3WDNA

High-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
b'SVRKFTEKHEWVTTENGVGTVGISNFAQEALGDVVYCSLPEVGTKLNKQEEFGALESVKAASELYSPLSGEVTEINKALAENPGLVNKSCYEDGWLIKMTFSNPSELDELMSEEAYEKYIKSIEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine cleavage system H protein, mitochondrial
publication title High-resolution X-ray crystal structure of bovine H-protein using the high-pressure cryocooling method
pubmed doi rcsb
source organism Bos taurus
molecule tags Oxidoreductase
total genus 36
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3wdnA00
1VDZA 4H13C 2K7VA 1GJXA 3A8JE 3T56B 1Q90A 3VR6A 1GUNA 5BN4A 1Q1EA 1GHJA 2K33A 2ZT9C 3OOCA 3QG1A 2QF7A 1DCZA 1V43A 2IT1A 1H9MA 4JK1C 1OXTA 1TKWB 1V8QA 5A35A 4G7ZC 1DXMA 2NN6H 4IQZA 2AWOA 5KNBA 2PNRC 1H9KA 3D4RA 2O5IC 2PCFB 2D2CC 2KCCA 5K36H 3DXJC 1GUOA 3CRKC 1H9SA 2DN8A 2AUJD 1ZYRC 2JEAI 1E2WA 1LABA 4IFDG 1Y69U 3M7NA 3I72A 2NN6I 1E2VA 1E2ZA 4KN4C 3A8IE 3A8KE 2O5JC 1Y8PB 3T51B 1FR3A 4DNRB 3LWUA 4LJZC 3VR5A 3M85A 2EJGC 4OGQC 1QJOA 1I6VC 3BG3A 3MXUA 1GHKA 1IW7D 3QIAA 3BDOA 3D31A 1G291 1FYCA 2V4DA 1GUGA 1CI3M 3CRLC 3LNNA 4KI0A 3VR2A 5JEAG 4OO1G 1O78A 3FPPA 1OXUA 3AB9A 1B9MA 2B8GA 2R6GA 3EQLC 4OO1H 2B8FA 4KKSA 2BE5D 4KKTA 2JEBI 3I4LA 1IW7C 3MFYA 3M4YA 3OPOA 3GD7A 1YNJC 2F1MA 1T5EA 2EJMA 3ND9A 2E75C 2L5TA 2JE6I 2Q8IB 2A6EC 2EDGA 4PV1C 3PUXA 4JBWA 3A7LA 2YYZA 1HQMC 2BE5C 1GUSA 1TU2B 4G7HC 1VCIA 4IFDH 3IFTA 2PPBC 3VR3A 3PUZA 4KKUA 4KN7C 5BN5A 1LACA 1CFMA 2AUKA 5KNCA 2D5DA 4RCNA 3QJYA 1Z6HA 1CTMA 4G7OC 2D62A 3PV0A 1OXVA 3WDNA 1H9SB 1VF7A 3SDZA 1K8OA 3H94A 3KLRA 2A6ED 4I7ZC 1VF5C 3PUYA 4BA2I 4DNTB 5JEAH 1Y8OB 2A69C 4BA1I 2EVBA 1ONLA 3W3AA 1GUTA 4TQUS 3TZUA 2BDOA 3L7ZC 3N6RA 4DK0A 3NE5B 1IYVA 2BA0A 4XTCS 2CW0C 3P20A 4KMUC 1B9NA 2A6HC 1Z7TA 3FMCA 2A68D 1OXXK 2BA1A 3IKJA 3U9SA 1A6XA 3GQBA 1H9JA 1H9RA 2A69D 4HR7B 1HTPA 4LK1C 4XIGS 2NN6G 1Y8NB 2EJFC 3VR4A 3PUWA 4KHZA 5K36G 3ND8A 2KA7A 2DNCA 1Q1BA 2E76C 1IYUA 1PMRA 2A68C 4H0LC 4L8JA 1SMYC 5C0XG 2A6HD 2JXMB 3PUVA 4TKOB 1ZKOA 2LMCB 1HPCA 3OW7A 3I73A 3RLFA 1HCZA 3T53B 1BDOA 1EWHA 5C0XH 2E74C 5KNDA 4DK1A 4H44C 4GZYC 1YNNC 3A7AB 2K32A 1Q12A 1DD2A 1O7LA 1OXSC 3SE0A 1K8MA 3HGBA 3VA7A 2DNEA 5BN3A
chains in the Genus database with same CATH superfamily
2MGSA 4X66Q 4K8IA 4QIWE 5M3MG 3NWSA 2LS01 1GUNA 4KK7A 4HSVA 2VXWA 4RWSC 1Y1VH 2ZT9C 4HN7A 3S16B 1B2TA 1OXTA 1GOZA 1QE6A 1S3OA 4IURA 1ICFB 4IQZA 4DF7A 5GAHC 5KNBA 1GUOA 2PQAA 5ELFA 4A3JH 4A3MG 2NVYH 4ZQ3A 1KAWA 1Y69U 4A3EG 2KHJA 1SE2A 3GV6A 4O0AA 1VQGA 4X62Q 5F2DA 3JAMi 2PMZB 4DPGA 4FXGC 3VA5A 3NTHA 3KJOA 2NB0A 2Q8IB 4JBMA 1TWFH 3BYYB 4A93G 1J8IA 4KY7A 4M1UB 1GUSA 5IYBH 3KF8B 4N8X1 5GQOA 5JPNC 3H3VH 3PIP3 3DMUA 2M9VA 3MZ5A 4L63B 3C1FA 1CTMA 1HNWQ 2N55A 3SGIA 3K6OA 3MXGA 3TP6A 4JW0A 4NXMQ 2N3SA 4IPCA 2V1CC 2F03A 1X56A 1X55A 1SJHD 3OMGA 1AH9A 4KMUC 3DM1A 5FLMH 2D9UA 1HUNA 3SVMA 2N78A 1F2LA 1RL2A 4C3IH 3GTMB 1U9RA 4XT3B 4C56C 2YV5A 1EZ8A 5C3EG 1PH1A 2EJFC 2WIIB 3IRBA 1D5ZC 4OELB 1NSNS 1XNQL 5C0XG 1HFNA 1WOCA 2JA7G 4U68A 3E5SA 5KNDA 1IBMQ 5T1GA 1LTSD 2XGTA 3HOWB 4ODGA 1ESRA 1KLUD 2E2HB 3S1QB 3MWYW 2R3ZA 3I4NG 2C35B 4CKBA 4FO2A 1K3BC 5C4JH 4A3KG 1UEAB 4CKEA 4DN4M 4PZ6A 1QZGA 3GTLB 4U673 4R1JA 1V8QA 1K28A 3D6WA 1A0IA 3OSOA 5JVG3 4DXFA 1I4HA 3RR5A 1PFBA 5GAEC 5I6YA 1J5EQ 1JORA 1NBWA 5IGCA 1FNVA 5C44B 3LWUA 4LF7Q 4J6HA 2ASBA 5C3WA 1XMOL 3FPUB 3R3OA 1PH6A 3F2DA 3H3VC 3TP8A 4B9XA 1KHIA 1OXUA 2XWJB 3DEOA 5HGQA 1ESFA 3K5NA 4K6DA 2BE5D 5FOBB 3FRPB 3TS0A 3C1EA 3H09A 5A2QE 3K80C 4DV1L 1BNZA 1EY8A 1GUWA 1VQHA 2KENA 3K5OA 1X32A 4IOCA 2F4IA 1E1OA 3S2DH 4JI1L 2JYOA 1ICWA 1L1OB 1QCBD 4G7OC 3S1RH 3GDEA 1X3FA 3WDNA 3GTJH 3K7AH 5FJ8H 5D3IB 2EYOA 1CZWA 1WCMH 2XN9C 3DLLA 3CCEA 2JN4A 1LTGD 1GUTA 1E3PA 1OO9B 2K5HA 1BCPD 4B3RQ 1SFOB 4BBSB 2RDHA 3SEBA 5DNFA 1VQEA 4HJ7A 4LAAA 5EKIA 3HOZG 1LTBD 2F0QA 2F0KA 1A3UA 2KA7A 3T4AC 5IGBA 5IYDG 3PO2G 4PNYA 4R8NA 2Z8LA 1BBXC 2SNSA 2LMCB 4OWXB 4YCUA 1QVCA 4PZ8A 2JA8H 1EUJA 2CFMA 3S9WA 3HOUH 1V1PA 4HEDA 3A56A 4J8QA 2DJFC 1BXTA 2WB1E 1SNPA 4LFCL 3SE0A 4DR5Q 4C3JB 3HGBA 3K5MA 1S5BD 3I4MH 4ULLA 5BN3A 1D7QA 3AQQA 4KY5A 4B3MQ 4JI0L 3RZOB 1HZ9A 4RGMA 1ZYRD 5L37A 3L3OC 4NPSA 3SR1A 1Q1EA 2E2JH 1O7ZA 5IT9E 4IPDA 5M5XB 2AQ1B 5HGTA 3UDXA 1PFMA 3CRKC 3BZKA 2EYMA 4B9WA 2JEAI 4KHPQ 1T5XD 2F0LA 4EQ5A 4B3TL 3M7NA 4A3BB 1SEBD 1UWVA 5D65A 2B2UA 1GKHA 1IKMA 2Z9HA 1DOKA 2EY6A 5LMNL 1ENFA 3V2TA 4P73A 1GD7A 2J0TD 1YJWA 5IOCA 3LNNA 4EGVA 1STGA 5IGEA 1NJIC 4GOPB 2E5LQ 1QOHA 1BCPF 2IW3A 5M3MH 3G7LA 2ZTDA 1W3SA 4DK6C 4ZUJA 4IPHA 1FD7D 4GN3B 1C7YA 1KC8C 3H15A 1G91A 2B2YA 4L5QA 1G2SA 4A3MH 1EFWA 4DR1L 3CW2C 4A3EH 2XRQD 2UXCQ 3WOEA 1SYGA 1CSQA 2R7FA 2CVRA 1BCPC 3A5ZB 4EQOA 3K5LA 5EKKA 2HUGA 3H3VI 1MBYA 3ERSX 4DNTB 1PHJA 4TQUS 1X6OA 1DYQA 3CD6A 1UAPA 5FO9B 3OTOL 2OTJA 5IY0A 2A68D 1Y1WG 1HA5A 2NVTB 2O2LD 2F0HA 3NBHA 5JEAJ 1SYBA 1U4MA 3NTIA 4IUPA 4LF4L 3PIPA 2KCTA 1UE7A 3WOFA 3NQIA 1BBWA 2JXMB 3FP9A 2K6AA 3E9HA 1SE8A 2K4KA 5M5WB 3KYHC 2NZHA 3TP5A 1HUMA 1PFSA 1A3TA 4A3FG 1WVLA 2NVQH 4AYBB 5IGFA 2F0JA 4A4IA 1N33L 1VDZA 5AFWA 2XIWA 4GLVB 1TWAB 3AMUA 3T56B 4JI4L 1PZKD 4DUYL 1JWMD 2VZAA 1KQSA 1JCKB 4DV4Q 1HJPA 4JI6Q 1X3EA 3M9BA 3HOXG 5LL6S 4LF8L 1TKWB 2NWGA 5CV5A 5C3EH 2B29A 1IKLA 1CHPD 1CKMA 1AN8A 2D2CC 4LFBL 1TWHH 1LYLA 4DV2L 1AEXA 1QUQB 4PMWA 5I9PA 3PIO3 1RDPD 3TZDA 3S15B 1RJTA 1EFID 3OWEB 3J81i 2JA7H 1KDAA 1STEA 3NELA 3EIVA 2Q2HA 1LLRD 4DR6L 1YNXA 4NMZA 1EU3A 4DV3Q 2B2VA 2MUYA 1GVPA 5CC4A 5CGKA 2N8NA 3BS1A 1X54A 3D8GA 3GTGH 4NXNQ 3FPPA 2B8GA 2CQAA 5I9OA 1XNRQ 3I4NH 2RA4A 5I2XA 4AQYL 1DONA 4A3KH 3F8TA 1R9TH 3S17H 3OPOA 4HIMA 5C4XB 5IYBG 3I56A 4QCLA 2MP1A 2E75C 3CCRA 2JE6I 4OXPA 3D0FA 1BF4A 3I90A 2VW9A 2VQFQ 3H0GG 4OWTB 3PO3G 2MQHA 3T13A 1LUZA 3DWPA 4KN7C 4JBKA 1I3QB 2OEOA 1KRTA 3K7UC 4C3HG 2PQAB 1K8AC 4A3IH 4B3SQ 1HR0L 3GTQH 2KCNA 2R7ZB 1WTOA 3S2HH 4DV7Q 2ATWA 5IT9L 3IAYA 3J80i 5FLMG 4FYDA 3CQZB 3OYYA 2AKWB 2I46A 3T1HQ 1RIPA 2WAQG 1E24A 4LK1C 2ZXPA 3L9AX 3I7FA 4P71A 1VQNA 2PI2E 4JYAL 5K36G 5JOBA 5KRUA 3MFGA 2HHHQ 3CC4A 1SE3A 2A6HD 2A1AA 4RCOA 1PYSB 3TREA 4NKLA 5G3LF 2YU9H 1S5CD 2KECA 4TVAB 4YY3Q 3CCSA 2JA6B 3IL8A 3UE0A 1PYBA 2KBNA 3GTOH 1DD2A 3NUCA 4LF9L 4OEMB 1LT4D 2WB1B 2PW7A 4CJ1B 1RTNA 3VR6A 1TS2A 5DM63 1TWCB 3S24A 1SE4A 4JCVE 3K0YA 3QG1A 1C0AA 1DCZA 3E0EA 1S5FD 4FVMA 3JAML 1JOKA 1N34L 4G7ZC 3HOZH 3G6EA 1K9MC 4RH6A 5IYDH 3PO2H 1SAPA 4GOPA 1PDQA 1E2WA 5IP7G 4QQBX 3I72A 3G6JB 4DV0Q 2DY8A 4V0BA 1GUGA 5JEAG 1UE1A 2IX0A 2R61A 2EE1A 2GN5A 1KLGD 1J6QA 1EIFA 1I4RA 4KKTA 3ZJYC 4CJ2C 3X3MA 1YHBA 3TQYA 3LGJA 1L2FA 2UU9Q 3U50C 4DR7Q 1U4LA 2FMMA 4HCEA 4JBWA 1UE5A 1X3QA 1EOTA 3U4VA 2KCMA 3TBIB 1IBLQ 4YHHL 5C3XA 2X69A 5IWAL 1WCMG 3NP8A 1E22A 1EEID 5J39A 4X65L 2F0IA 1C4QA 1PZJD 3KUPA 5DAUA 1STNA 1IYJB 4QUFA 4IFDJ 3I55A 2EVBA 1XPOA 2VY3A 4G4KA 3P7JA 5JPMC 1UE6A 1Q86C 4LF5Q 3I70A 3RD4A 2Y0SE 2A6HC 3HOWG 3QR8A 1PH3A 2BH8A 4RFBA 5DEHA 1CA5A 2R92G 3ONAB 3HS0C 2A69D 3CCMA 1G6PA 3CCJA 1RODA 2EYJA 2IY5B 1B50A 4JI3L 4A3JB 2VB3X 4Y7NH 2E76C 1ZEQX 1TY0A 2Q8TA 2CCZA 3HOUG 3PUVA 1A8VA 1DOLA 3CAMA 4DAVA 1X9NA 4RGNA 3FHWA 2ES2A 4OL7A 2UUAL 2M2LA 1PYWD 1LTTD 3OMCA 5ELDA 1PV4A 2VB2X 3EFXD 3FKIG 1CSPA 1S4ZA 2A19A 3M4PA 1SYCA 4GKKL 4FP5D 5BR8L 1DGSA 3HEJA 1G8ZD 3Q8DA 2DJGC 1D1IA 1JE4A 3Q23A 3RZDH 2C5CA 2ZM6Q 2PCFB 1RCVD 1H9SA 3BDCA 1ILPA 1EIHA 1PH7A 2L9HA 3A54A 4DA2A 1SMXA 3D4WA 4WRDA 1MHWC 4JI7L 1LT3D 3QIAA 1G291 1TY2A 4A3FH 2NYZD 4MZ9A 1IBKQ 1NCVA 3E6ZX 2AQ2B 5IYCG 4IFDI 3MEFA 3CF5A 2L0CA 1F2MA 2EXDA 3HKZG 4F87A 3MHBA 1V1PB 3TSSA 1WD1A 1IW7C 3R2TA 1TWGH 4X3TA 2F1MA 4C3IB 3HOXH 2LY7A 3PIOA 2RDFA 3CU7A 3N52A 4GLXA 1LTAD 1MGSA 4JI5Q 1EY7A 5HURA 2I0QA 3HKSA 1LACA 3E0JA 4N9TA 4R8IA 1I6HH 4CGYB 2D5DA 3BVMA 4FF2A 1PTOF 3JC66 4Q5VA 3VYRA 1PH4A 2SOBA 1HTLD 4DUZL 1QZHA 2A69C 5ELBA 4OX9L 3GO5A 2B2TC 2E2IH 1SYEA 4IUQA 4DK0A 1MKHA 3D6CA 3Q24A 1BR9A 1JICA 1YBYA 2PYKA 4DV5Q 1ET9A 5C4JB 1XYIA 2F0MA 2CH4W 2K14A 2LKVA 2RSOA 4RMFA 1G2TA 1WFQA 1SN8A 2HQEA 3H0GH 3M7GA 3PO3H 1JJGA 1XTDA 4JI2L 3T1YQ 2KHIA 3MXPA 3G4SA 3J80E 2WP8J 1DM0B 2IPKD 1LTRD 1Q8KA 4C3HH 1ASZA 1NE3A 3U4ZA 1S40A 4R4TA 1MJCA 4CDCC 1VS0A 1SDFA 5EJWA 5EBDA 4P74A 2YTXA 1B70B 3ERQA 3HOVH 5E3FA 4X64Q 4DR3Q 1WTVA 1VQOA 2KHSA 4IJHA 5C5MA 2AMCB 1FL0A 3OHXC 3J7AF 1K0RA 2K33A 1HNXQ 2QF7A 1TS4A 1LTID 4I65A 2PNRC 1H9KA 3G48A 5K36H 3DXJC 1CK1A 1OTCA 4JI8Q 3S16H 4DNIA 4IFDG 3NBHB 1QWYA 2K5WA 1KTKA 1HZCA 4H7BA 3S2DB 5IODA 3A8IE 3MA2B 2RHQB 1EIYB 3VR5A 1B4OA 3S1RB 3VYUA 4BBRG 3K7AB 3EA6A 4ZLTF 2BOSA 1NMFA 2QW7A 3NBIA 2NVXH 3CRLC 3GTKB 4OIJA 1I5FA 1YHAA 4YIJA 2MJ8A 1CT1D 1NR2A 2K50A 2EYPA 2RCFA 1FVIA 1HA6A 4B08A 3F2BA 4H02A 1EY6A 4A76A 1EY5A 4YCVA 3M4QA 4JV5L 2DUDA 5IP7H 3QOLA 4DV6L 1M8AA 3HFZB 4A3IG 4K5WA 2Q2UA 4LMQD 2D62A 1SNOA 1VF7A 4QY7A 4DFAA 5JEAH 1SR3A 4KJNA 4CKCA 1AW7A 2KUMA 1NAPA 4DAPA 4DR4L 2JJQA 1N32L 1Z7TA 1YEZA 2Y0SB 1SNMA 3F2UA 4AYBG 1N8RC 4JI2Q 2K04A 4K8JA 3AFQA 1H9RA 3L0OA 4MIUA 3DWAA 5C6AA 1Q3LA 2B63G 4KHZA 2G5DA 1Q1BA 4MNOA 3GTMH 4IN3A 3GV3A 4ALPA 4BY1B 1Q46A 1Y14B 1ZKOA 2VQEL 1EWHA 4FF4A 1EZ6A 3NXWA 5ELOA 4F8MA 3A7AB 1I94L 1WTHA 4RHRA 1JE5A 3J81L 1OXSC 1K73C 1F9SA 1XNQQ 1O7YA 1EQQA 1XPUA 5M3MB 4A3GG 5GROA 3HOWH 1B1ZA 2R92H 3Q22A 4JK1C 2XTIA 4C2MH 4J15A 3UDGA 3OIPA 2O5IC 4JOIC 2ALYB 2A8VA 4M8AA 4RKLA 2PQEA 2A74C 1VQ6A 4A3DB 4ILWA 3KBGA 3URYA 4A3EB 2H5XA 5H1SE 2EOTA 1TQOA 1Y8PB 4UDUC 1TT2A 1I4XA 2EY5A 2VS1A 4KI0A 4IO9A 3FKIH 4QIWB 1GM5A 1PLFA 4S3SA 4RG1A 2UXDL 3U58A 3NEMA 4JVZA 3PQIA 2EY1A 4R9WA 4X6AH 5CV7A 2F4VL 1WTWA 1ASYA 4UP9A 5FO7B 3J80L 1XMOQ 3K0XA 4XDXA 4DGZA 2EY2A 3EN2A 4A93B 4XQQA 2BE5C 1MSHA 1SYDA 3CCVA 4KKUA 2F0EA 1EYCA 2ZJRA 4DV1Q 2RHSB 1F9PA 2XNAC 1EY9A 2CKZB 2KVMA 1Y8OB 2QEJC 5IYCH 1JWSD 2OF1A 4A75A 4FXDA 1D1KA 2PI2A 1EL0A 4N9PA 1HH2P 2BA0A 3PSIA 1SXTA 4JI1Q 1FJGL 3S1NH 4BY7G 5GAGC 3GQBA 2ZXOA 5IT9c 3JAME 4RHSA 2PW5A 3LX0A 4LF6L 2B3GA 5J1ZA 2JA5G 2L4NA 3S1MH 4NW2A 1TWHB 1NR4A 3DUZA 4EQPA 3VYSA 4X3UA 1CZGA 2SDFA 2JA7B 4PMCA 2UUCL 3CC7A 3MC0B 3T53B 1W6JA 2EYHA 3TP7A 3KJPA 3STBD 1HHVA 1IXRA 3KF6B 3UE1A 3GTGB 3TS2A 1KL9A 1KAAA 4IUVA 2K7VA 1QG7A 2MPMA 3A8JE 2QEXA 2QILA 1R9TB 3S17B 1EWIA 3BZCA 4UAIA 5IGGA 3SK5A 3TEHB 4A3LG 2IX3A 4LFCQ 5T1IA 1WTPA 1ZYRC 5AJ3L 3CMAA 4RA8A 1EY0A 1V1OA 4JI0Q 2VL6A 2CWPA 3KBXA 2O5JC 3JAMc 4XYQA 1BOSA 2K28A 4XYOA 4YCWA 3GTQB 1HNZL 3S2HB 2R6GA 4B3TQ 2ZTEA 4OWWB 4KTAA 4PQXA 4OO1H 3PCOB 1ILQA 2JEBI 4ZAIA 3I4LA 5CMDA 3ER0A 2B2WC 5ELNA 1K3RA 1L1OC 5HY6A 5LMNQ 4LW1A 4DU9A 3CP0A 1WJJA 2WINB 4DR2L 1CUKA 4LUZA 3PUXA 3DWQA 5JJZA 4IFDH 1TXYA 5JVH3 2UUBL 2J4XA 1BKBA 4Y52H 5G3LD 1P8LA 4MN3A 4RGTA 2GVBA 1B44D 4TRDA 1G6ZA 4BBRH 1H9SB 1M4VA 4GN4B 1JWUD 3KFUA 1WTQA 1XXGA 3V96A 1UNSA 1HZBA 4BA1I 3GTOB 1TR5A 4F88A 3L7ZC 5IGDA 4LFAL 4DR1Q 2WKCA 3SK6A 1I50H 5IP9G 3TN2A 1R4PB 4K2LA 2WAQE 2OXPA 4KD3A 3BYTB 2MHVA 2VUMG 1JJCB 4GLAC 1L0XB 3I4OA 4WFN3 3HOZB 3S14B 2NN6G 4ZKBB 2N88A 2F3VA 5EKLA 3STBC 2RSNA 4IUUA 2L11A 3PO2B 1LT5D 1MJEA 2CW0D 1PMRA 1X3PA 2A68C 4LUVA 4JBJA 1PH8A 1KIXA 4QF4A 3OTOQ 2F0DA 4UP8A 3HOYG 2UXBL 1II3A 5DLQE 2E74C 2GA4B 1BUVT 5M3FG 2IX1A 4IOAA 1PH9A 4LF4Q 1L0YB 1NNXA 2K32A 2WFWA 1Q12A 3HOVG 4ME5A 1O7LA 3P1HA 2Z0SA 3CHBD 1JQYD 1VQ7A 4MTKA 3M3YB 2Q8RE 2PMZE 1U4RA 2K52A 5EPLA 4RAUC 1TWAH 4MHEA 1PRTB 1M1KC 2B63H 2Z6BA 2CHBD 4L5SA 1C8CA 1V1QA 2PZTA 3W2DA 5E7NA 5E1FA 1TS3A 1N33Q 1FNWA 1SNCA 4JI4Q 4DUYQ 4DNRB 3F1ZA 1DOMA 2QCPX 4LJZC 1XWEA 2H1EA 4OGQC 1QJOA 4LF8Q 4UPAA 1K0SA 3CXCA 3BDOA 2IL8A 2V4DA 1CI3M 4LFBQ 1JB7A 4DV2Q 4K14A 5KIXA 4WJ3M 4IPGA 3I3CA 4CHTB 4A3GH 2B8FA 2AWNA 5JAVA 4EQNA 2K01A 4CDDC 5CV6A 2JP1A 4K0KL 3KLWA 3V05A 1N36L 4UHVA 4DR6Q 3ND9A 3BU2A 1EEFD 4UP7A 3SHLA 4I7AA 1VCIA 3BVGA 4GKJL 1F77A 4AQYQ 1Z6HA 4ME3A 4I7ZC 1RF2D 2Z1CA 5KGUA 3QWNA 4XQNA 1ONLA 5KYLA 2R93B 1YZ6A 2LXKA 2F0SA 1D6EC 3X3NA 1QVGA 1XMQL 2CW0C 1Y1WB 3KLSA 1AFPA 5TSSA 2BA1A 2YTVA 2L55A 3CQZH 5M5YH 2PO4A 1NUCA 1K83B 1HR0Q 4LUOA 2NTTA 3RZDB 3PUWA 1M90C 3KF6A 4A3CG 1A63A 1E7ZA 5ELEA 3E9IA 5LMUL 2IHEA 4KY6A 4X66L 4HSPA 3ITPA 2OT2A 4TKOB 2ZJPA 2QKIC 5LL6X 3M4OB 1HCZA 1PH2A 3Q0AA 1EYGA 1F9QA 4A3FB 4JYAQ 1KDCA 3P75A 1Y1VB 3GTPH 3AFPA 2F0UA 3W1BA 3UDFA 4R4QA 3A5UA 3ULPA 4BY7H 3J81j 3HG9A 3EJIA 4X62L 3HOXB 2NVYB 2HCCA 5M9OA 5A35A 3HP3A 1TWCH 2O4XA 2JA5H 4BS9A 2Z6KC 2OCEA 4LF9Q 3ULLA 2FHTA 5CBAE 1YJ9A 1WTRA 4HIKA 1YJNA 1JT8A 1PTOD 1Z47A 3NSWA 5C44G 2EJGC 1N34Q 1STYA 1ET6A 1JOQA 1KNAA 3T16A 3NPPA 1PTOH 3HKZE 2E2IB 3QOJA 1W2BA 1HZAA 1QNUA 5D3DA 4KKSA 2K03A 1HQRD 1QVFA 3CCLA 5KEEA 1TWFB 5EBCA 2K05A 1HNWL 4A3LH 1JJ2A 1A2UA 3ICEA 4OO1I 1AE3A 2L5TA 1WTXA 3FVQA 1PRTF 4DAMA 2DY7A 2YYZA 1HQMC 3H0GB 4DAYA 4NXML 2KJXA 2H4OA 4IJLA 1CKNA 3C2PA 3EBEA 2G9HD 2XWBB 5BN5A 2AUKA 3H6MA 5KNCA 3NK9A 4WJWA 4RCNA 4ZRZA 4C3HB 1UEBA 3W1GA 4O42A 2K1BA 2HDLA 2SNMA 1CQVA 3KLRA 5I2YA 1R4QB 1VF5C 3PUYA 4BY1G 4GNXC 1PA6A 4BA2I 5ELCA 3W3AA 2KEDA 4QMGA 5CV8A 5EAYA 3J81E 1HXYD 4YHHQ 2M00A 5IWAQ 1GXDC 5GADC 3AYHB 4LNQA 3QO2A 1VQBA 4X65Q 2RVLA 4BBSG 2LFNA 2WAQB 5C4ZA 1IBML 3EVQA 4HCSA 1AE2A 2WV6D 3ULJA 4XIGS 2XSCA 1X65A 5EQ0A 1O7IA 3CCUA 4H0LC 4NB3A 2OQ0A 2A5HA 4Q0FA 4A3DG 3A55A 1E1TA 1O80A 1YITA 2OTLA 3VYTA 5LMNW 1DJRD 1VQKA 2NVXB 3B6YA 3RN5A 1VQMA 4JI3Q 3PGZA 4C3JG 1IL8A 1D5MC 1LT6D 1HFGA 4H13C 5IP9H 3FEWX 1J5EL 2ZXRA 5COYA 1V9PA 1Q90A 4CJ0B 1MD2D 1JR0D 3KLSX 1PTOC 4GNXA 3K8AA 4AH6A 2VUMH 4HJ9A 4LF7L 4POGA 2UUAQ 1U4PA 3J81c 2I5HA 2NN6H 3R93A 3MXNA 5FLXL 2KCCA 5J3BA 3NWTA 2AUJD 3AEVA 1IZ6A 2ID0A 3Q6SA 4A3BG 3DM3A 4HJAA 3BVZA 2PZWA 3HZXA 1E2ZA 2I5LX 2KEEA 3A8KE 4GKKQ 1SNDA 2RBMA 5BR8Q 2K75A 3HOYH 1WYDA 3HRZC 3M85A 5M3FH 2MFIA 2F0WA 1FYCA 4OO1G 2K5DA 4DKAC 1B9MA 3WWVA 2HD3A 1B8AA 1H95A 4WJ4A 3FDTA 4EVOA 2B2TA 4F7XA 4QGUA 1EQVA 4V190 1QILA 3MFYA 2KQ3A 3GD7A 1FNUA 5CORA 2FINB 4JI7Q 2EJMA 3CCQA 1AZPA 3KDFA 3IFTA 2R7DA 3GTJB 4X3KA 1WCMB 2ICEC 4B3RL 1YNJD 5CR3A 3J80c 3PV0A 2A6ED 4FF1A 4ZCKA 2EQSA 1F2YA 3ZYYX 3K81C 2PZUA 1KXLA 3NE5B 1XTCD 4AYBE 1IYVA 4IALA 3CPFA 3FMCA 1S72A 1BCPB 2D0PA 3D4DA 3U9SA 2QDLA 2R92B 1A6XA 5C4HA 1EQRA 3MEHA 4ZYSA 4C2MB 5EGTA 4HR7B 4DUZQ 1HTPA 3KK7A 4OX9Q 1I4PA 4DR5L 3F2CA 4KD4A 1DZ1A 4K5VA 2JA8B 3HOUB 4B3ML 1LM0A 3TDQA 4KJOA 1NY4A 3OW7A 2DGYA 3RLFA 1MSGA 3I4MB 3CC2A 1JMCA 1CKOA 1K8MA 3FKIB 2HQLA 4KHPL 2E2JB 1MIUA 4O2DA 3UI2A 3OWFA 2J7ZA 1A62A 1D5XC 2IJ0A 2I5MX 1VMCA 4JPBW 1DXMA 2FFKB 4HAEA 2L1BA 1KD1C 4A3CH 2KOLA 2L15A 1STHA 2YTYA 2E5LL 2OQKA 1B53A 1LO5D 1TS5A 1TVXA 4BWGB 4P2CB 3BG3A 1KRSA 5JJIA 2QA4A 1SYFA 3RLNA 4XXEA 1HR0W 2EIFA 4HJ5A 4EX5A 1WI5A 3HKZB 4Z9CB 2E2HH 3EQLC 3S1QH 2IWHA 2UXCL 3I8ZA 3GTKH 3S1NB 4WORA 3M4YA 3GTLH 1RKNA 4A3MB 1YNJC 5C4XG 2WKDA 2A6EC 2LXJA 3SXHA 3S1MB 2B2UC 2Z4IA 1BBUA 1VQIA 5EPJA 2PPBC 3VR3A 1VQ8A 1PVOA 1EIGA 2F0TA 4KHVA 2TSSA 1WD0A 2G9DA 4K5XA 1KDBA 3QJYA 5C44H 1XX8A 1OXVA 3E3XA 2R7ZG 4JV5Q 3J7ZC 4HIDA 4YWKA 2NTSA 4DV6Q 1SLJA 3RLOA 1JB3A 1RTOA 2K5VA 4P75A 4ID6A 2B2YC 4LWCA 5ISRA 2JSOA 1S5ED 2GVAA 1Y8NB 4CDFC 5C5LA 2EYLA 3PF4A 2ICIA 1VQ9A 4E6IA 2Q2IA 4L8JA 4JOIA 2Q2TA 3VDYA 3RN2A 1EQTA 2EYFA 4DR4Q 4QB4A 1N32Q 1HPCA 2NVQB 1SBBB 2BCOA 3NHHA 3R8BA 4DV4L 4JI6L 5CYUA 4BY1H 4PG3A 2JA6G 2FMCA 2I07B 4K2KA 4HMIA 2JK8A 3R2IA 3CPWA 1UUPA 2DNEA 1RHPA 1SRUA 2WB1G 2XVSA 4FF3A 4PMBA 2D0OA 5C3EB 3KF8A 5EPKA 1SFOH 1GHJA 2X6GA 3I91A 2VQEQ 3PMFA 4HMJA 4BBSH 3OOCA 1V43A 5I4DA 4DV3L 3D3RA 1I94Q 3NQTA 5FO8B 4NXNL 5JJLA 3DHQA 2BDNA 1AZQA 2HDMA 1PFNA 2NN6I 1L0WA 4KN4C 4XT1B 3C46A 1XNRL 1FR3A 4A3DH 4BBRB 1ENAA 1I6VC 1ML0D 3RUZA 1F9RA 3D31A 4L5TA 3I4NB 3CMEA 4QL5A 4A3KB 1O78A 2VQFL 3SK8A 4C3JH 4DK3C 2AHOB 3KOJA 1I50B 4DXGA 2EXZA 3RZOH 4HIOA 1G51A 2R93G 2L12A 3PF5A 5E4XA 4KV6A 4B3SL 2RKSA 5M5XH 1A15A 2C9OA 4DV7L 1TU2B 4POFA 4G7HC 4N8FA 1C48A 4P72A 4A3BH 4GS3A 4JC0A 4O1NA 4A3IB 1BO0A 2E2DC 2UXDQ 5NUCA 4BXXG 4A93H 2B2VC 4C1NK 3T1HL 3RMHA 2F4VQ 5CV9A 1K8OA 2F0NA 1BVSA 3H94A 2QGQA 4PZ7A 1SJED 1CHQD 2NZOA 2K5NA 4FDBA 2HIXA 1I4GA 4ZUIA 2BH2A 3TZUA 3N6RA 2HHHL 3GP7A 1B3AA 5A2QL 1W6KA 1IHZA 1B9NA 1SNQA 2B39A 4UY8C 1PH5A 1RD9D 1J9OA 2P5ZX 3IKJA 1Y1VG 5J22A 3BDLA 4YY3L 2B63B 3EROA 1EWCA 3VR4A 5KYIA 3ND8A 2ZTCA 2F0VA 4A3JG 2YU9B 4NP5A 5CBEE 1FJGQ 1BQQT 3CKIB 1GO3E 4GN5A 1NTGA 5C0XH 4DAYB 1MI2A 5LHY1 4H44C 1CKNB 4IZ8A 4LF6Q 5E4WC 3O13A 4L5RC 1VQFA 1VQJA 1HRJA 2MO1A 2F3WA 4G57A 1GJXA 4A3GB 2UUCQ 1N9WA 3L2PA 5BN4A 2NVTH 4DV0L 2IT1A 4K6LA 3LWEA 4IUNA 1CQFA 2B2WA 1L1OA 2AWOA 3BZDB 3D4RA 1FGUA 5CV4A 2DN8A 2XRSD 1LABA 3C3LA 2HT1A 2MNAA 2RQXA 4RGOS 1P16A 2LSSA 5M5WH 4X3SA 1CA6A 3MXUA 2UU9L 1GHKA 3TRZA 2HCIA 4DR7L 1XPRA 2A73B 4TSSA 4QJFA 4R4IA 5AJ3Q 1JC7A 1IBLL 1TIID 3UDIA 2NZ1D 2OWOA 1I4QA 2RCNA 2ZJQA 3MAQA 5M5YB 1T5EA 4C3IG 4GOPC 1HNZQ 4J1MA 4PV1C 2FXQA 4IUTA 3A7LA 4FNFA 4AIMA 5DM73 4GNXB 3S15H 4OIKA 4LF5L 3PUZA 5JJKA 2F0OA 1AP0A 1PXUA 3QB3A 4ZK9B 5FK9C 1U5KA 1C9OA 3MXNB 1LTLA 2JA9A 1QNKA 2MO0A 4DR2Q 1YVCA 1E0BA 2BDOA 2E8GA 4YWMA 1YIJA 2HIVA 2UUBQ 3GTPB 1STAA 1D2BA 1F2ZA 4BY7B 1U0LA 4YWLA 3K58A 5C4XH 4Y7NB 2VNUD 4HTHA 3G71A 2RDGA 1K8GA 2JA5B 1EYDA 1SROA 1EY4A 5FLXE 4L6TB 4LFAQ 2EZVA 1IYUA 3S14H 4NDXA 5FKAC 1I3QH 4KLKA 3H91A 3I73A 3KDFB 1D8LA 4CBVA 4GZYC 1ENCA 2R7ZH 1PTOB 2ZM6L 1FGBD 2FJ2A 2N49A 3NENA 1SMYD 2F0PA 3VA7A 1Q82C 4RKBA 3MVVA 2F0GA 1VQ5A 2F0FA 1KNEA 3U9OA 3W5OA 1NMGA 1EYAA 2UXBQ 2NBFA 1YNND 1H9MA 3M3YH 3I2ZA 1PRTD 1YI2A 4CDEC 3A0JA 3TMEA 1IBKL 2F52A 2K5QA 3K57A 1LV9A 3J7A5 4ABNA 3NTKA 1CM9A 1E2VA 1Z9FA 3T51B 1VQ4A 2PNHA 5FLXc 5FJ8G 1IL2A 2JA6H 1IW7D 4XQJA 4ZKCB 4QUCA 3VR2A 5C0XJ 1QB5D 2QDBA 3AB9A 2NUCA 4JI5L 1VQPA 1TWGB 2CH4A 1B3QA 1T9HA 3K59A 5IE8A 3MTSA 4JG2A 1B7YB 2WACA 1Q81C 4OHJA 4R4OA 2ENBA 2F3IA 4C1NI 1VQCA 2EDGA 1VQAA 1I6HB 1S5DD 2CQOA 5D14A 4R4CA 1CFMA 2SEBD 4DV5L 1YHQA 2JQOA 4K0KQ 1N36Q 3SDZA 1EOVA 2JA8G 1SSOA 1ZXTA 3A74A 1VMPA 2Z4HA 3OW2A 1XJVA 1KABA 2EPBA 4OONA 3DEPA 3I4MG 3T1YL 2AQ3B 4GKJQ 2TMPA 4XTCS 3AU7A 3P20A 4APVA 1VQDA 2IHFA 2R93H 3SK4A 1QUQA 2Y0SG 1OXXK 5IIFA 3J7AV 3PO3B 2VUMB 1H9JA 4HJ8A 1EU4A 1A3VA 2CWAA 1Y1WH 3BJUA 1X3GA 5K5PA 3IFDA 2DNCA 1K83H 3J7YW 1Q7YC 1SMYC 1A2TA 1XMQQ 4BXXH 2Z6KA 4X64L 4DR3L 1VQLA 1PZID 3HOYB 1BDOA 1Q8IA 4MTNA 1HNXL 1STBA 4FXKC 4DK1A 5M3FB 1YNNC 3HOVB 2X6LA 1PRTC 1JOOA 3RNUA 2RF4A 5I6WA 3M4OH 4JI8L 5C0XI 3OIQA 5LMUQ
chains in the Genus database with same CATH topology
2MGSA 4K8IA 3NWSA 2LS01 1GUNA 4KK7A 4HSVA 2VXWA 4RWSC 4HN7A 2ZT9C 3S16B 1B2TA 1OXTA 1GOZA 1QE6A 4IURA 4DF7A 4IQZA 5KNBA 1GUOA 5ELFA 4ZQ3A 1Y69U 1SE2A 3GV6A 5F2DA 2PMZB 4FXGC 3VA5A 3NTHA 2NB0A 2Q8IB 3BYYB 1J8IA 4KY7A 4M1UB 1GUSA 5JPNC 3PIP3 3DMUA 2M9VA 3MZ5A 4L63B 3C1FA 1CTMA 2N55A 3K6OA 3MXGA 3TP6A 2F03A 1SJHD 3OMGA 4KMUC 3DM1A 2D9UA 1HUNA 3SVMA 1F2LA 3GTMB 1U9RA 4XT3B 4C56C 1EZ8A 2EJFC 2WIIB 1D5ZC 1NSNS 5C0XG 1HFNA 4U68A 3E5SA 5KNDA 5T1GA 1LTSD 3HOWB 4ODGA 1ESRA 1KLUD 2E2HB 3S1QB 3MWYW 2R3ZA 4CKBA 4FO2A 1UEAB 4CKEA 4DN4M 3GTLB 4U673 1V8QA 3D6WA 3OSOA 5JVG3 4DXFA 1I4HA 1PFBA 5I6YA 1JORA 5IGCA 1FNVA 5C44B 3LWUA 4J6HA 5C3WA 3FPUB 3R3OA 3H3VC 3TP8A 4B9XA 1OXUA 2XWJB 3DEOA 1ESFA 3K5NA 4K6DA 2BE5D 5FOBB 3FRPB 3C1EA 3H09A 5A2QE 1BNZA 1EY8A 1GUWA 3K5OA 1X32A 2F4IA 2JYOA 1ICWA 1QCBD 4G7OC 3WDNA 5D3IB 2EYOA 1CZWA 2XN9C 1LTGD 1GUTA 1OO9B 1BCPD 1SFOB 4BBSB 2RDHA 3SEBA 5DNFA 4LAAA 5EKIA 1LTBD 2F0QA 5IGBA 2F0KA 1A3UA 2KA7A 3T4AC 4PNYA 4R8NA 2Z8LA 1BBXC 2SNSA 2LMCB 3S9WA 1V1PA 4HEDA 3A56A 4J8QA 1BXTA 1SNPA 3SE0A 4C3JB 3HGBA 3K5MA 1S5BD 4ULLA 5BN3A 4KY5A 3RZOB 4RGMA 1ZYRD 3L3OC 3SR1A 1Q1EA 1O7ZA 5IT9E 5M5XB 2AQ1B 5HGTA 1PFMA 3CRKC 2EYMA 4B9WA 2JEAI 1T5XD 2F0LA 4A3BB 3M7NA 1SEBD 5D65A 2B2UA 1IKMA 1DOKA 2EY6A 1ENFA 3V2TA 2J0TD 5IOCA 3LNNA 4EGVA 1STGA 5IGEA 1QOHA 1BCPF 2IW3A 3G7LA 4ZUJA 1FD7D 1G91A 2B2YA 1G2SA 2XRQD 3WOEA 1SYGA 2CVRA 4EQOA 1BCPC 3K5LA 5EKKA 2HUGA 1MBYA 4DNTB 4TQUS 1DYQA 1UAPA 5FO9B 2A68D 2NVTB 1HA5A 2O2LD 2F0HA 3NBHA 5JEAJ 1SYBA 1U4MA 3NTIA 4IUPA 3WOFA 3NQIA 2JXMB 2K6AA 5M5WB 3TP5A 1HUMA 1A3TA 1WVLA 4AYBB 5IGFA 2F0JA 1VDZA 5AFWA 2XIWA 3AMUA 1TWAB 3T56B 1PZKD 1JWMD 1JCKB 5LL6S 1TKWB 2NWGA 5CV5A 1IKLA 1CHPD 1AN8A 2D2CC 1AEXA 4PMWA 5I9PA 3PIO3 1RDPD 3TZDA 3S15B 1RJTA 1EFID 3OWEB 1KDAA 1STEA 1LLRD 4NMZA 1EU3A 2B2VA 2MUYA 5CGKA 5CC4A 3BS1A 3D8GA 3FPPA 2B8GA 2CQAA 5I9OA 2RA4A 5I2XA 1DONA 3OPOA 5C4XB 4QCLA 2MP1A 2E75C 2JE6I 1BF4A 3I90A 3T13A 3DWPA 4KN7C 1I3QB 2OEOA 4C3HG 2KCNA 2R7ZB 1WTOA 5IT9L 3IAYA 4FYDA 3CQZB 2I46A 4LK1C 2ZXPA 3L9AX 5K36G 5JOBA 5KRUA 3MFGA 1SE3A 2A6HD 4RCOA 4NKLA 5G3LF 1S5CD 2KECA 2JA6B 3IL8A 1DD2A 3NUCA 1LT4D 2WB1B 2PW7A 4CJ1B 1RTNA 3VR6A 1TS2A 5DM63 1TWCB 1SE4A 3K0YA 3QG1A 1DCZA 3JAML 1S5FD 4FVMA 1JOKA 4G7ZC 4RH6A 1SAPA 1PDQA 1E2WA 3I72A 3G6JB 2DY8A 4V0BA 1GUGA 5JEAG 2IX0A 2R61A 2EE1A 1KLGD 1I4RA 4KKTA 4CJ2C 3X3MA 1U4LA 2FMMA 4HCEA 4JBWA 1X3QA 1EOTA 3TBIB 5C3XA 2X69A 3NP8A 1EEID 5J39A 2F0IA 1C4QA 1PZJD 3KUPA 5DAUA 1STNA 4QUFA 4IFDJ 2EVBA 4G4KA 3P7JA 5JPMC 3I70A 3RD4A 2A6HC 4RFBA 5DEHA 1CA5A 3ONAB 3HS0C 2A69D 1RODA 2EYJA 1B50A 4A3JB 2VB3X 2E76C 1ZEQX 1TY0A 2Q8TA 3PUVA 1DOLA 4DAVA 4RGNA 4OL7A 2M2LA 1PYWD 1LTTD 3OMCA 5ELDA 2VB2X 3EFXD 1S4ZA 1SYCA 4FP5D 3HEJA 1G8ZD 1JE4A 1D1IA 3Q23A 2C5CA 2PCFB 1RCVD 1H9SA 3BDCA 1ILPA 1EIHA 2L9HA 3A54A 4DA2A 3D4WA 4WRDA 1LT3D 3QIAA 1G291 1TY2A 2NYZD 1NCVA 3E6ZX 2AQ2B 4IFDI 2L0CA 1F2MA 4F87A 3MHBA 1V1PB 3TSSA 1WD1A 1IW7C 3R2TA 4X3TA 2F1MA 4C3IB 2LY7A 2RDFA 3CU7A 3N52A 1LTAD 1MGSA 1EY7A 5HURA 1LACA 3E0JA 4N9TA 4R8IA 4CGYB 2D5DA 3BVMA 4FF2A 1PTOF 4Q5VA 3VYRA 2SOBA 1HTLD 2A69C 5ELBA 3GO5A 2B2TC 1SYEA 4IUQA 4DK0A 3D6CA 3Q24A 1BR9A 1JICA 2PYKA 1ET9A 5C4JB 1XYIA 2F0MA 2LKVA 2RSOA 1G2TA 2HQEA 3M7GA 3MXPA 3J80E 2WP8J 1DM0B 2IPKD 1LTRD 1SDFA 5EJWA 5EBDA 3ERQA 5E3FA 1WTVA 2KHSA 5C5MA 3OHXC 3J7AF 2K33A 2QF7A 1TS4A 1LTID 4I65A 2PNRC 1H9KA 5K36H 3DXJC 1CK1A 4IFDG 1QWYA 2K5WA 1KTKA 4H7BA 3S2DB 5IODA 3A8IE 3MA2B 3VR5A 1B4OA 3S1RB 3VYUA 3K7AB 3EA6A 4ZLTF 2BOSA 3NBIA 3CRLC 3GTKB 4OIJA 4YIJA 2MJ8A 1CT1D 1NR2A 2EYPA 1HA6A 4B08A 1EY6A 1EY5A 3QOLA 1M8AA 4K5WA 4LMQD 2D62A 1SNOA 1VF7A 4DFAA 5JEAH 4KJNA 4CKCA 1AW7A 2KUMA 1NAPA 4DAPA 1Z7TA 2Y0SB 1SNMA 3F2UA 2K04A 4K8JA 1H9RA 4MIUA 5C6AA 3DWAA 1Q3LA 4KHZA 1Q1BA 4IN3A 3GV3A 4BY1B 1ZKOA 1EWHA 4FF4A 1EZ6A 3NXWA 4F8MA 3A7AB 4RHRA 3J81L 1OXSC 1F9SA 1O7YA 5M3MB 1B1ZA 3Q22A 4JK1C 3OIPA 2O5IC 4M8AA 4RKLA 2PQEA 2A74C 4A3DB 4ILWA 3KBGA 3URYA 4A3EB 2EOTA 1TQOA 1Y8PB 4UDUC 1TT2A 1I4XA 2EY5A 4KI0A 4QIWB 1PLFA 4S3SA 2EY1A 4R9WA 5CV7A 1WTWA 5FO7B 3J80L 4XDXA 4DGZA 2EY2A 4A93B 4XQQA 2BE5C 1MSHA 1SYDA 4KKUA 2F0EA 1EYCA 1F9PA 2XNAC 1EY9A 2KVMA 1Y8OB 2QEJC 1JWSD 2OF1A 4FXDA 1D1KA 1EL0A 4N9PA 2BA0A 1SXTA 3GQBA 2ZXOA 3JAME 4RHSA 2PW5A 3LX0A 5J1ZA 2L4NA 4NW2A 1TWHB 1NR4A 3DUZA 4EQPA 3VYSA 4X3UA 1CZGA 2SDFA 2JA7B 4PMCA 3MC0B 3T53B 1W6JA 2EYHA 3TP7A 1HHVA 3GTGB 1KAAA 4IUVA 2K7VA 1QG7A 2MPMA 3A8JE 2QILA 1R9TB 3S17B 4UAIA 5IGGA 3SK5A 2IX3A 5T1IA 1WTPA 1ZYRC 4RA8A 1EY0A 1V1OA 3KBXA 2O5JC 4XYQA 1BOSA 2K28A 4XYOA 3GTQB 3S2HB 2R6GA 4KTAA 4PQXA 4OO1H 1ILQA 2JEBI 4ZAIA 3I4LA 5CMDA 2B2WC 4DU9A 2WINB 3PUXA 3DWQA 5JJZA 4IFDH 5JVH3 2J4XA 5G3LD 4MN3A 4RGTA 1G6ZA 1B44D 4TRDA 1H9SB 1M4VA 1JWUD 1WTQA 1XXGA 3V96A 1UNSA 4BA1I 3GTOB 1TR5A 4F88A 3L7ZC 5IGDA 2WKCA 3SK6A 3TN2A 1R4PB 4K2LA 2OXPA 4KD3A 3BYTB 2MHVA 1L0XB 4WFN3 3HOZB 3S14B 2NN6G 4ZKBB 2N88A 2F3VA 5EKLA 2RSNA 4IUUA 2L11A 3PO2B 1LT5D 2CW0D 1PMRA 1X3PA 2A68C 4QF4A 2F0DA 1II3A 2E74C 2GA4B 1BUVT 2IX1A 1L0YB 2K32A 1Q12A 4ME5A 1O7LA 3P1HA 3CHBD 1JQYD 3M3YB 2Q8RE 1U4RA 5EPLA 4RAUC 4MHEA 1PRTB 2CHBD 1C8CA 2PZTA 3W2DA 5E1FA 1TS3A 1FNWA 1SNCA 4DNRB 1DOMA 2QCPX 4LJZC 1XWEA 2H1EA 4OGQC 1QJOA 3BDOA 2IL8A 2V4DA 1CI3M 4K14A 5KIXA 3I3CA 4CHTB 2B8FA 2AWNA 5JAVA 4EQNA 2K01A 5CV6A 2JP1A 3V05A 3ND9A 1EEFD 3SHLA 1VCIA 3BVGA 1F77A 1Z6HA 4I7ZC 1RF2D 2Z1CA 5KGUA 3QWNA 4XQNA 1ONLA 5KYLA 2R93B 2F0SA 1D6EC 3X3NA 2CW0C 1Y1WB 3KLSA 1AFPA 5TSSA 2BA1A 2L55A 2PO4A 1NUCA 1K83B 2NTTA 3RZDB 3PUWA 5ELEA 4KY6A 4HSPA 3ITPA 2OT2A 4TKOB 2QKIC 5LL6X 3M4OB 1HCZA 3Q0AA 1F9QA 4A3FB 1KDCA 3P75A 1Y1VB 2F0UA 3HG9A 3EJIA 3HOXB 2NVYB 2HCCA 5M9OA 5A35A 3HP3A 2O4XA 4BS9A 2FHTA 5CBAE 1WTRA 1PTOD 1Z47A 3NSWA 2EJGC 1STYA 1ET6A 1JOQA 1KNAA 3T16A 3NPPA 1PTOH 2E2IB 3QOJA 1QNUA 5D3DA 4KKSA 2K03A 1HQRD 5KEEA 1TWFB 5EBCA 2K05A 1A2UA 4OO1I 2L5TA 1WTXA 3FVQA 1PRTF 2DY7A 2YYZA 1HQMC 3H0GB 4DAYA 2KJXA 2H4OA 3C2PA 2G9HD 2XWBB 5BN5A 2AUKA 3H6MA 5KNCA 3NK9A 4WJWA 4RCNA 4ZRZA 4C3HB 4O42A 2K1BA 2HDLA 2SNMA 1CQVA 3KLRA 5I2YA 1R4QB 1VF5C 3PUYA 4BA2I 5ELCA 3W3AA 2KEDA 4QMGA 5CV8A 3J81E 1HXYD 2M00A 1GXDC 3QO2A 2RVLA 2LFNA 2WAQB 5C4ZA 3EVQA 4HCSA 2WV6D 4XIGS 2XSCA 5EQ0A 4H0LC 2A5HA 4Q0FA 3A55A 1O80A 3VYTA 1DJRD 2NVXB 4C3JG 1IL8A 1D5MC 1LT6D 1HFGA 4H13C 3FEWX 2ZXRA 5COYA 1Q90A 4CJ0B 1MD2D 1JR0D 3KLSX 1PTOC 1U4PA 2NN6H 3R93A 5FLXL 3MXNA 2KCCA 3NWTA 2AUJD 2ID0A 3Q6SA 2PZWA 3BVZA 3HZXA 1E2ZA 2KEEA 3A8KE 1SNDA 2RBMA 3M85A 3HRZC 2F0WA 1FYCA 4OO1G 2K5DA 1B9MA 3FDTA 4EVOA 2B2TA 4F7XA 1EQVA 4V190 1QILA 3MFYA 2KQ3A 3GD7A 1FNUA 5CORA 2FINB 2EJMA 1AZPA 3IFTA 3GTJB 4X3KA 1WCMB 2ICEC 1YNJD 5CR3A 3PV0A 2A6ED 4FF1A 1F2YA 3ZYYX 2PZUA 3NE5B 1XTCD 1IYVA 4IALA 3FMCA 1BCPB 3D4DA 3U9SA 1A6XA 2R92B 5C4HA 3MEHA 4ZYSA 4C2MB 5EGTA 4HR7B 1HTPA 3KK7A 1I4PA 4KD4A 1DZ1A 4K5VA 2JA8B 3HOUB 3TDQA 4KJOA 3OW7A 3RLFA 1MSGA 3I4MB 3FKIB 1K8MA 2E2JB 3UI2A 3OWFA 2J7ZA 1D5XC 2IJ0A 1VMCA 1DXMA 2FFKB 4HAEA 2L1BA 2KOLA 1STHA 1B53A 1LO5D 1TS5A 1TVXA 4BWGB 4P2CB 3BG3A 1SYFA 4XXEA 3HKZB 4Z9CB 3EQLC 2IWHA 3I8ZA 3S1NB 4WORA 3M4YA 1RKNA 4A3MB 1YNJC 2WKDA 2A6EC 3SXHA 3S1MB 2B2UC 2Z4IA 5EPJA 2PPBC 3VR3A 1EIGA 2F0TA 4KHVA 2TSSA 1WD0A 2G9DA 4K5XA 1KDBA 3QJYA 1XX8A 1OXVA 2NTSA 1JB3A 1RTOA 4ID6A 2B2YC 5ISRA 2JSOA 1S5ED 1Y8NB 5C5LA 2EYLA 2ICIA 4E6IA 4L8JA 1EQTA 2EYFA 4QB4A 1HPCA 2NVQB 1SBBB 2BCOA 3NHHA 3R8BA 5CYUA 2FMCA 2I07B 4K2KA 4HMIA 3R2IA 1UUPA 2DNEA 1RHPA 2XVSA 4FF3A 4PMBA 5C3EB 3KF8A 5EPKA 1GHJA 2X6GA 3I91A 3PMFA 4HMJA 3OOCA 1V43A 5I4DA 3D3RA 3NQTA 5FO8B 3DHQA 2BDNA 1AZQA 2HDMA 1PFNA 2NN6I 4KN4C 4XT1B 3C46A 1FR3A 4BBRB 1ENAA 1I6VC 1ML0D 3RUZA 1F9RA 3D31A 3I4NB 4A3KB 1O78A 3SK8A 1I50B 4DXGA 2EXZA 2L12A 5E4XA 4KV6A 2RKSA 1A15A 2C9OA 1TU2B 4G7HC 1C48A 4O1NA 4A3IB 1BO0A 2E2DC 5NUCA 2B2VC 4C1NK 3RMHA 5CV9A 1K8OA 2F0NA 3H94A 1SJED 1CHQD 1I4GA 4ZUIA 3TZUA 3N6RA 3GP7A 1B3AA 5A2QL 1W6KA 1IHZA 1B9NA 1SNQA 2B39A 1RD9D 1J9OA 3IKJA 5J22A 3BDLA 2B63B 3EROA 1EWCA 3VR4A 5KYIA 3ND8A 2F0VA 2YU9B 4NP5A 5CBEE 1BQQT 3CKIB 5C0XH 1MI2A 5LHY1 4H44C 4IZ8A 5E4WC 3O13A 1HRJA 2F3WA 4G57A 1GJXA 4A3GB 5BN4A 2IT1A 4K6LA 3LWEA 4IUNA 1CQFA 2B2WA 2AWOA 3BZDB 3D4RA 5CV4A 2DN8A 2XRSD 1LABA 3C3LA 2RQXA 4RGOS 1CA6A 4X3SA 3MXUA 1GHKA 2HCIA 2A73B 4TSSA 1JC7A 1TIID 2NZ1D 1I4QA 5M5YB 3MAQA 1T5EA 4C3IG 4J1MA 4PV1C 4IUTA 3A7LA 4FNFA 5DM73 4OIKA 3PUZA 2F0OA 1AP0A 1PXUA 3QB3A 4ZK9B 5FK9C 1QNKA 1E0BA 2BDOA 3GTPB 1STAA 1D2BA 1F2ZA 4BY7B 3K58A 4Y7NB 2VNUD 4HTHA 2RDGA 2JA5B 1EYDA 1EY4A 5FLXE 4L6TB 2EZVA 1IYUA 4NDXA 5FKAC 3H91A 3I73A 4CBVA 4GZYC 1ENCA 1PTOB 1FGBD 2FJ2A 1SMYD 2F0PA 3VA7A 4RKBA 3MVVA 2F0GA 2F0FA 1KNEA 3U9OA 1EYAA 2NBFA 1YNND 1H9MA 1PRTD 3TMEA 2K5QA 3K57A 1LV9A 4ABNA 3NTKA 1CM9A 1E2VA 3T51B 1IW7D 4XQJA 4ZKCB 4QUCA 3VR2A 5C0XJ 1QB5D 2QDBA 3AB9A 2NUCA 1TWGB 3K59A 3MTSA 2WACA 4OHJA 2ENBA 4C1NI 2EDGA 1I6HB 1S5DD 5D14A 1CFMA 2SEBD 3SDZA 1SSOA 1ZXTA 1VMPA 2Z4HA 1KABA 2EPBA 3DEPA 2AQ3B 2TMPA 4XTCS 3AU7A 3P20A 3SK4A 5IIFA 3J7AV 1OXXK 3PO3B 2VUMB 1H9JA 1EU4A 1A3VA 5K5PA 3IFDA 2DNCA 3J7YW 1SMYC 1A2TA 1PZID 3HOYB 1BDOA 1Q8IA 1STBA 4FXKC 4DK1A 5M3FB 1YNNC 3HOVB 2X6LA 1PRTC 1JOOA 5I6WA 5C0XI 3OIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VDZ A;  4H13 C;  2K7V A;  1GJX A;  3A8J E;  3T56 B;  1Q90 A;  3VR6 A;  1GUN A;  5BN4 A;  1Q1E A;  1GHJ A;  2K33 A;  2ZT9 C;  3OOC A;  3QG1 A;  2QF7 A;  1DCZ A;  1V43 A;  2IT1 A;  1H9M A;  4JK1 C;  1OXT A;  1TKW B;  1V8Q A;  5A35 A;  4G7Z C;  1DXM A;  2NN6 H;  4IQZ A;  2AWO A;  5KNB A;  2PNR C;  1H9K A;  3D4R A;  2O5I C;  2PCF B;  2D2C C;  2KCC A;  5K36 H;  3DXJ C;  1GUO A;  3CRK C;  1H9S A;  2DN8 A;  2AUJ D;  1ZYR C;  2JEA I;  1E2W A;  1LAB A;  4IFD G;  1Y69 U;  3M7N A;  3I72 A;  2NN6 I;  1E2V A;  1E2Z A;  4KN4 C;  3A8I E;  3A8K E;  2O5J C;  1Y8P B;  3T51 B;  1FR3 A;  4DNR B;  3LWU A;  4LJZ C;  3VR5 A;  3M85 A;  2EJG C;  4OGQ C;  1QJO A;  1I6V C;  3BG3 A;  3MXU A;  1GHK A;  1IW7 D;  3QIA A;  3BDO A;  3D31 A;  1G29 1;  1FYC A;  2V4D A;  1GUG A;  1CI3 M;  3CRL C;  3LNN A;  4KI0 A;  3VR2 A;  5JEA G;  4OO1 G;  1O78 A;  3FPP A;  1OXU A;  3AB9 A;  1B9M A;  2B8G A;  2R6G A;  3EQL C;  4OO1 H;  2B8F A;  4KKS A;  2BE5 D;  4KKT A;  2JEB I;  3I4L A;  1IW7 C;  3MFY A;  3M4Y A;  3OPO A;  3GD7 A;  1YNJ C;  2F1M A;  1T5E A;  2EJM A;  3ND9 A;  2E75 C;  2L5T A;  2JE6 I;  2Q8I B;  2A6E C;  2EDG A;  4PV1 C;  3PUX A;  4JBW A;  3A7L A;  2YYZ A;  1HQM C;  2BE5 C;  1GUS A;  1TU2 B;  4G7H C;  1VCI A;  4IFD H;  3IFT A;  2PPB C;  3VR3 A;  3PUZ A;  4KKU A;  4KN7 C;  5BN5 A;  1LAC A;  1CFM A;  2AUK A;  5KNC A;  2D5D A;  4RCN A;  3QJY A;  1Z6H A;  1CTM A;  4G7O C;  2D62 A;  3PV0 A;  1OXV A;  3WDN A;  1H9S B;  1VF7 A;  3SDZ A;  1K8O A;  3H94 A;  3KLR A;  2A6E D;  4I7Z C;  1VF5 C;  3PUY A;  4BA2 I;  4DNT B;  5JEA H;  1Y8O B;  2A69 C;  4BA1 I;  2EVB A;  1ONL A;  3W3A A;  1GUT A;  4TQU S;  3TZU A;  2BDO A;  3L7Z C;  3N6R A;  4DK0 A;  3NE5 B;  1IYV A;  2BA0 A;  4XTC S;  2CW0 C;  3P20 A;  4KMU C;  1B9N A;  2A6H C;  1Z7T A;  3FMC A;  2A68 D;  1OXX K;  2BA1 A;  3IKJ A;  3U9S A;  1A6X A;  3GQB A;  1H9J A;  1H9R A;  2A69 D;  4HR7 B;  1HTP A;  4LK1 C;  4XIG S;  2NN6 G;  1Y8N B;  2EJF C;  3VR4 A;  3PUW A;  4KHZ A;  5K36 G;  3ND8 A;  2KA7 A;  2DNC A;  1Q1B A;  2E76 C;  1IYU A;  1PMR A;  2A68 C;  4H0L C;  4L8J A;  1SMY C;  5C0X G;  2A6H D;  2JXM B;  3PUV A;  4TKO B;  1ZKO A;  2LMC B;  1HPC A;  3OW7 A;  3I73 A;  3RLF A;  1HCZ A;  3T53 B;  1BDO A;  1EWH A;  5C0X H;  2E74 C;  5KND A;  4DK1 A;  4H44 C;  4GZY C;  1YNN C;  3A7A B;  2K32 A;  1Q12 A;  1DD2 A;  1O7L A;  1OXS C;  3SE0 A;  1K8M A;  3HGB A;  3VA7 A;  2DNE A;  5BN3 A; 
#chains in the Genus database with same CATH topology
 2MGS A;  4X66 Q;  4K8I A;  4QIW E;  5M3M G;  3NWS A;  2LS0 1;  1GUN A;  4KK7 A;  4HSV A;  2VXW A;  4RWS C;  1Y1V H;  2ZT9 C;  4HN7 A;  3S16 B;  1B2T A;  1OXT A;  1GOZ A;  1QE6 A;  1S3O A;  4IUR A;  1ICF B;  4IQZ A;  4DF7 A;  5GAH C;  5KNB A;  1GUO A;  2PQA A;  5ELF A;  4A3J H;  4A3M G;  2NVY H;  4ZQ3 A;  1KAW A;  1Y69 U;  4A3E G;  2KHJ A;  1SE2 A;  3GV6 A;  4O0A A;  1VQG A;  4X62 Q;  5F2D A;  3JAM i;  2PMZ B;  4DPG A;  4FXG C;  3VA5 A;  3NTH A;  3KJO A;  2NB0 A;  2Q8I B;  4JBM A;  1TWF H;  3BYY B;  4A93 G;  1J8I A;  4KY7 A;  4M1U B;  1GUS A;  5IYB H;  3KF8 B;  4N8X 1;  5GQO A;  5JPN C;  3H3V H;  3PIP 3;  3DMU A;  2M9V A;  3MZ5 A;  4L63 B;  3C1F A;  1CTM A;  1HNW Q;  2N55 A;  3SGI A;  3K6O A;  3MXG A;  3TP6 A;  4JW0 A;  4NXM Q;  2N3S A;  4IPC A;  2V1C C;  2F03 A;  1X56 A;  1X55 A;  1SJH D;  3OMG A;  1AH9 A;  4KMU C;  3DM1 A;  5FLM H;  2D9U A;  1HUN A;  3SVM A;  2N78 A;  1F2L A;  1RL2 A;  4C3I H;  3GTM B;  1U9R A;  4XT3 B;  4C56 C;  2YV5 A;  1EZ8 A;  5C3E G;  1PH1 A;  2EJF C;  2WII B;  3IRB A;  1D5Z C;  4OEL B;  1NSN S;  1XNQ L;  5C0X G;  1HFN A;  1WOC A;  2JA7 G;  4U68 A;  3E5S A;  5KND A;  1IBM Q;  5T1G A;  1LTS D;  2XGT A;  3HOW B;  4ODG A;  1ESR A;  1KLU D;  2E2H B;  3S1Q B;  3MWY W;  2R3Z A;  3I4N G;  2C35 B;  4CKB A;  4FO2 A;  1K3B C;  5C4J H;  4A3K G;  1UEA B;  4CKE A;  4DN4 M;  4PZ6 A;  1QZG A;  3GTL B;  4U67 3;  4R1J A;  1V8Q A;  1K28 A;  3D6W A;  1A0I A;  3OSO A;  5JVG 3;  4DXF A;  1I4H A;  3RR5 A;  1PFB A;  5GAE C;  5I6Y A;  1J5E Q;  1JOR A;  1NBW A;  5IGC A;  1FNV A;  5C44 B;  3LWU A;  4LF7 Q;  4J6H A;  2ASB A;  5C3W A;  1XMO L;  3FPU B;  3R3O A;  1PH6 A;  3F2D A;  3H3V C;  3TP8 A;  4B9X A;  1KHI A;  1OXU A;  2XWJ B;  3DEO A;  5HGQ A;  1ESF A;  3K5N A;  4K6D A;  2BE5 D;  5FOB B;  3FRP B;  3TS0 A;  3C1E A;  3H09 A;  5A2Q E;  3K80 C;  4DV1 L;  1BNZ A;  1EY8 A;  1GUW A;  1VQH A;  2KEN A;  3K5O A;  1X32 A;  4IOC A;  2F4I A;  1E1O A;  3S2D H;  4JI1 L;  2JYO A;  1ICW A;  1L1O B;  1QCB D;  4G7O C;  3S1R H;  3GDE A;  1X3F A;  3WDN A;  3GTJ H;  3K7A H;  5FJ8 H;  5D3I B;  2EYO A;  1CZW A;  1WCM H;  2XN9 C;  3DLL A;  3CCE A;  2JN4 A;  1LTG D;  1GUT A;  1E3P A;  1OO9 B;  2K5H A;  1BCP D;  4B3R Q;  1SFO B;  4BBS B;  2RDH A;  3SEB A;  5DNF A;  1VQE A;  4HJ7 A;  4LAA A;  5EKI A;  3HOZ G;  1LTB D;  2F0Q A;  2F0K A;  1A3U A;  2KA7 A;  3T4A C;  5IGB A;  5IYD G;  3PO2 G;  4PNY A;  4R8N A;  2Z8L A;  1BBX C;  2SNS A;  2LMC B;  4OWX B;  4YCU A;  1QVC A;  4PZ8 A;  2JA8 H;  1EUJ A;  2CFM A;  3S9W A;  3HOU H;  1V1P A;  4HED A;  3A56 A;  4J8Q A;  2DJF C;  1BXT A;  2WB1 E;  1SNP A;  4LFC L;  3SE0 A;  4DR5 Q;  4C3J B;  3HGB A;  3K5M A;  1S5B D;  3I4M H;  4ULL A;  5BN3 A;  1D7Q A;  3AQQ A;  4KY5 A;  4B3M Q;  4JI0 L;  3RZO B;  1HZ9 A;  4RGM A;  1ZYR D;  5L37 A;  3L3O C;  4NPS A;  3SR1 A;  1Q1E A;  2E2J H;  1O7Z A;  5IT9 E;  4IPD A;  5M5X B;  2AQ1 B;  5HGT A;  3UDX A;  1PFM A;  3CRK C;  3BZK A;  2EYM A;  4B9W A;  2JEA I;  4KHP Q;  1T5X D;  2F0L A;  4EQ5 A;  4B3T L;  3M7N A;  4A3B B;  1SEB D;  1UWV A;  5D65 A;  2B2U A;  1GKH A;  1IKM A;  2Z9H A;  1DOK A;  2EY6 A;  5LMN L;  1ENF A;  3V2T A;  4P73 A;  1GD7 A;  2J0T D;  1YJW A;  5IOC A;  3LNN A;  4EGV A;  1STG A;  5IGE A;  1NJI C;  4GOP B;  2E5L Q;  1QOH A;  1BCP F;  2IW3 A;  5M3M H;  3G7L A;  2ZTD A;  1W3S A;  4DK6 C;  4ZUJ A;  4IPH A;  1FD7 D;  4GN3 B;  1C7Y A;  1KC8 C;  3H15 A;  1G91 A;  2B2Y A;  4L5Q A;  1G2S A;  4A3M H;  1EFW A;  4DR1 L;  3CW2 C;  4A3E H;  2XRQ D;  2UXC Q;  3WOE A;  1SYG A;  1CSQ A;  2R7F A;  2CVR A;  1BCP C;  3A5Z B;  4EQO A;  3K5L A;  5EKK A;  2HUG A;  3H3V I;  1MBY A;  3ERS X;  4DNT B;  1PHJ A;  4TQU S;  1X6O A;  1DYQ A;  3CD6 A;  1UAP A;  5FO9 B;  3OTO L;  2OTJ A;  5IY0 A;  2A68 D;  1Y1W G;  1HA5 A;  2NVT B;  2O2L D;  2F0H A;  3NBH A;  5JEA J;  1SYB A;  1U4M A;  3NTI A;  4IUP A;  4LF4 L;  3PIP A;  2KCT A;  1UE7 A;  3WOF A;  3NQI A;  1BBW A;  2JXM B;  3FP9 A;  2K6A A;  3E9H A;  1SE8 A;  2K4K A;  5M5W B;  3KYH C;  2NZH A;  3TP5 A;  1HUM A;  1PFS A;  1A3T A;  4A3F G;  1WVL A;  2NVQ H;  4AYB B;  5IGF A;  2F0J A;  4A4I A;  1N33 L;  1VDZ A;  5AFW A;  2XIW A;  4GLV B;  1TWA B;  3AMU A;  3T56 B;  4JI4 L;  1PZK D;  4DUY L;  1JWM D;  2VZA A;  1KQS A;  1JCK B;  4DV4 Q;  1HJP A;  4JI6 Q;  1X3E A;  3M9B A;  3HOX G;  5LL6 S;  4LF8 L;  1TKW B;  2NWG A;  5CV5 A;  5C3E H;  2B29 A;  1IKL A;  1CHP D;  1CKM A;  1AN8 A;  2D2C C;  4LFB L;  1TWH H;  1LYL A;  4DV2 L;  1AEX A;  1QUQ B;  4PMW A;  5I9P A;  3PIO 3;  1RDP D;  3TZD A;  3S15 B;  1RJT A;  1EFI D;  3OWE B;  3J81 i;  2JA7 H;  1KDA A;  1STE A;  3NEL A;  3EIV A;  2Q2H A;  1LLR D;  4DR6 L;  1YNX A;  4NMZ A;  1EU3 A;  4DV3 Q;  2B2V A;  2MUY A;  1GVP A;  5CC4 A;  5CGK A;  2N8N A;  3BS1 A;  1X54 A;  3D8G A;  3GTG H;  4NXN Q;  3FPP A;  2B8G A;  2CQA A;  5I9O A;  1XNR Q;  3I4N H;  2RA4 A;  5I2X A;  4AQY L;  1DON A;  4A3K H;  3F8T A;  1R9T H;  3S17 H;  3OPO A;  4HIM A;  5C4X B;  5IYB G;  3I56 A;  4QCL A;  2MP1 A;  2E75 C;  3CCR A;  2JE6 I;  4OXP A;  3D0F A;  1BF4 A;  3I90 A;  2VW9 A;  2VQF Q;  3H0G G;  4OWT B;  3PO3 G;  2MQH A;  3T13 A;  1LUZ A;  3DWP A;  4KN7 C;  4JBK A;  1I3Q B;  2OEO A;  1KRT A;  3K7U C;  4C3H G;  2PQA B;  1K8A C;  4A3I H;  4B3S Q;  1HR0 L;  3GTQ H;  2KCN A;  2R7Z B;  1WTO A;  3S2H H;  4DV7 Q;  2ATW A;  5IT9 L;  3IAY A;  3J80 i;  5FLM G;  4FYD A;  3CQZ B;  3OYY A;  2AKW B;  2I46 A;  3T1H Q;  1RIP A;  2WAQ G;  1E24 A;  4LK1 C;  2ZXP A;  3L9A X;  3I7F A;  4P71 A;  1VQN A;  2PI2 E;  4JYA L;  5K36 G;  5JOB A;  5KRU A;  3MFG A;  2HHH Q;  3CC4 A;  1SE3 A;  2A6H D;  2A1A A;  4RCO A;  1PYS B;  3TRE A;  4NKL A;  5G3L F;  2YU9 H;  1S5C D;  2KEC A;  4TVA B;  4YY3 Q;  3CCS A;  2JA6 B;  3IL8 A;  3UE0 A;  1PYB A;  2KBN A;  3GTO H;  1DD2 A;  3NUC A;  4LF9 L;  4OEM B;  1LT4 D;  2WB1 B;  2PW7 A;  4CJ1 B;  1RTN A;  3VR6 A;  1TS2 A;  5DM6 3;  1TWC B;  3S24 A;  1SE4 A;  4JCV E;  3K0Y A;  3QG1 A;  1C0A A;  1DCZ A;  3E0E A;  1S5F D;  4FVM A;  3JAM L;  1JOK A;  1N34 L;  4G7Z C;  3HOZ H;  3G6E A;  1K9M C;  4RH6 A;  5IYD H;  3PO2 H;  1SAP A;  4GOP A;  1PDQ A;  1E2W A;  5IP7 G;  4QQB X;  3I72 A;  3G6J B;  4DV0 Q;  2DY8 A;  4V0B A;  1GUG A;  5JEA G;  1UE1 A;  2IX0 A;  2R61 A;  2EE1 A;  2GN5 A;  1KLG D;  1J6Q A;  1EIF A;  1I4R A;  4KKT A;  3ZJY C;  4CJ2 C;  3X3M A;  1YHB A;  3TQY A;  3LGJ A;  1L2F A;  2UU9 Q;  3U50 C;  4DR7 Q;  1U4L A;  2FMM A;  4HCE A;  4JBW A;  1UE5 A;  1X3Q A;  1EOT A;  3U4V A;  2KCM A;  3TBI B;  1IBL Q;  4YHH L;  5C3X A;  2X69 A;  5IWA L;  1WCM G;  3NP8 A;  1E22 A;  1EEI D;  5J39 A;  4X65 L;  2F0I A;  1C4Q A;  1PZJ D;  3KUP A;  5DAU A;  1STN A;  1IYJ B;  4QUF A;  4IFD J;  3I55 A;  2EVB A;  1XPO A;  2VY3 A;  4G4K A;  3P7J A;  5JPM C;  1UE6 A;  1Q86 C;  4LF5 Q;  3I70 A;  3RD4 A;  2Y0S E;  2A6H C;  3HOW G;  3QR8 A;  1PH3 A;  2BH8 A;  4RFB A;  5DEH A;  1CA5 A;  2R92 G;  3ONA B;  3HS0 C;  2A69 D;  3CCM A;  1G6P A;  3CCJ A;  1ROD A;  2EYJ A;  2IY5 B;  1B50 A;  4JI3 L;  4A3J B;  2VB3 X;  4Y7N H;  2E76 C;  1ZEQ X;  1TY0 A;  2Q8T A;  2CCZ A;  3HOU G;  3PUV A;  1A8V A;  1DOL A;  3CAM A;  4DAV A;  1X9N A;  4RGN A;  3FHW A;  2ES2 A;  4OL7 A;  2UUA L;  2M2L A;  1PYW D;  1LTT D;  3OMC A;  5ELD A;  1PV4 A;  2VB2 X;  3EFX D;  3FKI G;  1CSP A;  1S4Z A;  2A19 A;  3M4P A;  1SYC A;  4GKK L;  4FP5 D;  5BR8 L;  1DGS A;  3HEJ A;  1G8Z D;  3Q8D A;  2DJG C;  1D1I A;  1JE4 A;  3Q23 A;  3RZD H;  2C5C A;  2ZM6 Q;  2PCF B;  1RCV D;  1H9S A;  3BDC A;  1ILP A;  1EIH A;  1PH7 A;  2L9H A;  3A54 A;  4DA2 A;  1SMX A;  3D4W A;  4WRD A;  1MHW C;  4JI7 L;  1LT3 D;  3QIA A;  1G29 1;  1TY2 A;  4A3F H;  2NYZ D;  4MZ9 A;  1IBK Q;  1NCV A;  3E6Z X;  2AQ2 B;  5IYC G;  4IFD I;  3MEF A;  3CF5 A;  2L0C A;  1F2M A;  2EXD A;  3HKZ G;  4F87 A;  3MHB A;  1V1P B;  3TSS A;  1WD1 A;  1IW7 C;  3R2T A;  1TWG H;  4X3T A;  2F1M A;  4C3I B;  3HOX H;  2LY7 A;  3PIO A;  2RDF A;  3CU7 A;  3N52 A;  4GLX A;  1LTA D;  1MGS A;  4JI5 Q;  1EY7 A;  5HUR A;  2I0Q A;  3HKS A;  1LAC A;  3E0J A;  4N9T A;  4R8I A;  1I6H H;  4CGY B;  2D5D A;  3BVM A;  4FF2 A;  1PTO F;  3JC6 6;  4Q5V A;  3VYR A;  1PH4 A;  2SOB A;  1HTL D;  4DUZ L;  1QZH A;  2A69 C;  5ELB A;  4OX9 L;  3GO5 A;  2B2T C;  2E2I H;  1SYE A;  4IUQ A;  4DK0 A;  1MKH A;  3D6C A;  3Q24 A;  1BR9 A;  1JIC A;  1YBY A;  2PYK A;  4DV5 Q;  1ET9 A;  5C4J B;  1XYI A;  2F0M A;  2CH4 W;  2K14 A;  2LKV A;  2RSO A;  4RMF A;  1G2T A;  1WFQ A;  1SN8 A;  2HQE A;  3H0G H;  3M7G A;  3PO3 H;  1JJG A;  1XTD A;  4JI2 L;  3T1Y Q;  2KHI A;  3MXP A;  3G4S A;  3J80 E;  2WP8 J;  1DM0 B;  2IPK D;  1LTR D;  1Q8K A;  4C3H H;  1ASZ A;  1NE3 A;  3U4Z A;  1S40 A;  4R4T A;  1MJC A;  4CDC C;  1VS0 A;  1SDF A;  5EJW A;  5EBD A;  4P74 A;  2YTX A;  1B70 B;  3ERQ A;  3HOV H;  5E3F A;  4X64 Q;  4DR3 Q;  1WTV A;  1VQO A;  2KHS A;  4IJH A;  5C5M A;  2AMC B;  1FL0 A;  3OHX C;  3J7A F;  1K0R A;  2K33 A;  1HNX Q;  2QF7 A;  1TS4 A;  1LTI D;  4I65 A;  2PNR C;  1H9K A;  3G48 A;  5K36 H;  3DXJ C;  1CK1 A;  1OTC A;  4JI8 Q;  3S16 H;  4DNI A;  4IFD G;  3NBH B;  1QWY A;  2K5W A;  1KTK A;  1HZC A;  4H7B A;  3S2D B;  5IOD A;  3A8I E;  3MA2 B;  2RHQ B;  1EIY B;  3VR5 A;  1B4O A;  3S1R B;  3VYU A;  4BBR G;  3K7A B;  3EA6 A;  4ZLT F;  2BOS A;  1NMF A;  2QW7 A;  3NBI A;  2NVX H;  3CRL C;  3GTK B;  4OIJ A;  1I5F A;  1YHA A;  4YIJ A;  2MJ8 A;  1CT1 D;  1NR2 A;  2K50 A;  2EYP A;  2RCF A;  1FVI A;  1HA6 A;  4B08 A;  3F2B A;  4H02 A;  1EY6 A;  4A76 A;  1EY5 A;  4YCV A;  3M4Q A;  4JV5 L;  2DUD A;  5IP7 H;  3QOL A;  4DV6 L;  1M8A A;  3HFZ B;  4A3I G;  4K5W A;  2Q2U A;  4LMQ D;  2D62 A;  1SNO A;  1VF7 A;  4QY7 A;  4DFA A;  5JEA H;  1SR3 A;  4KJN A;  4CKC A;  1AW7 A;  2KUM A;  1NAP A;  4DAP A;  4DR4 L;  2JJQ A;  1N32 L;  1Z7T A;  1YEZ A;  2Y0S B;  1SNM A;  3F2U A;  4AYB G;  1N8R C;  4JI2 Q;  2K04 A;  4K8J A;  3AFQ A;  1H9R A;  3L0O A;  4MIU A;  3DWA A;  5C6A A;  1Q3L A;  2B63 G;  4KHZ A;  2G5D A;  1Q1B A;  4MNO A;  3GTM H;  4IN3 A;  3GV3 A;  4ALP A;  4BY1 B;  1Q46 A;  1Y14 B;  1ZKO A;  2VQE L;  1EWH A;  4FF4 A;  1EZ6 A;  3NXW A;  5ELO A;  4F8M A;  3A7A B;  1I94 L;  1WTH A;  4RHR A;  1JE5 A;  3J81 L;  1OXS C;  1K73 C;  1F9S A;  1XNQ Q;  1O7Y A;  1EQQ A;  1XPU A;  5M3M B;  4A3G G;  5GRO A;  3HOW H;  1B1Z A;  2R92 H;  3Q22 A;  4JK1 C;  2XTI A;  4C2M H;  4J15 A;  3UDG A;  3OIP A;  2O5I C;  4JOI C;  2ALY B;  2A8V A;  4M8A A;  4RKL A;  2PQE A;  2A74 C;  1VQ6 A;  4A3D B;  4ILW A;  3KBG A;  3URY A;  4A3E B;  2H5X A;  5H1S E;  2EOT A;  1TQO A;  1Y8P B;  4UDU C;  1TT2 A;  1I4X A;  2EY5 A;  2VS1 A;  4KI0 A;  4IO9 A;  3FKI H;  4QIW B;  1GM5 A;  1PLF A;  4S3S A;  4RG1 A;  2UXD L;  3U58 A;  3NEM A;  4JVZ A;  3PQI A;  2EY1 A;  4R9W A;  4X6A H;  5CV7 A;  2F4V L;  1WTW A;  1ASY A;  4UP9 A;  5FO7 B;  3J80 L;  1XMO Q;  3K0X A;  4XDX A;  4DGZ A;  2EY2 A;  3EN2 A;  4A93 B;  4XQQ A;  2BE5 C;  1MSH A;  1SYD A;  3CCV A;  4KKU A;  2F0E A;  1EYC A;  2ZJR A;  4DV1 Q;  2RHS B;  1F9P A;  2XNA C;  1EY9 A;  2CKZ B;  2KVM A;  1Y8O B;  2QEJ C;  5IYC H;  1JWS D;  2OF1 A;  4A75 A;  4FXD A;  1D1K A;  2PI2 A;  1EL0 A;  4N9P A;  1HH2 P;  2BA0 A;  3PSI A;  1SXT A;  4JI1 Q;  1FJG L;  3S1N H;  4BY7 G;  5GAG C;  3GQB A;  2ZXO A;  5IT9 c;  3JAM E;  4RHS A;  2PW5 A;  3LX0 A;  4LF6 L;  2B3G A;  5J1Z A;  2JA5 G;  2L4N A;  3S1M H;  4NW2 A;  1TWH B;  1NR4 A;  3DUZ A;  4EQP A;  3VYS A;  4X3U A;  1CZG A;  2SDF A;  2JA7 B;  4PMC A;  2UUC L;  3CC7 A;  3MC0 B;  3T53 B;  1W6J A;  2EYH A;  3TP7 A;  3KJP A;  3STB D;  1HHV A;  1IXR A;  3KF6 B;  3UE1 A;  3GTG B;  3TS2 A;  1KL9 A;  1KAA A;  4IUV A;  2K7V A;  1QG7 A;  2MPM A;  3A8J E;  2QEX A;  2QIL A;  1R9T B;  3S17 B;  1EWI A;  3BZC A;  4UAI A;  5IGG A;  3SK5 A;  3TEH B;  4A3L G;  2IX3 A;  4LFC Q;  5T1I A;  1WTP A;  1ZYR C;  5AJ3 L;  3CMA A;  4RA8 A;  1EY0 A;  1V1O A;  4JI0 Q;  2VL6 A;  2CWP A;  3KBX A;  2O5J C;  3JAM c;  4XYQ A;  1BOS A;  2K28 A;  4XYO A;  4YCW A;  3GTQ B;  1HNZ L;  3S2H B;  2R6G A;  4B3T Q;  2ZTE A;  4OWW B;  4KTA A;  4PQX A;  4OO1 H;  3PCO B;  1ILQ A;  2JEB I;  4ZAI A;  3I4L A;  5CMD A;  3ER0 A;  2B2W C;  5ELN A;  1K3R A;  1L1O C;  5HY6 A;  5LMN Q;  4LW1 A;  4DU9 A;  3CP0 A;  1WJJ A;  2WIN B;  4DR2 L;  1CUK A;  4LUZ A;  3PUX A;  3DWQ A;  5JJZ A;  4IFD H;  1TXY A;  5JVH 3;  2UUB L;  2J4X A;  1BKB A;  4Y52 H;  5G3L D;  1P8L A;  4MN3 A;  4RGT A;  2GVB A;  1B44 D;  4TRD A;  1G6Z A;  4BBR H;  1H9S B;  1M4V A;  4GN4 B;  1JWU D;  3KFU A;  1WTQ A;  1XXG A;  3V96 A;  1UNS A;  1HZB A;  4BA1 I;  3GTO B;  1TR5 A;  4F88 A;  3L7Z C;  5IGD A;  4LFA L;  4DR1 Q;  2WKC A;  3SK6 A;  1I50 H;  5IP9 G;  3TN2 A;  1R4P B;  4K2L A;  2WAQ E;  2OXP A;  4KD3 A;  3BYT B;  2MHV A;  2VUM G;  1JJC B;  4GLA C;  1L0X B;  3I4O A;  4WFN 3;  3HOZ B;  3S14 B;  2NN6 G;  4ZKB B;  2N88 A;  2F3V A;  5EKL A;  3STB C;  2RSN A;  4IUU A;  2L11 A;  3PO2 B;  1LT5 D;  1MJE A;  2CW0 D;  1PMR A;  1X3P A;  2A68 C;  4LUV A;  4JBJ A;  1PH8 A;  1KIX A;  4QF4 A;  3OTO Q;  2F0D A;  4UP8 A;  3HOY G;  2UXB L;  1II3 A;  5DLQ E;  2E74 C;  2GA4 B;  1BUV T;  5M3F G;  2IX1 A;  4IOA A;  1PH9 A;  4LF4 Q;  1L0Y B;  1NNX A;  2K32 A;  2WFW A;  1Q12 A;  3HOV G;  4ME5 A;  1O7L A;  3P1H A;  2Z0S A;  3CHB D;  1JQY D;  1VQ7 A;  4MTK A;  3M3Y B;  2Q8R E;  2PMZ E;  1U4R A;  2K52 A;  5EPL A;  4RAU C;  1TWA H;  4MHE A;  1PRT B;  1M1K C;  2B63 H;  2Z6B A;  2CHB D;  4L5S A;  1C8C A;  1V1Q A;  2PZT A;  3W2D A;  5E7N A;  5E1F A;  1TS3 A;  1N33 Q;  1FNW A;  1SNC A;  4JI4 Q;  4DUY Q;  4DNR B;  3F1Z A;  1DOM A;  2QCP X;  4LJZ C;  1XWE A;  2H1E A;  4OGQ C;  1QJO A;  4LF8 Q;  4UPA A;  1K0S A;  3CXC A;  3BDO A;  2IL8 A;  2V4D A;  1CI3 M;  4LFB Q;  1JB7 A;  4DV2 Q;  4K14 A;  5KIX A;  4WJ3 M;  4IPG A;  3I3C A;  4CHT B;  4A3G H;  2B8F A;  2AWN A;  5JAV A;  4EQN A;  2K01 A;  4CDD C;  5CV6 A;  2JP1 A;  4K0K L;  3KLW A;  3V05 A;  1N36 L;  4UHV A;  4DR6 Q;  3ND9 A;  3BU2 A;  1EEF D;  4UP7 A;  3SHL A;  4I7A A;  1VCI A;  3BVG A;  4GKJ L;  1F77 A;  4AQY Q;  1Z6H A;  4ME3 A;  4I7Z C;  1RF2 D;  2Z1C A;  5KGU A;  3QWN A;  4XQN A;  1ONL A;  5KYL A;  2R93 B;  1YZ6 A;  2LXK A;  2F0S A;  1D6E C;  3X3N A;  1QVG A;  1XMQ L;  2CW0 C;  1Y1W B;  3KLS A;  1AFP A;  5TSS A;  2BA1 A;  2YTV A;  2L55 A;  3CQZ H;  5M5Y H;  2PO4 A;  1NUC A;  1K83 B;  1HR0 Q;  4LUO A;  2NTT A;  3RZD B;  3PUW A;  1M90 C;  3KF6 A;  4A3C G;  1A63 A;  1E7Z A;  5ELE A;  3E9I A;  5LMU L;  2IHE A;  4KY6 A;  4X66 L;  4HSP A;  3ITP A;  2OT2 A;  4TKO B;  2ZJP A;  2QKI C;  5LL6 X;  3M4O B;  1HCZ A;  1PH2 A;  3Q0A A;  1EYG A;  1F9Q A;  4A3F B;  4JYA Q;  1KDC A;  3P75 A;  1Y1V B;  3GTP H;  3AFP A;  2F0U A;  3W1B A;  3UDF A;  4R4Q A;  3A5U A;  3ULP A;  4BY7 H;  3J81 j;  3HG9 A;  3EJI A;  4X62 L;  3HOX B;  2NVY B;  2HCC A;  5M9O A;  5A35 A;  3HP3 A;  1TWC H;  2O4X A;  2JA5 H;  4BS9 A;  2Z6K C;  2OCE A;  4LF9 Q;  3ULL A;  2FHT A;  5CBA E;  1YJ9 A;  1WTR A;  4HIK A;  1YJN A;  1JT8 A;  1PTO D;  1Z47 A;  3NSW A;  5C44 G;  2EJG C;  1N34 Q;  1STY A;  1ET6 A;  1JOQ A;  1KNA A;  3T16 A;  3NPP A;  1PTO H;  3HKZ E;  2E2I B;  3QOJ A;  1W2B A;  1HZA A;  1QNU A;  5D3D A;  4KKS A;  2K03 A;  1HQR D;  1QVF A;  3CCL A;  5KEE A;  1TWF B;  5EBC A;  2K05 A;  1HNW L;  4A3L H;  1JJ2 A;  1A2U A;  3ICE A;  4OO1 I;  1AE3 A;  2L5T A;  1WTX A;  3FVQ A;  1PRT F;  4DAM A;  2DY7 A;  2YYZ A;  1HQM C;  3H0G B;  4DAY A;  4NXM L;  2KJX A;  2H4O A;  4IJL A;  1CKN A;  3C2P A;  3EBE A;  2G9H D;  2XWB B;  5BN5 A;  2AUK A;  3H6M A;  5KNC A;  3NK9 A;  4WJW A;  4RCN A;  4ZRZ A;  4C3H B;  1UEB A;  3W1G A;  4O42 A;  2K1B A;  2HDL A;  2SNM A;  1CQV A;  3KLR A;  5I2Y A;  1R4Q B;  1VF5 C;  3PUY A;  4BY1 G;  4GNX C;  1PA6 A;  4BA2 I;  5ELC A;  3W3A A;  2KED A;  4QMG A;  5CV8 A;  5EAY A;  3J81 E;  1HXY D;  4YHH Q;  2M00 A;  5IWA Q;  1GXD C;  5GAD C;  3AYH B;  4LNQ A;  3QO2 A;  1VQB A;  4X65 Q;  2RVL A;  4BBS G;  2LFN A;  2WAQ B;  5C4Z A;  1IBM L;  3EVQ A;  4HCS A;  1AE2 A;  2WV6 D;  3ULJ A;  4XIG S;  2XSC A;  1X65 A;  5EQ0 A;  1O7I A;  3CCU A;  4H0L C;  4NB3 A;  2OQ0 A;  2A5H A;  4Q0F A;  4A3D G;  3A55 A;  1E1T A;  1O80 A;  1YIT A;  2OTL A;  3VYT A;  5LMN W;  1DJR D;  1VQK A;  2NVX B;  3B6Y A;  3RN5 A;  1VQM A;  4JI3 Q;  3PGZ A;  4C3J G;  1IL8 A;  1D5M C;  1LT6 D;  1HFG A;  4H13 C;  5IP9 H;  3FEW X;  1J5E L;  2ZXR A;  5COY A;  1V9P A;  1Q90 A;  4CJ0 B;  1MD2 D;  1JR0 D;  3KLS X;  1PTO C;  4GNX A;  3K8A A;  4AH6 A;  2VUM H;  4HJ9 A;  4LF7 L;  4POG A;  2UUA Q;  1U4P A;  3J81 c;  2I5H A;  2NN6 H;  3R93 A;  3MXN A;  5FLX L;  2KCC A;  5J3B A;  3NWT A;  2AUJ D;  3AEV A;  1IZ6 A;  2ID0 A;  3Q6S A;  4A3B G;  3DM3 A;  4HJA A;  3BVZ A;  2PZW A;  3HZX A;  1E2Z A;  2I5L X;  2KEE A;  3A8K E;  4GKK Q;  1SND A;  2RBM A;  5BR8 Q;  2K75 A;  3HOY H;  1WYD A;  3HRZ C;  3M85 A;  5M3F H;  2MFI A;  2F0W A;  1FYC A;  4OO1 G;  2K5D A;  4DKA C;  1B9M A;  3WWV A;  2HD3 A;  1B8A A;  1H95 A;  4WJ4 A;  3FDT A;  4EVO A;  2B2T A;  4F7X A;  4QGU A;  1EQV A;  4V19 0;  1QIL A;  3MFY A;  2KQ3 A;  3GD7 A;  1FNU A;  5COR A;  2FIN B;  4JI7 Q;  2EJM A;  3CCQ A;  1AZP A;  3KDF A;  3IFT A;  2R7D A;  3GTJ B;  4X3K A;  1WCM B;  2ICE C;  4B3R L;  1YNJ D;  5CR3 A;  3J80 c;  3PV0 A;  2A6E D;  4FF1 A;  4ZCK A;  2EQS A;  1F2Y A;  3ZYY X;  3K81 C;  2PZU A;  1KXL A;  3NE5 B;  1XTC D;  4AYB E;  1IYV A;  4IAL A;  3CPF A;  3FMC A;  1S72 A;  1BCP B;  2D0P A;  3D4D A;  3U9S A;  2QDL A;  2R92 B;  1A6X A;  5C4H A;  1EQR A;  3MEH A;  4ZYS A;  4C2M B;  5EGT A;  4HR7 B;  4DUZ Q;  1HTP A;  3KK7 A;  4OX9 Q;  1I4P A;  4DR5 L;  3F2C A;  4KD4 A;  1DZ1 A;  4K5V A;  2JA8 B;  3HOU B;  4B3M L;  1LM0 A;  3TDQ A;  4KJO A;  1NY4 A;  3OW7 A;  2DGY A;  3RLF A;  1MSG A;  3I4M B;  3CC2 A;  1JMC A;  1CKO A;  1K8M A;  3FKI B;  2HQL A;  4KHP L;  2E2J B;  1MIU A;  4O2D A;  3UI2 A;  3OWF A;  2J7Z A;  1A62 A;  1D5X C;  2IJ0 A;  2I5M X;  1VMC A;  4JPB W;  1DXM A;  2FFK B;  4HAE A;  2L1B A;  1KD1 C;  4A3C H;  2KOL A;  2L15 A;  1STH A;  2YTY A;  2E5L L;  2OQK A;  1B53 A;  1LO5 D;  1TS5 A;  1TVX A;  4BWG B;  4P2C B;  3BG3 A;  1KRS A;  5JJI A;  2QA4 A;  1SYF A;  3RLN A;  4XXE A;  1HR0 W;  2EIF A;  4HJ5 A;  4EX5 A;  1WI5 A;  3HKZ B;  4Z9C B;  2E2H H;  3EQL C;  3S1Q H;  2IWH A;  2UXC L;  3I8Z A;  3GTK H;  3S1N B;  4WOR A;  3M4Y A;  3GTL H;  1RKN A;  4A3M B;  1YNJ C;  5C4X G;  2WKD A;  2A6E C;  2LXJ A;  3SXH A;  3S1M B;  2B2U C;  2Z4I A;  1BBU A;  1VQI A;  5EPJ A;  2PPB C;  3VR3 A;  1VQ8 A;  1PVO A;  1EIG A;  2F0T A;  4KHV A;  2TSS A;  1WD0 A;  2G9D A;  4K5X A;  1KDB A;  3QJY A;  5C44 H;  1XX8 A;  1OXV A;  3E3X A;  2R7Z G;  4JV5 Q;  3J7Z C;  4HID A;  4YWK A;  2NTS A;  4DV6 Q;  1SLJ A;  3RLO A;  1JB3 A;  1RTO A;  2K5V A;  4P75 A;  4ID6 A;  2B2Y C;  4LWC A;  5ISR A;  2JSO A;  1S5E D;  2GVA A;  1Y8N B;  4CDF C;  5C5L A;  2EYL A;  3PF4 A;  2ICI A;  1VQ9 A;  4E6I A;  2Q2I A;  4L8J A;  4JOI A;  2Q2T A;  3VDY A;  3RN2 A;  1EQT A;  2EYF A;  4DR4 Q;  4QB4 A;  1N32 Q;  1HPC A;  2NVQ B;  1SBB B;  2BCO A;  3NHH A;  3R8B A;  4DV4 L;  4JI6 L;  5CYU A;  4BY1 H;  4PG3 A;  2JA6 G;  2FMC A;  2I07 B;  4K2K A;  4HMI A;  2JK8 A;  3R2I A;  3CPW A;  1UUP A;  2DNE A;  1RHP A;  1SRU A;  2WB1 G;  2XVS A;  4FF3 A;  4PMB A;  2D0O A;  5C3E B;  3KF8 A;  5EPK A;  1SFO H;  1GHJ A;  2X6G A;  3I91 A;  2VQE Q;  3PMF A;  4HMJ A;  4BBS H;  3OOC A;  1V43 A;  5I4D A;  4DV3 L;  3D3R A;  1I94 Q;  3NQT A;  5FO8 B;  4NXN L;  5JJL A;  3DHQ A;  2BDN A;  1AZQ A;  2HDM A;  1PFN A;  2NN6 I;  1L0W A;  4KN4 C;  4XT1 B;  3C46 A;  1XNR L;  1FR3 A;  4A3D H;  4BBR B;  1ENA A;  1I6V C;  1ML0 D;  3RUZ A;  1F9R A;  3D31 A;  4L5T A;  3I4N B;  3CME A;  4QL5 A;  4A3K B;  1O78 A;  2VQF L;  3SK8 A;  4C3J H;  4DK3 C;  2AHO B;  3KOJ A;  1I50 B;  4DXG A;  2EXZ A;  3RZO H;  4HIO A;  1G51 A;  2R93 G;  2L12 A;  3PF5 A;  5E4X A;  4KV6 A;  4B3S L;  2RKS A;  5M5X H;  1A15 A;  2C9O A;  4DV7 L;  1TU2 B;  4POF A;  4G7H C;  4N8F A;  1C48 A;  4P72 A;  4A3B H;  4GS3 A;  4JC0 A;  4O1N A;  4A3I B;  1BO0 A;  2E2D C;  2UXD Q;  5NUC A;  4BXX G;  4A93 H;  2B2V C;  4C1N K;  3T1H L;  3RMH A;  2F4V Q;  5CV9 A;  1K8O A;  2F0N A;  1BVS A;  3H94 A;  2QGQ A;  4PZ7 A;  1SJE D;  1CHQ D;  2NZO A;  2K5N A;  4FDB A;  2HIX A;  1I4G A;  4ZUI A;  2BH2 A;  3TZU A;  3N6R A;  2HHH L;  3GP7 A;  1B3A A;  5A2Q L;  1W6K A;  1IHZ A;  1B9N A;  1SNQ A;  2B39 A;  4UY8 C;  1PH5 A;  1RD9 D;  1J9O A;  2P5Z X;  3IKJ A;  1Y1V G;  5J22 A;  3BDL A;  4YY3 L;  2B63 B;  3ERO A;  1EWC A;  3VR4 A;  5KYI A;  3ND8 A;  2ZTC A;  2F0V A;  4A3J G;  2YU9 B;  4NP5 A;  5CBE E;  1FJG Q;  1BQQ T;  3CKI B;  1GO3 E;  4GN5 A;  1NTG A;  5C0X H;  4DAY B;  1MI2 A;  5LHY 1;  4H44 C;  1CKN B;  4IZ8 A;  4LF6 Q;  5E4W C;  3O13 A;  4L5R C;  1VQF A;  1VQJ A;  1HRJ A;  2MO1 A;  2F3W A;  4G57 A;  1GJX A;  4A3G B;  2UUC Q;  1N9W A;  3L2P A;  5BN4 A;  2NVT H;  4DV0 L;  2IT1 A;  4K6L A;  3LWE A;  4IUN A;  1CQF A;  2B2W A;  1L1O A;  2AWO A;  3BZD B;  3D4R A;  1FGU A;  5CV4 A;  2DN8 A;  2XRS D;  1LAB A;  3C3L A;  2HT1 A;  2MNA A;  2RQX A;  4RGO S;  1P16 A;  2LSS A;  5M5W H;  4X3S A;  1CA6 A;  3MXU A;  2UU9 L;  1GHK A;  3TRZ A;  2HCI A;  4DR7 L;  1XPR A;  2A73 B;  4TSS A;  4QJF A;  4R4I A;  5AJ3 Q;  1JC7 A;  1IBL L;  1TII D;  3UDI A;  2NZ1 D;  2OWO A;  1I4Q A;  2RCN A;  2ZJQ A;  3MAQ A;  5M5Y B;  1T5E A;  4C3I G;  4GOP C;  1HNZ Q;  4J1M A;  4PV1 C;  2FXQ A;  4IUT A;  3A7L A;  4FNF A;  4AIM A;  5DM7 3;  4GNX B;  3S15 H;  4OIK A;  4LF5 L;  3PUZ A;  5JJK A;  2F0O A;  1AP0 A;  1PXU A;  3QB3 A;  4ZK9 B;  5FK9 C;  1U5K A;  1C9O A;  3MXN B;  1LTL A;  2JA9 A;  1QNK A;  2MO0 A;  4DR2 Q;  1YVC A;  1E0B A;  2BDO A;  2E8G A;  4YWM A;  1YIJ A;  2HIV A;  2UUB Q;  3GTP B;  1STA A;  1D2B A;  1F2Z A;  4BY7 B;  1U0L A;  4YWL A;  3K58 A;  5C4X H;  4Y7N B;  2VNU D;  4HTH A;  3G71 A;  2RDG A;  1K8G A;  2JA5 B;  1EYD A;  1SRO A;  1EY4 A;  5FLX E;  4L6T B;  4LFA Q;  2EZV A;  1IYU A;  3S14 H;  4NDX A;  5FKA C;  1I3Q H;  4KLK A;  3H91 A;  3I73 A;  3KDF B;  1D8L A;  4CBV A;  4GZY C;  1ENC A;  2R7Z H;  1PTO B;  2ZM6 L;  1FGB D;  2FJ2 A;  2N49 A;  3NEN A;  1SMY D;  2F0P A;  3VA7 A;  1Q82 C;  4RKB A;  3MVV A;  2F0G A;  1VQ5 A;  2F0F A;  1KNE A;  3U9O A;  3W5O A;  1NMG A;  1EYA A;  2UXB Q;  2NBF A;  1YNN D;  1H9M A;  3M3Y H;  3I2Z A;  1PRT D;  1YI2 A;  4CDE C;  3A0J A;  3TME A;  1IBK L;  2F52 A;  2K5Q A;  3K57 A;  1LV9 A;  3J7A 5;  4ABN A;  3NTK A;  1CM9 A;  1E2V A;  1Z9F A;  3T51 B;  1VQ4 A;  2PNH A;  5FLX c;  5FJ8 G;  1IL2 A;  2JA6 H;  1IW7 D;  4XQJ A;  4ZKC B;  4QUC A;  3VR2 A;  5C0X J;  1QB5 D;  2QDB A;  3AB9 A;  2NUC A;  4JI5 L;  1VQP A;  1TWG B;  2CH4 A;  1B3Q A;  1T9H A;  3K59 A;  5IE8 A;  3MTS A;  4JG2 A;  1B7Y B;  2WAC A;  1Q81 C;  4OHJ A;  4R4O A;  2ENB A;  2F3I A;  4C1N I;  1VQC A;  2EDG A;  1VQA A;  1I6H B;  1S5D D;  2CQO A;  5D14 A;  4R4C A;  1CFM A;  2SEB D;  4DV5 L;  1YHQ A;  2JQO A;  4K0K Q;  1N36 Q;  3SDZ A;  1EOV A;  2JA8 G;  1SSO A;  1ZXT A;  3A74 A;  1VMP A;  2Z4H A;  3OW2 A;  1XJV A;  1KAB A;  2EPB A;  4OON A;  3DEP A;  3I4M G;  3T1Y L;  2AQ3 B;  4GKJ Q;  2TMP A;  4XTC S;  3AU7 A;  3P20 A;  4APV A;  1VQD A;  2IHF A;  2R93 H;  3SK4 A;  1QUQ A;  2Y0S G;  1OXX K;  5IIF A;  3J7A V;  3PO3 B;  2VUM B;  1H9J A;  4HJ8 A;  1EU4 A;  1A3V A;  2CWA A;  1Y1W H;  3BJU A;  1X3G A;  5K5P A;  3IFD A;  2DNC A;  1K83 H;  3J7Y W;  1Q7Y C;  1SMY C;  1A2T A;  1XMQ Q;  4BXX H;  2Z6K A;  4X64 L;  4DR3 L;  1VQL A;  1PZI D;  3HOY B;  1BDO A;  1Q8I A;  4MTN A;  1HNX L;  1STB A;  4FXK C;  4DK1 A;  5M3F B;  1YNN C;  3HOV B;  2X6L A;  1PRT C;  1JOO A;  3RNU A;  2RF4 A;  5I6W A;  3M4O H;  4JI8 L;  5C0X I;  3OIQ A;  5LMU Q; 
#chains in the Genus database with same CATH homology
 2MGS A;  4K8I A;  3NWS A;  2LS0 1;  1GUN A;  4KK7 A;  4HSV A;  2VXW A;  4RWS C;  4HN7 A;  2ZT9 C;  3S16 B;  1B2T A;  1OXT A;  1GOZ A;  1QE6 A;  4IUR A;  4DF7 A;  4IQZ A;  5KNB A;  1GUO A;  5ELF A;  4ZQ3 A;  1Y69 U;  1SE2 A;  3GV6 A;  5F2D A;  2PMZ B;  4FXG C;  3VA5 A;  3NTH A;  2NB0 A;  2Q8I B;  3BYY B;  1J8I A;  4KY7 A;  4M1U B;  1GUS A;  5JPN C;  3PIP 3;  3DMU A;  2M9V A;  3MZ5 A;  4L63 B;  3C1F A;  1CTM A;  2N55 A;  3K6O A;  3MXG A;  3TP6 A;  2F03 A;  1SJH D;  3OMG A;  4KMU C;  3DM1 A;  2D9U A;  1HUN A;  3SVM A;  1F2L A;  3GTM B;  1U9R A;  4XT3 B;  4C56 C;  1EZ8 A;  2EJF C;  2WII B;  1D5Z C;  1NSN S;  5C0X G;  1HFN A;  4U68 A;  3E5S A;  5KND A;  5T1G A;  1LTS D;  3HOW B;  4ODG A;  1ESR A;  1KLU D;  2E2H B;  3S1Q B;  3MWY W;  2R3Z A;  4CKB A;  4FO2 A;  1UEA B;  4CKE A;  4DN4 M;  3GTL B;  4U67 3;  1V8Q A;  3D6W A;  3OSO A;  5JVG 3;  4DXF A;  1I4H A;  1PFB A;  5I6Y A;  1JOR A;  5IGC A;  1FNV A;  5C44 B;  3LWU A;  4J6H A;  5C3W A;  3FPU B;  3R3O A;  3H3V C;  3TP8 A;  4B9X A;  1OXU A;  2XWJ B;  3DEO A;  1ESF A;  3K5N A;  4K6D A;  2BE5 D;  5FOB B;  3FRP B;  3C1E A;  3H09 A;  5A2Q E;  1BNZ A;  1EY8 A;  1GUW A;  3K5O A;  1X32 A;  2F4I A;  2JYO A;  1ICW A;  1QCB D;  4G7O C;  3WDN A;  5D3I B;  2EYO A;  1CZW A;  2XN9 C;  1LTG D;  1GUT A;  1OO9 B;  1BCP D;  1SFO B;  4BBS B;  2RDH A;  3SEB A;  5DNF A;  4LAA A;  5EKI A;  1LTB D;  2F0Q A;  5IGB A;  2F0K A;  1A3U A;  2KA7 A;  3T4A C;  4PNY A;  4R8N A;  2Z8L A;  1BBX C;  2SNS A;  2LMC B;  3S9W A;  1V1P A;  4HED A;  3A56 A;  4J8Q A;  1BXT A;  1SNP A;  3SE0 A;  4C3J B;  3HGB A;  3K5M A;  1S5B D;  4ULL A;  5BN3 A;  4KY5 A;  3RZO B;  4RGM A;  1ZYR D;  3L3O C;  3SR1 A;  1Q1E A;  1O7Z A;  5IT9 E;  5M5X B;  2AQ1 B;  5HGT A;  1PFM A;  3CRK C;  2EYM A;  4B9W A;  2JEA I;  1T5X D;  2F0L A;  4A3B B;  3M7N A;  1SEB D;  5D65 A;  2B2U A;  1IKM A;  1DOK A;  2EY6 A;  1ENF A;  3V2T A;  2J0T D;  5IOC A;  3LNN A;  4EGV A;  1STG A;  5IGE A;  1QOH A;  1BCP F;  2IW3 A;  3G7L A;  4ZUJ A;  1FD7 D;  1G91 A;  2B2Y A;  1G2S A;  2XRQ D;  3WOE A;  1SYG A;  2CVR A;  4EQO A;  1BCP C;  3K5L A;  5EKK A;  2HUG A;  1MBY A;  4DNT B;  4TQU S;  1DYQ A;  1UAP A;  5FO9 B;  2A68 D;  2NVT B;  1HA5 A;  2O2L D;  2F0H A;  3NBH A;  5JEA J;  1SYB A;  1U4M A;  3NTI A;  4IUP A;  3WOF A;  3NQI A;  2JXM B;  2K6A A;  5M5W B;  3TP5 A;  1HUM A;  1A3T A;  1WVL A;  4AYB B;  5IGF A;  2F0J A;  1VDZ A;  5AFW A;  2XIW A;  3AMU A;  1TWA B;  3T56 B;  1PZK D;  1JWM D;  1JCK B;  5LL6 S;  1TKW B;  2NWG A;  5CV5 A;  1IKL A;  1CHP D;  1AN8 A;  2D2C C;  1AEX A;  4PMW A;  5I9P A;  3PIO 3;  1RDP D;  3TZD A;  3S15 B;  1RJT A;  1EFI D;  3OWE B;  1KDA A;  1STE A;  1LLR D;  4NMZ A;  1EU3 A;  2B2V A;  2MUY A;  5CGK A;  5CC4 A;  3BS1 A;  3D8G A;  3FPP A;  2B8G A;  2CQA A;  5I9O A;  2RA4 A;  5I2X A;  1DON A;  3OPO A;  5C4X B;  4QCL A;  2MP1 A;  2E75 C;  2JE6 I;  1BF4 A;  3I90 A;  3T13 A;  3DWP A;  4KN7 C;  1I3Q B;  2OEO A;  4C3H G;  2KCN A;  2R7Z B;  1WTO A;  5IT9 L;  3IAY A;  4FYD A;  3CQZ B;  2I46 A;  4LK1 C;  2ZXP A;  3L9A X;  5K36 G;  5JOB A;  5KRU A;  3MFG A;  1SE3 A;  2A6H D;  4RCO A;  4NKL A;  5G3L F;  1S5C D;  2KEC A;  2JA6 B;  3IL8 A;  1DD2 A;  3NUC A;  1LT4 D;  2WB1 B;  2PW7 A;  4CJ1 B;  1RTN A;  3VR6 A;  1TS2 A;  5DM6 3;  1TWC B;  1SE4 A;  3K0Y A;  3QG1 A;  1DCZ A;  3JAM L;  1S5F D;  4FVM A;  1JOK A;  4G7Z C;  4RH6 A;  1SAP A;  1PDQ A;  1E2W A;  3I72 A;  3G6J B;  2DY8 A;  4V0B A;  1GUG A;  5JEA G;  2IX0 A;  2R61 A;  2EE1 A;  1KLG D;  1I4R A;  4KKT A;  4CJ2 C;  3X3M A;  1U4L A;  2FMM A;  4HCE A;  4JBW A;  1X3Q A;  1EOT A;  3TBI B;  5C3X A;  2X69 A;  3NP8 A;  1EEI D;  5J39 A;  2F0I A;  1C4Q A;  1PZJ D;  3KUP A;  5DAU A;  1STN A;  4QUF A;  4IFD J;  2EVB A;  4G4K A;  3P7J A;  5JPM C;  3I70 A;  3RD4 A;  2A6H C;  4RFB A;  5DEH A;  1CA5 A;  3ONA B;  3HS0 C;  2A69 D;  1ROD A;  2EYJ A;  1B50 A;  4A3J B;  2VB3 X;  2E76 C;  1ZEQ X;  1TY0 A;  2Q8T A;  3PUV A;  1DOL A;  4DAV A;  4RGN A;  4OL7 A;  2M2L A;  1PYW D;  1LTT D;  3OMC A;  5ELD A;  2VB2 X;  3EFX D;  1S4Z A;  1SYC A;  4FP5 D;  3HEJ A;  1G8Z D;  1JE4 A;  1D1I A;  3Q23 A;  2C5C A;  2PCF B;  1RCV D;  1H9S A;  3BDC A;  1ILP A;  1EIH A;  2L9H A;  3A54 A;  4DA2 A;  3D4W A;  4WRD A;  1LT3 D;  3QIA A;  1G29 1;  1TY2 A;  2NYZ D;  1NCV A;  3E6Z X;  2AQ2 B;  4IFD I;  2L0C A;  1F2M A;  4F87 A;  3MHB A;  1V1P B;  3TSS A;  1WD1 A;  1IW7 C;  3R2T A;  4X3T A;  2F1M A;  4C3I B;  2LY7 A;  2RDF A;  3CU7 A;  3N52 A;  1LTA D;  1MGS A;  1EY7 A;  5HUR A;  1LAC A;  3E0J A;  4N9T A;  4R8I A;  4CGY B;  2D5D A;  3BVM A;  4FF2 A;  1PTO F;  4Q5V A;  3VYR A;  2SOB A;  1HTL D;  2A69 C;  5ELB A;  3GO5 A;  2B2T C;  1SYE A;  4IUQ A;  4DK0 A;  3D6C A;  3Q24 A;  1BR9 A;  1JIC A;  2PYK A;  1ET9 A;  5C4J B;  1XYI A;  2F0M A;  2LKV A;  2RSO A;  1G2T A;  2HQE A;  3M7G A;  3MXP A;  3J80 E;  2WP8 J;  1DM0 B;  2IPK D;  1LTR D;  1SDF A;  5EJW A;  5EBD A;  3ERQ A;  5E3F A;  1WTV A;  2KHS A;  5C5M A;  3OHX C;  3J7A F;  2K33 A;  2QF7 A;  1TS4 A;  1LTI D;  4I65 A;  2PNR C;  1H9K A;  5K36 H;  3DXJ C;  1CK1 A;  4IFD G;  1QWY A;  2K5W A;  1KTK A;  4H7B A;  3S2D B;  5IOD A;  3A8I E;  3MA2 B;  3VR5 A;  1B4O A;  3S1R B;  3VYU A;  3K7A B;  3EA6 A;  4ZLT F;  2BOS A;  3NBI A;  3CRL C;  3GTK B;  4OIJ A;  4YIJ A;  2MJ8 A;  1CT1 D;  1NR2 A;  2EYP A;  1HA6 A;  4B08 A;  1EY6 A;  1EY5 A;  3QOL A;  1M8A A;  4K5W A;  4LMQ D;  2D62 A;  1SNO A;  1VF7 A;  4DFA A;  5JEA H;  4KJN A;  4CKC A;  1AW7 A;  2KUM A;  1NAP A;  4DAP A;  1Z7T A;  2Y0S B;  1SNM A;  3F2U A;  2K04 A;  4K8J A;  1H9R A;  4MIU A;  5C6A A;  3DWA A;  1Q3L A;  4KHZ A;  1Q1B A;  4IN3 A;  3GV3 A;  4BY1 B;  1ZKO A;  1EWH A;  4FF4 A;  1EZ6 A;  3NXW A;  4F8M A;  3A7A B;  4RHR A;  3J81 L;  1OXS C;  1F9S A;  1O7Y A;  5M3M B;  1B1Z A;  3Q22 A;  4JK1 C;  3OIP A;  2O5I C;  4M8A A;  4RKL A;  2PQE A;  2A74 C;  4A3D B;  4ILW A;  3KBG A;  3URY A;  4A3E B;  2EOT A;  1TQO A;  1Y8P B;  4UDU C;  1TT2 A;  1I4X A;  2EY5 A;  4KI0 A;  4QIW B;  1PLF A;  4S3S A;  2EY1 A;  4R9W A;  5CV7 A;  1WTW A;  5FO7 B;  3J80 L;  4XDX A;  4DGZ A;  2EY2 A;  4A93 B;  4XQQ A;  2BE5 C;  1MSH A;  1SYD A;  4KKU A;  2F0E A;  1EYC A;  1F9P A;  2XNA C;  1EY9 A;  2KVM A;  1Y8O B;  2QEJ C;  1JWS D;  2OF1 A;  4FXD A;  1D1K A;  1EL0 A;  4N9P A;  2BA0 A;  1SXT A;  3GQB A;  2ZXO A;  3JAM E;  4RHS A;  2PW5 A;  3LX0 A;  5J1Z A;  2L4N A;  4NW2 A;  1TWH B;  1NR4 A;  3DUZ A;  4EQP A;  3VYS A;  4X3U A;  1CZG A;  2SDF A;  2JA7 B;  4PMC A;  3MC0 B;  3T53 B;  1W6J A;  2EYH A;  3TP7 A;  1HHV A;  3GTG B;  1KAA A;  4IUV A;  2K7V A;  1QG7 A;  2MPM A;  3A8J E;  2QIL A;  1R9T B;  3S17 B;  4UAI A;  5IGG A;  3SK5 A;  2IX3 A;  5T1I A;  1WTP A;  1ZYR C;  4RA8 A;  1EY0 A;  1V1O A;  3KBX A;  2O5J C;  4XYQ A;  1BOS A;  2K28 A;  4XYO A;  3GTQ B;  3S2H B;  2R6G A;  4KTA A;  4PQX A;  4OO1 H;  1ILQ A;  2JEB I;  4ZAI A;  3I4L A;  5CMD A;  2B2W C;  4DU9 A;  2WIN B;  3PUX A;  3DWQ A;  5JJZ A;  4IFD H;  5JVH 3;  2J4X A;  5G3L D;  4MN3 A;  4RGT A;  1G6Z A;  1B44 D;  4TRD A;  1H9S B;  1M4V A;  1JWU D;  1WTQ A;  1XXG A;  3V96 A;  1UNS A;  4BA1 I;  3GTO B;  1TR5 A;  4F88 A;  3L7Z C;  5IGD A;  2WKC A;  3SK6 A;  3TN2 A;  1R4P B;  4K2L A;  2OXP A;  4KD3 A;  3BYT B;  2MHV A;  1L0X B;  4WFN 3;  3HOZ B;  3S14 B;  2NN6 G;  4ZKB B;  2N88 A;  2F3V A;  5EKL A;  2RSN A;  4IUU A;  2L11 A;  3PO2 B;  1LT5 D;  2CW0 D;  1PMR A;  1X3P A;  2A68 C;  4QF4 A;  2F0D A;  1II3 A;  2E74 C;  2GA4 B;  1BUV T;  2IX1 A;  1L0Y B;  2K32 A;  1Q12 A;  4ME5 A;  1O7L A;  3P1H A;  3CHB D;  1JQY D;  3M3Y B;  2Q8R E;  1U4R A;  5EPL A;  4RAU C;  4MHE A;  1PRT B;  2CHB D;  1C8C A;  2PZT A;  3W2D A;  5E1F A;  1TS3 A;  1FNW A;  1SNC A;  4DNR B;  1DOM A;  2QCP X;  4LJZ C;  1XWE A;  2H1E A;  4OGQ C;  1QJO A;  3BDO A;  2IL8 A;  2V4D A;  1CI3 M;  4K14 A;  5KIX A;  3I3C A;  4CHT B;  2B8F A;  2AWN A;  5JAV A;  4EQN A;  2K01 A;  5CV6 A;  2JP1 A;  3V05 A;  3ND9 A;  1EEF D;  3SHL A;  1VCI A;  3BVG A;  1F77 A;  1Z6H A;  4I7Z C;  1RF2 D;  2Z1C A;  5KGU A;  3QWN A;  4XQN A;  1ONL A;  5KYL A;  2R93 B;  2F0S A;  1D6E C;  3X3N A;  2CW0 C;  1Y1W B;  3KLS A;  1AFP A;  5TSS A;  2BA1 A;  2L55 A;  2PO4 A;  1NUC A;  1K83 B;  2NTT A;  3RZD B;  3PUW A;  5ELE A;  4KY6 A;  4HSP A;  3ITP A;  2OT2 A;  4TKO B;  2QKI C;  5LL6 X;  3M4O B;  1HCZ A;  3Q0A A;  1F9Q A;  4A3F B;  1KDC A;  3P75 A;  1Y1V B;  2F0U A;  3HG9 A;  3EJI A;  3HOX B;  2NVY B;  2HCC A;  5M9O A;  5A35 A;  3HP3 A;  2O4X A;  4BS9 A;  2FHT A;  5CBA E;  1WTR A;  1PTO D;  1Z47 A;  3NSW A;  2EJG C;  1STY A;  1ET6 A;  1JOQ A;  1KNA A;  3T16 A;  3NPP A;  1PTO H;  2E2I B;  3QOJ A;  1QNU A;  5D3D A;  4KKS A;  2K03 A;  1HQR D;  5KEE A;  1TWF B;  5EBC A;  2K05 A;  1A2U A;  4OO1 I;  2L5T A;  1WTX A;  3FVQ A;  1PRT F;  2DY7 A;  2YYZ A;  1HQM C;  3H0G B;  4DAY A;  2KJX A;  2H4O A;  3C2P A;  2G9H D;  2XWB B;  5BN5 A;  2AUK A;  3H6M A;  5KNC A;  3NK9 A;  4WJW A;  4RCN A;  4ZRZ A;  4C3H B;  4O42 A;  2K1B A;  2HDL A;  2SNM A;  1CQV A;  3KLR A;  5I2Y A;  1R4Q B;  1VF5 C;  3PUY A;  4BA2 I;  5ELC A;  3W3A A;  2KED A;  4QMG A;  5CV8 A;  3J81 E;  1HXY D;  2M00 A;  1GXD C;  3QO2 A;  2RVL A;  2LFN A;  2WAQ B;  5C4Z A;  3EVQ A;  4HCS A;  2WV6 D;  4XIG S;  2XSC A;  5EQ0 A;  4H0L C;  2A5H A;  4Q0F A;  3A55 A;  1O80 A;  3VYT A;  1DJR D;  2NVX B;  4C3J G;  1IL8 A;  1D5M C;  1LT6 D;  1HFG A;  4H13 C;  3FEW X;  2ZXR A;  5COY A;  1Q90 A;  4CJ0 B;  1MD2 D;  1JR0 D;  3KLS X;  1PTO C;  1U4P A;  2NN6 H;  3R93 A;  5FLX L;  3MXN A;  2KCC A;  3NWT A;  2AUJ D;  2ID0 A;  3Q6S A;  2PZW A;  3BVZ A;  3HZX A;  1E2Z A;  2KEE A;  3A8K E;  1SND A;  2RBM A;  3M85 A;  3HRZ C;  2F0W A;  1FYC A;  4OO1 G;  2K5D A;  1B9M A;  3FDT A;  4EVO A;  2B2T A;  4F7X A;  1EQV A;  4V19 0;  1QIL A;  3MFY A;  2KQ3 A;  3GD7 A;  1FNU A;  5COR A;  2FIN B;  2EJM A;  1AZP A;  3IFT A;  3GTJ B;  4X3K A;  1WCM B;  2ICE C;  1YNJ D;  5CR3 A;  3PV0 A;  2A6E D;  4FF1 A;  1F2Y A;  3ZYY X;  2PZU A;  3NE5 B;  1XTC D;  1IYV A;  4IAL A;  3FMC A;  1BCP B;  3D4D A;  3U9S A;  1A6X A;  2R92 B;  5C4H A;  3MEH A;  4ZYS A;  4C2M B;  5EGT A;  4HR7 B;  1HTP A;  3KK7 A;  1I4P A;  4KD4 A;  1DZ1 A;  4K5V A;  2JA8 B;  3HOU B;  3TDQ A;  4KJO A;  3OW7 A;  3RLF A;  1MSG A;  3I4M B;  3FKI B;  1K8M A;  2E2J B;  3UI2 A;  3OWF A;  2J7Z A;  1D5X C;  2IJ0 A;  1VMC A;  1DXM A;  2FFK B;  4HAE A;  2L1B A;  2KOL A;  1STH A;  1B53 A;  1LO5 D;  1TS5 A;  1TVX A;  4BWG B;  4P2C B;  3BG3 A;  1SYF A;  4XXE A;  3HKZ B;  4Z9C B;  3EQL C;  2IWH A;  3I8Z A;  3S1N B;  4WOR A;  3M4Y A;  1RKN A;  4A3M B;  1YNJ C;  2WKD A;  2A6E C;  3SXH A;  3S1M B;  2B2U C;  2Z4I A;  5EPJ A;  2PPB C;  3VR3 A;  1EIG A;  2F0T A;  4KHV A;  2TSS A;  1WD0 A;  2G9D A;  4K5X A;  1KDB A;  3QJY A;  1XX8 A;  1OXV A;  2NTS A;  1JB3 A;  1RTO A;  4ID6 A;  2B2Y C;  5ISR A;  2JSO A;  1S5E D;  1Y8N B;  5C5L A;  2EYL A;  2ICI A;  4E6I A;  4L8J A;  1EQT A;  2EYF A;  4QB4 A;  1HPC A;  2NVQ B;  1SBB B;  2BCO A;  3NHH A;  3R8B A;  5CYU A;  2FMC A;  2I07 B;  4K2K A;  4HMI A;  3R2I A;  1UUP A;  2DNE A;  1RHP A;  2XVS A;  4FF3 A;  4PMB A;  5C3E B;  3KF8 A;  5EPK A;  1GHJ A;  2X6G A;  3I91 A;  3PMF A;  4HMJ A;  3OOC A;  1V43 A;  5I4D A;  3D3R A;  3NQT A;  5FO8 B;  3DHQ A;  2BDN A;  1AZQ A;  2HDM A;  1PFN A;  2NN6 I;  4KN4 C;  4XT1 B;  3C46 A;  1FR3 A;  4BBR B;  1ENA A;  1I6V C;  1ML0 D;  3RUZ A;  1F9R A;  3D31 A;  3I4N B;  4A3K B;  1O78 A;  3SK8 A;  1I50 B;  4DXG A;  2EXZ A;  2L12 A;  5E4X A;  4KV6 A;  2RKS A;  1A15 A;  2C9O A;  1TU2 B;  4G7H C;  1C48 A;  4O1N A;  4A3I B;  1BO0 A;  2E2D C;  5NUC A;  2B2V C;  4C1N K;  3RMH A;  5CV9 A;  1K8O A;  2F0N A;  3H94 A;  1SJE D;  1CHQ D;  1I4G A;  4ZUI A;  3TZU A;  3N6R A;  3GP7 A;  1B3A A;  5A2Q L;  1W6K A;  1IHZ A;  1B9N A;  1SNQ A;  2B39 A;  1RD9 D;  1J9O A;  3IKJ A;  5J22 A;  3BDL A;  2B63 B;  3ERO A;  1EWC A;  3VR4 A;  5KYI A;  3ND8 A;  2F0V A;  2YU9 B;  4NP5 A;  5CBE E;  1BQQ T;  3CKI B;  5C0X H;  1MI2 A;  5LHY 1;  4H44 C;  4IZ8 A;  5E4W C;  3O13 A;  1HRJ A;  2F3W A;  4G57 A;  1GJX A;  4A3G B;  5BN4 A;  2IT1 A;  4K6L A;  3LWE A;  4IUN A;  1CQF A;  2B2W A;  2AWO A;  3BZD B;  3D4R A;  5CV4 A;  2DN8 A;  2XRS D;  1LAB A;  3C3L A;  2RQX A;  4RGO S;  1CA6 A;  4X3S A;  3MXU A;  1GHK A;  2HCI A;  2A73 B;  4TSS A;  1JC7 A;  1TII D;  2NZ1 D;  1I4Q A;  5M5Y B;  3MAQ A;  1T5E A;  4C3I G;  4J1M A;  4PV1 C;  4IUT A;  3A7L A;  4FNF A;  5DM7 3;  4OIK A;  3PUZ A;  2F0O A;  1AP0 A;  1PXU A;  3QB3 A;  4ZK9 B;  5FK9 C;  1QNK A;  1E0B A;  2BDO A;  3GTP B;  1STA A;  1D2B A;  1F2Z A;  4BY7 B;  3K58 A;  4Y7N B;  2VNU D;  4HTH A;  2RDG A;  2JA5 B;  1EYD A;  1EY4 A;  5FLX E;  4L6T B;  2EZV A;  1IYU A;  4NDX A;  5FKA C;  3H91 A;  3I73 A;  4CBV A;  4GZY C;  1ENC A;  1PTO B;  1FGB D;  2FJ2 A;  1SMY D;  2F0P A;  3VA7 A;  4RKB A;  3MVV A;  2F0G A;  2F0F A;  1KNE A;  3U9O A;  1EYA A;  2NBF A;  1YNN D;  1H9M A;  1PRT D;  3TME A;  2K5Q A;  3K57 A;  1LV9 A;  4ABN A;  3NTK A;  1CM9 A;  1E2V A;  3T51 B;  1IW7 D;  4XQJ A;  4ZKC B;  4QUC A;  3VR2 A;  5C0X J;  1QB5 D;  2QDB A;  3AB9 A;  2NUC A;  1TWG B;  3K59 A;  3MTS A;  2WAC A;  4OHJ A;  2ENB A;  4C1N I;  2EDG A;  1I6H B;  1S5D D;  5D14 A;  1CFM A;  2SEB D;  3SDZ A;  1SSO A;  1ZXT A;  1VMP A;  2Z4H A;  1KAB A;  2EPB A;  3DEP A;  2AQ3 B;  2TMP A;  4XTC S;  3AU7 A;  3P20 A;  3SK4 A;  5IIF A;  3J7A V;  1OXX K;  3PO3 B;  2VUM B;  1H9J A;  1EU4 A;  1A3V A;  5K5P A;  3IFD A;  2DNC A;  3J7Y W;  1SMY C;  1A2T A;  1PZI D;  3HOY B;  1BDO A;  1Q8I A;  1STB A;  4FXK C;  4DK1 A;  5M3F B;  1YNN C;  3HOV B;  2X6L A;  1PRT C;  1JOO A;  5I6W A;  5C0X I;  3OIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...