A;  2NVY B;  2QIL A;  2YU9 B;  1S5C D;  1BR9 A;  4Q5V A;  2MHV A;  1WTQ A;  1OXS C;  3W3A A;  2X69 A;  4R8N A;  5BN4 A;  4X3T A;  1Y69 U;  5ELE A;  4FF4 A;  5EGT A;  4FXK C;  2X6L A;  3G7L A;  3J7A V;  4C1N K;  4RGO S;  1JC7 A;  3EFX D;  3LWU A;  4WFN 3;  4BA1 I;  2DY7 A;  2NTS A;  5C6A A;  1T5X D;  5TSS A;  2XN9 C;  2E2J B;  4QMG A;  2BDO A;  4FYD A;  4FNF A;  4RKB A;  3NQT A;  3GTG B;  2WAQ B;  5JVG 3;  1SYD A;  1VCI A;  3D4D A;  1SND A;  3P20 A;  3ND8 A;  4KY7 A;  3TME A;  1CQV A;  3Q22 A;  3URY A;  1C4Q A;  4PV1 C;  3M4O B;  3R93 A;  3DWA A;  1J9O A;  3FEW X;  3OWF A;  4DNR B;  5ELC A;  3KLR A;  3P75 A;  1G91 A;  1TWG B;  1NUC A;  2K5D A;  1SMY D;  2B2U C;  1Z6H A;  2RDF A;  4KKT A;  2PQE A;  4IUQ A;  1F2M A;  1AEX A;  2L0C A;  5FOB B;  1A2U A;  4ILW A;  2OT2 A;  3BVM A;  3QO2 A;  4F88 A;  1TWF B;  5C4J B;  3QOL A;  4PMB A;  4FXD A;  3I4N B;  4HTH A;  3E6Z X;  1TVX A;  2IWH A;  2I07 B;  1RHP A;  3K5N A;  1K8M A;  1EZ6 A;  2A68 C;  5I6W A;  2B2W A;  1GUO A;  2O2L D;  3OMG A;  2EPB A;  3KBG A;  1RCV D;  3HS0 C;  1G2S A;  2WV6 D;  1DM0 B;  3P1H A;  1LT6 D;  2MPM A;  3R2T A;  4A3E B;  3NE5 B;  3SEB A;  4ODG A;  5M3M B;  5C0X J;  1CQF A;  5KRU A;  3VR5 A;  3D6C A;  1Y1V B;  1DD2 A;  2G9H D;  4BA2 I;  2JA5 B;  4TQU S;  1MD2 D;  4EVO A;  1GUW A;  4XT3 B;  5KND A;  3DXJ C;  3CU7 A;  4HMI A;  2EXZ A;  4LMQ D;  4BBR B;  3QOJ A;  5AFW A;  1BCP B;  4FP5 D;  2B2W C;  1HFN A;  2BA1 A;  1QG7 A;  1AFP A;  1STA A;  2A74 C;  5I2Y A;  3FMC A;  2CW0 D;  2K32 A;  4G4K A;  4I65 A;  3D31 A;  1MGS A;  1KNE A;  3WOF A;  4RWS C;  2KUM A;  1DOK A;  1R4Q B;  3FRP B;  3C1F A;  2JA7 B;  1SMY C;  1SEB D;  2F0M A;  4A3F B;  3LNN A;  2RVL A;  1X3Q A;  5E1F A;  4K2L A;  5T1G A;  1EQT A;  1SYC A;  2Z8L A;  2E74 C;  3GTO B;  4BWG B;  4X3S A;  2R3Z A;  2EJG C;  2EZV A;  5JJZ A;  1IYU A;  1STG A;  2LKV A;  3J81 L;  3MAQ A;  5EPL A;  1SNM A;  3ERQ A;  2FMM A;  2L11 A;  1L0Y B;  2AUK A;  5D3I B;  5KYL A;  5KNB A;  1JCK B;  2FFK B;  4FXG C;  1A2T A;  2Y0S B;  5BN3 A;  3DMU A;  1SJH D;  3I3C A;  3SHL A;  5LHY 1;  4XYO A;  1HCZ A;  1JWM D;  3S15 B;  3GTM B;  3CQZ B;  5CV7 A;  1TS2 A;  5CBA E;  3UI2 A;  5A2Q L;  1HHV A;  1FGB D;  2BE5 D;  1LTA D;  3HOY B;  3LX0 A;  4KV6 A;  1UUP A;  2EY1 A;  2PYK A;  2L12 A;  3Q23 A;  3NHH A;  2O4X A;  4ZUJ A;  5M3F B;  2O5I C;  1ENC A;  3H94 A;  2ZXO A;  1LV9 A;  2F0F A;  3NUC A;  2R93 B;  1PFM A;  5J22 A;  1FD7 D;  2CW0 C;  2M2L A;  1B2T A;  1Q12 A;  1IYV A;  3A55 A;  3RZD B;  1TT2 A;  4M1U B;  1STH A;  1GJX A;  2EY6 A;  3HG9 A;  1WVL A;  3GTQ B;  4AYB B;  2BA0 A;  1XWE A;  2F0I A;  3VR3 A;  4J1M A;  1LTI D;  2J4X A;  3HP3 A;  2PMZ B;  4NKL A;  4CHT B;  4PMC A;  1B44 D;  4KK7 A;  4XQN A;  4A3K B;  3MA2 B;  4C3I B;  1V43 A;  4MHE A;  1C48 A;  2F03 A;  5KYI A;  3HOV B;  5JAV A;  3HZX A;  1EL0 A;  4U67 3;  2K28 A;  3QJY A;  4A3D B;  4V0B A;  3Q6S A;  1YNN D;  1TWH B;  5NUC A;  2VB2 X;  3D4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...